3S17K

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s17K00
1TWFC 2JA6K 4A3KK 3GTLC 1WCMC 3RZDK 5IYDK 3S2HK 4BBSC 2JA8C 4A3MK 4MEXA 2NVQC 4A3BK 4X6AC 5IP9C 5IYCC 2E2IK 4A3CC 1ZYRA 3S2DC 3S17K 4A93K 1TWGC 3S1MC 1YNNA 5M5WK 2NVXK 4A3JC 3I4MK 3S1RC 4BXXK 4LK1A 3M4OC 4Y52C 4A3IC 3GTJC 4A3DK 4XSXA 5IP7K 3HOWK 3GTGC 3H0GK 5M5YK 2R92C 3HOUC 3GTPC 2E2JC 3PO2C 1Y1WK 1Y1VC 3M3YC 3HOXC 1HQMA 1TWCK 5TMCA 3S1RK 3S15K 4YFXA 2A6EA 2JA6C 1TWHK 3CQZC 1WCMK 3S1NC 5FLMC 3HOVC 1I3QK 5IYBK 2B63K 1I50K 2JA8K 3HOYC 4OIPA 4A3MC 2E2HC 2YU9C 1TWAC 3GTMC 1R9TC 2JA5C 4QJVB 4G7HA 4A3JK 3GTKC 2O5JA 4C3HK 4LJZA 3K7AC 4X6AK 3S2HC 4BBSK 5M3FK 2VUMC 3S2DK 3M4OK 4A3GC 2PA8L 4GZYA 1I6HC 2JA7K 2NVQK 2CW0A 4OIOA 4LLGA 5IP9K 2WAQL 1BDFA 1SMYA 5C4XK 5C3EC 2E2IC 2NVTC 3GTGK 4G7OA 4A93C 4A3EK 1TWGK 5FJ8K 2NVXC 2R7ZK 4BXXC 3S14K 2WB1D 4Q5SA 4XLNA 1Y1VK 4XLPA 4OINA 3H3VL 3M3YK 3S1QK 4BY7C 3I4NK 3GTJK 4C2MK 3S15C 1YNJA 3S16K 2WAQD 1TWHC 4Y7NK 2R92K 3HOUK 3EQLA 3PO3K 4AYBL 2BE5A 5IYBC 5C44C 4BY1K 3GTQK 4KMUA 2NVYC 1R9TK 4A3FC 2A68A 4G7ZA 5C4JC 2PMZL 3CQZK 4LK0A 1SFOC 1XPPA 2A69A 4QIWD 3GTKK 1K83K 1IW7A 1I6VA 2PPBA 3HOVK 2VUMK 3HOZC 4A3KC 4A3GK 3RZDC 4A3LK 2JA7C 4YFNA 4BBRC 3FKIC 3GTMK 5C3EK 2NVTK 2JA5K 3GTOK 2R93C 5IYCK 4A3CK 2R93K 5M3MK 3K7AK 1TWFK 3WODA 4BY7K 4MEYA 3GTLK 4A3LC 1I6HK 4QIWL 5IYDC 4AYBD 5TMFA 2PMZD 3DXJA 2Y0SD 3S16C 5C4XC 4NOIA 4OIQA 4A3EC 4A3BC 3PO3C 4JK1A 5IP7C 2R7ZC 3HOWC 4XSZA 4OIRA 4KN7A 5D4DA 3S14C 3H3VD 4MQ9A 4YG2A 3S17C 3GTPK 4KN4A 3S1MK 4C3IK 3I4MC 3S1QC 2E2JK 3PO2K 3I4NC 4A3FK 1Y1WC 4Y52K 4Y7NC 4A3IK 1K83C 4A3DC 5M5XK 3HOZK 2WB1L 4YFKA 3H0GC 5C44K 5FLMK 4BY1C 4QJVA 4BBRK 4ZH4A 3GTQC 1I3QC 3FKIK 2B63C 3RZOK 1I50C 2NVYK 4Q4ZA 2PA8D 3HKZD 4C3JK 2O5IA 3HOYK 3GTOC 2E2HK 5C4JK 2YU9K 3HOXK 1SFOK 1TWAK 3RZOC 3S1NK 2A6HA 1TWCC 3HKZL 2Y0SL
chains in the Genus database with same CATH superfamily
3OEPA 4BLBA 2JA6K 2JA5A 3TFIA 4PABA 5IYDK 2NVQC 1J6VA 2E2IK 5IYCC 3S2DC 3S17K 4A93K 3I4MK 2NVYA 1IE0A 3M4OC 3A8IA 3GTGC 5M5YK 1GE9A 3G4AA 3GEHA 1HQMA 1TWCK 3S1RK 3A8JA 1TWHK 1J6XA 4J3NA 2YU9A 1I3QK 4KMAA 1O27A 2E2HC 3BUEA 1IQ0A 1WOPA 4A3JK 4X6AK 4C3HK 1KQ4A 1JVIA 1JOEA 4A3GC 2GAHC 2JA7K 1WOOA 4OIOA 2E2IC 5C4XK 3A8KA 4G7OA 1DCHA 3GTGK 5FJ8K 2JA6A 4BXXC 2WB1D 4XLNA 4BY7C 1XXAA 3S1QK 4GTDA 4LQYA 1B4AA 3N0BA 3EQLA 1BGWA 4AYBL 3L4JA 1F93A 5C44C 4C3IC 1RU0A 5IOTA 4G7ZA 5C4JC 2PHCB 1SFOC 1BS2A 4X6AC 1XPPA 1K83K 1I6VA 2PPBA 1EQRA 2GAGC 4KASA 1V5VA 2JA7C 3G4CA 3FKIC 2NVTK 2JA5K 3GTOK 2CFAB 4G0UA 4A3CK 3NUHA 3GEEA 4C3HC 1TWFK 2R93A 3WODA 4RMFA 1USMA 4QIWL 4AYBD 5TMFA 1WIHA 3DXJA 5C4XC 1WSVA 1I3QA 4A3EC 5IP7C 4XSZA 4KN7A 4YG2A 4KN4A 1O2BA 4A3IK 1K83C 4A3DC 5M5XK 5IORA 1HI9A 3GTQC 4QJVA 1O28A 2NVYK 2O5IA 3GTOC 2E2HK 5C4JK 4KC6A 3HOXK 4FM9A 3RZOC 2R93C 4GTBA 2ZUFA 2Y0SL 1YNJA 1EH1A 2D6FC 3RZDK 3S2HK 1I50A 1O2FB 1YCLA 2JA8C 3SZZA 1XZPB 4A3CC 3CQZA 1ZYRA 1YNNA 1WQHA 4BXXK 4LK1A 1WQFA 4C45A 4A3IC 4A3DK 3GIRA 4XSXA 5IP7K 3GTGA 3AQPA 1VRQC 4WJ3M 4LOWA 1PJ7A 3M3YC 4LR2A 5TMCA 1XXCA 2JA6C 5FLMC 4FZBA 5IOQA 4G0WA 3HOVC 3LPXA 2E2IA 2JA8K 2RH6A 1ZQ1C 4M1XA 3L4KA 3GTMC 2JA5C 4QJVB 2O5JA 2XCRB 4AH6A 1F7UA 3S2HC 3T02A 1IL2A 3M4OK 2CW0A 1VJEA 2WAQL 4LLGA 4A3EK 2NVXC 2FQTA 2R7ZK 2FQOA 4KM9A 3JSTA 1VGXA 3H3VL 3M3YK 1Y1WA 1TWHC 2R92K 3HOUK 2BE5A 2EBBA 3GTQK 1DCOA 4KMUA 2ZFZA 2NVYC 1C0AA 1ISEA 2PMZL 3RZOK 3S1NK 3HOVK 1R9TA 4A3KC 4KMHA 4A3GK 3RZDC 4A3LK 1UV7A 4YFNA 3H0GA 3GTMK 1JQWA 1O24A 3TFHA 4GTEA 3FOFA 1TWCA 4BY7K 3GTLK 2ZUEA 2PMZD 2GSNA 1O25A 4ILDA 2R7ZC 3GTJA 5D4DA 3S1MK 3GTPK 1F9NA 4C3IK 2V6SA 4GTLA 3I4NC 4KDDA 1XZPA 4Y52K 4Y7NC 4BLAA 1O2AA 4YFKA 3H0GC 3AQOA 5FLMK 2B63C 3FKIK 2P5MA 3HKZD 1WCMA 2VUMA 1TWAK 5CHPA 2GSOA 2PA8L 1TWFC 5L46A 4A3KK 3GTLC 1WCMC 1ZBSA 4A3MK 4MEXA 1EK8A 5IP9C 1EFWA 1TWGC 3S1MC 2NVXK 2NVXA 3MMLB 4P5BA 5EGEA 3HOWK 2R92C 3HOUC 1WORA 1WSRA 3GTPC 1Y1VC 3HOXC 3LAPA 4KATA 3S15K 1YX2A 1INNA 3S1NC 2B63K 5IYBK 1WQGA 3HOYC 4OIPA 1TWAC 5HL8A 2RGRA 1WOSA 3VA7A 1R9TC 3GTKA 4LJZA 3K7AC 3N0CA 5M3FK 2VUMC 1I6HC 5IP9K 1BDFA 5C3EC 1TWGK 4WILA 4Q5SA 5JVOA 1Y1VK 2P8TA 1B4BA 2KWAA 3I4NK 2V6TA 3BP3A 3GTJK 4C2MK 4O2DA 3S16K 3GSIA 4Y7NK 1XXBA 2XCOA 3ERED 2A69A 1TWGA 4QIWD 2Y3PA 3LAJA 3GTMA 3HOZC 1DD5A 3AH5A 3TTGA 1J6WA 3GTLA 3K7AK 4MEYA 4DDQA 1Y1VA 1I6HK 5IYDC 1O26A 3S16C 2Y0SD 2R7ZA 4NOIA 2B63A 4A3BC 3CAGA 4KB4A 3HOWC 3S17C 5IOSA 4MQ9A 3GEIA 4KARA 2E2JK 3PO2K 1BJTA 2V6UA 3HOZK 4BY1C 4A3LC 1I50C 2JH3A 2PA8D 3HOYK 1VH2A 1AB4A 3QX3A 3HKZL 4ZH4A 3FOEA 1TWAA 4BKWA 5EGHA 4BBSC 4GTCA 1L0WA 4A3BK 2GSUA 3TFJA 1O29A 1ZXOA 5M5WK 4A3JC 1PJ5A 1F7VA 4Y52C 3GTJC 4C2MC 4P9SA 3GTPA 4KB2A 3H0GK 3N3YA 2E2JC 3PO2C 1Y1WK 3Q3QA 4YFXA 2A6EA 3CQZC 1WCMK 2E2HA 1SFOA 3ADAC 1XZQA 1I50K 3IPJA 5JFEA 4C3JC 4A3MC 2YU9C 3V4GA 4PAAA 3AD9C 4G7HA 3GTKC 4BBSK 1DCPA 4GTAA 3GTOA 4GZYA 3AD7C 2NVQK 1SMYA 2NVTC 1J98A 5TJ3A 4A93C 1TWHA 1K83A 1IS1A 3S14K 5CJ9A 4XLPA 4KAWX 4OINA 3S15C 2WAQD 2CFAA 2R92A 3PO3K 4GT9A 3HXAA 5IYBC 4BY1K 4GTFA 3FHZA 1R9TK 4A3FC 2A68A 1USOA 4WJ4A 3CQZK 4LK0A 3GTKK 4KM8A 3GDZA 1IW7A 3T00A 2VUMK 2XCQA 3FKIA 4BBRC 1VLOA 2JA7A 1IBAA 5C3EK 3S0XA 1PJ6A 1EI6A 5E68A 5IYCK 1XZQB 2R93K 5M3MK 1TWFA 4XCHA 3OREA 4OIQA 3SZYA 3PO3C 3GTQA 4JK1A 4GFQA 3S14C 4OIRA 3S2DK 3H3VD 3S1QC 3I4MC 4P5AA 4A3FK 1Y1WC 3T01A 1G51A 1X31C 3AD8C 1ZVUA 2WB1L 4G0VA 5C44K 4BBRK 1I3QC 4Q4ZA 4C3JK 2YU9K 4KMDA 2W7VA 3OPFA 1SFOK 2A6HA 1TWCC 3BP8C 3S1RC
chains in the Genus database with same CATH topology
1TWFC 2JA6K 4A3KK 3GTLC 1WCMC 3RZDK 5IYDK 3S2HK 4BBSC 2JA8C 4A3MK 4MEXA 2NVQC 4A3BK 4X6AC 5IP9C 5IYCC 2E2IK 4A3CC 1ZYRA 3S2DC 3S17K 4A93K 1TWGC 3S1MC 1YNNA 5M5WK 2NVXK 4A3JC 3I4MK 3S1RC 4BXXK 4LK1A 3M4OC 4Y52C 4A3IC 3GTJC 4A3DK 4XSXA 5IP7K 3HOWK 3GTGC 3H0GK 5M5YK 2R92C 3HOUC 3GTPC 2E2JC 3PO2C 1Y1WK 1Y1VC 3M3YC 3HOXC 1HQMA 1TWCK 5TMCA 3S1RK 3S15K 4YFXA 2A6EA 2JA6C 1TWHK 3CQZC 1WCMK 3S1NC 5FLMC 3HOVC 1I3QK 5IYBK 2B63K 1I50K 2JA8K 3HOYC 4OIPA 4A3MC 2E2HC 2YU9C 1TWAC 3GTMC 1R9TC 2JA5C 4QJVB 4G7HA 4A3JK 3GTKC 2O5JA 4C3HK 4LJZA 3K7AC 4X6AK 3S2HC 4BBSK 5M3FK 2VUMC 3S2DK 3M4OK 4A3GC 2PA8L 4GZYA 1I6HC 2JA7K 2NVQK 2CW0A 4OIOA 4LLGA 5IP9K 2WAQL 1BDFA 1SMYA 5C4XK 5C3EC 2E2IC 2NVTC 3GTGK 4G7OA 4A93C 4A3EK 1TWGK 5FJ8K 2NVXC 2R7ZK 4BXXC 3S14K 2WB1D 4Q5SA 4XLNA 1Y1VK 4XLPA 4OINA 3H3VL 3M3YK 3S1QK 4BY7C 3I4NK 3GTJK 4C2MK 3S15C 1YNJA 3S16K 2WAQD 1TWHC 4Y7NK 2R92K 3HOUK 3EQLA 3PO3K 4AYBL 2BE5A 5IYBC 5C44C 4BY1K 3GTQK 4KMUA 2NVYC 1R9TK 4A3FC 2A68A 4G7ZA 5C4JC 2PMZL 3CQZK 4LK0A 1SFOC 1XPPA 2A69A 4QIWD 3GTKK 1K83K 1IW7A 1I6VA 2PPBA 3HOVK 2VUMK 3HOZC 4A3KC 4A3GK 3RZDC 4A3LK 2JA7C 4YFNA 4BBRC 3FKIC 3GTMK 5C3EK 2NVTK 2JA5K 3GTOK 2R93C 5IYCK 4A3CK 2R93K 5M3MK 3K7AK 1TWFK 3WODA 4BY7K 4MEYA 3GTLK 4A3LC 1I6HK 4QIWL 5IYDC 4AYBD 5TMFA 2PMZD 3DXJA 2Y0SD 3S16C 5C4XC 4NOIA 4OIQA 4A3EC 4A3BC 3PO3C 4JK1A 5IP7C 2R7ZC 3HOWC 4XSZA 4OIRA 4KN7A 5D4DA 3S14C 3H3VD 4MQ9A 4YG2A 3S17C 3GTPK 4KN4A 3S1MK 4C3IK 3I4MC 3S1QC 2E2JK 3PO2K 3I4NC 4A3FK 1Y1WC 4Y52K 4Y7NC 4A3IK 1K83C 4A3DC 5M5XK 3HOZK 2WB1L 4YFKA 3H0GC 5C44K 5FLMK 4BY1C 4QJVA 4BBRK 4ZH4A 3GTQC 1I3QC 3FKIK 2B63C 3RZOK 1I50C 2NVYK 4Q4ZA 2PA8D 3HKZD 4C3JK 2O5IA 3HOYK 3GTOC 2E2HK 5C4JK 2YU9K 3HOXK 1SFOK 1TWAK 3RZOC 3S1NK 2A6HA 1TWCC 3HKZL 2Y0SL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF C;  2JA6 K;  4A3K K;  3GTL C;  1WCM C;  3RZD K;  5IYD K;  3S2H K;  4BBS C;  2JA8 C;  4A3M K;  4MEX A;  2NVQ C;  4A3B K;  4X6A C;  5IP9 C;  5IYC C;  2E2I K;  4A3C C;  1ZYR A;  3S2D C;  3S17 K;  4A93 K;  1TWG C;  3S1M C;  1YNN A;  5M5W K;  2NVX K;  4A3J C;  3I4M K;  3S1R C;  4BXX K;  4LK1 A;  3M4O C;  4Y52 C;  4A3I C;  3GTJ C;  4A3D K;  4XSX A;  5IP7 K;  3HOW K;  3GTG C;  3H0G K;  5M5Y K;  2R92 C;  3HOU C;  3GTP C;  2E2J C;  3PO2 C;  1Y1W K;  1Y1V C;  3M3Y C;  3HOX C;  1HQM A;  1TWC K;  5TMC A;  3S1R K;  3S15 K;  4YFX A;  2A6E A;  2JA6 C;  1TWH K;  3CQZ C;  1WCM K;  3S1N C;  5FLM C;  3HOV C;  1I3Q K;  5IYB K;  2B63 K;  1I50 K;  2JA8 K;  3HOY C;  4OIP A;  4A3M C;  2E2H C;  2YU9 C;  1TWA C;  3GTM C;  1R9T C;  2JA5 C;  4QJV B;  4G7H A;  4A3J K;  3GTK C;  2O5J A;  4C3H K;  4LJZ A;  3K7A C;  4X6A K;  3S2H C;  4BBS K;  5M3F K;  2VUM C;  3S2D K;  3M4O K;  4A3G C;  2PA8 L;  4GZY A;  1I6H C;  2JA7 K;  2NVQ K;  2CW0 A;  4OIO A;  4LLG A;  5IP9 K;  2WAQ L;  1BDF A;  1SMY A;  5C4X K;  5C3E C;  2E2I C;  2NVT C;  3GTG K;  4G7O A;  4A93 C;  4A3E K;  1TWG K;  5FJ8 K;  2NVX C;  2R7Z K;  4BXX C;  3S14 K;  2WB1 D;  4Q5S A;  4XLN A;  1Y1V K;  4XLP A;  4OIN A;  3H3V L;  3M3Y K;  3S1Q K;  4BY7 C;  3I4N K;  3GTJ K;  4C2M K;  3S15 C;  1YNJ A;  3S16 K;  2WAQ D;  1TWH C;  4Y7N K;  2R92 K;  3HOU K;  3EQL A;  3PO3 K;  4AYB L;  2BE5 A;  5IYB C;  5C44 C;  4BY1 K;  3GTQ K;  4KMU A;  2NVY C;  1R9T K;  4A3F C;  2A68 A;  4G7Z A;  5C4J C;  2PMZ L;  3CQZ K;  4LK0 A;  1SFO C;  1XPP A;  2A69 A;  4QIW D;  3GTK K;  1K83 K;  1IW7 A;  1I6V A;  2PPB A;  3HOV K;  2VUM K;  3HOZ C;  4A3K C;  4A3G K;  3RZD C;  4A3L K;  2JA7 C;  4YFN A;  4BBR C;  3FKI C;  3GTM K;  5C3E K;  2NVT K;  2JA5 K;  3GTO K;  2R93 C;  5IYC K;  4A3C K;  2R93 K;  5M3M K;  3K7A K;  1TWF K;  3WOD A;  4BY7 K;  4MEY A;  3GTL K;  4A3L C;  1I6H K;  4QIW L;  5IYD C;  4AYB D;  5TMF A;  2PMZ D;  3DXJ A;  2Y0S D;  3S16 C;  5C4X C;  4NOI A;  4OIQ A;  4A3E C;  4A3B C;  3PO3 C;  4JK1 A;  5IP7 C;  2R7Z C;  3HOW C;  4XSZ A;  4OIR A;  4KN7 A;  5D4D A;  3S14 C;  3H3V D;  4MQ9 A;  4YG2 A;  3S17 C;  3GTP K;  4KN4 A;  3S1M K;  4C3I K;  3I4M C;  3S1Q C;  2E2J K;  3PO2 K;  3I4N C;  4A3F K;  1Y1W C;  4Y52 K;  4Y7N C;  4A3I K;  1K83 C;  4A3D C;  5M5X K;  3HOZ K;  2WB1 L;  4YFK A;  3H0G C;  5C44 K;  5FLM K;  4BY1 C;  4QJV A;  4BBR K;  4ZH4 A;  3GTQ C;  1I3Q C;  3FKI K;  2B63 C;  3RZO K;  1I50 C;  2NVY K;  4Q4Z A;  2PA8 D;  3HKZ D;  4C3J K;  2O5I A;  3HOY K;  3GTO C;  2E2H K;  5C4J K;  2YU9 K;  3HOX K;  1SFO K;  1TWA K;  3RZO C;  3S1N K;  2A6H A;  1TWC C;  3HKZ L;  2Y0S L; 
#chains in the Genus database with same CATH topology
 3OEP A;  4BLB A;  2JA6 K;  2JA5 A;  3TFI A;  4PAB A;  5IYD K;  2NVQ C;  1J6V A;  2E2I K;  5IYC C;  3S2D C;  3S17 K;  4A93 K;  3I4M K;  2NVY A;  1IE0 A;  3M4O C;  3A8I A;  3GTG C;  5M5Y K;  1GE9 A;  3G4A A;  3GEH A;  1HQM A;  1TWC K;  3S1R K;  3A8J A;  1TWH K;  1J6X A;  4J3N A;  2YU9 A;  1I3Q K;  4KMA A;  1O27 A;  2E2H C;  3BUE A;  1IQ0 A;  1WOP A;  4A3J K;  4X6A K;  4C3H K;  1KQ4 A;  1JVI A;  1JOE A;  4A3G C;  2GAH C;  2JA7 K;  1WOO A;  4OIO A;  2E2I C;  5C4X K;  3A8K A;  4G7O A;  1DCH A;  3GTG K;  5FJ8 K;  2JA6 A;  4BXX C;  2WB1 D;  4XLN A;  4BY7 C;  1XXA A;  3S1Q K;  4GTD A;  4LQY A;  1B4A A;  3N0B A;  3EQL A;  1BGW A;  4AYB L;  3L4J A;  1F93 A;  5C44 C;  4C3I C;  1RU0 A;  5IOT A;  4G7Z A;  5C4J C;  2PHC B;  1SFO C;  1BS2 A;  4X6A C;  1XPP A;  1K83 K;  1I6V A;  2PPB A;  1EQR A;  2GAG C;  4KAS A;  1V5V A;  2JA7 C;  3G4C A;  3FKI C;  2NVT K;  2JA5 K;  3GTO K;  2CFA B;  4G0U A;  4A3C K;  3NUH A;  3GEE A;  4C3H C;  1TWF K;  2R93 A;  3WOD A;  4RMF A;  1USM A;  4QIW L;  4AYB D;  5TMF A;  1WIH A;  3DXJ A;  5C4X C;  1WSV A;  1I3Q A;  4A3E C;  5IP7 C;  4XSZ A;  4KN7 A;  4YG2 A;  4KN4 A;  1O2B A;  4A3I K;  1K83 C;  4A3D C;  5M5X K;  5IOR A;  1HI9 A;  3GTQ C;  4QJV A;  1O28 A;  2NVY K;  2O5I A;  3GTO C;  2E2H K;  5C4J K;  4KC6 A;  3HOX K;  4FM9 A;  3RZO C;  2R93 C;  4GTB A;  2ZUF A;  2Y0S L;  1YNJ A;  1EH1 A;  2D6F C;  3RZD K;  3S2H K;  1I50 A;  1O2F B;  1YCL A;  2JA8 C;  3SZZ A;  1XZP B;  4A3C C;  3CQZ A;  1ZYR A;  1YNN A;  1WQH A;  4BXX K;  4LK1 A;  1WQF A;  4C45 A;  4A3I C;  4A3D K;  3GIR A;  4XSX A;  5IP7 K;  3GTG A;  3AQP A;  1VRQ C;  4WJ3 M;  4LOW A;  1PJ7 A;  3M3Y C;  4LR2 A;  5TMC A;  1XXC A;  2JA6 C;  5FLM C;  4FZB A;  5IOQ A;  4G0W A;  3HOV C;  3LPX A;  2E2I A;  2JA8 K;  2RH6 A;  1ZQ1 C;  4M1X A;  3L4K A;  3GTM C;  2JA5 C;  4QJV B;  2O5J A;  2XCR B;  4AH6 A;  1F7U A;  3S2H C;  3T02 A;  1IL2 A;  3M4O K;  2CW0 A;  1VJE A;  2WAQ L;  4LLG A;  4A3E K;  2NVX C;  2FQT A;  2R7Z K;  2FQO A;  4KM9 A;  3JST A;  1VGX A;  3H3V L;  3M3Y K;  1Y1W A;  1TWH C;  2R92 K;  3HOU K;  2BE5 A;  2EBB A;  3GTQ K;  1DCO A;  4KMU A;  2ZFZ A;  2NVY C;  1C0A A;  1ISE A;  2PMZ L;  3RZO K;  3S1N K;  3HOV K;  1R9T A;  4A3K C;  4KMH A;  4A3G K;  3RZD C;  4A3L K;  1UV7 A;  4YFN A;  3H0G A;  3GTM K;  1JQW A;  1O24 A;  3TFH A;  4GTE A;  3FOF A;  1TWC A;  4BY7 K;  3GTL K;  2ZUE A;  2PMZ D;  2GSN A;  1O25 A;  4ILD A;  2R7Z C;  3GTJ A;  5D4D A;  3S1M K;  3GTP K;  1F9N A;  4C3I K;  2V6S A;  4GTL A;  3I4N C;  4KDD A;  1XZP A;  4Y52 K;  4Y7N C;  4BLA A;  1O2A A;  4YFK A;  3H0G C;  3AQO A;  5FLM K;  2B63 C;  3FKI K;  2P5M A;  3HKZ D;  1WCM A;  2VUM A;  1TWA K;  5CHP A;  2GSO A;  2PA8 L;  1TWF C;  5L46 A;  4A3K K;  3GTL C;  1WCM C;  1ZBS A;  4A3M K;  4MEX A;  1EK8 A;  5IP9 C;  1EFW A;  1TWG C;  3S1M C;  2NVX K;  2NVX A;  3MML B;  4P5B A;  5EGE A;  3HOW K;  2R92 C;  3HOU C;  1WOR A;  1WSR A;  3GTP C;  1Y1V C;  3HOX C;  3LAP A;  4KAT A;  3S15 K;  1YX2 A;  1INN A;  3S1N C;  2B63 K;  5IYB K;  1WQG A;  3HOY C;  4OIP A;  1TWA C;  5HL8 A;  2RGR A;  1WOS A;  3VA7 A;  1R9T C;  3GTK A;  4LJZ A;  3K7A C;  3N0C A;  5M3F K;  2VUM C;  1I6H C;  5IP9 K;  1BDF A;  5C3E C;  1TWG K;  4WIL A;  4Q5S A;  5JVO A;  1Y1V K;  2P8T A;  1B4B A;  2KWA A;  3I4N K;  2V6T A;  3BP3 A;  3GTJ K;  4C2M K;  4O2D A;  3S16 K;  3GSI A;  4Y7N K;  1XXB A;  2XCO A;  3ERE D;  2A69 A;  1TWG A;  4QIW D;  2Y3P A;  3LAJ A;  3GTM A;  3HOZ C;  1DD5 A;  3AH5 A;  3TTG A;  1J6W A;  3GTL A;  3K7A K;  4MEY A;  4DDQ A;  1Y1V A;  1I6H K;  5IYD C;  1O26 A;  3S16 C;  2Y0S D;  2R7Z A;  4NOI A;  2B63 A;  4A3B C;  3CAG A;  4KB4 A;  3HOW C;  3S17 C;  5IOS A;  4MQ9 A;  3GEI A;  4KAR A;  2E2J K;  3PO2 K;  1BJT A;  2V6U A;  3HOZ K;  4BY1 C;  4A3L C;  1I50 C;  2JH3 A;  2PA8 D;  3HOY K;  1VH2 A;  1AB4 A;  3QX3 A;  3HKZ L;  4ZH4 A;  3FOE A;  1TWA A;  4BKW A;  5EGH A;  4BBS C;  4GTC A;  1L0W A;  4A3B K;  2GSU A;  3TFJ A;  1O29 A;  1ZXO A;  5M5W K;  4A3J C;  1PJ5 A;  1F7V A;  4Y52 C;  3GTJ C;  4C2M C;  4P9S A;  3GTP A;  4KB2 A;  3H0G K;  3N3Y A;  2E2J C;  3PO2 C;  1Y1W K;  3Q3Q A;  4YFX A;  2A6E A;  3CQZ C;  1WCM K;  2E2H A;  1SFO A;  3ADA C;  1XZQ A;  1I50 K;  3IPJ A;  5JFE A;  4C3J C;  4A3M C;  2YU9 C;  3V4G A;  4PAA A;  3AD9 C;  4G7H A;  3GTK C;  4BBS K;  1DCP A;  4GTA A;  3GTO A;  4GZY A;  3AD7 C;  2NVQ K;  1SMY A;  2NVT C;  1J98 A;  5TJ3 A;  4A93 C;  1TWH A;  1K83 A;  1IS1 A;  3S14 K;  5CJ9 A;  4XLP A;  4KAW X;  4OIN A;  3S15 C;  2WAQ D;  2CFA A;  2R92 A;  3PO3 K;  4GT9 A;  3HXA A;  5IYB C;  4BY1 K;  4GTF A;  3FHZ A;  1R9T K;  4A3F C;  2A68 A;  1USO A;  4WJ4 A;  3CQZ K;  4LK0 A;  3GTK K;  4KM8 A;  3GDZ A;  1IW7 A;  3T00 A;  2VUM K;  2XCQ A;  3FKI A;  4BBR C;  1VLO A;  2JA7 A;  1IBA A;  5C3E K;  3S0X A;  1PJ6 A;  1EI6 A;  5E68 A;  5IYC K;  1XZQ B;  2R93 K;  5M3M K;  1TWF A;  4XCH A;  3ORE A;  4OIQ A;  3SZY A;  3PO3 C;  3GTQ A;  4JK1 A;  4GFQ A;  3S14 C;  4OIR A;  3S2D K;  3H3V D;  3S1Q C;  3I4M C;  4P5A A;  4A3F K;  1Y1W C;  3T01 A;  1G51 A;  1X31 C;  3AD8 C;  1ZVU A;  2WB1 L;  4G0V A;  5C44 K;  4BBR K;  1I3Q C;  4Q4Z A;  4C3J K;  2YU9 K;  4KMD A;  2W7V A;  3OPF A;  1SFO K;  2A6H A;  1TWC C;  3BP8 C;  3S1R C; 
#chains in the Genus database with same CATH homology
 1TWF C;  2JA6 K;  4A3K K;  3GTL C;  1WCM C;  3RZD K;  5IYD K;  3S2H K;  4BBS C;  2JA8 C;  4A3M K;  4MEX A;  2NVQ C;  4A3B K;  4X6A C;  5IP9 C;  5IYC C;  2E2I K;  4A3C C;  1ZYR A;  3S2D C;  3S17 K;  4A93 K;  1TWG C;  3S1M C;  1YNN A;  5M5W K;  2NVX K;  4A3J C;  3I4M K;  3S1R C;  4BXX K;  4LK1 A;  3M4O C;  4Y52 C;  4A3I C;  3GTJ C;  4A3D K;  4XSX A;  5IP7 K;  3HOW K;  3GTG C;  3H0G K;  5M5Y K;  2R92 C;  3HOU C;  3GTP C;  2E2J C;  3PO2 C;  1Y1W K;  1Y1V C;  3M3Y C;  3HOX C;  1HQM A;  1TWC K;  5TMC A;  3S1R K;  3S15 K;  4YFX A;  2A6E A;  2JA6 C;  1TWH K;  3CQZ C;  1WCM K;  3S1N C;  5FLM C;  3HOV C;  1I3Q K;  5IYB K;  2B63 K;  1I50 K;  2JA8 K;  3HOY C;  4OIP A;  4A3M C;  2E2H C;  2YU9 C;  1TWA C;  3GTM C;  1R9T C;  2JA5 C;  4QJV B;  4G7H A;  4A3J K;  3GTK C;  2O5J A;  4C3H K;  4LJZ A;  3K7A C;  4X6A K;  3S2H C;  4BBS K;  5M3F K;  2VUM C;  3S2D K;  3M4O K;  4A3G C;  2PA8 L;  4GZY A;  1I6H C;  2JA7 K;  2NVQ K;  2CW0 A;  4OIO A;  4LLG A;  5IP9 K;  2WAQ L;  1BDF A;  1SMY A;  5C4X K;  5C3E C;  2E2I C;  2NVT C;  3GTG K;  4G7O A;  4A93 C;  4A3E K;  1TWG K;  5FJ8 K;  2NVX C;  2R7Z K;  4BXX C;  3S14 K;  2WB1 D;  4Q5S A;  4XLN A;  1Y1V K;  4XLP A;  4OIN A;  3H3V L;  3M3Y K;  3S1Q K;  4BY7 C;  3I4N K;  3GTJ K;  4C2M K;  3S15 C;  1YNJ A;  3S16 K;  2WAQ D;  1TWH C;  4Y7N K;  2R92 K;  3HOU K;  3EQL A;  3PO3 K;  4AYB L;  2BE5 A;  5IYB C;  5C44 C;  4BY1 K;  3GTQ K;  4KMU A;  2NVY C;  1R9T K;  4A3F C;  2A68 A;  4G7Z A;  5C4J C;  2PMZ L;  3CQZ K;  4LK0 A;  1SFO C;  1XPP A;  2A69 A;  4QIW D;  3GTK K;  1K83 K;  1IW7 A;  1I6V A;  2PPB A;  3HOV K;  2VUM K;  3HOZ C;  4A3K C;  4A3G K;  3RZD C;  4A3L K;  2JA7 C;  4YFN A;  4BBR C;  3FKI C;  3GTM K;  5C3E K;  2NVT K;  2JA5 K;  3GTO K;  2R93 C;  5IYC K;  4A3C K;  2R93 K;  5M3M K;  3K7A K;  1TWF K;  3WOD A;  4BY7 K;  4MEY A;  3GTL K;  4A3L C;  1I6H K;  4QIW L;  5IYD C;  4AYB D;  5TMF A;  2PMZ D;  3DXJ A;  2Y0S D;  3S16 C;  5C4X C;  4NOI A;  4OIQ A;  4A3E C;  4A3B C;  3PO3 C;  4JK1 A;  5IP7 C;  2R7Z C;  3HOW C;  4XSZ A;  4OIR A;  4KN7 A;  5D4D A;  3S14 C;  3H3V D;  4MQ9 A;  4YG2 A;  3S17 C;  3GTP K;  4KN4 A;  3S1M K;  4C3I K;  3I4M C;  3S1Q C;  2E2J K;  3PO2 K;  3I4N C;  4A3F K;  1Y1W C;  4Y52 K;  4Y7N C;  4A3I K;  1K83 C;  4A3D C;  5M5X K;  3HOZ K;  2WB1 L;  4YFK A;  3H0G C;  5C44 K;  5FLM K;  4BY1 C;  4QJV A;  4BBR K;  4ZH4 A;  3GTQ C;  1I3Q C;  3FKI K;  2B63 C;  3RZO K;  1I50 C;  2NVY K;  4Q4Z A;  2PA8 D;  3HKZ D;  4C3J K;  2O5I A;  3HOY K;  3GTO C;  2E2H K;  5C4J K;  2YU9 K;  3HOX K;  1SFO K;  1TWA K;  3RZO C;  3S1N K;  2A6H A;  1TWC C;  3HKZ L;  2Y0S L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...