3S17K

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s17K00
3GTLC 1IW7A 3S1NK 4C2MK 2NVTC 1HQMA 4C3HK 3HOYK 1I6HC 3GTOK 3EQLA 2R93C 4BY7C 4XSXA 1Y1VK 4A3JK 2R7ZC 4A93C 1K83C 4A3KC 4A3GK 4OIRA 4Y52C 5IP7K 2E2HC 3GTPK 5C4XC 3S16C 4XLNA 3DXJA 1R9TK 4KN4A 4LLGA 4A3EK 4A3IK 3FKIK 2R92K 5M5WK 4OIPA 3HOXK 5M3FK 3S1QC 2VUMC 4A3LC 4G7ZA 1BDFA 1TWCK 1TWGC 4G7HA 3S2HC 2PA8D 4X6AK 2BE5A 4A3FC 3GTLK 3S1RK 3K7AC 3PO2C 2E2JC 1I3QC 2NVTK 3PO3C 1Y1WC 2JA8C 3HOUC 3H0GC 5IYCC 4A3DC 5IYDC 1TWFC 2A68A 2PA8L 4YFNA 4BY7K 2R7ZK 4LK0A 3GTKC 3GTMC 4A93K 1K83K 5C4JC 2WB1L 4GZYA 2YU9K 5D4DA 5IYBC 3GTQK 4Y52K 5C4XK 2E2HK 4A3CC 3S16K 1SMYA 5TMCA 4MEYA 4Y7NC 3HOWC 4BXXK 3M4OC 5C3EK 1WCMC 1TWGK 3S2HK 3GTGC 4A3BC 3PO2K 4LK1A 4MQ9A 3PO3K 3K7AK 3HOVC 4BY1C 3I4MC 1TWHC 5IP9C 3WODA 5FLMC 1Y1WK 2JA8K 3HOUK 4BBSC 4QIWL 4Q4ZA 1XPPA 4XSZA 2JA5C 4OIOA 3RZDC 5C44K 3HOWK 3S14K 4A3DK 5IYDK 3GTKK 2WB1D 5M5YK 2B63C 3S1MC 3CQZC 2NVYC 1ZYRA 1SFOC 1I6HK 2R93K 1I6VA 4A3CK 1I50C 3RZOC 3S17C 1TWAC 3S15C 4C3IK 4A3KK 2NVXC 3M4OK 2NVQC 4KMUA 3M3YC 4BY1K 3HKZD 2O5JA 5M5XK 4XLPA 3I4MK 1TWHK 5IP9K 2A6EA 5FLMK 2PMZD 2VUMK 4A3LK 3S1QK 4QIWD 4BBSK 2Y0SL 3RZDK 2JA5K 3HOZC 4QJVB 4A3FK 1R9TC 2E2JK 1I3QK 3HKZL 2B63K 3S1MK 4YG2A 2A6HA 2NVYK 2PMZL 3CQZK 3FKIC 3H0GK 4NOIA 4AYBL 4YFXA 1I50K 5IYCK 1TWFK 3RZOK 1TWAK 3S17K 3GTMK 3S15K 2A69A 5C4JK 3S1RC 2NVXK 2JA6C 4KN7A 5IYBK 5TMFA 2NVQK 3I4NC 4MEXA 4A3MC 2E2IC 4BBRC 3S2DC 5FJ8K 2JA7C 3M3YK 3GTJC 1YNNA 4Y7NK 2O5IA 3S1NC 2WAQD 3GTJK 2YU9C 2Y0SD 4YFKA 1WCMK 3GTQC 3H3VD 4LJZA 3GTGK 3GTOC 3HOZK 3HOYC 4A3BK 3HOVK 2PPBA 1Y1VC 1YNJA 4A3JC 4OINA 2WAQL 4AYBD 2CW0A 4BXXC 4ZH4A 4A3GC 3H3VL 5IP7C 5C3EC 3GTPC 4JK1A 4OIQA 4C3JK 2JA6K 4QJVA 4A3EC 4A3IC 1SFOK 2R92C 3HOXC 4A3MK 2E2IK 4BBRK 3I4NK 3S2DK 4G7OA 4Q5SA 2JA7K 3S14C 5M3MK 5C44C 1TWCC 4X6AC
chains in the Genus database with same CATH superfamily
4GTDA 3HOYK 3GTQA 2R93C 1UV7A 3EQLA 2E2HA 1ISEA 3L4KA 3Q3QA 1Y1VK 4A3JK 3T01A 1K83C 3G4AA 1O2FB 4OIRA 3GTPK 5C4XC 4GTCA 2P5MA 3GEEA 4A3EK 4A3IK 4A3LC 2VUMC 5CJ9A 1BDFA 4KM9A 2BE5A 3PO2C 1Y1WC 2GAHC 2R93A 3GDZA 3OEPA 4GZYA 3GTMC 1GE9A 1VLOA 1O26A 5D4DA 1YCLA 3TFIA 1TWHA 2VUMA 5C3EK 2D6FC 1IE0A 1WIHA 3MMLB 3GTGC 4MQ9A 3PO3K 3K7AK 3HOVC 4BY1C 2B63A 1J6XA 3HOUK 1F9NA 2NVYA 1XPPA 4XSZA 1PJ7A 3RZDC 5C44K 3GTKK 3GTMA 2WB1D 4C3JC 4P5BA 1SFOC 1I6VA 4BLAA 4A3KK 4C45A 1IL2A 3M3YC 3GTGA 3N0CA 3GSIA 2O5JA 3HKZD 3I4MK 3S1QK 5IP9K 4BBSK 1WOOA 1XXCA 1PJ6A 2E2JK 3IPJA 3S1MK 2A6HA 2V6TA 1SFOA 3FOFA 1I50K 1XZPB 5IYCK 5IORA 2E2IA 1TWFK 2GSOA 1TWAK 3S17K 5C4JK 3S1RC 2NVXK 5IOTA 5TMFA 2NVQK 3I4NC 4KB2A 1WOPA 3CAGA 1WORA 4KC6A 5E68A 2ZFZA 2Y3PA 4YFKA 3HXAA 3HOZK 4LJZA 3GTOC 2FQTA 2PPBA 4KM8A 2WAQL 4FZBA 5IP7C 4JK1A 4QJVA 2R92C 1X31C 1PJ5A 4BBRK 4LOWA 1IQ0A 3HOWC 2V6SA 1EI6A 3GTLC 2R7ZA 1O24A 2NVTC 4WJ4A 5L46A 1WOSA 3LAJA 1KQ4A 4G0UA 3V4GA 3OPFA 4GTFA 4C3IC 4A3GK 4Y52C 2E2HC 1F93A 3S16C 4XLNA 1TWGA 4KN4A 1ZBSA 1WSVA 4FM9A 3FKIK 4OIPA 5M3FK 1BGWA 1TWCK 4G7HA 4BKWA 3S2HC 4KARA 1I3QC 1WQGA 1YX2A 1ZQ1C 2JA8C 4A3DC 2A68A 4YFNA 2PA8L 4KASA 1K83K 1XZQB 2YU9K 4G0VA 5IYBC 5C4XK 2JH3A 4A3CC 1J6WA 3N3YA 3BP3A 2JA5A 4A3BC 3PO2K 4LK1A 3AD7C 1I3QA 1IBAA 1TWHC 5FLMC 1Y1WK 3CQZA 4QIWL 4KAWX 4LQYA 3S14K 4OIOA 2KWAA 3GEIA 3TFHA 3NUHA 1EH1A 5M5YK 2B63C 2NVYC 1VGXA 1I6HK 4J3NA 3AH5A 3RZOC 1O2BA 1O2AA 4KMUA 1DD5A 2V6UA 4BY1K 3AQOA 2A6EA 5IOSA 3RZDK 1WQHA 4A3FK 3FHZA 2P8TA 4YG2A 2JA6A 2PMZL 3H0GK 2JA7A 3GTJA 5HL8A 2PHCB 4KN7A 3S2DC 4A3MC 2E2IC 5FJ8K 3M3YK 1YNNA 2GSUA 4Y7NK 1Y1VA 3S1NC 2WAQD 2Y0SD 1WCMK 3GTPA 1ZVUA 4PABA 1C0AA 4ILDA 4AYBD 2CW0A 1JOEA 1DCPA 3H3VL 5C3EC 4OIQA 1EQRA 4GFQA 2GAGC 3ADAC 4G7OA 3I4NK 3HOXC 4P9SA 3BP8C 5C44C 2CFAB 4X6AC 4PAAA 1XZPA 1VJEA 4C2MK 4C3HK 1HI9A 3GTOK 1BJTA 4BY7C 3A8JA 2R7ZC 4A93C 3AD9C 4A3KC 2FQOA 3SZYA 5IP7K 3LPXA 4O2DA 3DXJA 1R9TK 4LLGA 1INNA 2R92K 3LAPA 3S1QC 1O28A 2XCRB 4G7ZA 5CHPA 1TWGC 2PA8D 3GTLK 2E2JC 2NVTK 3GTKA 5IYCC 5IYDC 1TWFC 3T02A 3JSTA 5C4JC 2WB1L 4GTAA 3GTQK 4Y52K 2E2HK 3S16K 5TMCA 4BXXK 1EK8A 3M4OC 3S2HK 1O27A 3TTGA 3OREA 1B4AA 4WILA 2JA8K 4Q4ZA 2JA5C 4A3DK 1I50A 4KB4A 4KMHA 1TWFA 1WQFA 1TWAA 2NVXA 3CQZC 2R93K 3AQPA 4A3CK 4DDQA 3S15C 1XZQA 1DCOA 1DCHA 1O29A 5M5XK 4A3LK 1TWHK 5FLMK 2PMZD 2VUMK 2ZUFA 1F7VA 2B63K 2RGRA 2NVYK 1G51A 3FKIC 4BLBA 4NOIA 3RZOK 3GTMK 1ZXOA 2JA6C 1USOA 2JA7C 1VRQC 3GTJC 5TJ3A 1VH2A 1USMA 2YU9C 3HOYC 3H3VD 3GTGK 4XCHA 3SZZA 3HOVK 4M1XA 1Y1VC 1YNJA 4A3JC 4OINA 3FKIA 3GTPC 1TWCA 4C3JK 4A3EC 4A3IC 1SFOK 3QX3A 1F7UA 2XCQA 4A3MK 2E2IK 3S2DK 1JQWA 4GT9A 3S14C 1XXAA 1IW7A 3S1NK 1K83A 5EGHA 1HQMA 2YU9A 1I6HC 1V5VA 1J6VA 5EGEA 3T00A 1IS1A 4XSXA 3GIRA 1O25A 4AH6A 1WSRA 5M5WK 3HOXK 3A8IA 1Y1WA 4GTBA 2EBBA 4LR2A 4X6AK 4A3FC 3S1RK 3K7AC 3PO3C 1J98A 1B4BA 4WJ3M 3HOUC 3H0GC 4P5AA 4RMFA 4BY7K 2R7ZK 4LK0A 3GTKC 4A93K 4GTLA 2CFAA 3G4CA 3A8KA 1SMYA 3FOEA 4MEYA 4Y7NC 3GEHA 4KMDA 1WCMC 1TWGK 1BS2A 5JFEA 3S0XA 3I4MC 5IP9C 3WODA 4BBSC 1L0WA 3H0GA 1AB4A 2XCOA 5IYDK 3HOWK 1JVIA 4KMAA 1RU0A 3S1MC 1ZYRA 3N0BA 1I50C 4KATA 3S17C 1TWAC 4GTEA 4C3IK 2NVXC 4C2MC 3M4OK 2NVQC 4C3HC 5IOQA 1WCMA 4XLPA 3L4JA 4QIWD 2Y0SL 2JA5K 1XXBA 3HOZC 4QJVB 1R9TC 3TFJA 1I3QK 3HKZL 3CQZK 4AYBL 4YFXA 1EFWA 2ZUEA 3S15K 2A69A 4KDDA 5IYBK 3AD8C 4MEXA 4BBRC 4G0WA 3GTOA 2O5IA 3GTQC 4A3BK 3BUEA 3ERED 1R9TA 2R92A 2RH6A 4BXXC 4ZH4A 4A3GC 2W7VA 2GSNA 3VA7A 2JA6K 3GTLA 5JVOA 4Q5SA 2JA7K 5M3MK 3GTJK 1TWCC
chains in the Genus database with same CATH topology
3GTLC 1IW7A 3S1NK 4C2MK 2NVTC 1HQMA 4C3HK 3HOYK 1I6HC 3GTOK 3EQLA 2R93C 4BY7C 4XSXA 1Y1VK 4A3JK 2R7ZC 4A93C 1K83C 4A3KC 4A3GK 4OIRA 4Y52C 5IP7K 2E2HC 3GTPK 5C4XC 3S16C 4XLNA 3DXJA 1R9TK 4KN4A 4LLGA 4A3EK 4A3IK 3FKIK 2R92K 5M5WK 4OIPA 3HOXK 5M3FK 3S1QC 2VUMC 4A3LC 4G7ZA 1BDFA 1TWCK 1TWGC 4G7HA 3S2HC 2PA8D 4X6AK 2BE5A 4A3FC 3GTLK 3S1RK 3K7AC 3PO2C 2E2JC 1I3QC 2NVTK 3PO3C 1Y1WC 2JA8C 3HOUC 3H0GC 5IYCC 4A3DC 5IYDC 1TWFC 2A68A 2PA8L 4YFNA 4BY7K 2R7ZK 4LK0A 3GTKC 3GTMC 4A93K 1K83K 5C4JC 2WB1L 4GZYA 2YU9K 5D4DA 5IYBC 3GTQK 4Y52K 5C4XK 2E2HK 4A3CC 3S16K 1SMYA 5TMCA 4MEYA 4Y7NC 3HOWC 4BXXK 3M4OC 5C3EK 1WCMC 1TWGK 3S2HK 3GTGC 4A3BC 3PO2K 4LK1A 4MQ9A 3PO3K 3K7AK 3HOVC 4BY1C 3I4MC 1TWHC 5IP9C 3WODA 5FLMC 1Y1WK 2JA8K 3HOUK 4BBSC 4QIWL 4Q4ZA 1XPPA 4XSZA 2JA5C 4OIOA 3RZDC 5C44K 3HOWK 3S14K 4A3DK 5IYDK 3GTKK 2WB1D 5M5YK 2B63C 3S1MC 3CQZC 2NVYC 1ZYRA 1SFOC 1I6HK 2R93K 1I6VA 4A3CK 1I50C 3RZOC 3S17C 1TWAC 3S15C 4C3IK 4A3KK 2NVXC 3M4OK 2NVQC 4KMUA 3M3YC 4BY1K 3HKZD 2O5JA 5M5XK 4XLPA 3I4MK 1TWHK 5IP9K 2A6EA 5FLMK 2PMZD 2VUMK 4A3LK 3S1QK 4QIWD 4BBSK 2Y0SL 3RZDK 2JA5K 3HOZC 4QJVB 4A3FK 1R9TC 2E2JK 1I3QK 3HKZL 2B63K 3S1MK 4YG2A 2A6HA 2NVYK 2PMZL 3CQZK 3FKIC 3H0GK 4NOIA 4AYBL 4YFXA 1I50K 5IYCK 1TWFK 3RZOK 1TWAK 3S17K 3GTMK 3S15K 2A69A 5C4JK 3S1RC 2NVXK 2JA6C 4KN7A 5IYBK 5TMFA 2NVQK 3I4NC 4MEXA 4A3MC 2E2IC 4BBRC 3S2DC 5FJ8K 2JA7C 3M3YK 3GTJC 1YNNA 4Y7NK 2O5IA 3S1NC 2WAQD 3GTJK 2YU9C 2Y0SD 4YFKA 1WCMK 3GTQC 3H3VD 4LJZA 3GTGK 3GTOC 3HOZK 3HOYC 4A3BK 3HOVK 2PPBA 1Y1VC 1YNJA 4A3JC 4OINA 2WAQL 4AYBD 2CW0A 4BXXC 4ZH4A 4A3GC 3H3VL 5IP7C 5C3EC 3GTPC 4JK1A 4OIQA 4C3JK 2JA6K 4QJVA 4A3EC 4A3IC 1SFOK 2R92C 3HOXC 4A3MK 2E2IK 4BBRK 3I4NK 3S2DK 4G7OA 4Q5SA 2JA7K 3S14C 5M3MK 5C44C 1TWCC 4X6AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL C;  1IW7 A;  3S1N K;  4C2M K;  2NVT C;  1HQM A;  4C3H K;  3HOY K;  1I6H C;  3GTO K;  3EQL A;  2R93 C;  4BY7 C;  4XSX A;  1Y1V K;  4A3J K;  2R7Z C;  4A93 C;  1K83 C;  4A3K C;  4A3G K;  4OIR A;  4Y52 C;  5IP7 K;  2E2H C;  3GTP K;  5C4X C;  3S16 C;  4XLN A;  3DXJ A;  1R9T K;  4KN4 A;  4LLG A;  4A3E K;  4A3I K;  3FKI K;  2R92 K;  5M5W K;  4OIP A;  3HOX K;  5M3F K;  3S1Q C;  2VUM C;  4A3L C;  4G7Z A;  1BDF A;  1TWC K;  1TWG C;  4G7H A;  3S2H C;  2PA8 D;  4X6A K;  2BE5 A;  4A3F C;  3GTL K;  3S1R K;  3K7A C;  3PO2 C;  2E2J C;  1I3Q C;  2NVT K;  3PO3 C;  1Y1W C;  2JA8 C;  3HOU C;  3H0G C;  5IYC C;  4A3D C;  5IYD C;  1TWF C;  2A68 A;  2PA8 L;  4YFN A;  4BY7 K;  2R7Z K;  4LK0 A;  3GTK C;  3GTM C;  4A93 K;  1K83 K;  5C4J C;  2WB1 L;  4GZY A;  2YU9 K;  5D4D A;  5IYB C;  3GTQ K;  4Y52 K;  5C4X K;  2E2H K;  4A3C C;  3S16 K;  1SMY A;  5TMC A;  4MEY A;  4Y7N C;  3HOW C;  4BXX K;  3M4O C;  5C3E K;  1WCM C;  1TWG K;  3S2H K;  3GTG C;  4A3B C;  3PO2 K;  4LK1 A;  4MQ9 A;  3PO3 K;  3K7A K;  3HOV C;  4BY1 C;  3I4M C;  1TWH C;  5IP9 C;  3WOD A;  5FLM C;  1Y1W K;  2JA8 K;  3HOU K;  4BBS C;  4QIW L;  4Q4Z A;  1XPP A;  4XSZ A;  2JA5 C;  4OIO A;  3RZD C;  5C44 K;  3HOW K;  3S14 K;  4A3D K;  5IYD K;  3GTK K;  2WB1 D;  5M5Y K;  2B63 C;  3S1M C;  3CQZ C;  2NVY C;  1ZYR A;  1SFO C;  1I6H K;  2R93 K;  1I6V A;  4A3C K;  1I50 C;  3RZO C;  3S17 C;  1TWA C;  3S15 C;  4C3I K;  4A3K K;  2NVX C;  3M4O K;  2NVQ C;  4KMU A;  3M3Y C;  4BY1 K;  3HKZ D;  2O5J A;  5M5X K;  4XLP A;  3I4M K;  1TWH K;  5IP9 K;  2A6E A;  5FLM K;  2PMZ D;  2VUM K;  4A3L K;  3S1Q K;  4QIW D;  4BBS K;  2Y0S L;  3RZD K;  2JA5 K;  3HOZ C;  4QJV B;  4A3F K;  1R9T C;  2E2J K;  1I3Q K;  3HKZ L;  2B63 K;  3S1M K;  4YG2 A;  2A6H A;  2NVY K;  2PMZ L;  3CQZ K;  3FKI C;  3H0G K;  4NOI A;  4AYB L;  4YFX A;  1I50 K;  5IYC K;  1TWF K;  3RZO K;  1TWA K;  3S17 K;  3GTM K;  3S15 K;  2A69 A;  5C4J K;  3S1R C;  2NVX K;  2JA6 C;  4KN7 A;  5IYB K;  5TMF A;  2NVQ K;  3I4N C;  4MEX A;  4A3M C;  2E2I C;  4BBR C;  3S2D C;  5FJ8 K;  2JA7 C;  3M3Y K;  3GTJ C;  1YNN A;  4Y7N K;  2O5I A;  3S1N C;  2WAQ D;  3GTJ K;  2YU9 C;  2Y0S D;  4YFK A;  1WCM K;  3GTQ C;  3H3V D;  4LJZ A;  3GTG K;  3GTO C;  3HOZ K;  3HOY C;  4A3B K;  3HOV K;  2PPB A;  1Y1V C;  1YNJ A;  4A3J C;  4OIN A;  2WAQ L;  4AYB D;  2CW0 A;  4BXX C;  4ZH4 A;  4A3G C;  3H3V L;  5IP7 C;  5C3E C;  3GTP C;  4JK1 A;  4OIQ A;  4C3J K;  2JA6 K;  4QJV A;  4A3E C;  4A3I C;  1SFO K;  2R92 C;  3HOX C;  4A3M K;  2E2I K;  4BBR K;  3I4N K;  3S2D K;  4G7O A;  4Q5S A;  2JA7 K;  3S14 C;  5M3M K;  5C44 C;  1TWC C;  4X6A C; 
#chains in the Genus database with same CATH topology
 4GTD A;  3HOY K;  3GTQ A;  2R93 C;  1UV7 A;  3EQL A;  2E2H A;  1ISE A;  3L4K A;  3Q3Q A;  1Y1V K;  4A3J K;  3T01 A;  1K83 C;  3G4A A;  1O2F B;  4OIR A;  3GTP K;  5C4X C;  4GTC A;  2P5M A;  3GEE A;  4A3E K;  4A3I K;  4A3L C;  2VUM C;  5CJ9 A;  1BDF A;  4KM9 A;  2BE5 A;  3PO2 C;  1Y1W C;  2GAH C;  2R93 A;  3GDZ A;  3OEP A;  4GZY A;  3GTM C;  1GE9 A;  1VLO A;  1O26 A;  5D4D A;  1YCL A;  3TFI A;  1TWH A;  2VUM A;  5C3E K;  2D6F C;  1IE0 A;  1WIH A;  3MML B;  3GTG C;  4MQ9 A;  3PO3 K;  3K7A K;  3HOV C;  4BY1 C;  2B63 A;  1J6X A;  3HOU K;  1F9N A;  2NVY A;  1XPP A;  4XSZ A;  1PJ7 A;  3RZD C;  5C44 K;  3GTK K;  3GTM A;  2WB1 D;  4C3J C;  4P5B A;  1SFO C;  1I6V A;  4BLA A;  4A3K K;  4C45 A;  1IL2 A;  3M3Y C;  3GTG A;  3N0C A;  3GSI A;  2O5J A;  3HKZ D;  3I4M K;  3S1Q K;  5IP9 K;  4BBS K;  1WOO A;  1XXC A;  1PJ6 A;  2E2J K;  3IPJ A;  3S1M K;  2A6H A;  2V6T A;  1SFO A;  3FOF A;  1I50 K;  1XZP B;  5IYC K;  5IOR A;  2E2I A;  1TWF K;  2GSO A;  1TWA K;  3S17 K;  5C4J K;  3S1R C;  2NVX K;  5IOT A;  5TMF A;  2NVQ K;  3I4N C;  4KB2 A;  1WOP A;  3CAG A;  1WOR A;  4KC6 A;  5E68 A;  2ZFZ A;  2Y3P A;  4YFK A;  3HXA A;  3HOZ K;  4LJZ A;  3GTO C;  2FQT A;  2PPB A;  4KM8 A;  2WAQ L;  4FZB A;  5IP7 C;  4JK1 A;  4QJV A;  2R92 C;  1X31 C;  1PJ5 A;  4BBR K;  4LOW A;  1IQ0 A;  3HOW C;  2V6S A;  1EI6 A;  3GTL C;  2R7Z A;  1O24 A;  2NVT C;  4WJ4 A;  5L46 A;  1WOS A;  3LAJ A;  1KQ4 A;  4G0U A;  3V4G A;  3OPF A;  4GTF A;  4C3I C;  4A3G K;  4Y52 C;  2E2H C;  1F93 A;  3S16 C;  4XLN A;  1TWG A;  4KN4 A;  1ZBS A;  1WSV A;  4FM9 A;  3FKI K;  4OIP A;  5M3F K;  1BGW A;  1TWC K;  4G7H A;  4BKW A;  3S2H C;  4KAR A;  1I3Q C;  1WQG A;  1YX2 A;  1ZQ1 C;  2JA8 C;  4A3D C;  2A68 A;  4YFN A;  2PA8 L;  4KAS A;  1K83 K;  1XZQ B;  2YU9 K;  4G0V A;  5IYB C;  5C4X K;  2JH3 A;  4A3C C;  1J6W A;  3N3Y A;  3BP3 A;  2JA5 A;  4A3B C;  3PO2 K;  4LK1 A;  3AD7 C;  1I3Q A;  1IBA A;  1TWH C;  5FLM C;  1Y1W K;  3CQZ A;  4QIW L;  4KAW X;  4LQY A;  3S14 K;  4OIO A;  2KWA A;  3GEI A;  3TFH A;  3NUH A;  1EH1 A;  5M5Y K;  2B63 C;  2NVY C;  1VGX A;  1I6H K;  4J3N A;  3AH5 A;  3RZO C;  1O2B A;  1O2A A;  4KMU A;  1DD5 A;  2V6U A;  4BY1 K;  3AQO A;  2A6E A;  5IOS A;  3RZD K;  1WQH A;  4A3F K;  3FHZ A;  2P8T A;  4YG2 A;  2JA6 A;  2PMZ L;  3H0G K;  2JA7 A;  3GTJ A;  5HL8 A;  2PHC B;  4KN7 A;  3S2D C;  4A3M C;  2E2I C;  5FJ8 K;  3M3Y K;  1YNN A;  2GSU A;  4Y7N K;  1Y1V A;  3S1N C;  2WAQ D;  2Y0S D;  1WCM K;  3GTP A;  1ZVU A;  4PAB A;  1C0A A;  4ILD A;  4AYB D;  2CW0 A;  1JOE A;  1DCP A;  3H3V L;  5C3E C;  4OIQ A;  1EQR A;  4GFQ A;  2GAG C;  3ADA C;  4G7O A;  3I4N K;  3HOX C;  4P9S A;  3BP8 C;  5C44 C;  2CFA B;  4X6A C;  4PAA A;  1XZP A;  1VJE A;  4C2M K;  4C3H K;  1HI9 A;  3GTO K;  1BJT A;  4BY7 C;  3A8J A;  2R7Z C;  4A93 C;  3AD9 C;  4A3K C;  2FQO A;  3SZY A;  5IP7 K;  3LPX A;  4O2D A;  3DXJ A;  1R9T K;  4LLG A;  1INN A;  2R92 K;  3LAP A;  3S1Q C;  1O28 A;  2XCR B;  4G7Z A;  5CHP A;  1TWG C;  2PA8 D;  3GTL K;  2E2J C;  2NVT K;  3GTK A;  5IYC C;  5IYD C;  1TWF C;  3T02 A;  3JST A;  5C4J C;  2WB1 L;  4GTA A;  3GTQ K;  4Y52 K;  2E2H K;  3S16 K;  5TMC A;  4BXX K;  1EK8 A;  3M4O C;  3S2H K;  1O27 A;  3TTG A;  3ORE A;  1B4A A;  4WIL A;  2JA8 K;  4Q4Z A;  2JA5 C;  4A3D K;  1I50 A;  4KB4 A;  4KMH A;  1TWF A;  1WQF A;  1TWA A;  2NVX A;  3CQZ C;  2R93 K;  3AQP A;  4A3C K;  4DDQ A;  3S15 C;  1XZQ A;  1DCO A;  1DCH A;  1O29 A;  5M5X K;  4A3L K;  1TWH K;  5FLM K;  2PMZ D;  2VUM K;  2ZUF A;  1F7V A;  2B63 K;  2RGR A;  2NVY K;  1G51 A;  3FKI C;  4BLB A;  4NOI A;  3RZO K;  3GTM K;  1ZXO A;  2JA6 C;  1USO A;  2JA7 C;  1VRQ C;  3GTJ C;  5TJ3 A;  1VH2 A;  1USM A;  2YU9 C;  3HOY C;  3H3V D;  3GTG K;  4XCH A;  3SZZ A;  3HOV K;  4M1X A;  1Y1V C;  1YNJ A;  4A3J C;  4OIN A;  3FKI A;  3GTP C;  1TWC A;  4C3J K;  4A3E C;  4A3I C;  1SFO K;  3QX3 A;  1F7U A;  2XCQ A;  4A3M K;  2E2I K;  3S2D K;  1JQW A;  4GT9 A;  3S14 C;  1XXA A;  1IW7 A;  3S1N K;  1K83 A;  5EGH A;  1HQM A;  2YU9 A;  1I6H C;  1V5V A;  1J6V A;  5EGE A;  3T00 A;  1IS1 A;  4XSX A;  3GIR A;  1O25 A;  4AH6 A;  1WSR A;  5M5W K;  3HOX K;  3A8I A;  1Y1W A;  4GTB A;  2EBB A;  4LR2 A;  4X6A K;  4A3F C;  3S1R K;  3K7A C;  3PO3 C;  1J98 A;  1B4B A;  4WJ3 M;  3HOU C;  3H0G C;  4P5A A;  4RMF A;  4BY7 K;  2R7Z K;  4LK0 A;  3GTK C;  4A93 K;  4GTL A;  2CFA A;  3G4C A;  3A8K A;  1SMY A;  3FOE A;  4MEY A;  4Y7N C;  3GEH A;  4KMD A;  1WCM C;  1TWG K;  1BS2 A;  5JFE A;  3S0X A;  3I4M C;  5IP9 C;  3WOD A;  4BBS C;  1L0W A;  3H0G A;  1AB4 A;  2XCO A;  5IYD K;  3HOW K;  1JVI A;  4KMA A;  1RU0 A;  3S1M C;  1ZYR A;  3N0B A;  1I50 C;  4KAT A;  3S17 C;  1TWA C;  4GTE A;  4C3I K;  2NVX C;  4C2M C;  3M4O K;  2NVQ C;  4C3H C;  5IOQ A;  1WCM A;  4XLP A;  3L4J A;  4QIW D;  2Y0S L;  2JA5 K;  1XXB A;  3HOZ C;  4QJV B;  1R9T C;  3TFJ A;  1I3Q K;  3HKZ L;  3CQZ K;  4AYB L;  4YFX A;  1EFW A;  2ZUE A;  3S15 K;  2A69 A;  4KDD A;  5IYB K;  3AD8 C;  4MEX A;  4BBR C;  4G0W A;  3GTO A;  2O5I A;  3GTQ C;  4A3B K;  3BUE A;  3ERE D;  1R9T A;  2R92 A;  2RH6 A;  4BXX C;  4ZH4 A;  4A3G C;  2W7V A;  2GSN A;  3VA7 A;  2JA6 K;  3GTL A;  5JVO A;  4Q5S A;  2JA7 K;  5M3M K;  3GTJ K;  1TWC C; 
#chains in the Genus database with same CATH homology
 3GTL C;  1IW7 A;  3S1N K;  4C2M K;  2NVT C;  1HQM A;  4C3H K;  3HOY K;  1I6H C;  3GTO K;  3EQL A;  2R93 C;  4BY7 C;  4XSX A;  1Y1V K;  4A3J K;  2R7Z C;  4A93 C;  1K83 C;  4A3K C;  4A3G K;  4OIR A;  4Y52 C;  5IP7 K;  2E2H C;  3GTP K;  5C4X C;  3S16 C;  4XLN A;  3DXJ A;  1R9T K;  4KN4 A;  4LLG A;  4A3E K;  4A3I K;  3FKI K;  2R92 K;  5M5W K;  4OIP A;  3HOX K;  5M3F K;  3S1Q C;  2VUM C;  4A3L C;  4G7Z A;  1BDF A;  1TWC K;  1TWG C;  4G7H A;  3S2H C;  2PA8 D;  4X6A K;  2BE5 A;  4A3F C;  3GTL K;  3S1R K;  3K7A C;  3PO2 C;  2E2J C;  1I3Q C;  2NVT K;  3PO3 C;  1Y1W C;  2JA8 C;  3HOU C;  3H0G C;  5IYC C;  4A3D C;  5IYD C;  1TWF C;  2A68 A;  2PA8 L;  4YFN A;  4BY7 K;  2R7Z K;  4LK0 A;  3GTK C;  3GTM C;  4A93 K;  1K83 K;  5C4J C;  2WB1 L;  4GZY A;  2YU9 K;  5D4D A;  5IYB C;  3GTQ K;  4Y52 K;  5C4X K;  2E2H K;  4A3C C;  3S16 K;  1SMY A;  5TMC A;  4MEY A;  4Y7N C;  3HOW C;  4BXX K;  3M4O C;  5C3E K;  1WCM C;  1TWG K;  3S2H K;  3GTG C;  4A3B C;  3PO2 K;  4LK1 A;  4MQ9 A;  3PO3 K;  3K7A K;  3HOV C;  4BY1 C;  3I4M C;  1TWH C;  5IP9 C;  3WOD A;  5FLM C;  1Y1W K;  2JA8 K;  3HOU K;  4BBS C;  4QIW L;  4Q4Z A;  1XPP A;  4XSZ A;  2JA5 C;  4OIO A;  3RZD C;  5C44 K;  3HOW K;  3S14 K;  4A3D K;  5IYD K;  3GTK K;  2WB1 D;  5M5Y K;  2B63 C;  3S1M C;  3CQZ C;  2NVY C;  1ZYR A;  1SFO C;  1I6H K;  2R93 K;  1I6V A;  4A3C K;  1I50 C;  3RZO C;  3S17 C;  1TWA C;  3S15 C;  4C3I K;  4A3K K;  2NVX C;  3M4O K;  2NVQ C;  4KMU A;  3M3Y C;  4BY1 K;  3HKZ D;  2O5J A;  5M5X K;  4XLP A;  3I4M K;  1TWH K;  5IP9 K;  2A6E A;  5FLM K;  2PMZ D;  2VUM K;  4A3L K;  3S1Q K;  4QIW D;  4BBS K;  2Y0S L;  3RZD K;  2JA5 K;  3HOZ C;  4QJV B;  4A3F K;  1R9T C;  2E2J K;  1I3Q K;  3HKZ L;  2B63 K;  3S1M K;  4YG2 A;  2A6H A;  2NVY K;  2PMZ L;  3CQZ K;  3FKI C;  3H0G K;  4NOI A;  4AYB L;  4YFX A;  1I50 K;  5IYC K;  1TWF K;  3RZO K;  1TWA K;  3S17 K;  3GTM K;  3S15 K;  2A69 A;  5C4J K;  3S1R C;  2NVX K;  2JA6 C;  4KN7 A;  5IYB K;  5TMF A;  2NVQ K;  3I4N C;  4MEX A;  4A3M C;  2E2I C;  4BBR C;  3S2D C;  5FJ8 K;  2JA7 C;  3M3Y K;  3GTJ C;  1YNN A;  4Y7N K;  2O5I A;  3S1N C;  2WAQ D;  3GTJ K;  2YU9 C;  2Y0S D;  4YFK A;  1WCM K;  3GTQ C;  3H3V D;  4LJZ A;  3GTG K;  3GTO C;  3HOZ K;  3HOY C;  4A3B K;  3HOV K;  2PPB A;  1Y1V C;  1YNJ A;  4A3J C;  4OIN A;  2WAQ L;  4AYB D;  2CW0 A;  4BXX C;  4ZH4 A;  4A3G C;  3H3V L;  5IP7 C;  5C3E C;  3GTP C;  4JK1 A;  4OIQ A;  4C3J K;  2JA6 K;  4QJV A;  4A3E C;  4A3I C;  1SFO K;  2R92 C;  3HOX C;  4A3M K;  2E2I K;  4BBR K;  3I4N K;  3S2D K;  4G7O A;  4Q5S A;  2JA7 K;  3S14 C;  5M3M K;  5C44 C;  1TWC C;  4X6A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...