3S17K

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s17K00
4Q5SA 5D4DA 5M5XK 2JA8C 5IYDK 2NVYK 1IW7A 2NVTK 1I6VA 2NVYC 4LJZA 4QJVA 4YFXA 2NVTC 4GZYA 4X6AK 3S15K 2R92K 4X6AC 2NVXK 2R92C 3S15C 1YNJA 4LK1A 2NVXC 2R7ZK 2Y0SL 1ZYRA 5IYBK 2A6EA 5IYBC 2Y0SD 4BBSC 2BE5A 2VUMK 2A68A 3S2HC 2VUMC 3CQZK 2PMZL 4BY7K 3HOYK 4BY7C 3HOYC 2PMZD 3RZDK 4LLGA 2O5IA 3GTGK 1SFOK 1Y1VK 3GTGC 1TWGK 1SFOC 1Y1VC 1TWGC 1R9TK 4A3KK 1R9TC 3HOVK 4XSXA 5FLMK 4A3KC 3HOWK 3HOVC 3EQLA 4C2MK 5C4JK 3HOWC 2A69A 5C4JC 4NOIA 3M4OK 2JA5K 3M4OC 2JA5C 1TWAK 1TWAC 2PPBA 4G7OA 4AYBL 1I3QK 4YFNA 4A3MK 1I3QC 4A3MC 4AYBD 3S16K 3S16C 3GTPK 5IYCK 3GTPC 5IYCC 2R7ZC 3PO3K 2B63K 5C3EK 4A3CK 2B63C 5C3EC 4A3CC 1K83K 1K83C 1WCMK 4YFKA 2A6HA 5FJ8K 1WCMC 3CQZC 4OIQA 3HOUK 3S1QK 4A3GK 4A3GC 3HOUC 3S1QC 4A3DK 5TMCA 2JA6K 4KMUA 1BDFA 2E2JK 3RZDC 2JA6C 3S2DK 2E2JC 3S2DC 5M5WK 3GTLK 4OIPA 5C44K 1I50K 2PA8L 3GTLC 5C44C 3S14K 1I50C 2PA8D 4G7ZA 5FLMC 1YNNA 3GTMK 4A3JK 3GTMC 3K7AK 4A3JC 3K7AC 4MEYA 1XPPA 4A3EK 2NVQK 4A3DC 4A3EC 2NVQC 4YG2A 1I6HK 3I4MK 1I6HC 4C3HK 4JK1A 3I4MC 2WB1L 3S1NK 4Y52K 3S1NC 4Y52C 4A3BK 2WB1D 4A3BC 3S1RK 3PO3C 3S1RC 4A93K 3GTQK 4MEXA 4A93C 3GTJK 3GTQC 4ZH4A 4QIWL 3GTJC 3HOXK 4A3FK 4A3IK 4A3FC 4A3IC 3HOXC 2WAQL 4QIWD 5IP7K 3S1MK 4Q4ZA 1TWCK 5IP7C 3S1MC 2WAQD 3FKIK 1TWCC 5IYDC 3HOZK 3FKIC 4BXXK 4BXXC 3HOZC 4C3JK 3S14C 4LK0A 4OINA 5M5YK 2O5JA 4MQ9A 4BY1K 2JA8K 4Y7NK 3H0GK 4BY1C 3GTKK 4Y7NC 3H0GC 3S17K 3GTKC 3S17C 2CW0A 1TWFK 3HKZL 3PO2K 1TWFC 3DXJA 4KN4A 3PO2C 3HKZD 5M3FK 4XLNA 3S2HK 4KN7A 4BBSK 4A3LK 3M3YK 4A3LC 3M3YC 5IP9K 4BBRK 2E2HK 4XSZA 5IP9C 4BBRC 2E2HC 4OIOA 3GTOK 4QJVB 4XLPA 3GTOC 1SMYA 2E2IK 3I4NK 2E2IC 3I4NC 1TWHK 3H3VL 2YU9K 1TWHC 4OIRA 5M3MK 2YU9C 4G7HA 3H3VD 3RZOK 5C4XK 2JA7K 4C3IK 3RZOC 2JA7C 2R93K 1HQMA 5C4XC 2R93C 3WODA 1Y1WK 5TMFA 1Y1WC
chains in the Genus database with same CATH superfamily
1EH1A 4Q5SA 2V6TA 1WOOA 1EQRA 4GZYA 4X6AC 1I50A 2R92C 2NVXC 5IYBC 2Y0SD 1IQ0A 3BP8C 2XCQA 2PMZL 3N0CA 1O27A 3N0BA 1O2FB 2P8TA 4LLGA 1IBAA 2O5IA 3LAJA 4KM9A 1HI9A 1Y1VK 1SFOC 1R9TK 3HOVC 5C4JK 3HOWC 4P5AA 4NOIA 3M4OK 2JA5C 1TWAC 1F7UA 4G7OA 1DCHA 4YFNA 1I3QC 4A3MC 3S16K 4C45A 3GTPC 1G51A 1PJ7A 2B63K 5FJ8K 1TWFA 3GDZA 3CQZC 3S1QK 1BJTA 3HOUC 4A3DK 5TMCA 3S2DK 4GTDA 1O2AA 3T00A 2E2JC 5M5WK 3GTLK 5C44K 3OEPA 1I50C 3LPXA 2E2HA 2KWAA 2P5MA 1USOA 1ZVUA 3K7AK 4A3JC 4A3EK 2NVQK 4YG2A 1J6WA 3S1NK 4C3HC 1J98A 4Y52C 3CAGA 4GTLA 3S1RK 2W7VA 4GTEA 3SZYA 4A93K 3GTJK 1RU0A 4G0UA 4A3IC 5TJ3A 3HOXC 2V6UA 1TWCK 2GSUA 3S1MC 2WAQD 5IYDK 4G0WA 4BXXC 3A8KA 1ISEA 1JVIA 4C3JC 2PHCB 3FHZA 5EGEA 5M5YK 1DD5A 4Y7NK 3H0GK 4BY1C 3GTKK 1WSRA 1TWFC 4DDQA 3TFIA 5JFEA 5M3FK 1R9TA 4GTFA 4BBRC 2E2HC 1XZQA 3HXAA 3I4NC 4O2DA 1JQWA 2YU9K 3GEIA 3H3VD 2B63A 2JA7K 3RZOC 1J6VA 4C3IC 1Y1WK 4M1XA 2ZFZA 1XZPA 1XXAA 5M5XK 2JA8C 2NVYK 2NVTK 1I6VA 4QJVA 4KM8A 1VJEA 3S15K 3GTLA 3TFHA 4LK1A 2R7ZK 5IORA 4BBSC 2BE5A 2A68A 4BY7K 4KATA 3FOFA 2PMZD 2RGRA 3JSTA 4WJ3M 1TWGK 1Y1VC 4A3KK 1R9TC 4XSXA 1WQGA 3GTJA 5C4JC 3OPFA 3M4OC 4RMFA 1TWCA 3G4CA 1O25A 3S16C 3PO3K 4A3CK 3H0GA 2B63C 1IS1A 3GTKA 4YFKA 2XCRB 3S1QC 4A3DC 1BDFA 3RZDC 2ZUFA 3S2DC 2Y3PA 4OIPA 2PA8L 3GTLC 5C44C 4KAWX 4GTAA 3FOEA 5FLMC 3GTMK 4XCHA 5L46A 3K7AC 1WQHA 1F7VA 2YU9A 4A3EC 2NVQC 2GAGC 1USMA 2JA7A 1I6HK 1Y1WA 3S1NC 4FZBA 2RH6A 3S1RC 3GTQK 2NVYA 4A93C 4PAAA 4GT9A 4QIWL 1ZBSA 3GTJC 1WOPA 4A3FK 1O28A 4Q4ZA 1TWCC 3V4GA 5IYDC 3HOZK 3GEHA 3S14C 3AD7C 1IE0A 4MQ9A 5E68A 2CFAB 4Y7NC 3H0GC 1WSVA 3GTKC 2CW0A 3A8JA 1X31C 4KN4A 1TWGA 1B4AA 5CJ9A 4XLNA 4KN7A 3G4AA 4LOWA 3M3YK 4A3LK 1WIHA 2FQTA 3BUEA 4XSZA 3AD8C 3GSIA 3GTOK 1SMYA 2E2IK 4KASA 3MMLB 5JVOA 1TWHK 4PABA 1VLOA 2YU9C 2JA7C 1HQMA 1Y1WC 1WORA 3N3YA 5D4DA 2NVYC 4LJZA 4YFXA 2NVTC 1Y1VA 3S15C 1YNJA 3AD9C 3OREA 1ZYRA 2A6EA 1DCPA 4WJ4A 3GTMA 3S2HC 2VUMK 2EBBA 3CQZK 3HOYK 4BY7C 1F93A 1O29A 3GTGK 2D6FC 1TWGC 1PJ6A 4A3KC 4C2MK 3GTQA 1JOEA 2GSNA 4KDDA 4P5BA 1YCLA 3ERED 2PPBA 4AYBL 2GSOA 3NUHA 5IYCK 4ILDA 1J6XA 5C3EK 4A3CC 1K83K 3ADAC 1WCMK 2A6HA 4A3GK 1V5VA 2JA6K 4KMUA 2FQOA 4FM9A 4KB2A 4KB4A 2PA8D 3L4KA 3GTOA 3GTMC 2E2IA 4MEYA 1VGXA 1XPPA 1TWHA 1XXCA 3TTGA 3I4MK 1I6HC 1YX2A 2WB1L 2GAHC 4A3BK 1O2BA 3AQOA 3QX3A 4MEXA 3GTQC 4WILA 2ZUEA 4A3FC 3S0XA 4QIWD 3VA7A 5IP7K 3T02A 3FKIK 3GIRA 3AQPA 3HOZC 1VRQC 5IOTA 2VUMA 4LK0A 1XZQB 2JA8K 1GE9A 3S17K 3BP3A 3HKZL 3PO2K 3GTGA 4KC6A 1KQ4A 1EI6A 1WOSA 4BBSK 4A3LC 3M3YC 1XZPB 5IP9K 4OIOA 4QJVB 3GTOC 3LAPA 1XXBA 2E2IC 3Q3QA 1TWHC 2R7ZA 4G7HA 5C4XK 3L4JA 2R93K 4KMDA 1O24A 1K83A 1WCMA 1EK8A 1B4BA 1UV7A 1WQFA 5CHPA 1IW7A 2JA6A 4X6AK 2R92K 2NVXK 2Y0SL 5IYBK 1ZXOA 2VUMC 3SZZA 1AB4A 3HOYC 1BGWA 5IOSA 3RZDK 3AH5A 4J3NA 1SFOK 1ZQ1C 3GTGC 2XCOA 3HOVK 5FLMK 3HOWK 3EQLA 2A69A 4C2MC 2JA5K 4KMAA 1PJ5A 1VH2A 1TWAK 3FKIA 1I3QK 4A3MK 4AYBD 4LR2A 3GTPK 1L0WA 5IYCC 2R7ZC 5HL8A 5C3EC 1K83C 1WCMC 4OIQA 3HOUK 1F9NA 4A3GC 4G0VA 4AH6A 2E2JK 2JA6C 2V6SA 3S14K 1I50K 4BLAA 4G7ZA 1YNNA 4A3JK 1C0AA 4GFQA 1BS2A 2R93A 4C3HK 4JK1A 3I4MC 4KARA 4Y52K 2WB1D 4LQYA 3TFJA 4A3BC 4BLBA 3PO3C 5EGHA 4ZH4A 5IOQA 4A3IK 3HOXK 1INNA 4GTBA 2R92A 2WAQL 3S1MK 2NVXA 5IP7C 4BXXK 3IPJA 3FKIC 1EFWA 1O26A 3T01A 4C3JK 4OINA 2O5JA 4BY1K 3A8IA 1IL2A 3S17C 2JH3A 4KMHA 1TWFK 4GTCA 1SFOA 3DXJA 3PO2C 3HKZD 4BKWA 3S2HK 4P9SA 1DCOA 4BBRK 2E2HK 2JA5A 3GEEA 5IP9C 1TWAA 4XLPA 1I3QA 3I4NK 2CFAA 3GTPA 3H3VL 4OIRA 5M3MK 3RZOK 4C3IK 5C4XC 2R93C 3WODA 5TMFA 3CQZA
chains in the Genus database with same CATH topology
4Q5SA 5D4DA 5M5XK 2JA8C 5IYDK 2NVYK 1IW7A 2NVTK 1I6VA 2NVYC 4LJZA 4QJVA 4YFXA 2NVTC 4GZYA 4X6AK 3S15K 2R92K 4X6AC 2NVXK 2R92C 3S15C 1YNJA 4LK1A 2NVXC 2R7ZK 2Y0SL 1ZYRA 5IYBK 2A6EA 5IYBC 2Y0SD 4BBSC 2BE5A 2VUMK 2A68A 3S2HC 2VUMC 3CQZK 2PMZL 4BY7K 3HOYK 4BY7C 3HOYC 2PMZD 3RZDK 4LLGA 2O5IA 3GTGK 1SFOK 1Y1VK 3GTGC 1TWGK 1SFOC 1Y1VC 1TWGC 1R9TK 4A3KK 1R9TC 3HOVK 4XSXA 5FLMK 4A3KC 3HOWK 3HOVC 3EQLA 4C2MK 5C4JK 3HOWC 2A69A 5C4JC 4NOIA 3M4OK 2JA5K 3M4OC 2JA5C 1TWAK 1TWAC 2PPBA 4G7OA 4AYBL 1I3QK 4YFNA 4A3MK 1I3QC 4A3MC 4AYBD 3S16K 3S16C 3GTPK 5IYCK 3GTPC 5IYCC 2R7ZC 3PO3K 2B63K 5C3EK 4A3CK 2B63C 5C3EC 4A3CC 1K83K 1K83C 1WCMK 4YFKA 2A6HA 5FJ8K 1WCMC 3CQZC 4OIQA 3HOUK 3S1QK 4A3GK 4A3GC 3HOUC 3S1QC 4A3DK 5TMCA 2JA6K 4KMUA 1BDFA 2E2JK 3RZDC 2JA6C 3S2DK 2E2JC 3S2DC 5M5WK 3GTLK 4OIPA 5C44K 1I50K 2PA8L 3GTLC 5C44C 3S14K 1I50C 2PA8D 4G7ZA 5FLMC 1YNNA 3GTMK 4A3JK 3GTMC 3K7AK 4A3JC 3K7AC 4MEYA 1XPPA 4A3EK 2NVQK 4A3DC 4A3EC 2NVQC 4YG2A 1I6HK 3I4MK 1I6HC 4C3HK 4JK1A 3I4MC 2WB1L 3S1NK 4Y52K 3S1NC 4Y52C 4A3BK 2WB1D 4A3BC 3S1RK 3PO3C 3S1RC 4A93K 3GTQK 4MEXA 4A93C 3GTJK 3GTQC 4ZH4A 4QIWL 3GTJC 3HOXK 4A3FK 4A3IK 4A3FC 4A3IC 3HOXC 2WAQL 4QIWD 5IP7K 3S1MK 4Q4ZA 1TWCK 5IP7C 3S1MC 2WAQD 3FKIK 1TWCC 5IYDC 3HOZK 3FKIC 4BXXK 4BXXC 3HOZC 4C3JK 3S14C 4LK0A 4OINA 5M5YK 2O5JA 4MQ9A 4BY1K 2JA8K 4Y7NK 3H0GK 4BY1C 3GTKK 4Y7NC 3H0GC 3S17K 3GTKC 3S17C 2CW0A 1TWFK 3HKZL 3PO2K 1TWFC 3DXJA 4KN4A 3PO2C 3HKZD 5M3FK 4XLNA 3S2HK 4KN7A 4BBSK 4A3LK 3M3YK 4A3LC 3M3YC 5IP9K 4BBRK 2E2HK 4XSZA 5IP9C 4BBRC 2E2HC 4OIOA 3GTOK 4QJVB 4XLPA 3GTOC 1SMYA 2E2IK 3I4NK 2E2IC 3I4NC 1TWHK 3H3VL 2YU9K 1TWHC 4OIRA 5M3MK 2YU9C 4G7HA 3H3VD 3RZOK 5C4XK 2JA7K 4C3IK 3RZOC 2JA7C 2R93K 1HQMA 5C4XC 2R93C 3WODA 1Y1WK 5TMFA 1Y1WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5S A;  5D4D A;  5M5X K;  2JA8 C;  5IYD K;  2NVY K;  1IW7 A;  2NVT K;  1I6V A;  2NVY C;  4LJZ A;  4QJV A;  4YFX A;  2NVT C;  4GZY A;  4X6A K;  3S15 K;  2R92 K;  4X6A C;  2NVX K;  2R92 C;  3S15 C;  1YNJ A;  4LK1 A;  2NVX C;  2R7Z K;  2Y0S L;  1ZYR A;  5IYB K;  2A6E A;  5IYB C;  2Y0S D;  4BBS C;  2BE5 A;  2VUM K;  2A68 A;  3S2H C;  2VUM C;  3CQZ K;  2PMZ L;  4BY7 K;  3HOY K;  4BY7 C;  3HOY C;  2PMZ D;  3RZD K;  4LLG A;  2O5I A;  3GTG K;  1SFO K;  1Y1V K;  3GTG C;  1TWG K;  1SFO C;  1Y1V C;  1TWG C;  1R9T K;  4A3K K;  1R9T C;  3HOV K;  4XSX A;  5FLM K;  4A3K C;  3HOW K;  3HOV C;  3EQL A;  4C2M K;  5C4J K;  3HOW C;  2A69 A;  5C4J C;  4NOI A;  3M4O K;  2JA5 K;  3M4O C;  2JA5 C;  1TWA K;  1TWA C;  2PPB A;  4G7O A;  4AYB L;  1I3Q K;  4YFN A;  4A3M K;  1I3Q C;  4A3M C;  4AYB D;  3S16 K;  3S16 C;  3GTP K;  5IYC K;  3GTP C;  5IYC C;  2R7Z C;  3PO3 K;  2B63 K;  5C3E K;  4A3C K;  2B63 C;  5C3E C;  4A3C C;  1K83 K;  1K83 C;  1WCM K;  4YFK A;  2A6H A;  5FJ8 K;  1WCM C;  3CQZ C;  4OIQ A;  3HOU K;  3S1Q K;  4A3G K;  4A3G C;  3HOU C;  3S1Q C;  4A3D K;  5TMC A;  2JA6 K;  4KMU A;  1BDF A;  2E2J K;  3RZD C;  2JA6 C;  3S2D K;  2E2J C;  3S2D C;  5M5W K;  3GTL K;  4OIP A;  5C44 K;  1I50 K;  2PA8 L;  3GTL C;  5C44 C;  3S14 K;  1I50 C;  2PA8 D;  4G7Z A;  5FLM C;  1YNN A;  3GTM K;  4A3J K;  3GTM C;  3K7A K;  4A3J C;  3K7A C;  4MEY A;  1XPP A;  4A3E K;  2NVQ K;  4A3D C;  4A3E C;  2NVQ C;  4YG2 A;  1I6H K;  3I4M K;  1I6H C;  4C3H K;  4JK1 A;  3I4M C;  2WB1 L;  3S1N K;  4Y52 K;  3S1N C;  4Y52 C;  4A3B K;  2WB1 D;  4A3B C;  3S1R K;  3PO3 C;  3S1R C;  4A93 K;  3GTQ K;  4MEX A;  4A93 C;  3GTJ K;  3GTQ C;  4ZH4 A;  4QIW L;  3GTJ C;  3HOX K;  4A3F K;  4A3I K;  4A3F C;  4A3I C;  3HOX C;  2WAQ L;  4QIW D;  5IP7 K;  3S1M K;  4Q4Z A;  1TWC K;  5IP7 C;  3S1M C;  2WAQ D;  3FKI K;  1TWC C;  5IYD C;  3HOZ K;  3FKI C;  4BXX K;  4BXX C;  3HOZ C;  4C3J K;  3S14 C;  4LK0 A;  4OIN A;  5M5Y K;  2O5J A;  4MQ9 A;  4BY1 K;  2JA8 K;  4Y7N K;  3H0G K;  4BY1 C;  3GTK K;  4Y7N C;  3H0G C;  3S17 K;  3GTK C;  3S17 C;  2CW0 A;  1TWF K;  3HKZ L;  3PO2 K;  1TWF C;  3DXJ A;  4KN4 A;  3PO2 C;  3HKZ D;  5M3F K;  4XLN A;  3S2H K;  4KN7 A;  4BBS K;  4A3L K;  3M3Y K;  4A3L C;  3M3Y C;  5IP9 K;  4BBR K;  2E2H K;  4XSZ A;  5IP9 C;  4BBR C;  2E2H C;  4OIO A;  3GTO K;  4QJV B;  4XLP A;  3GTO C;  1SMY A;  2E2I K;  3I4N K;  2E2I C;  3I4N C;  1TWH K;  3H3V L;  2YU9 K;  1TWH C;  4OIR A;  5M3M K;  2YU9 C;  4G7H A;  3H3V D;  3RZO K;  5C4X K;  2JA7 K;  4C3I K;  3RZO C;  2JA7 C;  2R93 K;  1HQM A;  5C4X C;  2R93 C;  3WOD A;  1Y1W K;  5TMF A;  1Y1W C; 
#chains in the Genus database with same CATH topology
 1EH1 A;  4Q5S A;  2V6T A;  1WOO A;  1EQR A;  4GZY A;  4X6A C;  1I50 A;  2R92 C;  2NVX C;  5IYB C;  2Y0S D;  1IQ0 A;  3BP8 C;  2XCQ A;  2PMZ L;  3N0C A;  1O27 A;  3N0B A;  1O2F B;  2P8T A;  4LLG A;  1IBA A;  2O5I A;  3LAJ A;  4KM9 A;  1HI9 A;  1Y1V K;  1SFO C;  1R9T K;  3HOV C;  5C4J K;  3HOW C;  4P5A A;  4NOI A;  3M4O K;  2JA5 C;  1TWA C;  1F7U A;  4G7O A;  1DCH A;  4YFN A;  1I3Q C;  4A3M C;  3S16 K;  4C45 A;  3GTP C;  1G51 A;  1PJ7 A;  2B63 K;  5FJ8 K;  1TWF A;  3GDZ A;  3CQZ C;  3S1Q K;  1BJT A;  3HOU C;  4A3D K;  5TMC A;  3S2D K;  4GTD A;  1O2A A;  3T00 A;  2E2J C;  5M5W K;  3GTL K;  5C44 K;  3OEP A;  1I50 C;  3LPX A;  2E2H A;  2KWA A;  2P5M A;  1USO A;  1ZVU A;  3K7A K;  4A3J C;  4A3E K;  2NVQ K;  4YG2 A;  1J6W A;  3S1N K;  4C3H C;  1J98 A;  4Y52 C;  3CAG A;  4GTL A;  3S1R K;  2W7V A;  4GTE A;  3SZY A;  4A93 K;  3GTJ K;  1RU0 A;  4G0U A;  4A3I C;  5TJ3 A;  3HOX C;  2V6U A;  1TWC K;  2GSU A;  3S1M C;  2WAQ D;  5IYD K;  4G0W A;  4BXX C;  3A8K A;  1ISE A;  1JVI A;  4C3J C;  2PHC B;  3FHZ A;  5EGE A;  5M5Y K;  1DD5 A;  4Y7N K;  3H0G K;  4BY1 C;  3GTK K;  1WSR A;  1TWF C;  4DDQ A;  3TFI A;  5JFE A;  5M3F K;  1R9T A;  4GTF A;  4BBR C;  2E2H C;  1XZQ A;  3HXA A;  3I4N C;  4O2D A;  1JQW A;  2YU9 K;  3GEI A;  3H3V D;  2B63 A;  2JA7 K;  3RZO C;  1J6V A;  4C3I C;  1Y1W K;  4M1X A;  2ZFZ A;  1XZP A;  1XXA A;  5M5X K;  2JA8 C;  2NVY K;  2NVT K;  1I6V A;  4QJV A;  4KM8 A;  1VJE A;  3S15 K;  3GTL A;  3TFH A;  4LK1 A;  2R7Z K;  5IOR A;  4BBS C;  2BE5 A;  2A68 A;  4BY7 K;  4KAT A;  3FOF A;  2PMZ D;  2RGR A;  3JST A;  4WJ3 M;  1TWG K;  1Y1V C;  4A3K K;  1R9T C;  4XSX A;  1WQG A;  3GTJ A;  5C4J C;  3OPF A;  3M4O C;  4RMF A;  1TWC A;  3G4C A;  1O25 A;  3S16 C;  3PO3 K;  4A3C K;  3H0G A;  2B63 C;  1IS1 A;  3GTK A;  4YFK A;  2XCR B;  3S1Q C;  4A3D C;  1BDF A;  3RZD C;  2ZUF A;  3S2D C;  2Y3P A;  4OIP A;  2PA8 L;  3GTL C;  5C44 C;  4KAW X;  4GTA A;  3FOE A;  5FLM C;  3GTM K;  4XCH A;  5L46 A;  3K7A C;  1WQH A;  1F7V A;  2YU9 A;  4A3E C;  2NVQ C;  2GAG C;  1USM A;  2JA7 A;  1I6H K;  1Y1W A;  3S1N C;  4FZB A;  2RH6 A;  3S1R C;  3GTQ K;  2NVY A;  4A93 C;  4PAA A;  4GT9 A;  4QIW L;  1ZBS A;  3GTJ C;  1WOP A;  4A3F K;  1O28 A;  4Q4Z A;  1TWC C;  3V4G A;  5IYD C;  3HOZ K;  3GEH A;  3S14 C;  3AD7 C;  1IE0 A;  4MQ9 A;  5E68 A;  2CFA B;  4Y7N C;  3H0G C;  1WSV A;  3GTK C;  2CW0 A;  3A8J A;  1X31 C;  4KN4 A;  1TWG A;  1B4A A;  5CJ9 A;  4XLN A;  4KN7 A;  3G4A A;  4LOW A;  3M3Y K;  4A3L K;  1WIH A;  2FQT A;  3BUE A;  4XSZ A;  3AD8 C;  3GSI A;  3GTO K;  1SMY A;  2E2I K;  4KAS A;  3MML B;  5JVO A;  1TWH K;  4PAB A;  1VLO A;  2YU9 C;  2JA7 C;  1HQM A;  1Y1W C;  1WOR A;  3N3Y A;  5D4D A;  2NVY C;  4LJZ A;  4YFX A;  2NVT C;  1Y1V A;  3S15 C;  1YNJ A;  3AD9 C;  3ORE A;  1ZYR A;  2A6E A;  1DCP A;  4WJ4 A;  3GTM A;  3S2H C;  2VUM K;  2EBB A;  3CQZ K;  3HOY K;  4BY7 C;  1F93 A;  1O29 A;  3GTG K;  2D6F C;  1TWG C;  1PJ6 A;  4A3K C;  4C2M K;  3GTQ A;  1JOE A;  2GSN A;  4KDD A;  4P5B A;  1YCL A;  3ERE D;  2PPB A;  4AYB L;  2GSO A;  3NUH A;  5IYC K;  4ILD A;  1J6X A;  5C3E K;  4A3C C;  1K83 K;  3ADA C;  1WCM K;  2A6H A;  4A3G K;  1V5V A;  2JA6 K;  4KMU A;  2FQO A;  4FM9 A;  4KB2 A;  4KB4 A;  2PA8 D;  3L4K A;  3GTO A;  3GTM C;  2E2I A;  4MEY A;  1VGX A;  1XPP A;  1TWH A;  1XXC A;  3TTG A;  3I4M K;  1I6H C;  1YX2 A;  2WB1 L;  2GAH C;  4A3B K;  1O2B A;  3AQO A;  3QX3 A;  4MEX A;  3GTQ C;  4WIL A;  2ZUE A;  4A3F C;  3S0X A;  4QIW D;  3VA7 A;  5IP7 K;  3T02 A;  3FKI K;  3GIR A;  3AQP A;  3HOZ C;  1VRQ C;  5IOT A;  2VUM A;  4LK0 A;  1XZQ B;  2JA8 K;  1GE9 A;  3S17 K;  3BP3 A;  3HKZ L;  3PO2 K;  3GTG A;  4KC6 A;  1KQ4 A;  1EI6 A;  1WOS A;  4BBS K;  4A3L C;  3M3Y C;  1XZP B;  5IP9 K;  4OIO A;  4QJV B;  3GTO C;  3LAP A;  1XXB A;  2E2I C;  3Q3Q A;  1TWH C;  2R7Z A;  4G7H A;  5C4X K;  3L4J A;  2R93 K;  4KMD A;  1O24 A;  1K83 A;  1WCM A;  1EK8 A;  1B4B A;  1UV7 A;  1WQF A;  5CHP A;  1IW7 A;  2JA6 A;  4X6A K;  2R92 K;  2NVX K;  2Y0S L;  5IYB K;  1ZXO A;  2VUM C;  3SZZ A;  1AB4 A;  3HOY C;  1BGW A;  5IOS A;  3RZD K;  3AH5 A;  4J3N A;  1SFO K;  1ZQ1 C;  3GTG C;  2XCO A;  3HOV K;  5FLM K;  3HOW K;  3EQL A;  2A69 A;  4C2M C;  2JA5 K;  4KMA A;  1PJ5 A;  1VH2 A;  1TWA K;  3FKI A;  1I3Q K;  4A3M K;  4AYB D;  4LR2 A;  3GTP K;  1L0W A;  5IYC C;  2R7Z C;  5HL8 A;  5C3E C;  1K83 C;  1WCM C;  4OIQ A;  3HOU K;  1F9N A;  4A3G C;  4G0V A;  4AH6 A;  2E2J K;  2JA6 C;  2V6S A;  3S14 K;  1I50 K;  4BLA A;  4G7Z A;  1YNN A;  4A3J K;  1C0A A;  4GFQ A;  1BS2 A;  2R93 A;  4C3H K;  4JK1 A;  3I4M C;  4KAR A;  4Y52 K;  2WB1 D;  4LQY A;  3TFJ A;  4A3B C;  4BLB A;  3PO3 C;  5EGH A;  4ZH4 A;  5IOQ A;  4A3I K;  3HOX K;  1INN A;  4GTB A;  2R92 A;  2WAQ L;  3S1M K;  2NVX A;  5IP7 C;  4BXX K;  3IPJ A;  3FKI C;  1EFW A;  1O26 A;  3T01 A;  4C3J K;  4OIN A;  2O5J A;  4BY1 K;  3A8I A;  1IL2 A;  3S17 C;  2JH3 A;  4KMH A;  1TWF K;  4GTC A;  1SFO A;  3DXJ A;  3PO2 C;  3HKZ D;  4BKW A;  3S2H K;  4P9S A;  1DCO A;  4BBR K;  2E2H K;  2JA5 A;  3GEE A;  5IP9 C;  1TWA A;  4XLP A;  1I3Q A;  3I4N K;  2CFA A;  3GTP A;  3H3V L;  4OIR A;  5M3M K;  3RZO K;  4C3I K;  5C4X C;  2R93 C;  3WOD A;  5TMF A;  3CQZ A; 
#chains in the Genus database with same CATH homology
 4Q5S A;  5D4D A;  5M5X K;  2JA8 C;  5IYD K;  2NVY K;  1IW7 A;  2NVT K;  1I6V A;  2NVY C;  4LJZ A;  4QJV A;  4YFX A;  2NVT C;  4GZY A;  4X6A K;  3S15 K;  2R92 K;  4X6A C;  2NVX K;  2R92 C;  3S15 C;  1YNJ A;  4LK1 A;  2NVX C;  2R7Z K;  2Y0S L;  1ZYR A;  5IYB K;  2A6E A;  5IYB C;  2Y0S D;  4BBS C;  2BE5 A;  2VUM K;  2A68 A;  3S2H C;  2VUM C;  3CQZ K;  2PMZ L;  4BY7 K;  3HOY K;  4BY7 C;  3HOY C;  2PMZ D;  3RZD K;  4LLG A;  2O5I A;  3GTG K;  1SFO K;  1Y1V K;  3GTG C;  1TWG K;  1SFO C;  1Y1V C;  1TWG C;  1R9T K;  4A3K K;  1R9T C;  3HOV K;  4XSX A;  5FLM K;  4A3K C;  3HOW K;  3HOV C;  3EQL A;  4C2M K;  5C4J K;  3HOW C;  2A69 A;  5C4J C;  4NOI A;  3M4O K;  2JA5 K;  3M4O C;  2JA5 C;  1TWA K;  1TWA C;  2PPB A;  4G7O A;  4AYB L;  1I3Q K;  4YFN A;  4A3M K;  1I3Q C;  4A3M C;  4AYB D;  3S16 K;  3S16 C;  3GTP K;  5IYC K;  3GTP C;  5IYC C;  2R7Z C;  3PO3 K;  2B63 K;  5C3E K;  4A3C K;  2B63 C;  5C3E C;  4A3C C;  1K83 K;  1K83 C;  1WCM K;  4YFK A;  2A6H A;  5FJ8 K;  1WCM C;  3CQZ C;  4OIQ A;  3HOU K;  3S1Q K;  4A3G K;  4A3G C;  3HOU C;  3S1Q C;  4A3D K;  5TMC A;  2JA6 K;  4KMU A;  1BDF A;  2E2J K;  3RZD C;  2JA6 C;  3S2D K;  2E2J C;  3S2D C;  5M5W K;  3GTL K;  4OIP A;  5C44 K;  1I50 K;  2PA8 L;  3GTL C;  5C44 C;  3S14 K;  1I50 C;  2PA8 D;  4G7Z A;  5FLM C;  1YNN A;  3GTM K;  4A3J K;  3GTM C;  3K7A K;  4A3J C;  3K7A C;  4MEY A;  1XPP A;  4A3E K;  2NVQ K;  4A3D C;  4A3E C;  2NVQ C;  4YG2 A;  1I6H K;  3I4M K;  1I6H C;  4C3H K;  4JK1 A;  3I4M C;  2WB1 L;  3S1N K;  4Y52 K;  3S1N C;  4Y52 C;  4A3B K;  2WB1 D;  4A3B C;  3S1R K;  3PO3 C;  3S1R C;  4A93 K;  3GTQ K;  4MEX A;  4A93 C;  3GTJ K;  3GTQ C;  4ZH4 A;  4QIW L;  3GTJ C;  3HOX K;  4A3F K;  4A3I K;  4A3F C;  4A3I C;  3HOX C;  2WAQ L;  4QIW D;  5IP7 K;  3S1M K;  4Q4Z A;  1TWC K;  5IP7 C;  3S1M C;  2WAQ D;  3FKI K;  1TWC C;  5IYD C;  3HOZ K;  3FKI C;  4BXX K;  4BXX C;  3HOZ C;  4C3J K;  3S14 C;  4LK0 A;  4OIN A;  5M5Y K;  2O5J A;  4MQ9 A;  4BY1 K;  2JA8 K;  4Y7N K;  3H0G K;  4BY1 C;  3GTK K;  4Y7N C;  3H0G C;  3S17 K;  3GTK C;  3S17 C;  2CW0 A;  1TWF K;  3HKZ L;  3PO2 K;  1TWF C;  3DXJ A;  4KN4 A;  3PO2 C;  3HKZ D;  5M3F K;  4XLN A;  3S2H K;  4KN7 A;  4BBS K;  4A3L K;  3M3Y K;  4A3L C;  3M3Y C;  5IP9 K;  4BBR K;  2E2H K;  4XSZ A;  5IP9 C;  4BBR C;  2E2H C;  4OIO A;  3GTO K;  4QJV B;  4XLP A;  3GTO C;  1SMY A;  2E2I K;  3I4N K;  2E2I C;  3I4N C;  1TWH K;  3H3V L;  2YU9 K;  1TWH C;  4OIR A;  5M3M K;  2YU9 C;  4G7H A;  3H3V D;  3RZO K;  5C4X K;  2JA7 K;  4C3I K;  3RZO C;  2JA7 C;  2R93 K;  1HQM A;  5C4X C;  2R93 C;  3WOD A;  1Y1W K;  5TMF A;  1Y1W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...