1TWHK

Rna polymerase ii complexed with 2'datp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twhK00
3HOZK 3HOZC 1HQMA 4C3JK 3I4NC 4Y7NK 2PA8L 3HOXC 3GTPK 4OIRA 3S17C 3GTPC 2NVYC 5C4JK 3GTOC 4XSXA 4C3IK 5C4JC 4A3MC 4A3CK 5C4XC 4A3CC 5IP7C 4A3EK 3HKZD 4A3EC 2R92K 3HOYK 4XLPA 2R92C 3HOYC 1IW7A 2E2HK 2E2HC 4A3GK 4GZYA 4MEXA 4A3KK 2NVTK 4A3KC 1SMYA 2NVTC 3PO3K 2JA5C 2WAQD 2PPBA 3H3VD 2A6HA 3PO3C 4BBSK 4G7ZA 2VUMK 4BBSC 4LK1A 5M5XK 2VUMC 5M5WK 3M3YC 3S1NC 4BBRC 2R7ZK 2BE5A 2R7ZC 2O5JA 4MQ9A 3PO2K 3RZOK 3S2DK 3H0GK 1I6VA 3RZOC 3S2DC 3H0GC 3I4MK 4Y7NC 3H3VL 3S16K 3I4MC 4Q4ZA 3S16C 2E2JK 2NVQK 4LJZA 3S14K 4A3JK 4Q5SA 4A3JC 5D4DA 4A93K 5FLMK 5IYCK 3HOVK 5FLMC 4QIWD 4C3HK 5IYCC 3GTKK 3GTQK 3GTKC 4QJVA 4G7OA 2A6EA 4NOIA 4BXXK 4XSZA 1I3QK 1Y1VK 2A68A 4YG2A 1I3QC 1Y1VC 4BXXC 4A3GC 1TWAK 1TWAC 4KMUA 2E2IK 1XPPA 4OINA 3S1MK 2E2IC 2WB1D 1YNJA 4JK1A 3S1MC 4Y52K 5IP9K 4QJVB 4Y52C 4OIOA 5IP9C 4BY1K 4QIWL 1TWCK 3GTLK 3GTLC 1BDFA 1TWCC 3HKZL 5IYDC 2PMZD 4C2MK 1R9TK 4XLNA 1R9TC 3K7AK 2JA7K 4A3DK 4YFXA 3K7AC 2NVXK 3PO2C 4KN4A 4G7HA 3EQLA 1I50K 1I50C 5IYBK 2WAQL 2Y0SD 3FKIK 5IYBC 1YNNA 3FKIC 4LK0A 5M3MK 2JA6K 2CW0A 2JA6C 2E2JC 2NVQC 3HOUC 3HOUK 5TMFA 5M5YK 2JA8K 3S14C 4BY7K 3RZDK 4BY7C 5C44K 4A93C 2PMZL 3RZDC 4LLGA 4YFNA 3HOVC 5IYDK 3GTQC 5M3FK 2B63K 1TWGK 1Y1WK 2B63C 1Y1WC 3GTMK 1TWHK 3M4OK 1TWHC 3M4OC 3CQZK 2Y0SL 3CQZC 4A3FK 3S15K 3HOWK 3S15C 3HOWC 4X6AK 4OIQA 4A3LK 3I4NK 4BY1C 4A3LC 4YFKA 3GTGK 3HOXK 3S17K 3GTGC 2JA7C 2NVYK 3GTOK 3S2HK 1K83K 4A3IK 3S2HC 4A3BK 2NVXC 1K83C 4OIPA 5C4XK 4A3IC 4AYBD 4A3MK 3WODA 5IP7K 4A3BC 2WB1L 3S1RK 3S1RC 4X6AC 2O5IA 3GTJK 2JA8C 3GTJC 5FJ8K 5C44C 1ZYRA 4MEYA 3DXJA 1TWFK 2JA5K 2YU9K 5TMCA 4KN7A 1TWFC 2PA8D 5C3EK 2YU9C 2R93K 5C3EC 1TWGC 4ZH4A 2R93C 1WCMK 4AYBL 1SFOK 3GTMC 2A69A 1WCMC 1SFOC 3S1QK 3M3YK 3S1QC 3S1NK 1I6HK 4BBRK 1I6HC 4A3FC 4A3DC
chains in the Genus database with same CATH superfamily
1O28A 3HXAA 3GTGA 4C3JC 2PA8L 4KMDA 3GTOA 4LR2A 3GTPK 3S17C 4GTAA 2NVYC 5C4JK 3GTOC 1O27A 4A3CK 5C4XC 4A3EK 4BLAA 1JOEA 1BGWA 2R92K 1RU0A 4PABA 1DCHA 3IPJA 2PHCB 3OREA 4WILA 4MEXA 1SMYA 3PO3K 3AD7C 1SFOA 2VUMK 4BBSC 1ISEA 5M5XK 3M3YC 4GFQA 4BBRC 3FOFA 4G0UA 4ILDA 2V6TA 4Y7NC 2E2JK 1B4AA 3FOEA 4Q5SA 5D4DA 4C3IC 4A93K 5IYCK 5IOQA 2P5MA 5HL8A 3GTKC 1XXBA 2A6EA 5JVOA 4BLBA 1I3QK 1Y1VK 1TWAK 2E2IK 1XPPA 4OINA 1EQRA 3S1MC 4Y52K 3LPXA 1GE9A 3GTLK 1VJEA 5IYDK 1TWCC 2R7ZA 1R9TC 4C2MC 3H0GA 3K7AC 2Y0SD 4LK0A 3FKIC 4X6AK 1VGXA 4O2DA 1O25A 1IBAA 4P9SA 2XCRB 2B63C 1C0AA 3CQZC 4A3FK 3TTGA 3HOWK 4OIQA 4BY1C 4A3LC 4YFKA 5IOSA 3T02A 2NVXC 1K83C 1I50A 4A3IC 4G0VA 1EI6A 4GTLA 5IP7K 2FQOA 2JA6A 1F9NA 3S1RK 1XZPB 3GDZA 3GTJK 1EFWA 5C44C 3GTQA 1XZQB 3DXJA 4MEYA 1TWFK 1I6HC 2PA8D 5C3EK 1TWHA 1TWGC 3A8KA 4GTCA 2W7VA 4AYBL 3GTMC 2A69A 1WCMC 3S1QC 3S1NK 3N0BA 3HOZK 1VH2A 3HOXC 3GTPC 4GTEA 1J6XA 4XSXA 5C4JC 1O24A 4A3CC 4A3EC 3LAJA 4XLPA 2R92C 2ZUEA 2E2HK 4RMFA 4A3KK 2YU9A 5IOTA 2R93A 1PJ7A 3PO3C 4KMHA 2A6HA 2GSOA 1INNA 3BP3A 4LK1A 1PJ6A 2VUMC 5M5WK 4PAAA 2O5JA 3MMLB 4MQ9A 3RZOK 3S2DK 1I6VA 1XXAA 1VRQC 2ZFZA 3NUHA 3H3VL 2NVYA 4Q4ZA 1F7UA 2NVQK 4LJZA 3TFJA 4A3JK 1IE0A 4C3HK 5IYCC 3GTQK 4QJVA 4G7OA 3ADAC 1B4BA 4BXXK 2A68A 4YG2A 1I3QC 1Y1VC 4A3GC 1TWAC 2E2IC 1V5VA 4KATA 4KASA 3Q3QA 4Y52C 1WQGA 3FHZA 1DCOA 3GTLC 1BDFA 5IYDC 4AH6A 1WQHA 4A3DK 4YFXA 3PO2C 4KN4A 3QX3A 3EQLA 5IYBK 1J98A 5EGHA 4KARA 1YNNA 1ZVUA 2CW0A 3S14C 4WJ3M 4LOWA 5TMFA 5M5YK 2JA8K 3RZDK 1G51A 3GTKA 4LLGA 4YFNA 4KB4A 3HOVC 2Y3PA 1Y1WK 1JQWA 1IL2A 1TWCA 3HOWC 1R9TA 4M1XA 3GTGK 2CFAA 3S17K 2JA7C 2NVYK 3GTOK 3S2HK 4A3BK 1USOA 5C4XK 4AYBD 3T00A 3FKIA 1IS1A 1WOPA 3S1RC 2RGRA 1O29A 4KDDA 3GTJC 2B63A 1ZXOA 1TWFC 4KN7A 5C3EC 4ZH4A 3N3YA 3CQZA 4KMAA 1SFOK 3M3YK 4BBRK 5CJ9A 1WORA 3BUEA 3HOZC 3N0CA 3I4NC 4Y7NK 5EGEA 3V4GA 1K83A 3AD8C 2NVXA 4P5BA 1J6WA 3CAGA 4C3IK 4A3MC 2FQTA 3HKZD 3HOYK 1IW7A 2E2HC 2NVTK 4A3KC 1TWGA 2JA5C 3H3VD 3GTMA 5JFEA 1WCMA 4G7ZA 4WJ4A 1IQ0A 2R7ZK 1WOOA 3H0GK 3AQOA 1EK8A 3RZOC 3S2DC 3AD9C 3I4MK 3GTPA 3S16K 1DD5A 3TFHA 4XCHA 2P8TA 2KWAA 4GTDA 4A3JC 5FLMK 1F7VA 2R92A 3GEIA 4BXXC 1WQFA 4KMUA 2VUMA 4JK1A 5IP9K 4QJVB 4OIOA 4BY1K 4QIWL 3HKZL 1YCLA 4XLNA 4DDQA 2NVXK 3OPFA 3ERED 3OEPA 1I50K 5CHPA 5IYBC 2GAHC 2JA6K 5M3MK 3HOUK 2XCOA 2E2JC 4BY7K 5C44K 1ZBSA 2PMZL 3RZDC 4A93C 4C45A 1TWGK 1I3QA 1Y1VA 3L4JA 1Y1WC 1TWHK 3GTMK 3JSTA 3M4OK 1TWAA 2E2IA 3S0XA 3S15K 1UV7A 5TJ3A 3GTLA 1VLOA 3AH5A 4KC6A 3HOXK 3A8JA 3GTGC 1DCPA 3S2HC 4A3BC 4GTBA 3WODA 1BS2A 3GEHA 1AB4A 4X6AC 2CFAB 2V6SA 4BKWA 3SZYA 2YU9K 5TMCA 2R93K 4FM9A 2GSUA 1SFOC 5E68A 1I6HK 4A3FC 1HQMA 1O26A 4C3JK 3G4CA 2JA7A 4KB2A 5IORA 4OIRA 4FZBA 4G0WA 1F93A 5IP7C 3T01A 1JVIA 3GTJA 3HOYC 4A3GK 4GZYA 1TWFA 1KQ4A 2NVTC 2WAQD 3L4KA 2PPBA 4BBSK 4LQYA 2EBBA 1X31C 3S1NC 2BE5A 2R7ZC 3PO2K 4KM9A 3SZZA 3H0GC 3I4MC 3A8IA 3S16C 3S14K 3HOVK 5FLMC 4QIWD 3BP8C 3GTKK 2E2HA 4NOIA 1L0WA 4XSZA 1XXCA 2V6UA 2JA5A 4P5AA 2JH3A 3S1MK 2WB1D 1YNJA 3GIRA 3GSIA 4GT9A 3TFIA 2XCQA 3AQPA 5IP9C 1TWCK 2GSNA 1R9TK 2PMZD 4C2MK 3LAPA 2D6FC 3K7AK 2JA7K 2GAGC 4G7HA 1I50C 4KAWX 2WAQL 3FKIK 4GTFA 2JA6C 5L46A 2NVQC 3HOUC 4BY7C 1USMA 4C3HC 3GTQC 3G4AA 1WOSA 5M3FK 2B63K 1O2AA 1TWHC 3M4OC 3CQZK 2Y0SL 1O2BA 1WIHA 3S15C 4A3LK 3I4NK 1XZPA 4A3DC 1BJTA 1EH1A 1K83K 4A3IK 1ZQ1C 4A3MK 4OIPA 1XZQA 4J3NA 1PJ5A 2WB1L 1WSRA 1WSVA 2O5IA 1O2FB 2JA8C 5FJ8K 1HI9A 1ZYRA 2JA5K 1J6VA 3VA7A 1Y1WA 2YU9C 1YX2A 2R93C 1WCMK 3S1QK 3GEEA 2ZUFA 4KM8A 2RH6A
chains in the Genus database with same CATH topology
3HOZK 3HOZC 1HQMA 4C3JK 3I4NC 4Y7NK 2PA8L 3HOXC 3GTPK 4OIRA 3S17C 3GTPC 2NVYC 5C4JK 3GTOC 4XSXA 4C3IK 5C4JC 4A3MC 4A3CK 5C4XC 4A3CC 5IP7C 4A3EK 3HKZD 4A3EC 2R92K 3HOYK 4XLPA 2R92C 3HOYC 1IW7A 2E2HK 2E2HC 4A3GK 4GZYA 4MEXA 4A3KK 2NVTK 4A3KC 1SMYA 2NVTC 3PO3K 2JA5C 2WAQD 2PPBA 3H3VD 2A6HA 3PO3C 4BBSK 4G7ZA 2VUMK 4BBSC 4LK1A 5M5XK 2VUMC 5M5WK 3M3YC 3S1NC 4BBRC 2R7ZK 2BE5A 2R7ZC 2O5JA 4MQ9A 3PO2K 3RZOK 3S2DK 3H0GK 1I6VA 3RZOC 3S2DC 3H0GC 3I4MK 4Y7NC 3H3VL 3S16K 3I4MC 4Q4ZA 3S16C 2E2JK 2NVQK 4LJZA 3S14K 4A3JK 4Q5SA 4A3JC 5D4DA 4A93K 5FLMK 5IYCK 3HOVK 5FLMC 4QIWD 4C3HK 5IYCC 3GTKK 3GTQK 3GTKC 4QJVA 4G7OA 2A6EA 4NOIA 4BXXK 4XSZA 1I3QK 1Y1VK 2A68A 4YG2A 1I3QC 1Y1VC 4BXXC 4A3GC 1TWAK 1TWAC 4KMUA 2E2IK 1XPPA 4OINA 3S1MK 2E2IC 2WB1D 1YNJA 4JK1A 3S1MC 4Y52K 5IP9K 4QJVB 4Y52C 4OIOA 5IP9C 4BY1K 4QIWL 1TWCK 3GTLK 3GTLC 1BDFA 1TWCC 3HKZL 5IYDC 2PMZD 4C2MK 1R9TK 4XLNA 1R9TC 3K7AK 2JA7K 4A3DK 4YFXA 3K7AC 2NVXK 3PO2C 4KN4A 4G7HA 3EQLA 1I50K 1I50C 5IYBK 2WAQL 2Y0SD 3FKIK 5IYBC 1YNNA 3FKIC 4LK0A 5M3MK 2JA6K 2CW0A 2JA6C 2E2JC 2NVQC 3HOUC 3HOUK 5TMFA 5M5YK 2JA8K 3S14C 4BY7K 3RZDK 4BY7C 5C44K 4A93C 2PMZL 3RZDC 4LLGA 4YFNA 3HOVC 5IYDK 3GTQC 5M3FK 2B63K 1TWGK 1Y1WK 2B63C 1Y1WC 3GTMK 1TWHK 3M4OK 1TWHC 3M4OC 3CQZK 2Y0SL 3CQZC 4A3FK 3S15K 3HOWK 3S15C 3HOWC 4X6AK 4OIQA 4A3LK 3I4NK 4BY1C 4A3LC 4YFKA 3GTGK 3HOXK 3S17K 3GTGC 2JA7C 2NVYK 3GTOK 3S2HK 1K83K 4A3IK 3S2HC 4A3BK 2NVXC 1K83C 4OIPA 5C4XK 4A3IC 4AYBD 4A3MK 3WODA 5IP7K 4A3BC 2WB1L 3S1RK 3S1RC 4X6AC 2O5IA 3GTJK 2JA8C 3GTJC 5FJ8K 5C44C 1ZYRA 4MEYA 3DXJA 1TWFK 2JA5K 2YU9K 5TMCA 4KN7A 1TWFC 2PA8D 5C3EK 2YU9C 2R93K 5C3EC 1TWGC 4ZH4A 2R93C 1WCMK 4AYBL 1SFOK 3GTMC 2A69A 1WCMC 1SFOC 3S1QK 3M3YK 3S1QC 3S1NK 1I6HK 4BBRK 1I6HC 4A3FC 4A3DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ K;  3HOZ C;  1HQM A;  4C3J K;  3I4N C;  4Y7N K;  2PA8 L;  3HOX C;  3GTP K;  4OIR A;  3S17 C;  3GTP C;  2NVY C;  5C4J K;  3GTO C;  4XSX A;  4C3I K;  5C4J C;  4A3M C;  4A3C K;  5C4X C;  4A3C C;  5IP7 C;  4A3E K;  3HKZ D;  4A3E C;  2R92 K;  3HOY K;  4XLP A;  2R92 C;  3HOY C;  1IW7 A;  2E2H K;  2E2H C;  4A3G K;  4GZY A;  4MEX A;  4A3K K;  2NVT K;  4A3K C;  1SMY A;  2NVT C;  3PO3 K;  2JA5 C;  2WAQ D;  2PPB A;  3H3V D;  2A6H A;  3PO3 C;  4BBS K;  4G7Z A;  2VUM K;  4BBS C;  4LK1 A;  5M5X K;  2VUM C;  5M5W K;  3M3Y C;  3S1N C;  4BBR C;  2R7Z K;  2BE5 A;  2R7Z C;  2O5J A;  4MQ9 A;  3PO2 K;  3RZO K;  3S2D K;  3H0G K;  1I6V A;  3RZO C;  3S2D C;  3H0G C;  3I4M K;  4Y7N C;  3H3V L;  3S16 K;  3I4M C;  4Q4Z A;  3S16 C;  2E2J K;  2NVQ K;  4LJZ A;  3S14 K;  4A3J K;  4Q5S A;  4A3J C;  5D4D A;  4A93 K;  5FLM K;  5IYC K;  3HOV K;  5FLM C;  4QIW D;  4C3H K;  5IYC C;  3GTK K;  3GTQ K;  3GTK C;  4QJV A;  4G7O A;  2A6E A;  4NOI A;  4BXX K;  4XSZ A;  1I3Q K;  1Y1V K;  2A68 A;  4YG2 A;  1I3Q C;  1Y1V C;  4BXX C;  4A3G C;  1TWA K;  1TWA C;  4KMU A;  2E2I K;  1XPP A;  4OIN A;  3S1M K;  2E2I C;  2WB1 D;  1YNJ A;  4JK1 A;  3S1M C;  4Y52 K;  5IP9 K;  4QJV B;  4Y52 C;  4OIO A;  5IP9 C;  4BY1 K;  4QIW L;  1TWC K;  3GTL K;  3GTL C;  1BDF A;  1TWC C;  3HKZ L;  5IYD C;  2PMZ D;  4C2M K;  1R9T K;  4XLN A;  1R9T C;  3K7A K;  2JA7 K;  4A3D K;  4YFX A;  3K7A C;  2NVX K;  3PO2 C;  4KN4 A;  4G7H A;  3EQL A;  1I50 K;  1I50 C;  5IYB K;  2WAQ L;  2Y0S D;  3FKI K;  5IYB C;  1YNN A;  3FKI C;  4LK0 A;  5M3M K;  2JA6 K;  2CW0 A;  2JA6 C;  2E2J C;  2NVQ C;  3HOU C;  3HOU K;  5TMF A;  5M5Y K;  2JA8 K;  3S14 C;  4BY7 K;  3RZD K;  4BY7 C;  5C44 K;  4A93 C;  2PMZ L;  3RZD C;  4LLG A;  4YFN A;  3HOV C;  5IYD K;  3GTQ C;  5M3F K;  2B63 K;  1TWG K;  1Y1W K;  2B63 C;  1Y1W C;  3GTM K;  1TWH K;  3M4O K;  1TWH C;  3M4O C;  3CQZ K;  2Y0S L;  3CQZ C;  4A3F K;  3S15 K;  3HOW K;  3S15 C;  3HOW C;  4X6A K;  4OIQ A;  4A3L K;  3I4N K;  4BY1 C;  4A3L C;  4YFK A;  3GTG K;  3HOX K;  3S17 K;  3GTG C;  2JA7 C;  2NVY K;  3GTO K;  3S2H K;  1K83 K;  4A3I K;  3S2H C;  4A3B K;  2NVX C;  1K83 C;  4OIP A;  5C4X K;  4A3I C;  4AYB D;  4A3M K;  3WOD A;  5IP7 K;  4A3B C;  2WB1 L;  3S1R K;  3S1R C;  4X6A C;  2O5I A;  3GTJ K;  2JA8 C;  3GTJ C;  5FJ8 K;  5C44 C;  1ZYR A;  4MEY A;  3DXJ A;  1TWF K;  2JA5 K;  2YU9 K;  5TMC A;  4KN7 A;  1TWF C;  2PA8 D;  5C3E K;  2YU9 C;  2R93 K;  5C3E C;  1TWG C;  4ZH4 A;  2R93 C;  1WCM K;  4AYB L;  1SFO K;  3GTM C;  2A69 A;  1WCM C;  1SFO C;  3S1Q K;  3M3Y K;  3S1Q C;  3S1N K;  1I6H K;  4BBR K;  1I6H C;  4A3F C;  4A3D C; 
#chains in the Genus database with same CATH topology
 1O28 A;  3HXA A;  3GTG A;  4C3J C;  2PA8 L;  4KMD A;  3GTO A;  4LR2 A;  3GTP K;  3S17 C;  4GTA A;  2NVY C;  5C4J K;  3GTO C;  1O27 A;  4A3C K;  5C4X C;  4A3E K;  4BLA A;  1JOE A;  1BGW A;  2R92 K;  1RU0 A;  4PAB A;  1DCH A;  3IPJ A;  2PHC B;  3ORE A;  4WIL A;  4MEX A;  1SMY A;  3PO3 K;  3AD7 C;  1SFO A;  2VUM K;  4BBS C;  1ISE A;  5M5X K;  3M3Y C;  4GFQ A;  4BBR C;  3FOF A;  4G0U A;  4ILD A;  2V6T A;  4Y7N C;  2E2J K;  1B4A A;  3FOE A;  4Q5S A;  5D4D A;  4C3I C;  4A93 K;  5IYC K;  5IOQ A;  2P5M A;  5HL8 A;  3GTK C;  1XXB A;  2A6E A;  5JVO A;  4BLB A;  1I3Q K;  1Y1V K;  1TWA K;  2E2I K;  1XPP A;  4OIN A;  1EQR A;  3S1M C;  4Y52 K;  3LPX A;  1GE9 A;  3GTL K;  1VJE A;  5IYD K;  1TWC C;  2R7Z A;  1R9T C;  4C2M C;  3H0G A;  3K7A C;  2Y0S D;  4LK0 A;  3FKI C;  4X6A K;  1VGX A;  4O2D A;  1O25 A;  1IBA A;  4P9S A;  2XCR B;  2B63 C;  1C0A A;  3CQZ C;  4A3F K;  3TTG A;  3HOW K;  4OIQ A;  4BY1 C;  4A3L C;  4YFK A;  5IOS A;  3T02 A;  2NVX C;  1K83 C;  1I50 A;  4A3I C;  4G0V A;  1EI6 A;  4GTL A;  5IP7 K;  2FQO A;  2JA6 A;  1F9N A;  3S1R K;  1XZP B;  3GDZ A;  3GTJ K;  1EFW A;  5C44 C;  3GTQ A;  1XZQ B;  3DXJ A;  4MEY A;  1TWF K;  1I6H C;  2PA8 D;  5C3E K;  1TWH A;  1TWG C;  3A8K A;  4GTC A;  2W7V A;  4AYB L;  3GTM C;  2A69 A;  1WCM C;  3S1Q C;  3S1N K;  3N0B A;  3HOZ K;  1VH2 A;  3HOX C;  3GTP C;  4GTE A;  1J6X A;  4XSX A;  5C4J C;  1O24 A;  4A3C C;  4A3E C;  3LAJ A;  4XLP A;  2R92 C;  2ZUE A;  2E2H K;  4RMF A;  4A3K K;  2YU9 A;  5IOT A;  2R93 A;  1PJ7 A;  3PO3 C;  4KMH A;  2A6H A;  2GSO A;  1INN A;  3BP3 A;  4LK1 A;  1PJ6 A;  2VUM C;  5M5W K;  4PAA A;  2O5J A;  3MML B;  4MQ9 A;  3RZO K;  3S2D K;  1I6V A;  1XXA A;  1VRQ C;  2ZFZ A;  3NUH A;  3H3V L;  2NVY A;  4Q4Z A;  1F7U A;  2NVQ K;  4LJZ A;  3TFJ A;  4A3J K;  1IE0 A;  4C3H K;  5IYC C;  3GTQ K;  4QJV A;  4G7O A;  3ADA C;  1B4B A;  4BXX K;  2A68 A;  4YG2 A;  1I3Q C;  1Y1V C;  4A3G C;  1TWA C;  2E2I C;  1V5V A;  4KAT A;  4KAS A;  3Q3Q A;  4Y52 C;  1WQG A;  3FHZ A;  1DCO A;  3GTL C;  1BDF A;  5IYD C;  4AH6 A;  1WQH A;  4A3D K;  4YFX A;  3PO2 C;  4KN4 A;  3QX3 A;  3EQL A;  5IYB K;  1J98 A;  5EGH A;  4KAR A;  1YNN A;  1ZVU A;  2CW0 A;  3S14 C;  4WJ3 M;  4LOW A;  5TMF A;  5M5Y K;  2JA8 K;  3RZD K;  1G51 A;  3GTK A;  4LLG A;  4YFN A;  4KB4 A;  3HOV C;  2Y3P A;  1Y1W K;  1JQW A;  1IL2 A;  1TWC A;  3HOW C;  1R9T A;  4M1X A;  3GTG K;  2CFA A;  3S17 K;  2JA7 C;  2NVY K;  3GTO K;  3S2H K;  4A3B K;  1USO A;  5C4X K;  4AYB D;  3T00 A;  3FKI A;  1IS1 A;  1WOP A;  3S1R C;  2RGR A;  1O29 A;  4KDD A;  3GTJ C;  2B63 A;  1ZXO A;  1TWF C;  4KN7 A;  5C3E C;  4ZH4 A;  3N3Y A;  3CQZ A;  4KMA A;  1SFO K;  3M3Y K;  4BBR K;  5CJ9 A;  1WOR A;  3BUE A;  3HOZ C;  3N0C A;  3I4N C;  4Y7N K;  5EGE A;  3V4G A;  1K83 A;  3AD8 C;  2NVX A;  4P5B A;  1J6W A;  3CAG A;  4C3I K;  4A3M C;  2FQT A;  3HKZ D;  3HOY K;  1IW7 A;  2E2H C;  2NVT K;  4A3K C;  1TWG A;  2JA5 C;  3H3V D;  3GTM A;  5JFE A;  1WCM A;  4G7Z A;  4WJ4 A;  1IQ0 A;  2R7Z K;  1WOO A;  3H0G K;  3AQO A;  1EK8 A;  3RZO C;  3S2D C;  3AD9 C;  3I4M K;  3GTP A;  3S16 K;  1DD5 A;  3TFH A;  4XCH A;  2P8T A;  2KWA A;  4GTD A;  4A3J C;  5FLM K;  1F7V A;  2R92 A;  3GEI A;  4BXX C;  1WQF A;  4KMU A;  2VUM A;  4JK1 A;  5IP9 K;  4QJV B;  4OIO A;  4BY1 K;  4QIW L;  3HKZ L;  1YCL A;  4XLN A;  4DDQ A;  2NVX K;  3OPF A;  3ERE D;  3OEP A;  1I50 K;  5CHP A;  5IYB C;  2GAH C;  2JA6 K;  5M3M K;  3HOU K;  2XCO A;  2E2J C;  4BY7 K;  5C44 K;  1ZBS A;  2PMZ L;  3RZD C;  4A93 C;  4C45 A;  1TWG K;  1I3Q A;  1Y1V A;  3L4J A;  1Y1W C;  1TWH K;  3GTM K;  3JST A;  3M4O K;  1TWA A;  2E2I A;  3S0X A;  3S15 K;  1UV7 A;  5TJ3 A;  3GTL A;  1VLO A;  3AH5 A;  4KC6 A;  3HOX K;  3A8J A;  3GTG C;  1DCP A;  3S2H C;  4A3B C;  4GTB A;  3WOD A;  1BS2 A;  3GEH A;  1AB4 A;  4X6A C;  2CFA B;  2V6S A;  4BKW A;  3SZY A;  2YU9 K;  5TMC A;  2R93 K;  4FM9 A;  2GSU A;  1SFO C;  5E68 A;  1I6H K;  4A3F C;  1HQM A;  1O26 A;  4C3J K;  3G4C A;  2JA7 A;  4KB2 A;  5IOR A;  4OIR A;  4FZB A;  4G0W A;  1F93 A;  5IP7 C;  3T01 A;  1JVI A;  3GTJ A;  3HOY C;  4A3G K;  4GZY A;  1TWF A;  1KQ4 A;  2NVT C;  2WAQ D;  3L4K A;  2PPB A;  4BBS K;  4LQY A;  2EBB A;  1X31 C;  3S1N C;  2BE5 A;  2R7Z C;  3PO2 K;  4KM9 A;  3SZZ A;  3H0G C;  3I4M C;  3A8I A;  3S16 C;  3S14 K;  3HOV K;  5FLM C;  4QIW D;  3BP8 C;  3GTK K;  2E2H A;  4NOI A;  1L0W A;  4XSZ A;  1XXC A;  2V6U A;  2JA5 A;  4P5A A;  2JH3 A;  3S1M K;  2WB1 D;  1YNJ A;  3GIR A;  3GSI A;  4GT9 A;  3TFI A;  2XCQ A;  3AQP A;  5IP9 C;  1TWC K;  2GSN A;  1R9T K;  2PMZ D;  4C2M K;  3LAP A;  2D6F C;  3K7A K;  2JA7 K;  2GAG C;  4G7H A;  1I50 C;  4KAW X;  2WAQ L;  3FKI K;  4GTF A;  2JA6 C;  5L46 A;  2NVQ C;  3HOU C;  4BY7 C;  1USM A;  4C3H C;  3GTQ C;  3G4A A;  1WOS A;  5M3F K;  2B63 K;  1O2A A;  1TWH C;  3M4O C;  3CQZ K;  2Y0S L;  1O2B A;  1WIH A;  3S15 C;  4A3L K;  3I4N K;  1XZP A;  4A3D C;  1BJT A;  1EH1 A;  1K83 K;  4A3I K;  1ZQ1 C;  4A3M K;  4OIP A;  1XZQ A;  4J3N A;  1PJ5 A;  2WB1 L;  1WSR A;  1WSV A;  2O5I A;  1O2F B;  2JA8 C;  5FJ8 K;  1HI9 A;  1ZYR A;  2JA5 K;  1J6V A;  3VA7 A;  1Y1W A;  2YU9 C;  1YX2 A;  2R93 C;  1WCM K;  3S1Q K;  3GEE A;  2ZUF A;  4KM8 A;  2RH6 A; 
#chains in the Genus database with same CATH homology
 3HOZ K;  3HOZ C;  1HQM A;  4C3J K;  3I4N C;  4Y7N K;  2PA8 L;  3HOX C;  3GTP K;  4OIR A;  3S17 C;  3GTP C;  2NVY C;  5C4J K;  3GTO C;  4XSX A;  4C3I K;  5C4J C;  4A3M C;  4A3C K;  5C4X C;  4A3C C;  5IP7 C;  4A3E K;  3HKZ D;  4A3E C;  2R92 K;  3HOY K;  4XLP A;  2R92 C;  3HOY C;  1IW7 A;  2E2H K;  2E2H C;  4A3G K;  4GZY A;  4MEX A;  4A3K K;  2NVT K;  4A3K C;  1SMY A;  2NVT C;  3PO3 K;  2JA5 C;  2WAQ D;  2PPB A;  3H3V D;  2A6H A;  3PO3 C;  4BBS K;  4G7Z A;  2VUM K;  4BBS C;  4LK1 A;  5M5X K;  2VUM C;  5M5W K;  3M3Y C;  3S1N C;  4BBR C;  2R7Z K;  2BE5 A;  2R7Z C;  2O5J A;  4MQ9 A;  3PO2 K;  3RZO K;  3S2D K;  3H0G K;  1I6V A;  3RZO C;  3S2D C;  3H0G C;  3I4M K;  4Y7N C;  3H3V L;  3S16 K;  3I4M C;  4Q4Z A;  3S16 C;  2E2J K;  2NVQ K;  4LJZ A;  3S14 K;  4A3J K;  4Q5S A;  4A3J C;  5D4D A;  4A93 K;  5FLM K;  5IYC K;  3HOV K;  5FLM C;  4QIW D;  4C3H K;  5IYC C;  3GTK K;  3GTQ K;  3GTK C;  4QJV A;  4G7O A;  2A6E A;  4NOI A;  4BXX K;  4XSZ A;  1I3Q K;  1Y1V K;  2A68 A;  4YG2 A;  1I3Q C;  1Y1V C;  4BXX C;  4A3G C;  1TWA K;  1TWA C;  4KMU A;  2E2I K;  1XPP A;  4OIN A;  3S1M K;  2E2I C;  2WB1 D;  1YNJ A;  4JK1 A;  3S1M C;  4Y52 K;  5IP9 K;  4QJV B;  4Y52 C;  4OIO A;  5IP9 C;  4BY1 K;  4QIW L;  1TWC K;  3GTL K;  3GTL C;  1BDF A;  1TWC C;  3HKZ L;  5IYD C;  2PMZ D;  4C2M K;  1R9T K;  4XLN A;  1R9T C;  3K7A K;  2JA7 K;  4A3D K;  4YFX A;  3K7A C;  2NVX K;  3PO2 C;  4KN4 A;  4G7H A;  3EQL A;  1I50 K;  1I50 C;  5IYB K;  2WAQ L;  2Y0S D;  3FKI K;  5IYB C;  1YNN A;  3FKI C;  4LK0 A;  5M3M K;  2JA6 K;  2CW0 A;  2JA6 C;  2E2J C;  2NVQ C;  3HOU C;  3HOU K;  5TMF A;  5M5Y K;  2JA8 K;  3S14 C;  4BY7 K;  3RZD K;  4BY7 C;  5C44 K;  4A93 C;  2PMZ L;  3RZD C;  4LLG A;  4YFN A;  3HOV C;  5IYD K;  3GTQ C;  5M3F K;  2B63 K;  1TWG K;  1Y1W K;  2B63 C;  1Y1W C;  3GTM K;  1TWH K;  3M4O K;  1TWH C;  3M4O C;  3CQZ K;  2Y0S L;  3CQZ C;  4A3F K;  3S15 K;  3HOW K;  3S15 C;  3HOW C;  4X6A K;  4OIQ A;  4A3L K;  3I4N K;  4BY1 C;  4A3L C;  4YFK A;  3GTG K;  3HOX K;  3S17 K;  3GTG C;  2JA7 C;  2NVY K;  3GTO K;  3S2H K;  1K83 K;  4A3I K;  3S2H C;  4A3B K;  2NVX C;  1K83 C;  4OIP A;  5C4X K;  4A3I C;  4AYB D;  4A3M K;  3WOD A;  5IP7 K;  4A3B C;  2WB1 L;  3S1R K;  3S1R C;  4X6A C;  2O5I A;  3GTJ K;  2JA8 C;  3GTJ C;  5FJ8 K;  5C44 C;  1ZYR A;  4MEY A;  3DXJ A;  1TWF K;  2JA5 K;  2YU9 K;  5TMC A;  4KN7 A;  1TWF C;  2PA8 D;  5C3E K;  2YU9 C;  2R93 K;  5C3E C;  1TWG C;  4ZH4 A;  2R93 C;  1WCM K;  4AYB L;  1SFO K;  3GTM C;  2A69 A;  1WCM C;  1SFO C;  3S1Q K;  3M3Y K;  3S1Q C;  3S1N K;  1I6H K;  4BBR K;  1I6H C;  4A3F C;  4A3D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...