3S17K

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s17K00
5IYDK 4A3EC 4BY1K 3DXJA 5C44C 5C4XC 3HOXK 3GTJC 4C3IK 4LJZA 4AYBD 2NVXK 3PO2C 4A3CK 3PO3K 2NVQC 4AYBL 3GTPK 3S1QK 1R9TC 1Y1VC 2JA6K 2O5JA 5FJ8K 4QIWL 2NVTC 1TWHC 3S2DC 2YU9C 4YFNA 3GTGC 3S16C 4A3JC 3GTMC 4A3LK 1I3QC 5TMCA 2PPBA 3HOUK 4ZH4A 4Y52C 2VUMK 1HQMA 4XSZA 4QJVA 5C4JC 1TWAK 5FLMC 4A3FC 3HOVK 2NVYC 4Y7NK 5TMFA 5IYCK 4A3BK 4A93C 4A3MK 3HKZD 3RZDK 3S1MC 4X6AK 2JA5C 4KN7A 4A3EK 2A6HA 3HKZL 3M3YC 4YFKA 5C4XK 2WAQD 4OIQA 4A3DK 3GTJK 3FKIK 2WAQL 1IW7A 4A3KC 3PO2K 4OIOA 1WCMC 3M4OC 4G7ZA 4BBRC 1Y1WK 3S1RC 4OIPA 4QJVB 4C2MK 1R9TK 3S2HC 2R93C 1Y1VK 3GTOC 1TWFK 3S14C 3H0GC 3I4NC 3HOZC 3RZOC 2YU9K 3GTGK 1SFOC 4BBSC 2WB1D 3I4MC 5D4DA 1BDFA 1I3QK 2WB1L 2Y0SD 4Q4ZA 2E2HK 2JA8K 3GTLC 4G7OA 2Y0SL 3HOYC 4Y52K 2BE5A 5IP9C 1YNNA 3GTQC 3HOWC 4A3FK 2E2JC 2NVYK 5C3EC 2R92C 4LK0A 4A93K 4A3GK 1TWCC 1I50K 3S1MK 1I6HK 3S15C 3RZDC 3WODA 4X6AC 1K83C 4A3IK 5IYBK 4G7HA 3S1NC 2B63K 3GTKC 4A3KK 3M4OK 5C44K 4A3LC 2JA7C 4XSXA 4LK1A 5IYBC 5IYDC 4BY1C 3GTOK 3CQZC 3H0GK 3HOZK 4Q5SA 3HOXC 2NVQK 2R7ZC 3RZOK 1TWGC 4MQ9A 2NVXC 2E2IC 4BXXC 4BY7C 1SFOK 4A3CC 3PO3C 4BBSK 3GTPC 2NVTK 3S1QC 1TWHK 3S2DK 3S16K 5M5YK 4A3JK 3HOYK 3GTMK 4KN4A 4JK1A 2PMZD 5C4JK 5FLMK 2PMZL 4YFXA 3K7AC 2VUMC 2JA5K 1TWAC 2A68A 2PA8D 3GTKK 4A3BC 3M3YK 4C3HK 2PA8L 4KMUA 5IP7C 3S17C 3CQZK 1WCMK 4A3DC 2A6EA 4BBRK 2O5IA 3FKIC 3S1RK 2R7ZK 1TWGK 4BY7K 3S2HK 2E2IK 3I4NK 3S14K 4BXXK 2R93K 5M5WK 1XPPA 3EQLA 1Y1WC 4OIRA 4C3JK 4YG2A 5M3MK 4QIWD 1TWFC 4MEYA 5M5XK 2CW0A 4LLGA 3I4MK 1YNJA 5M3FK 3GTLK 2JA6C 1ZYRA 1I6VA 3GTQK 5IP9K 3HOWK 2E2HC 2JA8C 2E2JK 5C3EK 3K7AK 2R92K 2JA7K 1TWCK 3H3VD 4GZYA 3S15K 1K83K 4NOIA 3H3VL 3HOUC 4A3GC 1I50C 2A69A 4OINA 1I6HC 5IP7K 3S17K 3S1NK 4MEXA 4XLNA 3HOVC 4Y7NC 4XLPA 5IYCC 4A3IC 4A3MC 1SMYA 2B63C
chains in the Genus database with same CATH superfamily
5IYDK 4A3EC 1JQWA 3HOXK 4P5AA 2JH3A 4XCHA 4LJZA 3AD7C 3GTKA 1PJ7A 1O26A 2NVQC 4AYBL 2CFAA 3VA7A 1WCMA 5FJ8K 2NVTC 1IE0A 4YFNA 3GTGC 2E2IA 3S16C 4KMHA 4M1XA 5TMCA 2RH6A 3HOUK 1HQMA 3G4CA 4A3FC 5FLMC 4Y7NK 4A3BK 5IYCK 3HKZD 3GTQA 3JSTA 5JVOA 3M3YC 4YFKA 4OIQA 5CHPA 1WQGA 3GTJK 1IW7A 2PHCB 4OIOA 2ZUFA 4BBRC 1Y1WK 3S1RC 1R9TK 3S2HC 3I4NC 3LPXA 3H0GC 3HOZC 2YU9K 4KB2A 3GEEA 3N0BA 4BBSC 1I3QK 1PJ5A 4Q4ZA 1TWGA 2ZUEA 4Y52K 2XCOA 1J98A 1IL2A 5C3EC 4A93K 2XCQA 1WSVA 1TWCC 1O2FB 1J6WA 1WQHA 1K83C 2V6UA 5IYBK 2B63K 1RU0A 1IS1A 4LQYA 5C44K 4A3LC 2JA7C 4XSXA 3GTOK 3CQZC 4BKWA 1USMA 4GTEA 4BY7C 2NVXC 4BXXC 4G0WA 3OREA 3S2DK 3A8KA 2GSNA 1ZXOA 4A3JK 3AD9C 3GIRA 1Y1WA 1V5VA 3K7AC 2PA8D 4KMDA 5HL8A 2R7ZK 3FKIC 4GTLA 3EQLA 4C3IC 2B63A 2Y3PA 4C45A 1O2AA 2P8TA 3AD8C 2R92K 4GFQA 1INNA 3H3VD 5IOTA 1IQ0A 4KMAA 4OINA 1I6HC 3S1NK 4KM9A 4DDQA 4KARA 4X6AC 4A3MC 1SMYA 5C4XC 3N3YA 3AH5A 3GEHA 1Y1VC 2JA6K 3LAJA 2O5JA 3L4JA 4QIWL 4P9SA 2R7ZA 1TWHC 3N0CA 3GTMC 4ILDA 1PJ6A 1VLOA 1XZQA 1WORA 3BP8C 4ZH4A 1YX2A 4QJVA 5C4JC 1TWAK 3HOVK 2NVYC 4KDDA 3RZDK 4KN7A 4A3EK 4C3HC 4A3DK 2R92A 1XZPB 2WAQL 3T02A 3S0XA 1WCMC 1X31C 3M4OC 4G7ZA 5TJ3A 1DCOA 3S14C 1TWFK 4C3JC 3RZOC 3GTGK 4WILA 5D4DA 1BDFA 2WB1L 2E2HK 3SZZA 2JA8K 4G7OA 2Y0SL 2BE5A 5IP9C 1YNNA 2XCRB 3GTQC 5EGEA 4A3FK 3HOWC 2E2JC 4A3GK 1VJEA 5IOQA 3S15C 1IBAA 4A3IK 2KWAA 1ZQ1C 1O27A 4LK1A 1ZVUA 5IYDC 3H0GK 1WOSA 1TWAA 3HOZK 4Q5SA 3HOXC 1WSRA 3FOEA 1EK8A 1TWGC 1EQRA 4FZBA 4BBSK 1O24A 1GE9A 3T01A 3GEIA 1TWFA 2PMZD 2FQTA 1DCHA 3GTGA 2JA5K 4A3BC 2E2HA 5IP7C 3S17C 3CQZK 3TFJA 1J6XA 2R93K 4BY7K 5IOSA 4BXXK 5M5WK 1Y1WC 4YG2A 4QIWD 5M5XK 4KATA 3TTGA 3I4MK 1YNJA 5M3FK 3GTJA 3GTLK 1L0WA 1DCPA 4WJ3M 3GDZA 1R9TA 3K7AK 4GZYA 2YU9A 2D6FC 2A69A 1WIHA 1I3QA 5IYBC 2B63C 4BY1K 3DXJA 5C44C 1VGXA 4C3IK 4AYBD 4G0VA 2JA5A 3PO2C 4A3CK 3PO3K 5JFEA 3GTPK 3S1QK 3CQZA 2EBBA 4GTFA 3GSIA 3S2DC 2R93A 3GTOA 4A3JC 1F7VA 4G0UA 1AB4A 4GTBA 1O25A 2RGRA 2VUMK 2CFAB 1EH1A 3GTLA 4X6AK 4A3MK 1XXAA 3S1MC 3L4KA 3HKZL 5C4XK 3AQOA 1O28A 4A3KC 4OIPA 1USOA 4C2MK 1Y1VK 1WOPA 2P5MA 4BLBA 1YCLA 1SFOC 3IPJA 3FHZA 4KM8A 3BP3A 3HOYC 3GTPA 2NVYK 4RMFA 2R92C 1I50K 2V6TA 3TFHA 5CJ9A 3WODA 4G7HA 3S1NC 3GTKC 1JOEA 4WJ4A 3M4OK 4LOWA 2VUMA 3V4GA 1BJTA 2GAGC 2NVQK 3RZOK 4MQ9A 4KB4A 2E2IC 2NVTK 3Q3QA 3S16K 2W7VA 4P5BA 1WQFA 4KN4A 1Y1VA 3LAPA 5FLMK 2JA6A 4GTAA 1TWAC 2A68A 3M3YK 2PA8L 2NVYA 4A3DC 2O5IA 4BBRK 1JVIA 3S1RK 1TWGK 4PAAA 1I50A 3S2HK 3I4NK 3CAGA 1VRQC 3OEPA 1XPPA 2ZFZA 4OIRA 5M3MK 1TWFC 4MEYA 2CW0A 3T00A 2GAHC 4LLGA 4KC6A 1ZBSA 1I6VA 2E2HC 2JA8C 5C3EK 1B4BA 1UV7A 1TWCK 3ERED 1C0AA 1K83K 3H3VL 3HOUC 4A3GC 5IP7K 3S17K 2FQOA 4J3NA 4Y7NC 4XLPA 5IYCC 3FOFA 4A3IC 2JA7K 1ISEA 4A3LK 1KQ4A 1VH2A 3GTJC 1DD5A 2NVXK 3SZYA 3NUHA 1R9TC 5EGHA 4FM9A 2YU9C 3H0GA 1BS2A 3OPFA 1I3QC 1HI9A 1XZPA 2GSOA 2PPBA 3A8IA 4Y52C 4XSZA 2V6SA 5TMFA 4A93C 2JA5C 2A6HA 2WAQD 4GTCA 5L46A 3FKIK 1TWCA 1XZQB 3PO2K 1O2BA 1K83A 2R93C 4QJVB 5E68A 3GTOC 2JA7A 4KASA 2WB1D 1F93A 3I4MC 1F7UA 2Y0SD 3GTLC 2NVXA 1EFWA 1B4AA 4LK0A 3S1MK 1I6HK 4A3KK 1EI6A 4BY1C 2GSUA 2R7ZC 1SFOK 4A3CC 3PO3C 3GTPC 3S1QC 1TWHK 3FKIA 1BGWA 5M5YK 3HOYK 3GTMK 3ADAC 4JK1A 1WOOA 4LR2A 3TFIA 5C4JK 2PMZL 4YFXA 3A8JA 2VUMC 3HXAA 1G51A 3GTKK 4PABA 4C3HK 1O29A 1F9NA 4KMUA 1WCMK 2A6EA 5IORA 1J6VA 2E2IK 3S14K 1XXBA 4C3JK 3G4AA 4C2MC 3QX3A 4GTDA 2JA6C 1XXCA 1ZYRA 4AH6A 4BLAA 3GTQK 5IP9K 3BUEA 4KAWX 3HOWK 2E2JK 1SFOA 4GT9A 3S15K 1TWHA 4O2DA 4NOIA 3AQPA 1I50C 3GTMA 3MMLB 4MEXA 4XLNA 3HOVC 3RZDC
chains in the Genus database with same CATH topology
5IYDK 4A3EC 4BY1K 3DXJA 5C44C 5C4XC 3HOXK 3GTJC 4C3IK 4LJZA 4AYBD 2NVXK 3PO2C 4A3CK 3PO3K 2NVQC 4AYBL 3GTPK 3S1QK 1R9TC 1Y1VC 2JA6K 2O5JA 5FJ8K 4QIWL 2NVTC 1TWHC 3S2DC 2YU9C 4YFNA 3GTGC 3S16C 4A3JC 3GTMC 4A3LK 1I3QC 5TMCA 2PPBA 3HOUK 4ZH4A 4Y52C 2VUMK 1HQMA 4XSZA 4QJVA 5C4JC 1TWAK 5FLMC 4A3FC 3HOVK 2NVYC 4Y7NK 5TMFA 5IYCK 4A3BK 4A93C 4A3MK 3HKZD 3RZDK 3S1MC 4X6AK 2JA5C 4KN7A 4A3EK 2A6HA 3HKZL 3M3YC 4YFKA 5C4XK 2WAQD 4OIQA 4A3DK 3GTJK 3FKIK 2WAQL 1IW7A 4A3KC 3PO2K 4OIOA 1WCMC 3M4OC 4G7ZA 4BBRC 1Y1WK 3S1RC 4OIPA 4QJVB 4C2MK 1R9TK 3S2HC 2R93C 1Y1VK 3GTOC 1TWFK 3S14C 3H0GC 3I4NC 3HOZC 3RZOC 2YU9K 3GTGK 1SFOC 4BBSC 2WB1D 3I4MC 5D4DA 1BDFA 1I3QK 2WB1L 2Y0SD 4Q4ZA 2E2HK 2JA8K 3GTLC 4G7OA 2Y0SL 3HOYC 4Y52K 2BE5A 5IP9C 1YNNA 3GTQC 3HOWC 4A3FK 2E2JC 2NVYK 5C3EC 2R92C 4LK0A 4A93K 4A3GK 1TWCC 1I50K 3S1MK 1I6HK 3S15C 3RZDC 3WODA 4X6AC 1K83C 4A3IK 5IYBK 4G7HA 3S1NC 2B63K 3GTKC 4A3KK 3M4OK 5C44K 4A3LC 2JA7C 4XSXA 4LK1A 5IYBC 5IYDC 4BY1C 3GTOK 3CQZC 3H0GK 3HOZK 4Q5SA 3HOXC 2NVQK 2R7ZC 3RZOK 1TWGC 4MQ9A 2NVXC 2E2IC 4BXXC 4BY7C 1SFOK 4A3CC 3PO3C 4BBSK 3GTPC 2NVTK 3S1QC 1TWHK 3S2DK 3S16K 5M5YK 4A3JK 3HOYK 3GTMK 4KN4A 4JK1A 2PMZD 5C4JK 5FLMK 2PMZL 4YFXA 3K7AC 2VUMC 2JA5K 1TWAC 2A68A 2PA8D 3GTKK 4A3BC 3M3YK 4C3HK 2PA8L 4KMUA 5IP7C 3S17C 3CQZK 1WCMK 4A3DC 2A6EA 4BBRK 2O5IA 3FKIC 3S1RK 2R7ZK 1TWGK 4BY7K 3S2HK 2E2IK 3I4NK 3S14K 4BXXK 2R93K 5M5WK 1XPPA 3EQLA 1Y1WC 4OIRA 4C3JK 4YG2A 5M3MK 4QIWD 1TWFC 4MEYA 5M5XK 2CW0A 4LLGA 3I4MK 1YNJA 5M3FK 3GTLK 2JA6C 1ZYRA 1I6VA 3GTQK 5IP9K 3HOWK 2E2HC 2JA8C 2E2JK 5C3EK 3K7AK 2R92K 2JA7K 1TWCK 3H3VD 4GZYA 3S15K 1K83K 4NOIA 3H3VL 3HOUC 4A3GC 1I50C 2A69A 4OINA 1I6HC 5IP7K 3S17K 3S1NK 4MEXA 4XLNA 3HOVC 4Y7NC 4XLPA 5IYCC 4A3IC 4A3MC 1SMYA 2B63C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD K;  4A3E C;  4BY1 K;  3DXJ A;  5C44 C;  5C4X C;  3HOX K;  3GTJ C;  4C3I K;  4LJZ A;  4AYB D;  2NVX K;  3PO2 C;  4A3C K;  3PO3 K;  2NVQ C;  4AYB L;  3GTP K;  3S1Q K;  1R9T C;  1Y1V C;  2JA6 K;  2O5J A;  5FJ8 K;  4QIW L;  2NVT C;  1TWH C;  3S2D C;  2YU9 C;  4YFN A;  3GTG C;  3S16 C;  4A3J C;  3GTM C;  4A3L K;  1I3Q C;  5TMC A;  2PPB A;  3HOU K;  4ZH4 A;  4Y52 C;  2VUM K;  1HQM A;  4XSZ A;  4QJV A;  5C4J C;  1TWA K;  5FLM C;  4A3F C;  3HOV K;  2NVY C;  4Y7N K;  5TMF A;  5IYC K;  4A3B K;  4A93 C;  4A3M K;  3HKZ D;  3RZD K;  3S1M C;  4X6A K;  2JA5 C;  4KN7 A;  4A3E K;  2A6H A;  3HKZ L;  3M3Y C;  4YFK A;  5C4X K;  2WAQ D;  4OIQ A;  4A3D K;  3GTJ K;  3FKI K;  2WAQ L;  1IW7 A;  4A3K C;  3PO2 K;  4OIO A;  1WCM C;  3M4O C;  4G7Z A;  4BBR C;  1Y1W K;  3S1R C;  4OIP A;  4QJV B;  4C2M K;  1R9T K;  3S2H C;  2R93 C;  1Y1V K;  3GTO C;  1TWF K;  3S14 C;  3H0G C;  3I4N C;  3HOZ C;  3RZO C;  2YU9 K;  3GTG K;  1SFO C;  4BBS C;  2WB1 D;  3I4M C;  5D4D A;  1BDF A;  1I3Q K;  2WB1 L;  2Y0S D;  4Q4Z A;  2E2H K;  2JA8 K;  3GTL C;  4G7O A;  2Y0S L;  3HOY C;  4Y52 K;  2BE5 A;  5IP9 C;  1YNN A;  3GTQ C;  3HOW C;  4A3F K;  2E2J C;  2NVY K;  5C3E C;  2R92 C;  4LK0 A;  4A93 K;  4A3G K;  1TWC C;  1I50 K;  3S1M K;  1I6H K;  3S15 C;  3RZD C;  3WOD A;  4X6A C;  1K83 C;  4A3I K;  5IYB K;  4G7H A;  3S1N C;  2B63 K;  3GTK C;  4A3K K;  3M4O K;  5C44 K;  4A3L C;  2JA7 C;  4XSX A;  4LK1 A;  5IYB C;  5IYD C;  4BY1 C;  3GTO K;  3CQZ C;  3H0G K;  3HOZ K;  4Q5S A;  3HOX C;  2NVQ K;  2R7Z C;  3RZO K;  1TWG C;  4MQ9 A;  2NVX C;  2E2I C;  4BXX C;  4BY7 C;  1SFO K;  4A3C C;  3PO3 C;  4BBS K;  3GTP C;  2NVT K;  3S1Q C;  1TWH K;  3S2D K;  3S16 K;  5M5Y K;  4A3J K;  3HOY K;  3GTM K;  4KN4 A;  4JK1 A;  2PMZ D;  5C4J K;  5FLM K;  2PMZ L;  4YFX A;  3K7A C;  2VUM C;  2JA5 K;  1TWA C;  2A68 A;  2PA8 D;  3GTK K;  4A3B C;  3M3Y K;  4C3H K;  2PA8 L;  4KMU A;  5IP7 C;  3S17 C;  3CQZ K;  1WCM K;  4A3D C;  2A6E A;  4BBR K;  2O5I A;  3FKI C;  3S1R K;  2R7Z K;  1TWG K;  4BY7 K;  3S2H K;  2E2I K;  3I4N K;  3S14 K;  4BXX K;  2R93 K;  5M5W K;  1XPP A;  3EQL A;  1Y1W C;  4OIR A;  4C3J K;  4YG2 A;  5M3M K;  4QIW D;  1TWF C;  4MEY A;  5M5X K;  2CW0 A;  4LLG A;  3I4M K;  1YNJ A;  5M3F K;  3GTL K;  2JA6 C;  1ZYR A;  1I6V A;  3GTQ K;  5IP9 K;  3HOW K;  2E2H C;  2JA8 C;  2E2J K;  5C3E K;  3K7A K;  2R92 K;  2JA7 K;  1TWC K;  3H3V D;  4GZY A;  3S15 K;  1K83 K;  4NOI A;  3H3V L;  3HOU C;  4A3G C;  1I50 C;  2A69 A;  4OIN A;  1I6H C;  5IP7 K;  3S17 K;  3S1N K;  4MEX A;  4XLN A;  3HOV C;  4Y7N C;  4XLP A;  5IYC C;  4A3I C;  4A3M C;  1SMY A;  2B63 C; 
#chains in the Genus database with same CATH topology
 5IYD K;  4A3E C;  1JQW A;  3HOX K;  4P5A A;  2JH3 A;  4XCH A;  4LJZ A;  3AD7 C;  3GTK A;  1PJ7 A;  1O26 A;  2NVQ C;  4AYB L;  2CFA A;  3VA7 A;  1WCM A;  5FJ8 K;  2NVT C;  1IE0 A;  4YFN A;  3GTG C;  2E2I A;  3S16 C;  4KMH A;  4M1X A;  5TMC A;  2RH6 A;  3HOU K;  1HQM A;  3G4C A;  4A3F C;  5FLM C;  4Y7N K;  4A3B K;  5IYC K;  3HKZ D;  3GTQ A;  3JST A;  5JVO A;  3M3Y C;  4YFK A;  4OIQ A;  5CHP A;  1WQG A;  3GTJ K;  1IW7 A;  2PHC B;  4OIO A;  2ZUF A;  4BBR C;  1Y1W K;  3S1R C;  1R9T K;  3S2H C;  3I4N C;  3LPX A;  3H0G C;  3HOZ C;  2YU9 K;  4KB2 A;  3GEE A;  3N0B A;  4BBS C;  1I3Q K;  1PJ5 A;  4Q4Z A;  1TWG A;  2ZUE A;  4Y52 K;  2XCO A;  1J98 A;  1IL2 A;  5C3E C;  4A93 K;  2XCQ A;  1WSV A;  1TWC C;  1O2F B;  1J6W A;  1WQH A;  1K83 C;  2V6U A;  5IYB K;  2B63 K;  1RU0 A;  1IS1 A;  4LQY A;  5C44 K;  4A3L C;  2JA7 C;  4XSX A;  3GTO K;  3CQZ C;  4BKW A;  1USM A;  4GTE A;  4BY7 C;  2NVX C;  4BXX C;  4G0W A;  3ORE A;  3S2D K;  3A8K A;  2GSN A;  1ZXO A;  4A3J K;  3AD9 C;  3GIR A;  1Y1W A;  1V5V A;  3K7A C;  2PA8 D;  4KMD A;  5HL8 A;  2R7Z K;  3FKI C;  4GTL A;  3EQL A;  4C3I C;  2B63 A;  2Y3P A;  4C45 A;  1O2A A;  2P8T A;  3AD8 C;  2R92 K;  4GFQ A;  1INN A;  3H3V D;  5IOT A;  1IQ0 A;  4KMA A;  4OIN A;  1I6H C;  3S1N K;  4KM9 A;  4DDQ A;  4KAR A;  4X6A C;  4A3M C;  1SMY A;  5C4X C;  3N3Y A;  3AH5 A;  3GEH A;  1Y1V C;  2JA6 K;  3LAJ A;  2O5J A;  3L4J A;  4QIW L;  4P9S A;  2R7Z A;  1TWH C;  3N0C A;  3GTM C;  4ILD A;  1PJ6 A;  1VLO A;  1XZQ A;  1WOR A;  3BP8 C;  4ZH4 A;  1YX2 A;  4QJV A;  5C4J C;  1TWA K;  3HOV K;  2NVY C;  4KDD A;  3RZD K;  4KN7 A;  4A3E K;  4C3H C;  4A3D K;  2R92 A;  1XZP B;  2WAQ L;  3T02 A;  3S0X A;  1WCM C;  1X31 C;  3M4O C;  4G7Z A;  5TJ3 A;  1DCO A;  3S14 C;  1TWF K;  4C3J C;  3RZO C;  3GTG K;  4WIL A;  5D4D A;  1BDF A;  2WB1 L;  2E2H K;  3SZZ A;  2JA8 K;  4G7O A;  2Y0S L;  2BE5 A;  5IP9 C;  1YNN A;  2XCR B;  3GTQ C;  5EGE A;  4A3F K;  3HOW C;  2E2J C;  4A3G K;  1VJE A;  5IOQ A;  3S15 C;  1IBA A;  4A3I K;  2KWA A;  1ZQ1 C;  1O27 A;  4LK1 A;  1ZVU A;  5IYD C;  3H0G K;  1WOS A;  1TWA A;  3HOZ K;  4Q5S A;  3HOX C;  1WSR A;  3FOE A;  1EK8 A;  1TWG C;  1EQR A;  4FZB A;  4BBS K;  1O24 A;  1GE9 A;  3T01 A;  3GEI A;  1TWF A;  2PMZ D;  2FQT A;  1DCH A;  3GTG A;  2JA5 K;  4A3B C;  2E2H A;  5IP7 C;  3S17 C;  3CQZ K;  3TFJ A;  1J6X A;  2R93 K;  4BY7 K;  5IOS A;  4BXX K;  5M5W K;  1Y1W C;  4YG2 A;  4QIW D;  5M5X K;  4KAT A;  3TTG A;  3I4M K;  1YNJ A;  5M3F K;  3GTJ A;  3GTL K;  1L0W A;  1DCP A;  4WJ3 M;  3GDZ A;  1R9T A;  3K7A K;  4GZY A;  2YU9 A;  2D6F C;  2A69 A;  1WIH A;  1I3Q A;  5IYB C;  2B63 C;  4BY1 K;  3DXJ A;  5C44 C;  1VGX A;  4C3I K;  4AYB D;  4G0V A;  2JA5 A;  3PO2 C;  4A3C K;  3PO3 K;  5JFE A;  3GTP K;  3S1Q K;  3CQZ A;  2EBB A;  4GTF A;  3GSI A;  3S2D C;  2R93 A;  3GTO A;  4A3J C;  1F7V A;  4G0U A;  1AB4 A;  4GTB A;  1O25 A;  2RGR A;  2VUM K;  2CFA B;  1EH1 A;  3GTL A;  4X6A K;  4A3M K;  1XXA A;  3S1M C;  3L4K A;  3HKZ L;  5C4X K;  3AQO A;  1O28 A;  4A3K C;  4OIP A;  1USO A;  4C2M K;  1Y1V K;  1WOP A;  2P5M A;  4BLB A;  1YCL A;  1SFO C;  3IPJ A;  3FHZ A;  4KM8 A;  3BP3 A;  3HOY C;  3GTP A;  2NVY K;  4RMF A;  2R92 C;  1I50 K;  2V6T A;  3TFH A;  5CJ9 A;  3WOD A;  4G7H A;  3S1N C;  3GTK C;  1JOE A;  4WJ4 A;  3M4O K;  4LOW A;  2VUM A;  3V4G A;  1BJT A;  2GAG C;  2NVQ K;  3RZO K;  4MQ9 A;  4KB4 A;  2E2I C;  2NVT K;  3Q3Q A;  3S16 K;  2W7V A;  4P5B A;  1WQF A;  4KN4 A;  1Y1V A;  3LAP A;  5FLM K;  2JA6 A;  4GTA A;  1TWA C;  2A68 A;  3M3Y K;  2PA8 L;  2NVY A;  4A3D C;  2O5I A;  4BBR K;  1JVI A;  3S1R K;  1TWG K;  4PAA A;  1I50 A;  3S2H K;  3I4N K;  3CAG A;  1VRQ C;  3OEP A;  1XPP A;  2ZFZ A;  4OIR A;  5M3M K;  1TWF C;  4MEY A;  2CW0 A;  3T00 A;  2GAH C;  4LLG A;  4KC6 A;  1ZBS A;  1I6V A;  2E2H C;  2JA8 C;  5C3E K;  1B4B A;  1UV7 A;  1TWC K;  3ERE D;  1C0A A;  1K83 K;  3H3V L;  3HOU C;  4A3G C;  5IP7 K;  3S17 K;  2FQO A;  4J3N A;  4Y7N C;  4XLP A;  5IYC C;  3FOF A;  4A3I C;  2JA7 K;  1ISE A;  4A3L K;  1KQ4 A;  1VH2 A;  3GTJ C;  1DD5 A;  2NVX K;  3SZY A;  3NUH A;  1R9T C;  5EGH A;  4FM9 A;  2YU9 C;  3H0G A;  1BS2 A;  3OPF A;  1I3Q C;  1HI9 A;  1XZP A;  2GSO A;  2PPB A;  3A8I A;  4Y52 C;  4XSZ A;  2V6S A;  5TMF A;  4A93 C;  2JA5 C;  2A6H A;  2WAQ D;  4GTC A;  5L46 A;  3FKI K;  1TWC A;  1XZQ B;  3PO2 K;  1O2B A;  1K83 A;  2R93 C;  4QJV B;  5E68 A;  3GTO C;  2JA7 A;  4KAS A;  2WB1 D;  1F93 A;  3I4M C;  1F7U A;  2Y0S D;  3GTL C;  2NVX A;  1EFW A;  1B4A A;  4LK0 A;  3S1M K;  1I6H K;  4A3K K;  1EI6 A;  4BY1 C;  2GSU A;  2R7Z C;  1SFO K;  4A3C C;  3PO3 C;  3GTP C;  3S1Q C;  1TWH K;  3FKI A;  1BGW A;  5M5Y K;  3HOY K;  3GTM K;  3ADA C;  4JK1 A;  1WOO A;  4LR2 A;  3TFI A;  5C4J K;  2PMZ L;  4YFX A;  3A8J A;  2VUM C;  3HXA A;  1G51 A;  3GTK K;  4PAB A;  4C3H K;  1O29 A;  1F9N A;  4KMU A;  1WCM K;  2A6E A;  5IOR A;  1J6V A;  2E2I K;  3S14 K;  1XXB A;  4C3J K;  3G4A A;  4C2M C;  3QX3 A;  4GTD A;  2JA6 C;  1XXC A;  1ZYR A;  4AH6 A;  4BLA A;  3GTQ K;  5IP9 K;  3BUE A;  4KAW X;  3HOW K;  2E2J K;  1SFO A;  4GT9 A;  3S15 K;  1TWH A;  4O2D A;  4NOI A;  3AQP A;  1I50 C;  3GTM A;  3MML B;  4MEX A;  4XLN A;  3HOV C;  3RZD C; 
#chains in the Genus database with same CATH homology
 5IYD K;  4A3E C;  4BY1 K;  3DXJ A;  5C44 C;  5C4X C;  3HOX K;  3GTJ C;  4C3I K;  4LJZ A;  4AYB D;  2NVX K;  3PO2 C;  4A3C K;  3PO3 K;  2NVQ C;  4AYB L;  3GTP K;  3S1Q K;  1R9T C;  1Y1V C;  2JA6 K;  2O5J A;  5FJ8 K;  4QIW L;  2NVT C;  1TWH C;  3S2D C;  2YU9 C;  4YFN A;  3GTG C;  3S16 C;  4A3J C;  3GTM C;  4A3L K;  1I3Q C;  5TMC A;  2PPB A;  3HOU K;  4ZH4 A;  4Y52 C;  2VUM K;  1HQM A;  4XSZ A;  4QJV A;  5C4J C;  1TWA K;  5FLM C;  4A3F C;  3HOV K;  2NVY C;  4Y7N K;  5TMF A;  5IYC K;  4A3B K;  4A93 C;  4A3M K;  3HKZ D;  3RZD K;  3S1M C;  4X6A K;  2JA5 C;  4KN7 A;  4A3E K;  2A6H A;  3HKZ L;  3M3Y C;  4YFK A;  5C4X K;  2WAQ D;  4OIQ A;  4A3D K;  3GTJ K;  3FKI K;  2WAQ L;  1IW7 A;  4A3K C;  3PO2 K;  4OIO A;  1WCM C;  3M4O C;  4G7Z A;  4BBR C;  1Y1W K;  3S1R C;  4OIP A;  4QJV B;  4C2M K;  1R9T K;  3S2H C;  2R93 C;  1Y1V K;  3GTO C;  1TWF K;  3S14 C;  3H0G C;  3I4N C;  3HOZ C;  3RZO C;  2YU9 K;  3GTG K;  1SFO C;  4BBS C;  2WB1 D;  3I4M C;  5D4D A;  1BDF A;  1I3Q K;  2WB1 L;  2Y0S D;  4Q4Z A;  2E2H K;  2JA8 K;  3GTL C;  4G7O A;  2Y0S L;  3HOY C;  4Y52 K;  2BE5 A;  5IP9 C;  1YNN A;  3GTQ C;  3HOW C;  4A3F K;  2E2J C;  2NVY K;  5C3E C;  2R92 C;  4LK0 A;  4A93 K;  4A3G K;  1TWC C;  1I50 K;  3S1M K;  1I6H K;  3S15 C;  3RZD C;  3WOD A;  4X6A C;  1K83 C;  4A3I K;  5IYB K;  4G7H A;  3S1N C;  2B63 K;  3GTK C;  4A3K K;  3M4O K;  5C44 K;  4A3L C;  2JA7 C;  4XSX A;  4LK1 A;  5IYB C;  5IYD C;  4BY1 C;  3GTO K;  3CQZ C;  3H0G K;  3HOZ K;  4Q5S A;  3HOX C;  2NVQ K;  2R7Z C;  3RZO K;  1TWG C;  4MQ9 A;  2NVX C;  2E2I C;  4BXX C;  4BY7 C;  1SFO K;  4A3C C;  3PO3 C;  4BBS K;  3GTP C;  2NVT K;  3S1Q C;  1TWH K;  3S2D K;  3S16 K;  5M5Y K;  4A3J K;  3HOY K;  3GTM K;  4KN4 A;  4JK1 A;  2PMZ D;  5C4J K;  5FLM K;  2PMZ L;  4YFX A;  3K7A C;  2VUM C;  2JA5 K;  1TWA C;  2A68 A;  2PA8 D;  3GTK K;  4A3B C;  3M3Y K;  4C3H K;  2PA8 L;  4KMU A;  5IP7 C;  3S17 C;  3CQZ K;  1WCM K;  4A3D C;  2A6E A;  4BBR K;  2O5I A;  3FKI C;  3S1R K;  2R7Z K;  1TWG K;  4BY7 K;  3S2H K;  2E2I K;  3I4N K;  3S14 K;  4BXX K;  2R93 K;  5M5W K;  1XPP A;  3EQL A;  1Y1W C;  4OIR A;  4C3J K;  4YG2 A;  5M3M K;  4QIW D;  1TWF C;  4MEY A;  5M5X K;  2CW0 A;  4LLG A;  3I4M K;  1YNJ A;  5M3F K;  3GTL K;  2JA6 C;  1ZYR A;  1I6V A;  3GTQ K;  5IP9 K;  3HOW K;  2E2H C;  2JA8 C;  2E2J K;  5C3E K;  3K7A K;  2R92 K;  2JA7 K;  1TWC K;  3H3V D;  4GZY A;  3S15 K;  1K83 K;  4NOI A;  3H3V L;  3HOU C;  4A3G C;  1I50 C;  2A69 A;  4OIN A;  1I6H C;  5IP7 K;  3S17 K;  3S1N K;  4MEX A;  4XLN A;  3HOV C;  4Y7N C;  4XLP A;  5IYC C;  4A3I C;  4A3M C;  1SMY A;  2B63 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...