1TWHK

Rna polymerase ii complexed with 2'datp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twhK00
1Y1WC 4A3FC 3H3VD 5IYBK 3HKZL 2VUMC 3GTOK 3K7AC 1I6HK 5IP7K 3HOZK 3I4MC 2E2IC 5IYDK 1TWHC 2JA5K 2NVXC 2A69A 5M3FK 2JA6K 4A3CC 2A6HA 3GTGC 3RZOC 4BBRC 2E2JK 2BE5A 3M3YC 4A3JK 3GTJC 3S2DC 1I6HC 1YNNA 4Y52C 5M3MK 3HOXC 4A3DC 3CQZC 2R7ZK 2JA5C 3GTKK 4AYBD 4X6AK 3I4NK 4A3MK 1ZYRA 1Y1WK 2CW0A 5IYCC 5M5YK 4C3JK 3K7AK 3H0GK 3HOYC 3S15C 3I4MK 3HKZD 2E2IK 3FKIC 1TWGC 1TWHK 2NVXK 3GTQK 4A3CK 3GTGK 3RZOK 2R93K 3M3YK 2JA8C 3S2HC 3GTJK 4YFXA 5TMCA 2PMZL 3S2DK 2WB1L 3H0GC 4Y52K 3HOXK 5IP9C 4A3DK 4OINA 3CQZK 3GTQC 4A3EC 1XPPA 4QIWL 4QJVA 1K83C 2O5JA 2R93C 4OIQA 3DXJA 4C2MK 4NOIA 5IYCK 4Q4ZA 3S1MK 3PO3C 4JK1A 4GZYA 3EQLA 3HOYK 3S15K 2PA8L 4G7HA 3FKIK 1TWGK 4XLPA 2E2HC 1HQMA 2NVTC 4A93C 2A68A 4XLNA 3HOWK 1SMYA 2JA7C 4LK0A 2JA8K 3S2HK 5C44C 2WAQD 4Q5SA 3S1MC 3GTPK 4MQ9A 5FLMK 5IP9K 2PMZD 2WB1D 4BBSC 4A3EK 3HOVC 1K83K 3GTLC 2B63C 4QIWD 3HOWC 4OIPA 3PO2K 3WODA 4A3KC 4KN7A 3PO3K 3GTPC 4KN4A 4A3GC 4YG2A 5FLMC 3H3VL 2E2HK 3HOUK 3GTMK 2NVTK 4A93K 1WCMC 5M5XK 4LK1A 2YU9C 2JA7K 4X6AC 3PO2C 5C44K 5TMFA 4LJZA 4Y7NC 4OIOA 5D4DA 1SFOK 1I50K 2NVQC 4BBSK 1TWCC 3HOVK 3HOUC 3S17C 5M5WK 3GTLK 2B63K 3GTMC 1YNJA 4XSZA 3S1RK 4A3BK 4BXXC 3RZDK 4A3KK 4A3IC 3S1QK 1Y1VC 1R9TC 4A3GK 3M4OC 5C4XC 3S1NC 1SFOC 5C3EC 1I50C 2PPBA 1I3QC 4BY1C 3S16C 4A3LC 1WCMK 1TWAC 2Y0SL 4G7ZA 2YU9K 3S1RC 4QJVB 4A3BC 4BY7C 1TWFC 4XSXA 3RZDC 2R92C 3S1QC 4Y7NK 5FJ8K 4MEXA 5C4JC 4OIRA 2NVQK 1TWCK 2PA8D 2NVYK 5IYBC 4MEYA 1BDFA 3GTOC 3S17K 3S14K 4LLGA 5IP7C 3HOZC 5IYDC 4C3HK 4BXXK 2JA6C 4A3IK 2A6EA 4G7OA 1Y1VK 1R9TK 3M4OK 5C4XK 2E2JC 1I6VA 3S1NK 5C3EK 4A3FK 4A3JC 1I3QK 4BY1K 2O5IA 3S16K 2VUMK 2NVYC 4A3LK 3S14C 1TWAK 4BY7K 4AYBL 4KMUA 2R7ZC 1TWFK 2Y0SD 3GTKC 2R92K 4YFNA 4BBRK 4C3IK 4YFKA 1IW7A 2WAQL 3I4NC 4A3MC 4ZH4A 5C4JK
chains in the Genus database with same CATH superfamily
1EI6A 4O2DA 1EFWA 1Y1WA 5IYBK 1XZQA 3SZYA 3A8IA 3HOZK 2JA6K 3GDZA 5CHPA 4A3CC 4GTFA 3GTGA 2R93A 4A3JK 3MMLB 2RGRA 4GTCA 1O26A 4A3MK 1ZYRA 4BKWA 5IYCC 3BP8C 4RMFA 3HKZD 2E2IK 3FKIC 3I4MK 1TWHK 3GTQK 3ERED 3M3YK 4WILA 3GTJK 4YFXA 1ZXOA 3S2DK 4KMDA 4A3DK 3SZZA 3TTGA 1ISEA 1XPPA 1JVIA 4GTAA 4KMAA 5JFEA 2CFAB 4PAAA 3DXJA 4GFQA 4Q4ZA 2GSOA 1F7VA 3S15K 1UV7A 2E2HC 4WJ3M 1O25A 4J3NA 2A68A 3HOWK 1SMYA 4KASA 4LK0A 2JA7A 3S2HK 3HXAA 2WAQD 3S1MC 4G0VA 1I50A 3HOVC 3GTLC 4QIWD 1RU0A 3PO2K 2GSUA 4A3KC 4KN7A 2JH3A 1WOOA 3Q3QA 3H3VL 4P5AA 3HOUK 3GTMK 2NVTK 1WCMC 1USOA 1WSVA 4LJZA 4FZBA 4GT9A 1PJ6A 1JQWA 1WQGA 3GEIA 2KWAA 4BBSK 1TWCC 1O2FB 5M5WK 2B63K 1YCLA 1YNJA 4C3HC 1Y1VC 3M4OC 1SFOC 1I3QC 3S16C 2Y0SL 4WJ4A 3S1RC 1XZPA 1L0WA 3RZDC 3A8JA 2W7VA 2R92C 1BJTA 1IE0A 1B4AA 2NVQK 2NVYK 3S17K 3S14K 1INNA 5IP7C 5IYDC 2A6EA 1KQ4A 5C4XK 3S1NK 3LAPA 4BY1K 2V6UA 2ZUFA 1TWAK 3G4CA 4BY7K 1TWFK 3GTKC 4YFNA 1IW7A 1BS2A 3I4NC 4ZH4A 5C4JK 1Y1WC 4KARA 3S0XA 4C3JC 2VUMC 1WQFA 4KB2A 3GTQA 3GTGC 4BBRC 2ZFZA 3T02A 5M3MK 1IS1A 2R7ZK 4FM9A 1GE9A 4C2MC 1JOEA 3K7AK 3HOYC 4G0WA 3TFHA 3N3YA 1TWGC 2NVXK 3AD9C 3RZOK 5TMCA 2PMZL 2WB1L 3H0GC 4Y52K 3HOXK 5IP9C 3CQZK 1IL2A 4A3EC 1J6VA 1K83C 2GSNA 2YU9A 4GZYA 3S1MK 3PO3C 3EQLA 2XCOA 1HQMA 3GTMA 2JA7C 2FQOA 2JA8K 4Q5SA 3TFJA 1DCPA 2B63A 1J6WA 3CAGA 4GTLA 3GTPC 4A3GC 5FLMC 5IOQA 4DDQA 1PJ7A 3G4AA 3GTOA 4A93K 5M5XK 4LK1A 5C44K 4Y7NC 1SFOK 2NVYA 3S1RK 4BXXC 3RZDK 4M1XA 4A3IC 2P5MA 2GAHC 4G0UA 1XZQB 2V6SA 3AQPA 4X6AK 2YU9K 1TWAA 4A3BC 1TWFA 1WIHA 4C3IC 5FJ8K 2PA8D 4KM8A 5IYBC 1BDFA 1XXCA 3T00A 5IORA 3HOZC 2JA6C 4G7OA 3L4KA 1R9TK 2P8TA 1I6VA 1DD5A 5C3EK 4A3JC 4A3LK 2VUMK 4AYBL 2Y0SD 3JSTA 2R7ZA 3V4GA 4BBRK 2WAQL 4A3MC 1WOSA 4GTDA 4A3FC 3LPXA 3GTOK 1EK8A 3I4MC 3TFIA 2E2IC 1TWHC 2A69A 2NVXA 4AH6A 4KM9A 4KB4A 3FOEA 1DCOA 2E2JK 3M3YC 3GTJC 3S2DC 1I6HC 4A3DC 1ZQ1C 2JA5C 3CQZA 2E2HA 2FQTA 5EGHA 4LQYA 1B4BA 3IPJA 5M5YK 3H0GK 3S15C 3N0CA 4A3CK 4KMHA 4KAWX 3GEEA 3S2HC 3QX3A 2O5JA 3GSIA 1VJEA 1WCMA 2R93C 1VGXA 1WORA 1XXAA 2Y3PA 5IYCK 4JK1A 2XCRB 3FKIK 4XLPA 2NVTC 4XLNA 5IOSA 4GTEA 3AD7C 1WQHA 1ZVUA 3GTPK 5FLMK 1Y1VA 4KC6A 2PMZD 2WB1D 1SFOA 4BBSC 1I3QA 2B63C 1J98A 1XZPB 1ZBSA 4KN4A 2R92A 4LR2A 4YG2A 3T01A 2E2HK 3GIRA 3VA7A 4BLAA 5TMFA 3AQOA 1HI9A 4OIOA 5D4DA 4ILDA 2NVQC 3OPFA 3HOVK 3S17C 4C45A 3GTLK 2GAGC 4XSZA 4A3BK 4LOWA 4A3KK 1IQ0A 2V6TA 1R9TA 5C4XC 3S1NC 1I50C 4BY1C 1EH1A 1AB4A 2VUMA 1WCMK 1TWAC 4BY7C 4XSXA 1TWFC 1O27A 3GEHA 3S1QC 3ADAC 4P5BA 5IOTA 5C4JC 1TWCK 2ZUEA 2EBBA 4C3HK 1Y1VK 3M4OK 5L46A 4A3FK 1I3QK 3S16K 1BGWA 3NUHA 1TWGA 4KMUA 2R7ZC 2R92K 3H3VD 2RH6A 3HKZL 5E68A 3BUEA 3K7AC 3FOFA 1I6HK 2D6FC 5IP7K 3H0GA 1IBAA 5IYDK 2JA5K 2NVXC 5M3FK 2A6HA 1K83A 3RZOC 2BE5A 3OREA 5EGEA 1YNNA 4Y52C 3HOXC 3CQZC 3GTKK 4AYBD 1VH2A 1VLOA 3I4NK 3OEPA 3A8KA 1Y1WK 2CW0A 4C3JK 3FKIA 3AH5A 3GTGK 1O28A 4GTBA 2R93K 2JA8C 1EQRA 3LAJA 3GTPA 3AD8C 4OINA 3GTQC 4QJVA 4QIWL 2PHCB 4OIQA 4C2MK 4NOIA 3HOYK 1WSRA 4XCHA 2PA8L 4G7HA 1TWGK 4PABA 1F7UA 4A93C 4KATA 1WOPA 5C44C 1USMA 1V5VA 4MQ9A 4P9SA 3L4JA 5IP9K 4BLBA 4A3EK 1DCHA 1K83K 3GTLA 1X31C 3HOWC 1PJ5A 4OIPA 3WODA 3PO3K 4KDDA 3FHZA 4X6AC 2JA7K 2YU9C 1VRQC 3PO2C 2JA6A 1O2AA 1J6XA 1F9NA 3BP3A 1I50K 3HOUC 1TWCA 3GTMC 5JVOA 3S1QK 4A3GK 1G51A 1R9TC 1C0AA 5C3EC 2XCQA 2PPBA 4A3LC 1O29A 4G7ZA 1YX2A 4QJVB 2E2IA 1TWHA 1XXBA 3N0BA 4Y7NK 5CJ9A 1O2BA 4MEXA 4OIRA 5TJ3A 3GTJA 4MEYA 3GTOC 4LLGA 5HL8A 4BXXK 2CFAA 2JA5A 4A3IK 2E2JC 2O5IA 2NVYC 3S14C 1F93A 3GTKA 4C3IK 4YFKA 1O24A
chains in the Genus database with same CATH topology
1Y1WC 4A3FC 3H3VD 5IYBK 3HKZL 2VUMC 3GTOK 3K7AC 1I6HK 5IP7K 3HOZK 3I4MC 2E2IC 5IYDK 1TWHC 2JA5K 2NVXC 2A69A 5M3FK 2JA6K 4A3CC 2A6HA 3GTGC 3RZOC 4BBRC 2E2JK 2BE5A 3M3YC 4A3JK 3GTJC 3S2DC 1I6HC 1YNNA 4Y52C 5M3MK 3HOXC 4A3DC 3CQZC 2R7ZK 2JA5C 3GTKK 4AYBD 4X6AK 3I4NK 4A3MK 1ZYRA 1Y1WK 2CW0A 5IYCC 5M5YK 4C3JK 3K7AK 3H0GK 3HOYC 3S15C 3I4MK 3HKZD 2E2IK 3FKIC 1TWGC 1TWHK 2NVXK 3GTQK 4A3CK 3GTGK 3RZOK 2R93K 3M3YK 2JA8C 3S2HC 3GTJK 4YFXA 5TMCA 2PMZL 3S2DK 2WB1L 3H0GC 4Y52K 3HOXK 5IP9C 4A3DK 4OINA 3CQZK 3GTQC 4A3EC 1XPPA 4QIWL 4QJVA 1K83C 2O5JA 2R93C 4OIQA 3DXJA 4C2MK 4NOIA 5IYCK 4Q4ZA 3S1MK 3PO3C 4JK1A 4GZYA 3EQLA 3HOYK 3S15K 2PA8L 4G7HA 3FKIK 1TWGK 4XLPA 2E2HC 1HQMA 2NVTC 4A93C 2A68A 4XLNA 3HOWK 1SMYA 2JA7C 4LK0A 2JA8K 3S2HK 5C44C 2WAQD 4Q5SA 3S1MC 3GTPK 4MQ9A 5FLMK 5IP9K 2PMZD 2WB1D 4BBSC 4A3EK 3HOVC 1K83K 3GTLC 2B63C 4QIWD 3HOWC 4OIPA 3PO2K 3WODA 4A3KC 4KN7A 3PO3K 3GTPC 4KN4A 4A3GC 4YG2A 5FLMC 3H3VL 2E2HK 3HOUK 3GTMK 2NVTK 4A93K 1WCMC 5M5XK 4LK1A 2YU9C 2JA7K 4X6AC 3PO2C 5C44K 5TMFA 4LJZA 4Y7NC 4OIOA 5D4DA 1SFOK 1I50K 2NVQC 4BBSK 1TWCC 3HOVK 3HOUC 3S17C 5M5WK 3GTLK 2B63K 3GTMC 1YNJA 4XSZA 3S1RK 4A3BK 4BXXC 3RZDK 4A3KK 4A3IC 3S1QK 1Y1VC 1R9TC 4A3GK 3M4OC 5C4XC 3S1NC 1SFOC 5C3EC 1I50C 2PPBA 1I3QC 4BY1C 3S16C 4A3LC 1WCMK 1TWAC 2Y0SL 4G7ZA 2YU9K 3S1RC 4QJVB 4A3BC 4BY7C 1TWFC 4XSXA 3RZDC 2R92C 3S1QC 4Y7NK 5FJ8K 4MEXA 5C4JC 4OIRA 2NVQK 1TWCK 2PA8D 2NVYK 5IYBC 4MEYA 1BDFA 3GTOC 3S17K 3S14K 4LLGA 5IP7C 3HOZC 5IYDC 4C3HK 4BXXK 2JA6C 4A3IK 2A6EA 4G7OA 1Y1VK 1R9TK 3M4OK 5C4XK 2E2JC 1I6VA 3S1NK 5C3EK 4A3FK 4A3JC 1I3QK 4BY1K 2O5IA 3S16K 2VUMK 2NVYC 4A3LK 3S14C 1TWAK 4BY7K 4AYBL 4KMUA 2R7ZC 1TWFK 2Y0SD 3GTKC 2R92K 4YFNA 4BBRK 4C3IK 4YFKA 1IW7A 2WAQL 3I4NC 4A3MC 4ZH4A 5C4JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W C;  4A3F C;  3H3V D;  5IYB K;  3HKZ L;  2VUM C;  3GTO K;  3K7A C;  1I6H K;  5IP7 K;  3HOZ K;  3I4M C;  2E2I C;  5IYD K;  1TWH C;  2JA5 K;  2NVX C;  2A69 A;  5M3F K;  2JA6 K;  4A3C C;  2A6H A;  3GTG C;  3RZO C;  4BBR C;  2E2J K;  2BE5 A;  3M3Y C;  4A3J K;  3GTJ C;  3S2D C;  1I6H C;  1YNN A;  4Y52 C;  5M3M K;  3HOX C;  4A3D C;  3CQZ C;  2R7Z K;  2JA5 C;  3GTK K;  4AYB D;  4X6A K;  3I4N K;  4A3M K;  1ZYR A;  1Y1W K;  2CW0 A;  5IYC C;  5M5Y K;  4C3J K;  3K7A K;  3H0G K;  3HOY C;  3S15 C;  3I4M K;  3HKZ D;  2E2I K;  3FKI C;  1TWG C;  1TWH K;  2NVX K;  3GTQ K;  4A3C K;  3GTG K;  3RZO K;  2R93 K;  3M3Y K;  2JA8 C;  3S2H C;  3GTJ K;  4YFX A;  5TMC A;  2PMZ L;  3S2D K;  2WB1 L;  3H0G C;  4Y52 K;  3HOX K;  5IP9 C;  4A3D K;  4OIN A;  3CQZ K;  3GTQ C;  4A3E C;  1XPP A;  4QIW L;  4QJV A;  1K83 C;  2O5J A;  2R93 C;  4OIQ A;  3DXJ A;  4C2M K;  4NOI A;  5IYC K;  4Q4Z A;  3S1M K;  3PO3 C;  4JK1 A;  4GZY A;  3EQL A;  3HOY K;  3S15 K;  2PA8 L;  4G7H A;  3FKI K;  1TWG K;  4XLP A;  2E2H C;  1HQM A;  2NVT C;  4A93 C;  2A68 A;  4XLN A;  3HOW K;  1SMY A;  2JA7 C;  4LK0 A;  2JA8 K;  3S2H K;  5C44 C;  2WAQ D;  4Q5S A;  3S1M C;  3GTP K;  4MQ9 A;  5FLM K;  5IP9 K;  2PMZ D;  2WB1 D;  4BBS C;  4A3E K;  3HOV C;  1K83 K;  3GTL C;  2B63 C;  4QIW D;  3HOW C;  4OIP A;  3PO2 K;  3WOD A;  4A3K C;  4KN7 A;  3PO3 K;  3GTP C;  4KN4 A;  4A3G C;  4YG2 A;  5FLM C;  3H3V L;  2E2H K;  3HOU K;  3GTM K;  2NVT K;  4A93 K;  1WCM C;  5M5X K;  4LK1 A;  2YU9 C;  2JA7 K;  4X6A C;  3PO2 C;  5C44 K;  5TMF A;  4LJZ A;  4Y7N C;  4OIO A;  5D4D A;  1SFO K;  1I50 K;  2NVQ C;  4BBS K;  1TWC C;  3HOV K;  3HOU C;  3S17 C;  5M5W K;  3GTL K;  2B63 K;  3GTM C;  1YNJ A;  4XSZ A;  3S1R K;  4A3B K;  4BXX C;  3RZD K;  4A3K K;  4A3I C;  3S1Q K;  1Y1V C;  1R9T C;  4A3G K;  3M4O C;  5C4X C;  3S1N C;  1SFO C;  5C3E C;  1I50 C;  2PPB A;  1I3Q C;  4BY1 C;  3S16 C;  4A3L C;  1WCM K;  1TWA C;  2Y0S L;  4G7Z A;  2YU9 K;  3S1R C;  4QJV B;  4A3B C;  4BY7 C;  1TWF C;  4XSX A;  3RZD C;  2R92 C;  3S1Q C;  4Y7N K;  5FJ8 K;  4MEX A;  5C4J C;  4OIR A;  2NVQ K;  1TWC K;  2PA8 D;  2NVY K;  5IYB C;  4MEY A;  1BDF A;  3GTO C;  3S17 K;  3S14 K;  4LLG A;  5IP7 C;  3HOZ C;  5IYD C;  4C3H K;  4BXX K;  2JA6 C;  4A3I K;  2A6E A;  4G7O A;  1Y1V K;  1R9T K;  3M4O K;  5C4X K;  2E2J C;  1I6V A;  3S1N K;  5C3E K;  4A3F K;  4A3J C;  1I3Q K;  4BY1 K;  2O5I A;  3S16 K;  2VUM K;  2NVY C;  4A3L K;  3S14 C;  1TWA K;  4BY7 K;  4AYB L;  4KMU A;  2R7Z C;  1TWF K;  2Y0S D;  3GTK C;  2R92 K;  4YFN A;  4BBR K;  4C3I K;  4YFK A;  1IW7 A;  2WAQ L;  3I4N C;  4A3M C;  4ZH4 A;  5C4J K; 
#chains in the Genus database with same CATH topology
 1EI6 A;  4O2D A;  1EFW A;  1Y1W A;  5IYB K;  1XZQ A;  3SZY A;  3A8I A;  3HOZ K;  2JA6 K;  3GDZ A;  5CHP A;  4A3C C;  4GTF A;  3GTG A;  2R93 A;  4A3J K;  3MML B;  2RGR A;  4GTC A;  1O26 A;  4A3M K;  1ZYR A;  4BKW A;  5IYC C;  3BP8 C;  4RMF A;  3HKZ D;  2E2I K;  3FKI C;  3I4M K;  1TWH K;  3GTQ K;  3ERE D;  3M3Y K;  4WIL A;  3GTJ K;  4YFX A;  1ZXO A;  3S2D K;  4KMD A;  4A3D K;  3SZZ A;  3TTG A;  1ISE A;  1XPP A;  1JVI A;  4GTA A;  4KMA A;  5JFE A;  2CFA B;  4PAA A;  3DXJ A;  4GFQ A;  4Q4Z A;  2GSO A;  1F7V A;  3S15 K;  1UV7 A;  2E2H C;  4WJ3 M;  1O25 A;  4J3N A;  2A68 A;  3HOW K;  1SMY A;  4KAS A;  4LK0 A;  2JA7 A;  3S2H K;  3HXA A;  2WAQ D;  3S1M C;  4G0V A;  1I50 A;  3HOV C;  3GTL C;  4QIW D;  1RU0 A;  3PO2 K;  2GSU A;  4A3K C;  4KN7 A;  2JH3 A;  1WOO A;  3Q3Q A;  3H3V L;  4P5A A;  3HOU K;  3GTM K;  2NVT K;  1WCM C;  1USO A;  1WSV A;  4LJZ A;  4FZB A;  4GT9 A;  1PJ6 A;  1JQW A;  1WQG A;  3GEI A;  2KWA A;  4BBS K;  1TWC C;  1O2F B;  5M5W K;  2B63 K;  1YCL A;  1YNJ A;  4C3H C;  1Y1V C;  3M4O C;  1SFO C;  1I3Q C;  3S16 C;  2Y0S L;  4WJ4 A;  3S1R C;  1XZP A;  1L0W A;  3RZD C;  3A8J A;  2W7V A;  2R92 C;  1BJT A;  1IE0 A;  1B4A A;  2NVQ K;  2NVY K;  3S17 K;  3S14 K;  1INN A;  5IP7 C;  5IYD C;  2A6E A;  1KQ4 A;  5C4X K;  3S1N K;  3LAP A;  4BY1 K;  2V6U A;  2ZUF A;  1TWA K;  3G4C A;  4BY7 K;  1TWF K;  3GTK C;  4YFN A;  1IW7 A;  1BS2 A;  3I4N C;  4ZH4 A;  5C4J K;  1Y1W C;  4KAR A;  3S0X A;  4C3J C;  2VUM C;  1WQF A;  4KB2 A;  3GTQ A;  3GTG C;  4BBR C;  2ZFZ A;  3T02 A;  5M3M K;  1IS1 A;  2R7Z K;  4FM9 A;  1GE9 A;  4C2M C;  1JOE A;  3K7A K;  3HOY C;  4G0W A;  3TFH A;  3N3Y A;  1TWG C;  2NVX K;  3AD9 C;  3RZO K;  5TMC A;  2PMZ L;  2WB1 L;  3H0G C;  4Y52 K;  3HOX K;  5IP9 C;  3CQZ K;  1IL2 A;  4A3E C;  1J6V A;  1K83 C;  2GSN A;  2YU9 A;  4GZY A;  3S1M K;  3PO3 C;  3EQL A;  2XCO A;  1HQM A;  3GTM A;  2JA7 C;  2FQO A;  2JA8 K;  4Q5S A;  3TFJ A;  1DCP A;  2B63 A;  1J6W A;  3CAG A;  4GTL A;  3GTP C;  4A3G C;  5FLM C;  5IOQ A;  4DDQ A;  1PJ7 A;  3G4A A;  3GTO A;  4A93 K;  5M5X K;  4LK1 A;  5C44 K;  4Y7N C;  1SFO K;  2NVY A;  3S1R K;  4BXX C;  3RZD K;  4M1X A;  4A3I C;  2P5M A;  2GAH C;  4G0U A;  1XZQ B;  2V6S A;  3AQP A;  4X6A K;  2YU9 K;  1TWA A;  4A3B C;  1TWF A;  1WIH A;  4C3I C;  5FJ8 K;  2PA8 D;  4KM8 A;  5IYB C;  1BDF A;  1XXC A;  3T00 A;  5IOR A;  3HOZ C;  2JA6 C;  4G7O A;  3L4K A;  1R9T K;  2P8T A;  1I6V A;  1DD5 A;  5C3E K;  4A3J C;  4A3L K;  2VUM K;  4AYB L;  2Y0S D;  3JST A;  2R7Z A;  3V4G A;  4BBR K;  2WAQ L;  4A3M C;  1WOS A;  4GTD A;  4A3F C;  3LPX A;  3GTO K;  1EK8 A;  3I4M C;  3TFI A;  2E2I C;  1TWH C;  2A69 A;  2NVX A;  4AH6 A;  4KM9 A;  4KB4 A;  3FOE A;  1DCO A;  2E2J K;  3M3Y C;  3GTJ C;  3S2D C;  1I6H C;  4A3D C;  1ZQ1 C;  2JA5 C;  3CQZ A;  2E2H A;  2FQT A;  5EGH A;  4LQY A;  1B4B A;  3IPJ A;  5M5Y K;  3H0G K;  3S15 C;  3N0C A;  4A3C K;  4KMH A;  4KAW X;  3GEE A;  3S2H C;  3QX3 A;  2O5J A;  3GSI A;  1VJE A;  1WCM A;  2R93 C;  1VGX A;  1WOR A;  1XXA A;  2Y3P A;  5IYC K;  4JK1 A;  2XCR B;  3FKI K;  4XLP A;  2NVT C;  4XLN A;  5IOS A;  4GTE A;  3AD7 C;  1WQH A;  1ZVU A;  3GTP K;  5FLM K;  1Y1V A;  4KC6 A;  2PMZ D;  2WB1 D;  1SFO A;  4BBS C;  1I3Q A;  2B63 C;  1J98 A;  1XZP B;  1ZBS A;  4KN4 A;  2R92 A;  4LR2 A;  4YG2 A;  3T01 A;  2E2H K;  3GIR A;  3VA7 A;  4BLA A;  5TMF A;  3AQO A;  1HI9 A;  4OIO A;  5D4D A;  4ILD A;  2NVQ C;  3OPF A;  3HOV K;  3S17 C;  4C45 A;  3GTL K;  2GAG C;  4XSZ A;  4A3B K;  4LOW A;  4A3K K;  1IQ0 A;  2V6T A;  1R9T A;  5C4X C;  3S1N C;  1I50 C;  4BY1 C;  1EH1 A;  1AB4 A;  2VUM A;  1WCM K;  1TWA C;  4BY7 C;  4XSX A;  1TWF C;  1O27 A;  3GEH A;  3S1Q C;  3ADA C;  4P5B A;  5IOT A;  5C4J C;  1TWC K;  2ZUE A;  2EBB A;  4C3H K;  1Y1V K;  3M4O K;  5L46 A;  4A3F K;  1I3Q K;  3S16 K;  1BGW A;  3NUH A;  1TWG A;  4KMU A;  2R7Z C;  2R92 K;  3H3V D;  2RH6 A;  3HKZ L;  5E68 A;  3BUE A;  3K7A C;  3FOF A;  1I6H K;  2D6F C;  5IP7 K;  3H0G A;  1IBA A;  5IYD K;  2JA5 K;  2NVX C;  5M3F K;  2A6H A;  1K83 A;  3RZO C;  2BE5 A;  3ORE A;  5EGE A;  1YNN A;  4Y52 C;  3HOX C;  3CQZ C;  3GTK K;  4AYB D;  1VH2 A;  1VLO A;  3I4N K;  3OEP A;  3A8K A;  1Y1W K;  2CW0 A;  4C3J K;  3FKI A;  3AH5 A;  3GTG K;  1O28 A;  4GTB A;  2R93 K;  2JA8 C;  1EQR A;  3LAJ A;  3GTP A;  3AD8 C;  4OIN A;  3GTQ C;  4QJV A;  4QIW L;  2PHC B;  4OIQ A;  4C2M K;  4NOI A;  3HOY K;  1WSR A;  4XCH A;  2PA8 L;  4G7H A;  1TWG K;  4PAB A;  1F7U A;  4A93 C;  4KAT A;  1WOP A;  5C44 C;  1USM A;  1V5V A;  4MQ9 A;  4P9S A;  3L4J A;  5IP9 K;  4BLB A;  4A3E K;  1DCH A;  1K83 K;  3GTL A;  1X31 C;  3HOW C;  1PJ5 A;  4OIP A;  3WOD A;  3PO3 K;  4KDD A;  3FHZ A;  4X6A C;  2JA7 K;  2YU9 C;  1VRQ C;  3PO2 C;  2JA6 A;  1O2A A;  1J6X A;  1F9N A;  3BP3 A;  1I50 K;  3HOU C;  1TWC A;  3GTM C;  5JVO A;  3S1Q K;  4A3G K;  1G51 A;  1R9T C;  1C0A A;  5C3E C;  2XCQ A;  2PPB A;  4A3L C;  1O29 A;  4G7Z A;  1YX2 A;  4QJV B;  2E2I A;  1TWH A;  1XXB A;  3N0B A;  4Y7N K;  5CJ9 A;  1O2B A;  4MEX A;  4OIR A;  5TJ3 A;  3GTJ A;  4MEY A;  3GTO C;  4LLG A;  5HL8 A;  4BXX K;  2CFA A;  2JA5 A;  4A3I K;  2E2J C;  2O5I A;  2NVY C;  3S14 C;  1F93 A;  3GTK A;  4C3I K;  4YFK A;  1O24 A; 
#chains in the Genus database with same CATH homology
 1Y1W C;  4A3F C;  3H3V D;  5IYB K;  3HKZ L;  2VUM C;  3GTO K;  3K7A C;  1I6H K;  5IP7 K;  3HOZ K;  3I4M C;  2E2I C;  5IYD K;  1TWH C;  2JA5 K;  2NVX C;  2A69 A;  5M3F K;  2JA6 K;  4A3C C;  2A6H A;  3GTG C;  3RZO C;  4BBR C;  2E2J K;  2BE5 A;  3M3Y C;  4A3J K;  3GTJ C;  3S2D C;  1I6H C;  1YNN A;  4Y52 C;  5M3M K;  3HOX C;  4A3D C;  3CQZ C;  2R7Z K;  2JA5 C;  3GTK K;  4AYB D;  4X6A K;  3I4N K;  4A3M K;  1ZYR A;  1Y1W K;  2CW0 A;  5IYC C;  5M5Y K;  4C3J K;  3K7A K;  3H0G K;  3HOY C;  3S15 C;  3I4M K;  3HKZ D;  2E2I K;  3FKI C;  1TWG C;  1TWH K;  2NVX K;  3GTQ K;  4A3C K;  3GTG K;  3RZO K;  2R93 K;  3M3Y K;  2JA8 C;  3S2H C;  3GTJ K;  4YFX A;  5TMC A;  2PMZ L;  3S2D K;  2WB1 L;  3H0G C;  4Y52 K;  3HOX K;  5IP9 C;  4A3D K;  4OIN A;  3CQZ K;  3GTQ C;  4A3E C;  1XPP A;  4QIW L;  4QJV A;  1K83 C;  2O5J A;  2R93 C;  4OIQ A;  3DXJ A;  4C2M K;  4NOI A;  5IYC K;  4Q4Z A;  3S1M K;  3PO3 C;  4JK1 A;  4GZY A;  3EQL A;  3HOY K;  3S15 K;  2PA8 L;  4G7H A;  3FKI K;  1TWG K;  4XLP A;  2E2H C;  1HQM A;  2NVT C;  4A93 C;  2A68 A;  4XLN A;  3HOW K;  1SMY A;  2JA7 C;  4LK0 A;  2JA8 K;  3S2H K;  5C44 C;  2WAQ D;  4Q5S A;  3S1M C;  3GTP K;  4MQ9 A;  5FLM K;  5IP9 K;  2PMZ D;  2WB1 D;  4BBS C;  4A3E K;  3HOV C;  1K83 K;  3GTL C;  2B63 C;  4QIW D;  3HOW C;  4OIP A;  3PO2 K;  3WOD A;  4A3K C;  4KN7 A;  3PO3 K;  3GTP C;  4KN4 A;  4A3G C;  4YG2 A;  5FLM C;  3H3V L;  2E2H K;  3HOU K;  3GTM K;  2NVT K;  4A93 K;  1WCM C;  5M5X K;  4LK1 A;  2YU9 C;  2JA7 K;  4X6A C;  3PO2 C;  5C44 K;  5TMF A;  4LJZ A;  4Y7N C;  4OIO A;  5D4D A;  1SFO K;  1I50 K;  2NVQ C;  4BBS K;  1TWC C;  3HOV K;  3HOU C;  3S17 C;  5M5W K;  3GTL K;  2B63 K;  3GTM C;  1YNJ A;  4XSZ A;  3S1R K;  4A3B K;  4BXX C;  3RZD K;  4A3K K;  4A3I C;  3S1Q K;  1Y1V C;  1R9T C;  4A3G K;  3M4O C;  5C4X C;  3S1N C;  1SFO C;  5C3E C;  1I50 C;  2PPB A;  1I3Q C;  4BY1 C;  3S16 C;  4A3L C;  1WCM K;  1TWA C;  2Y0S L;  4G7Z A;  2YU9 K;  3S1R C;  4QJV B;  4A3B C;  4BY7 C;  1TWF C;  4XSX A;  3RZD C;  2R92 C;  3S1Q C;  4Y7N K;  5FJ8 K;  4MEX A;  5C4J C;  4OIR A;  2NVQ K;  1TWC K;  2PA8 D;  2NVY K;  5IYB C;  4MEY A;  1BDF A;  3GTO C;  3S17 K;  3S14 K;  4LLG A;  5IP7 C;  3HOZ C;  5IYD C;  4C3H K;  4BXX K;  2JA6 C;  4A3I K;  2A6E A;  4G7O A;  1Y1V K;  1R9T K;  3M4O K;  5C4X K;  2E2J C;  1I6V A;  3S1N K;  5C3E K;  4A3F K;  4A3J C;  1I3Q K;  4BY1 K;  2O5I A;  3S16 K;  2VUM K;  2NVY C;  4A3L K;  3S14 C;  1TWA K;  4BY7 K;  4AYB L;  4KMU A;  2R7Z C;  1TWF K;  2Y0S D;  3GTK C;  2R92 K;  4YFN A;  4BBR K;  4C3I K;  4YFK A;  1IW7 A;  2WAQ L;  3I4N C;  4A3M C;  4ZH4 A;  5C4J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...