1TWHK

Rna polymerase ii complexed with 2'datp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twhK00
5IYBK 4A3FK 2E2HC 1R9TK 4BBRC 3GTPC 4A3MK 1SFOC 3GTMK 4A3GK 4NOIA 3H0GK 5C4JC 4Y7NC 3PO2C 1I6VA 2Y0SD 4MEYA 2WAQD 2NVYK 4OIOA 4A3IK 4A3JK 2JA6K 5D4DA 1HQMA 2CW0A 5IYDC 4Q4ZA 2JA5K 2VUMK 5M5XK 1I6HC 4A3BK 3CQZC 2JA8C 1TWFC 3S2HK 2E2JK 2YU9K 4A3KC 4X6AK 4JK1A 2E2IK 3S17K 3HOUK 2PA8L 1K83K 3S1NK 3HOZC 4LLGA 3GTQK 2A69A 5C3EC 5C4XC 3HOVK 1I50C 1SMYA 2NVTC 5IP9K 3S16K 1WCMC 4BBRK 3HOWK 4A3DC 3S1MC 5C4JK 1YNJA 4XLPA 4Y7NK 3M4OK 1ZYRA 4A3JC 2JA6C 5M3MK 3GTLC 2BE5A 5TMCA 2R93K 5IYBC 4A3EC 1R9TC 4A3BC 4A3MC 3CQZK 2A6HA 3S1RC 3I4MK 2WAQL 1I3QC 3HKZD 2E2JC 2YU9C 4BY1K 4OIRA 2JA7K 4A93K 4BXXK 4X6AC 2A6EA 3S1NC 4A3IC 4KN4A 3FKIC 2Y0SL 2JA5C 2VUMC 4OINA 3RZOK 4BY7K 3GTGK 3S15C 2PA8D 3S14C 1TWGK 4G7ZA 2R92K 4A3DK 3S1MK 3RZDC 5M5WK 4QJVB 4A3CK 3M4OC 1K83C 4OIPA 1BDFA 4G7HA 2O5JA 4XSXA 4KN7A 5C3EK 5C4XK 2B63K 3HOVC 4OIQA 3HOXK 3HOYK 4G7OA 2NVXK 5IP9C 3S16C 5C44K 3M3YC 4Q5SA 3HOWC 3S1RK 4XSZA 4KMUA 5M3FK 4MQ9A 3I4MC 1I3QK 4BY1C 2JA7C 4A93C 4Y52K 4BXXC 1Y1VC 2PMZL 1YNNA 3GTKC 3S1QK 4LK0A 3I4NK 3S2DK 2PPBA 3EQLA 4YG2A 3GTLK 3PO3K 2R93C 4QIWD 5FLMK 4A3EK 3GTGC 3H3VL 2WB1L 3S15K 1TWGC 4BBSK 1Y1WK 4A3LK 2R92C 3RZDK 5IP7K 4C3JK 4A3CC 3HOYC 3RZOC 4BY7C 3S14K 3FKIK 1TWHK 4QIWL 4XLNA 4A3FC 4C3IK 1SFOK 3GTMC 4A3GC 4Y52C 1TWAC 5IYCC 3GTJK 4GZYA 3K7AC 2R7ZC 3GTOK 1Y1VK 1TWCC 3S1QC 3GTKK 2NVQC 3I4NC 3DXJA 2B63C 5IYDK 3HOXC 2NVXC 5C44C 3M3YK 2E2HK 3GTPK 1I6HK 4AYBL 5M5YK 2PMZD 3H0GC 5TMFA 2JA8K 4BBSC 3PO2K 1XPPA 2O5IA 5IP7C 3S17C 2NVYC 2A68A 4QJVA 4C2MK 3HOZK 3S2DC 2WB1D 3PO3C 1IW7A 3WODA 1I50K 5FJ8K 4LK1A 5FLMC 2NVTK 1TWHC 1WCMK 1TWFK 1Y1WC 4A3LC 4ZH4A 3S2HC 4AYBD 1TWAK 4A3KK 5IYCK 4YFKA 3GTJC 2E2IC 3K7AK 3HOUC 2R7ZK 3GTOC 1TWCK 4LJZA 3HKZL 4C3HK 4YFXA 2NVQK 3GTQC 3H3VD 4MEXA 4YFNA
chains in the Genus database with same CATH superfamily
4A3FK 4BBRC 4A3GK 3AD8C 3H0GK 1I6VA 2Y0SD 1R9TA 1HI9A 1XZPB 4MEYA 4OIOA 4A3IK 1WOOA 2JA6K 3Q3QA 1PJ7A 5D4DA 2CW0A 2JA5K 3VA7A 2VUMA 1GE9A 1WCMC 3G4CA 4BBRK 1WQGA 3HOWK 4XLPA 4Y7NK 1ZVUA 1YCLA 4KDDA 2JA6C 4FM9A 4P5BA 2R93K 1BS2A 4A3MC 3S1RC 1WSVA 2WAQL 1I3QC 3AH5A 4BY1K 1O27A 3TFIA 3BP8C 1VRQC 4KN4A 3OREA 1I50A 4GTLA 3RZOK 4PAAA 1EK8A 4WILA 3RZDC 4KASA 1BDFA 5TJ3A 4C45A 4XSXA 4KB4A 5C4XK 2B63K 1BGWA 2NVXK 2ZFZA 3S1RK 4KMUA 1TWAA 1I3QK 4BY1C 4GTCA 4LK0A 3GTLK 1Y1WK 1L0WA 4AH6A 3AQOA 4BY7C 1O26A 3S14K 3FKIK 1TWHK 3GDZA 1USOA 3GTOK 1Y1VK 3I4NC 4P5AA 2KWAA 5L46A 5C44C 1I6HK 1WORA 5M5YK 1XXAA 4BBSC 4GTBA 1IBAA 2A68A 4WJ4A 3PO3C 3T00A 1I50K 2NVTK 3OEPA 1IS1A 4KATA 1TWHC 3SZZA 1TWFK 2NVYA 3HKZL 3V4GA 1XZPA 5JVOA 4WJ3M 4GTAA 4YFNA 5IYBK 2GSOA 5EGHA 2E2HC 3TFHA 1IQ0A 4Y7NC 1O24A 2WAQD 2NVYK 4A3JK 1X31C 3GTQA 2XCQA 1DCOA 1ZQ1C 1XXCA 3ADAC 4A3BK 3NUHA 1TWFC 2PA8L 2V6SA 3GTQK 2A69A 1UV7A 5C4XC 1TWHA 3LAJA 3HOVK 1SMYA 3L4KA 1WIHA 2P5MA 5JFEA 4BKWA 3N0BA 4GT9A 1ZYRA 4A3JC 4KMAA 1Y1VA 4KM8A 3TFJA 2GAGC 5IOQA 1R9TC 4A3BC 1VJEA 1TWCA 3CQZK 3FOFA 4OIRA 3A8JA 1KQ4A 5IOSA 2Y0SL 3T02A 4OINA 4ILDA 2FQOA 1TWGK 4G7ZA 5M5WK 1K83C 1C0AA 4KN7A 5C3EK 2RH6A 5IP9C 3S16C 5C44K 4Q5SA 1I3QA 4XSZA 5M3FK 2NVXA 1USMA 1O2AA 1Y1VC 1YNNA 3GSIA 3I4NK 4GTFA 3PO3K 4QIWD 3T01A 1TWGC 4BBSK 5IP7K 4M1XA 2P8TA 5EGEA 3HOYC 3OPFA 4QIWL 4A3FC 4C3IK 4A3GC 3JSTA 1SFOA 2R93A 2JH3A 3DXJA 4KAWX 1BJTA 2E2HK 4AYBL 2PMZD 2O5IA 5IP7C 1ZBSA 2NVYC 1WOPA 4QJVA 4C2MK 2WB1D 5FLMC 1TWGA 3WODA 4LK1A 5FJ8K 1WCMK 4C3IC 4ZH4A 4YFKA 2E2IC 3ERED 2D6FC 3GTQC 2NVQK 2JA7A 2EBBA 3H0GA 2ZUFA 3GTPC 1R9TK 1EQRA 4A3MK 1SFOC 3GTMK 3MMLB 5C4JC 2GSNA 1O28A 5IYDC 3AD7C 1F7UA 5M5XK 3CQZC 4XCHA 3GEEA 4X6AK 4JK1A 2E2IK 4KC6A 3S1NK 1K83K 4KB2A 4C3HC 5C3EC 5IORA 2RGRA 5HL8A 3AQPA 5C4JK 1F9NA 3M4OK 4G0UA 4P9SA 2E2HA 1V5VA 3GTLC 1AB4A 3GTKA 5TMCA 4G0WA 1DD5A 3I4MK 2V6UA 3HKZD 4X6AC 1B4AA 4BXXK 2A6EA 3S1NC 1O29A 4G0VA 1EFWA 2JA5C 2VUMC 1TWFA 4BY7K 3GTOA 4RMFA 3GTGK 2PA8D 3S14C 3A8IA 2W7VA 2XCRB 4A3DK 1WSRA 1J6WA 3M4OC 4OIPA 2O5JA 3IPJA 3HOYK 4G7OA 1XZQB 2B63A 3S0XA 3HOWC 3I4MC 3GTMA 4A93C 3FOEA 4BXXC 3GTLA 4C2MC 3TTGA 2GAHC 1WQFA 5FLMK 4A3EK 3GTGC 3LAPA 1K83A 1Y1WA 1INNA 3RZOC 1IL2A 4Y52C 1TWAC 1JOEA 4GZYA 3K7AC 3S1QC 1YX2A 5CHPA 2NVQC 2B63C 5IYDK 3HOXC 1XXBA 2NVXC 3M3YK 4KARA 3GTPK 5TMFA 2ZUEA 4LR2A 2R7ZA 3S2DC 4GTEA 1WQHA 2XCOA 3BUEA 4A3LC 4A3KK 1TWAK 2V6TA 5IYCK 3GTJC 3K7AK 4LJZA 4C3HK 4YFXA 4KM9A 3L4JA 4MEXA 2CFAA 3LPXA 4KMDA 4NOIA 3PO2C 2FQTA 5IOTA 2CFAB 1VGXA 1HQMA 4Q4ZA 2JA6A 1J6VA 2VUMK 1I6HC 2GSUA 2JA8C 4KMHA 3S2HK 2E2JK 2YU9K 1EH1A 4A3KC 2E2IA 1JQWA 3S17K 3HOUK 1EI6A 3HOZC 4LLGA 3N0CA 3BP3A 1I50C 2NVTC 5IP9K 3S16K 4A3DC 3S1MC 1VH2A 3G4AA 1YNJA 4O2DA 1PJ5A 3A8KA 3GTPA 4GTDA 5M3MK 2BE5A 5E68A 5IYBC 4A3EC 1RU0A 2A6HA 2JA7K 2E2JC 2YU9C 4A93K 3FKIA 1O2FB 4FZBA 4A3IC 1O2BA 3S15C 3SZYA 1O25A 1G51A 1F93A 2R92K 3S1MK 4QJVB 4C3JC 4A3CK 4G7HA 1IE0A 3GEHA 4OIQA 3HOXK 3HOVC 3GTGA 3GEIA 3M3YC 4PABA 2PHCB 4Y52K 4MQ9A 1ZXOA 2JA7C 2PMZL 1WCMA 1DCPA 3GTKC 3S1QK 4J3NA 3S2DK 4GFQA 3EQLA 4YG2A 2PPBA 2R93C 3GTJA 3AD9C 3H3VL 3S15K 2WB1L 1PJ6A 4A3LK 1B4BA 2R92C 3RZDK 1F7VA 4C3JK 4A3CC 3CQZA 4BLBA 1J6XA 4XLNA 1J98A 1SFOK 3GTMC 5IYCC 3GTJK 2R7ZC 4LQYA 4BLAA 1TWCC 3GTKK 1WOSA 4LOWA 3FHZA 5CJ9A 3QX3A 2Y3PA 2JA8K 3H0GC 1DCHA 1XZQA 3PO2K 1XPPA 1ISEA 3GIRA 3S17C 3HOZK 1IW7A 2R92A 1Y1WC 3N3YA 3S2HC 4AYBD 4DDQA 2JA5A 1JVIA 3CAGA 3HOUC 3GTOC 2R7ZK 1TWCK 3H3VD 1VLOA 2YU9A 3HXAA 3FKIC
chains in the Genus database with same CATH topology
5IYBK 4A3FK 2E2HC 1R9TK 4BBRC 3GTPC 4A3MK 1SFOC 3GTMK 4A3GK 4NOIA 3H0GK 5C4JC 4Y7NC 3PO2C 1I6VA 2Y0SD 4MEYA 2WAQD 2NVYK 4OIOA 4A3IK 4A3JK 2JA6K 5D4DA 1HQMA 2CW0A 5IYDC 4Q4ZA 2JA5K 2VUMK 5M5XK 1I6HC 4A3BK 3CQZC 2JA8C 1TWFC 3S2HK 2E2JK 2YU9K 4A3KC 4X6AK 4JK1A 2E2IK 3S17K 3HOUK 2PA8L 1K83K 3S1NK 3HOZC 4LLGA 3GTQK 2A69A 5C3EC 5C4XC 3HOVK 1I50C 1SMYA 2NVTC 5IP9K 3S16K 1WCMC 4BBRK 3HOWK 4A3DC 3S1MC 5C4JK 1YNJA 4XLPA 4Y7NK 3M4OK 1ZYRA 4A3JC 2JA6C 5M3MK 3GTLC 2BE5A 5TMCA 2R93K 5IYBC 4A3EC 1R9TC 4A3BC 4A3MC 3CQZK 2A6HA 3S1RC 3I4MK 2WAQL 1I3QC 3HKZD 2E2JC 2YU9C 4BY1K 4OIRA 2JA7K 4A93K 4BXXK 4X6AC 2A6EA 3S1NC 4A3IC 4KN4A 3FKIC 2Y0SL 2JA5C 2VUMC 4OINA 3RZOK 4BY7K 3GTGK 3S15C 2PA8D 3S14C 1TWGK 4G7ZA 2R92K 4A3DK 3S1MK 3RZDC 5M5WK 4QJVB 4A3CK 3M4OC 1K83C 4OIPA 1BDFA 4G7HA 2O5JA 4XSXA 4KN7A 5C3EK 5C4XK 2B63K 3HOVC 4OIQA 3HOXK 3HOYK 4G7OA 2NVXK 5IP9C 3S16C 5C44K 3M3YC 4Q5SA 3HOWC 3S1RK 4XSZA 4KMUA 5M3FK 4MQ9A 3I4MC 1I3QK 4BY1C 2JA7C 4A93C 4Y52K 4BXXC 1Y1VC 2PMZL 1YNNA 3GTKC 3S1QK 4LK0A 3I4NK 3S2DK 2PPBA 3EQLA 4YG2A 3GTLK 3PO3K 2R93C 4QIWD 5FLMK 4A3EK 3GTGC 3H3VL 2WB1L 3S15K 1TWGC 4BBSK 1Y1WK 4A3LK 2R92C 3RZDK 5IP7K 4C3JK 4A3CC 3HOYC 3RZOC 4BY7C 3S14K 3FKIK 1TWHK 4QIWL 4XLNA 4A3FC 4C3IK 1SFOK 3GTMC 4A3GC 4Y52C 1TWAC 5IYCC 3GTJK 4GZYA 3K7AC 2R7ZC 3GTOK 1Y1VK 1TWCC 3S1QC 3GTKK 2NVQC 3I4NC 3DXJA 2B63C 5IYDK 3HOXC 2NVXC 5C44C 3M3YK 2E2HK 3GTPK 1I6HK 4AYBL 5M5YK 2PMZD 3H0GC 5TMFA 2JA8K 4BBSC 3PO2K 1XPPA 2O5IA 5IP7C 3S17C 2NVYC 2A68A 4QJVA 4C2MK 3HOZK 3S2DC 2WB1D 3PO3C 1IW7A 3WODA 1I50K 5FJ8K 4LK1A 5FLMC 2NVTK 1TWHC 1WCMK 1TWFK 1Y1WC 4A3LC 4ZH4A 3S2HC 4AYBD 1TWAK 4A3KK 5IYCK 4YFKA 3GTJC 2E2IC 3K7AK 3HOUC 2R7ZK 3GTOC 1TWCK 4LJZA 3HKZL 4C3HK 4YFXA 2NVQK 3GTQC 3H3VD 4MEXA 4YFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB K;  4A3F K;  2E2H C;  1R9T K;  4BBR C;  3GTP C;  4A3M K;  1SFO C;  3GTM K;  4A3G K;  4NOI A;  3H0G K;  5C4J C;  4Y7N C;  3PO2 C;  1I6V A;  2Y0S D;  4MEY A;  2WAQ D;  2NVY K;  4OIO A;  4A3I K;  4A3J K;  2JA6 K;  5D4D A;  1HQM A;  2CW0 A;  5IYD C;  4Q4Z A;  2JA5 K;  2VUM K;  5M5X K;  1I6H C;  4A3B K;  3CQZ C;  2JA8 C;  1TWF C;  3S2H K;  2E2J K;  2YU9 K;  4A3K C;  4X6A K;  4JK1 A;  2E2I K;  3S17 K;  3HOU K;  2PA8 L;  1K83 K;  3S1N K;  3HOZ C;  4LLG A;  3GTQ K;  2A69 A;  5C3E C;  5C4X C;  3HOV K;  1I50 C;  1SMY A;  2NVT C;  5IP9 K;  3S16 K;  1WCM C;  4BBR K;  3HOW K;  4A3D C;  3S1M C;  5C4J K;  1YNJ A;  4XLP A;  4Y7N K;  3M4O K;  1ZYR A;  4A3J C;  2JA6 C;  5M3M K;  3GTL C;  2BE5 A;  5TMC A;  2R93 K;  5IYB C;  4A3E C;  1R9T C;  4A3B C;  4A3M C;  3CQZ K;  2A6H A;  3S1R C;  3I4M K;  2WAQ L;  1I3Q C;  3HKZ D;  2E2J C;  2YU9 C;  4BY1 K;  4OIR A;  2JA7 K;  4A93 K;  4BXX K;  4X6A C;  2A6E A;  3S1N C;  4A3I C;  4KN4 A;  3FKI C;  2Y0S L;  2JA5 C;  2VUM C;  4OIN A;  3RZO K;  4BY7 K;  3GTG K;  3S15 C;  2PA8 D;  3S14 C;  1TWG K;  4G7Z A;  2R92 K;  4A3D K;  3S1M K;  3RZD C;  5M5W K;  4QJV B;  4A3C K;  3M4O C;  1K83 C;  4OIP A;  1BDF A;  4G7H A;  2O5J A;  4XSX A;  4KN7 A;  5C3E K;  5C4X K;  2B63 K;  3HOV C;  4OIQ A;  3HOX K;  3HOY K;  4G7O A;  2NVX K;  5IP9 C;  3S16 C;  5C44 K;  3M3Y C;  4Q5S A;  3HOW C;  3S1R K;  4XSZ A;  4KMU A;  5M3F K;  4MQ9 A;  3I4M C;  1I3Q K;  4BY1 C;  2JA7 C;  4A93 C;  4Y52 K;  4BXX C;  1Y1V C;  2PMZ L;  1YNN A;  3GTK C;  3S1Q K;  4LK0 A;  3I4N K;  3S2D K;  2PPB A;  3EQL A;  4YG2 A;  3GTL K;  3PO3 K;  2R93 C;  4QIW D;  5FLM K;  4A3E K;  3GTG C;  3H3V L;  2WB1 L;  3S15 K;  1TWG C;  4BBS K;  1Y1W K;  4A3L K;  2R92 C;  3RZD K;  5IP7 K;  4C3J K;  4A3C C;  3HOY C;  3RZO C;  4BY7 C;  3S14 K;  3FKI K;  1TWH K;  4QIW L;  4XLN A;  4A3F C;  4C3I K;  1SFO K;  3GTM C;  4A3G C;  4Y52 C;  1TWA C;  5IYC C;  3GTJ K;  4GZY A;  3K7A C;  2R7Z C;  3GTO K;  1Y1V K;  1TWC C;  3S1Q C;  3GTK K;  2NVQ C;  3I4N C;  3DXJ A;  2B63 C;  5IYD K;  3HOX C;  2NVX C;  5C44 C;  3M3Y K;  2E2H K;  3GTP K;  1I6H K;  4AYB L;  5M5Y K;  2PMZ D;  3H0G C;  5TMF A;  2JA8 K;  4BBS C;  3PO2 K;  1XPP A;  2O5I A;  5IP7 C;  3S17 C;  2NVY C;  2A68 A;  4QJV A;  4C2M K;  3HOZ K;  3S2D C;  2WB1 D;  3PO3 C;  1IW7 A;  3WOD A;  1I50 K;  5FJ8 K;  4LK1 A;  5FLM C;  2NVT K;  1TWH C;  1WCM K;  1TWF K;  1Y1W C;  4A3L C;  4ZH4 A;  3S2H C;  4AYB D;  1TWA K;  4A3K K;  5IYC K;  4YFK A;  3GTJ C;  2E2I C;  3K7A K;  3HOU C;  2R7Z K;  3GTO C;  1TWC K;  4LJZ A;  3HKZ L;  4C3H K;  4YFX A;  2NVQ K;  3GTQ C;  3H3V D;  4MEX A;  4YFN A; 
#chains in the Genus database with same CATH topology
 4A3F K;  4BBR C;  4A3G K;  3AD8 C;  3H0G K;  1I6V A;  2Y0S D;  1R9T A;  1HI9 A;  1XZP B;  4MEY A;  4OIO A;  4A3I K;  1WOO A;  2JA6 K;  3Q3Q A;  1PJ7 A;  5D4D A;  2CW0 A;  2JA5 K;  3VA7 A;  2VUM A;  1GE9 A;  1WCM C;  3G4C A;  4BBR K;  1WQG A;  3HOW K;  4XLP A;  4Y7N K;  1ZVU A;  1YCL A;  4KDD A;  2JA6 C;  4FM9 A;  4P5B A;  2R93 K;  1BS2 A;  4A3M C;  3S1R C;  1WSV A;  2WAQ L;  1I3Q C;  3AH5 A;  4BY1 K;  1O27 A;  3TFI A;  3BP8 C;  1VRQ C;  4KN4 A;  3ORE A;  1I50 A;  4GTL A;  3RZO K;  4PAA A;  1EK8 A;  4WIL A;  3RZD C;  4KAS A;  1BDF A;  5TJ3 A;  4C45 A;  4XSX A;  4KB4 A;  5C4X K;  2B63 K;  1BGW A;  2NVX K;  2ZFZ A;  3S1R K;  4KMU A;  1TWA A;  1I3Q K;  4BY1 C;  4GTC A;  4LK0 A;  3GTL K;  1Y1W K;  1L0W A;  4AH6 A;  3AQO A;  4BY7 C;  1O26 A;  3S14 K;  3FKI K;  1TWH K;  3GDZ A;  1USO A;  3GTO K;  1Y1V K;  3I4N C;  4P5A A;  2KWA A;  5L46 A;  5C44 C;  1I6H K;  1WOR A;  5M5Y K;  1XXA A;  4BBS C;  4GTB A;  1IBA A;  2A68 A;  4WJ4 A;  3PO3 C;  3T00 A;  1I50 K;  2NVT K;  3OEP A;  1IS1 A;  4KAT A;  1TWH C;  3SZZ A;  1TWF K;  2NVY A;  3HKZ L;  3V4G A;  1XZP A;  5JVO A;  4WJ3 M;  4GTA A;  4YFN A;  5IYB K;  2GSO A;  5EGH A;  2E2H C;  3TFH A;  1IQ0 A;  4Y7N C;  1O24 A;  2WAQ D;  2NVY K;  4A3J K;  1X31 C;  3GTQ A;  2XCQ A;  1DCO A;  1ZQ1 C;  1XXC A;  3ADA C;  4A3B K;  3NUH A;  1TWF C;  2PA8 L;  2V6S A;  3GTQ K;  2A69 A;  1UV7 A;  5C4X C;  1TWH A;  3LAJ A;  3HOV K;  1SMY A;  3L4K A;  1WIH A;  2P5M A;  5JFE A;  4BKW A;  3N0B A;  4GT9 A;  1ZYR A;  4A3J C;  4KMA A;  1Y1V A;  4KM8 A;  3TFJ A;  2GAG C;  5IOQ A;  1R9T C;  4A3B C;  1VJE A;  1TWC A;  3CQZ K;  3FOF A;  4OIR A;  3A8J A;  1KQ4 A;  5IOS A;  2Y0S L;  3T02 A;  4OIN A;  4ILD A;  2FQO A;  1TWG K;  4G7Z A;  5M5W K;  1K83 C;  1C0A A;  4KN7 A;  5C3E K;  2RH6 A;  5IP9 C;  3S16 C;  5C44 K;  4Q5S A;  1I3Q A;  4XSZ A;  5M3F K;  2NVX A;  1USM A;  1O2A A;  1Y1V C;  1YNN A;  3GSI A;  3I4N K;  4GTF A;  3PO3 K;  4QIW D;  3T01 A;  1TWG C;  4BBS K;  5IP7 K;  4M1X A;  2P8T A;  5EGE A;  3HOY C;  3OPF A;  4QIW L;  4A3F C;  4C3I K;  4A3G C;  3JST A;  1SFO A;  2R93 A;  2JH3 A;  3DXJ A;  4KAW X;  1BJT A;  2E2H K;  4AYB L;  2PMZ D;  2O5I A;  5IP7 C;  1ZBS A;  2NVY C;  1WOP A;  4QJV A;  4C2M K;  2WB1 D;  5FLM C;  1TWG A;  3WOD A;  4LK1 A;  5FJ8 K;  1WCM K;  4C3I C;  4ZH4 A;  4YFK A;  2E2I C;  3ERE D;  2D6F C;  3GTQ C;  2NVQ K;  2JA7 A;  2EBB A;  3H0G A;  2ZUF A;  3GTP C;  1R9T K;  1EQR A;  4A3M K;  1SFO C;  3GTM K;  3MML B;  5C4J C;  2GSN A;  1O28 A;  5IYD C;  3AD7 C;  1F7U A;  5M5X K;  3CQZ C;  4XCH A;  3GEE A;  4X6A K;  4JK1 A;  2E2I K;  4KC6 A;  3S1N K;  1K83 K;  4KB2 A;  4C3H C;  5C3E C;  5IOR A;  2RGR A;  5HL8 A;  3AQP A;  5C4J K;  1F9N A;  3M4O K;  4G0U A;  4P9S A;  2E2H A;  1V5V A;  3GTL C;  1AB4 A;  3GTK A;  5TMC A;  4G0W A;  1DD5 A;  3I4M K;  2V6U A;  3HKZ D;  4X6A C;  1B4A A;  4BXX K;  2A6E A;  3S1N C;  1O29 A;  4G0V A;  1EFW A;  2JA5 C;  2VUM C;  1TWF A;  4BY7 K;  3GTO A;  4RMF A;  3GTG K;  2PA8 D;  3S14 C;  3A8I A;  2W7V A;  2XCR B;  4A3D K;  1WSR A;  1J6W A;  3M4O C;  4OIP A;  2O5J A;  3IPJ A;  3HOY K;  4G7O A;  1XZQ B;  2B63 A;  3S0X A;  3HOW C;  3I4M C;  3GTM A;  4A93 C;  3FOE A;  4BXX C;  3GTL A;  4C2M C;  3TTG A;  2GAH C;  1WQF A;  5FLM K;  4A3E K;  3GTG C;  3LAP A;  1K83 A;  1Y1W A;  1INN A;  3RZO C;  1IL2 A;  4Y52 C;  1TWA C;  1JOE A;  4GZY A;  3K7A C;  3S1Q C;  1YX2 A;  5CHP A;  2NVQ C;  2B63 C;  5IYD K;  3HOX C;  1XXB A;  2NVX C;  3M3Y K;  4KAR A;  3GTP K;  5TMF A;  2ZUE A;  4LR2 A;  2R7Z A;  3S2D C;  4GTE A;  1WQH A;  2XCO A;  3BUE A;  4A3L C;  4A3K K;  1TWA K;  2V6T A;  5IYC K;  3GTJ C;  3K7A K;  4LJZ A;  4C3H K;  4YFX A;  4KM9 A;  3L4J A;  4MEX A;  2CFA A;  3LPX A;  4KMD A;  4NOI A;  3PO2 C;  2FQT A;  5IOT A;  2CFA B;  1VGX A;  1HQM A;  4Q4Z A;  2JA6 A;  1J6V A;  2VUM K;  1I6H C;  2GSU A;  2JA8 C;  4KMH A;  3S2H K;  2E2J K;  2YU9 K;  1EH1 A;  4A3K C;  2E2I A;  1JQW A;  3S17 K;  3HOU K;  1EI6 A;  3HOZ C;  4LLG A;  3N0C A;  3BP3 A;  1I50 C;  2NVT C;  5IP9 K;  3S16 K;  4A3D C;  3S1M C;  1VH2 A;  3G4A A;  1YNJ A;  4O2D A;  1PJ5 A;  3A8K A;  3GTP A;  4GTD A;  5M3M K;  2BE5 A;  5E68 A;  5IYB C;  4A3E C;  1RU0 A;  2A6H A;  2JA7 K;  2E2J C;  2YU9 C;  4A93 K;  3FKI A;  1O2F B;  4FZB A;  4A3I C;  1O2B A;  3S15 C;  3SZY A;  1O25 A;  1G51 A;  1F93 A;  2R92 K;  3S1M K;  4QJV B;  4C3J C;  4A3C K;  4G7H A;  1IE0 A;  3GEH A;  4OIQ A;  3HOX K;  3HOV C;  3GTG A;  3GEI A;  3M3Y C;  4PAB A;  2PHC B;  4Y52 K;  4MQ9 A;  1ZXO A;  2JA7 C;  2PMZ L;  1WCM A;  1DCP A;  3GTK C;  3S1Q K;  4J3N A;  3S2D K;  4GFQ A;  3EQL A;  4YG2 A;  2PPB A;  2R93 C;  3GTJ A;  3AD9 C;  3H3V L;  3S15 K;  2WB1 L;  1PJ6 A;  4A3L K;  1B4B A;  2R92 C;  3RZD K;  1F7V A;  4C3J K;  4A3C C;  3CQZ A;  4BLB A;  1J6X A;  4XLN A;  1J98 A;  1SFO K;  3GTM C;  5IYC C;  3GTJ K;  2R7Z C;  4LQY A;  4BLA A;  1TWC C;  3GTK K;  1WOS A;  4LOW A;  3FHZ A;  5CJ9 A;  3QX3 A;  2Y3P A;  2JA8 K;  3H0G C;  1DCH A;  1XZQ A;  3PO2 K;  1XPP A;  1ISE A;  3GIR A;  3S17 C;  3HOZ K;  1IW7 A;  2R92 A;  1Y1W C;  3N3Y A;  3S2H C;  4AYB D;  4DDQ A;  2JA5 A;  1JVI A;  3CAG A;  3HOU C;  3GTO C;  2R7Z K;  1TWC K;  3H3V D;  1VLO A;  2YU9 A;  3HXA A;  3FKI C; 
#chains in the Genus database with same CATH homology
 5IYB K;  4A3F K;  2E2H C;  1R9T K;  4BBR C;  3GTP C;  4A3M K;  1SFO C;  3GTM K;  4A3G K;  4NOI A;  3H0G K;  5C4J C;  4Y7N C;  3PO2 C;  1I6V A;  2Y0S D;  4MEY A;  2WAQ D;  2NVY K;  4OIO A;  4A3I K;  4A3J K;  2JA6 K;  5D4D A;  1HQM A;  2CW0 A;  5IYD C;  4Q4Z A;  2JA5 K;  2VUM K;  5M5X K;  1I6H C;  4A3B K;  3CQZ C;  2JA8 C;  1TWF C;  3S2H K;  2E2J K;  2YU9 K;  4A3K C;  4X6A K;  4JK1 A;  2E2I K;  3S17 K;  3HOU K;  2PA8 L;  1K83 K;  3S1N K;  3HOZ C;  4LLG A;  3GTQ K;  2A69 A;  5C3E C;  5C4X C;  3HOV K;  1I50 C;  1SMY A;  2NVT C;  5IP9 K;  3S16 K;  1WCM C;  4BBR K;  3HOW K;  4A3D C;  3S1M C;  5C4J K;  1YNJ A;  4XLP A;  4Y7N K;  3M4O K;  1ZYR A;  4A3J C;  2JA6 C;  5M3M K;  3GTL C;  2BE5 A;  5TMC A;  2R93 K;  5IYB C;  4A3E C;  1R9T C;  4A3B C;  4A3M C;  3CQZ K;  2A6H A;  3S1R C;  3I4M K;  2WAQ L;  1I3Q C;  3HKZ D;  2E2J C;  2YU9 C;  4BY1 K;  4OIR A;  2JA7 K;  4A93 K;  4BXX K;  4X6A C;  2A6E A;  3S1N C;  4A3I C;  4KN4 A;  3FKI C;  2Y0S L;  2JA5 C;  2VUM C;  4OIN A;  3RZO K;  4BY7 K;  3GTG K;  3S15 C;  2PA8 D;  3S14 C;  1TWG K;  4G7Z A;  2R92 K;  4A3D K;  3S1M K;  3RZD C;  5M5W K;  4QJV B;  4A3C K;  3M4O C;  1K83 C;  4OIP A;  1BDF A;  4G7H A;  2O5J A;  4XSX A;  4KN7 A;  5C3E K;  5C4X K;  2B63 K;  3HOV C;  4OIQ A;  3HOX K;  3HOY K;  4G7O A;  2NVX K;  5IP9 C;  3S16 C;  5C44 K;  3M3Y C;  4Q5S A;  3HOW C;  3S1R K;  4XSZ A;  4KMU A;  5M3F K;  4MQ9 A;  3I4M C;  1I3Q K;  4BY1 C;  2JA7 C;  4A93 C;  4Y52 K;  4BXX C;  1Y1V C;  2PMZ L;  1YNN A;  3GTK C;  3S1Q K;  4LK0 A;  3I4N K;  3S2D K;  2PPB A;  3EQL A;  4YG2 A;  3GTL K;  3PO3 K;  2R93 C;  4QIW D;  5FLM K;  4A3E K;  3GTG C;  3H3V L;  2WB1 L;  3S15 K;  1TWG C;  4BBS K;  1Y1W K;  4A3L K;  2R92 C;  3RZD K;  5IP7 K;  4C3J K;  4A3C C;  3HOY C;  3RZO C;  4BY7 C;  3S14 K;  3FKI K;  1TWH K;  4QIW L;  4XLN A;  4A3F C;  4C3I K;  1SFO K;  3GTM C;  4A3G C;  4Y52 C;  1TWA C;  5IYC C;  3GTJ K;  4GZY A;  3K7A C;  2R7Z C;  3GTO K;  1Y1V K;  1TWC C;  3S1Q C;  3GTK K;  2NVQ C;  3I4N C;  3DXJ A;  2B63 C;  5IYD K;  3HOX C;  2NVX C;  5C44 C;  3M3Y K;  2E2H K;  3GTP K;  1I6H K;  4AYB L;  5M5Y K;  2PMZ D;  3H0G C;  5TMF A;  2JA8 K;  4BBS C;  3PO2 K;  1XPP A;  2O5I A;  5IP7 C;  3S17 C;  2NVY C;  2A68 A;  4QJV A;  4C2M K;  3HOZ K;  3S2D C;  2WB1 D;  3PO3 C;  1IW7 A;  3WOD A;  1I50 K;  5FJ8 K;  4LK1 A;  5FLM C;  2NVT K;  1TWH C;  1WCM K;  1TWF K;  1Y1W C;  4A3L C;  4ZH4 A;  3S2H C;  4AYB D;  1TWA K;  4A3K K;  5IYC K;  4YFK A;  3GTJ C;  2E2I C;  3K7A K;  3HOU C;  2R7Z K;  3GTO C;  1TWC K;  4LJZ A;  3HKZ L;  4C3H K;  4YFX A;  2NVQ K;  3GTQ C;  3H3V D;  4MEX A;  4YFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...