1HI9A

Zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
274
structure length
274
Chain Sequence
MKLYMSVDMEGISGLPDDTFVDSGKRNYERGRLIMTEEANYCIAEAFNSGCTEVLVNDSHSKMNNLMVEKLHPEADLISGDVKPFSMVEGLDDTFRGALFLGYHARASTPGVMSHSMIFGVRHFYINDRPVGELGLNAYVAGYYDVPVLMVAGDDRAAKEAEELIPNVTTAAVKQTISRSAVKCLSPAKRGRLLTEKTAFALQNKDKVKPLTPPDRPVLSIEFANYGQAEWANLMPGTEIKTGTTTVQFQAKDMLEAYQAMLVMTELAMRTSFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIPEPTIDE TRANSPORT PROTEIN DPPA
publication title Structure of the Bacillus Subtilis D-Aminopeptidase Dppa Reveals a Novel Self-Compartmentalizing Protease
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase (protease)
total genus 89
structure length 274
sequence length 274
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04951 Peptidase_M55 D-aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.130 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Dipeptide transport protein 1hi9A02
3.40.50.10780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dipeptide transport protein 1hi9A01
1HI9A
chains in the Genus database with same CATH superfamily
3GAZA 5EERA 4N8SA 4IINA 4U3JA 4A10A 2UXDB 3K30A 5ITZB 4GAEA 3HR4A 4N3NA 2O2GA 3TW4A 3P9PA 1UM9A 5DM0A 1T4MA 3F6PA 1XZIA 1AX9A 1RWKA 1KI8A 1WY5A 1YMUA 4R8KA 2QN9A 4BE4A 2QUIA 1I7DA 4INOA 1C9NA 2Z1NA 5BNIA 1FZTA 4MMZB 4C3VA 4YXFA 3A1TA 2E4XA 4JB2A 1A4XA 4JUFA 4KM9A 4PLCA 3CLKA 3C3YA 1HQCA 5B53A 4I1SA 3EF3A 5ALIA 5JDIC 1NI4B 5F51A 1DAPA 4NJEB 3RANA 2R5FA 3FZGA 1VJ5A 3VC3A 3ETGA 1M3SA 5CP8A 2GRUA 2WJ4A 4NG5A 1MMFB 1SBTA 3ZHCA 3JRXA 3KP1A 2JPDA 4LI0A 4C01A 3LC1O 4Y6GB 3WE7A 4YRKA 3DMTA 4O2BF 2EF1A 5GGYA 1WCV1 3HDTA 2O2EA 2OFPA 4EECA 3FG9A 5LUBA 3VNBA 2WIBA 3A1NA 2JGLA 4BMPB 2BGRA 3WQSB 3K16A 4BBAA 2RH9B 3AY7A 1U28C 3BJEA 4RK0A 5HKOA 4CU5A 2I8CA 1JALA 1SVSA 3PENA 2DT5A 3KPJA 3CQZA 4DR7B 1FFBA 1GNLA 3A70A 2GCOB 2W98A 5ES4B 3HA2A 2ZVDA 5AMXA 4L8VA 1X14A 3IIIA 1D4OA 2XEXA 2RAPA 4HQ0A 5K3SA 1UFKA 1SH7A 4RJLA 2R4UA 4FR2A 5DYYA 5JEDA 1T3SA 1NFFA 1I5EA 1O29A 4FUTA 5K4HA 2ZZMA 1T15A 4L0DA 4GF5A 3M3YC 1M7HA 2BW0A 2FEXA 1WIHA 1QZUA 2JHFA 2OXCA 2R65A 3D1JA 4LOWA 2H08A 4QLOA 1VXRA 2JLCA 3NX4A 4KL8S 1T9HA 1M7GA 1VI2A 2PV0A 2J7KA 4ZO8A 4EATA 5AW3A 1TMOA 4MJXA 1OYYA 2G7ZA 1XALA 4REMA 1ZA2A 3A4LA 5FPKA 2OY0A 3LYHA 4WSOA 1JAYA 4UBNA 4B0PA 3EEBA 3OQBA 3S2GA 1N2EA 3W1EA 2ZDQA 1G21E 1JJ7A 3QVGA 1Z5NA 1N57A 1NUTA 1IEWA 3HOVC 4DNQA 1JQDA 1QFJA 2OENG 5BW6B 2I4RA 3RIHA 5IKPA 1H9BA 4WILA 1YS4A 3T0IA 1SFOK 4PIMA 4NMXB 4DL9A 5FDFA 3K70C 1JEAA 4RHEA 1Q0HA 1BDBA 1U0SY 2GETA 3AQOA 2F9LA 2EBUA 4JUIA 5DSXA 1CR4A 4I4TA 5G0TA 5A5GA 5ABPA 3Q8LA 1UK9A 1Q7EA 1G42A 4XGQA 5D85A 4Q1BA 2TMDA 4ZTZB 5JBIA 4CM8A 1GEEA 2HJGA 2NP7A 1Z8FA 1RXCA 1QO9A 3EJ6A 5E2AA 1A82A 1EEHA 1LY1A 3B2QA 4KPGA 5HIJA 3AEQB 1ZHHA 4LHYA 2WNHA 5ECDA 4GECA 5DIZA 3JQBA 4RSHA 4O4HB 1MRNA 3WGOA 1HYBA 4V0SA 4YCJA 1YAJA 2XV1A 2VLBA 1SK8A 2VDWA 4S1PA 5EZYA 1CUZA 1FDVA 2YRWA 4LOAA 3ML1A 2ECFA 5G0WA 3VHXA 4G4IA 4NJMA 4BO6A 2I29A 2RONA 1OU4A 3GZJA 2PFSA 4IGIA 4LRQA 2C4VA 1ECGA 4RV9A 4ZRDA 1XTSA 4DARA 1OA1A 4LRYA 1DFIA 1YUNA 3F4BA 3RD5A 4N3AA 4ZGGA 3BVPA 4BEVA 2IRWA 1QIKA 4BY1C 3VR5D 1G5PA 3ZX5A 2Z3ZA 5BYJA 3HJBA 3PV0A 1QVAA 2R7KA 3STTA 4MKZA 2PL9A 1Y1QA 1LNZA 2REBA 4KE9A 4M9SA 4U3JB 4XLZA 5TPZA 2I99A 2JLRA 4DC0A 1BJTA 3K94A 3KOYA 1UM9B 4DS3A 1PT7A 5JS7A 1XVUA 5KHOC 4HBGA 1ZC4A 4BLTA 3I37X 4PU0A 1PTJA 2K7ZA 1TC2A 3CURA 3HB5X 4JXJA 5SZJA 3RVSA 1COWD 4P9SA 1MAAA 3DJYA 3CVUA 5FOTA 3SZZA 2AT1A 2QDKA 1ZGCA 3H1AA 3I32A 4GOND 3ZW9A 4CF7A 3MPUA 4JYAB 2XMCA 3L4KA 3A7DA 2VNIA 4CMHA 2H57A 2FWPA 5FNVA 1E9AA 2BGTA 5WRFA 3C3MA 1AJEA 4DNPA 1C3OA 1QRDA 4TQAA 3UOAB 4QNRA 4LY6A 5FD8A 4FQ8A 3QH4A 4EITA 4DLTA 1TU4A 2WIGA 1U04A 3LDFA 3QPDA 3QW4B 2GTPA 3IHTA 5DW3A 2AUMA 5H16A 4OIPA 5DCUA 3RU2A 1P33A 2F1KA 2PL3A 3NOQA 2A1TS 3N1UA 3R7LA 1QH0A 2J33A 4IJ5A 1DKQA 5EKXA 4Y1GA 4P22A 4EKYA 1SO8A 1IVSA 5A02A 3N28A 3WLSA 1YB6A 4JNKA 2WJ3A 1RLTA 1NFQA 3DZKA 4WCFC 5LC1A 2B98A 1J6VA 5LD2B 3TS1A 2GZ3A 1K3TA 4EF5A 3DMYA 5C5CA 1KAHA 2E55A 1PJZA 3HXKA 3IB3A 5DI3A 1ZM7A 2ODNA 1M2VA 3HFGA 5KOYA 2O50A 8AT1A 5JPIA 3UAXA 4FFRA 3F9RA 4PZLA 1PG5A 1SXHA 1BGXT 3CTPA 3HUFA 2A0FA 3IR7A 2Q1TA 4LC0A 3SQOA 1W2GA 5JMOA 2XY4A 4XB1A 4BVAA 4L0MA 1RPZA 3CPHA 1GGHA 3KJHA 2ALJA 2XYGA 2N9UA 1KEEA 1QJCA 4HN2A 2Q7OE 1W8IA 5P21A 1IBRA 3GA0A 3T7AA 1E7QA 4LY9A 1O26A 4CHGA 1GJRA 4ECEA 3QVGB 5IFKA 4F45A 3WODA 1WCMK 2N1BA 1EVLA 1UC8A 1KU6A 5AHOA 3ADOA 1IHUA 1SC1A 4X1IA 4DM7A 2Z8YA 1P72A 4JL8A 1AGRA 3C5EA 2BMEA 4O8ZA 4ALJA 1XQYA 5JXIA 5ICEA 1KYVA 1S2MA 3CSUA 4I36A 2IHNA 1FJGB 4I4TB 2QTTA 4W99A 1GM5A 5DNVA 4HYQA 2BC9A 2NQTA 2UVPA 5JVDF 3MMLB 3D3JA 1YJQA 5JS8A 2X76A 4DLZA 1JDBB 4TM7A 3LQ4A 4CM8B 2GCNA 1N0WA 1NJGA 2A67A 3IR5A 4P3KA 3DSRA 1WCWA 2ODTX 1YR9A 2E2IA 5DYGA 2IBMA 1F9EA 1RZ3A 4TLLB 1E5TA 1UBEA 1K83K 2VSQA 1PFWA 4J1TC 4NV3A 4PS0A 2K87A 4NRDA 5B58C 3KB1A 2QT1A 3E70C 3ONVA 5KYXA 1KTIA 3WIEA 2VDWB 5EZYB 2QD1A 2ARKA 3LUDA 4P4TA 2IDZA 1Z4LA 4IHAA 1TUGA 4RM3A 3VHXB 1LZLA 4NJMB 3ROGA 1J8YF 1Z68A 2ZBFA 4RANA 3NBYC 3P2MA 1U94A 1I5OA 3EXHC 4D3XA 2D7DA 421PA 5EGEA 2AOVA 3FUVA 1RYNA 4OHUA 3PWKA 4UNNA 4UZSA 1Q7RA 3ZTTA 4GM4A 3DLAA 4ZVVA 1BQEA 4WAUA 1JSRA 1T5HX 1CY6A 2IHUA 4YIKA 1FX1A 5BSMA 1ACMA 1SEVA 3C5VA 1SIOA 4M7WA 4N7MA 2CJPA 4P4NA 3DHWC 3RUHA 5TIIA 2JKVA 2V5UA 2NVTK 4NH4A 1KF0A 4RV4A 1W581 2GA9A 2NVXC 1WNFA 1JDUA 3QIAA 3UUFA 3X0DA 3L9WA 4LBWA 2B1GA 4JR1A 3H97A 2JA8C 5A6VA 1IZ0A 5CDSA 1I3LA 3LO5A 4DR1B 2GERA 4HNAA 5HJEA 3AYXB 3EDMA 3GTMC 1KDTA 1NZJA 2AB0A 2WQZA 3CUTA 3M34A 4PZ0A 1UMCA 3S8MA 3W2TA 5KZMB 1IDOA 5HRUA 3W4KA 1LA2A 2P91A 1E7WA 2Q3HA 5FNVB 1YAHA 2VF2A 2BUBA 5UKDA 5IPFA 1ZJWA 3QG5A 2IYWA 5LBUA 1C3OB 3AK4A 1NKVA 1U0LA 2CMDA 1GPKA 2UKDA 2V54A 2YWJA 3FH0A 1PR0A 1T4GA 3C43A 3U40A 4URWR 2FLVA 2YICA 2A58A 5BSHA 2W2OA 2NO4A 3EYAA 3BYZA 3DB1A 3U6KA 1GN8A 3I9LA 5EJFA 5CAEA 1QKKA 3EC2A 4HAOA 3WRVA 3DBVO 4OVKA 1G8KA 1KO7A 1P45A 1LCIA 1U98A 5DX0A 1YDFA 2BHSA 4HMPA 1KMIY 2IZ7A 2E2HK 4IKOA 4CLHA 1R6AA 2DY0A 1RJFA 1XK6A 3LVBA 3ORSA 4D43A 1I50K 1BN7A 5BSUA 4RTQA 3RTBA 1BMFD 1PWZA 3QBJA 3TAHA 4KMOA 4US1R 1G19A 4BWFB 2C2ZA 3MTEA 4DLBA 1X2BA 3TVDA 2X41A 5DI3B 1UBGA 3TXXA 1M2VB 2D8MA 3LW8A 2QSUA 1C4XA 4G4SP 1WXQA 1S8OA 4ZWNA 2JCVA 4BS9A 4KDFA 1JQ3A 3L0YA 4DA0A 1XQ9A 3I9V6 3RVRA 2CNNA 4TWAA 2ON6A 2NX2A 5JROA 4CEJA 4FVTA 4AI6A 4O4LF 4C4YA 2FN9A 3AU8A 4HVTA 5H3CA 3MMSA 1KEEB 4GYKA 1PJLA 1R3UA 1UWLA 2HZBA 4FIZA 2PLNA 2W48A 5BQPA 1WBBA 3IEVA 3L7BA 5A7HA 1NNSA 1JVSA 3SQDA 4DXDA 2X22A 4L75A 3MWDA 1GAWA 2GS9A 4JC8A 1FFWA 2AI3A 4PG4A 3UJHA 3F97A 2YYSA 3Q5DA 2FTKE 5FTWA 3D8NA 3TE6A 4X1IB 1OR8A 1D2CA 2RGAA 1HQKA 3E0QA 2ZI7A 4DLRA 4FDMA 3M89A 4LHWA 2RB5A 3K96A 3WL4A 1H2ZA 5IANA 2CNWD 2JKZA 5GTDA 3G9ZA 4M38A 1KK0A 1YI1A 3I9FA 1TWAA 2CUTA 2DFTA 2UVPB 2V7QD 3GCWA 4GL4A 4JJFA 5AK4A 3SSOA 1BD3A 4PXAA 3WQRA 4US0R 4YALA 4B7XA 4WZAE 2EWWA 2WEKA 2CMHA 1V4VA 3EB9A 3COYA 5I9LA 1A9SA 3LQKA 4UZEA 1DBIA 4BFYA 3EQ7A 5AHRA 2XWBF 3IMEA 4GKVA 4HYEA 3ZZ1A 3PYMA 4F2WA 4PHGA 5KYXB 2R3SA 1ISPA 1W6UA 1UBOS 1CUAA 5ALDA 1S96A 1YI8A 1M0WA 2A84A 2GZRA 3TG8A 3U4IA 3WKCA 1OVMA 3ORHA 4LRTB 1ILEA 2XH8A 1OAAA 1ZI6A 4XQ0A 4D9GA 3DMNA 1P7YA 3U7IA 1IZZA 1P61B 3QX7A 2P9TA 4DVJA 4UPEA 2ZCJA 4FHZA 1U8EA 1L5NA 2HR1A 4JVMA 3FTEA 4LDQA 3EYWA 2PWZA 3AR6A 4PZ9A 4C7KA 2NV0A 3V8VA 2UXCB 3ETJA 2XCOA 3STXA 4P5AA 1LX7A 1JJFA 1VSBA 2XUQA 4WCDA 4B82A 4BO3A 4WK4B 3P8ZA 1RYFA 2W2LD 1GXSA 1CLUA 1FNDA 2E2WA 2YUTA 3B6EA 3HUTA 4HWOA 3R9WA 3WBBA 2XCSB 2GHTA 3DBHA 3PE4A 1ZD1A 3JRNA 4KQGA 4ACBA 1CRWG 3BSWA 1JAXA 2IVZA 5E3JA 5H3HA 1S89A 1GSOA 4HNAB 5NLLA 2UUBB 2NZWA 4AZVA 4TS4A 3MCAA 5A1TA 5F7XA 3ICEA 3OEPA 2PO7A 1DOAA 2HBRA 1UMCB 3TZQA 3SVTA 4HN9A 4JITA 1N3LA 4RFSA 1DC4A 1QM5A 2I2AA 4X54A 1CUGA 4LBYA 4OQFA 3O2NA 5JFEA 5IJAA 4AIRA 1IY2A 4MKFA 3PUZA 4EENA 2OD9A 5ALRA 4ZCTA 2CYCA 1LC3A 2WM9B 1NXQA 3AY0A 4I3HA 2RH6A 5BNZA 1Y6GA 1RHRA 3D7MA 3D4IA 1N2CA 1W6RA 5AVOA 2G06A 4I9HA 2HH9A 5KHAA 4LECA 2DVMA 3TH5A 2MSNA 5AJYA 2VSFA 5ICFA 3LKVA 3OZGA 3ZD9A 2HREA 2FVYA 1T3HA 5D51S 1HT0A 5CAEB 3CGGA 4DJ5X 3ROTA 1Z88A 1MXHA 4TTRA 4H7IA 4KR2A 4O0MA 3ZGZA 2IGBA 5AXDA 1JIJA 4H4EA 5LZ8A 2UZAA 3SZMA 3HOWC 1WBDA 1VG8A 1HO3A 3QVSA 5I7WA 2CSUA 1PS8A 5TNXA 2OGSA 1LDYA 1SOUA 2JG3A 1B1CA 2ZJAA 4HB0A 3KUCA 1DEAA 4JXKA 3VR4A 5ETJA 1UJ6A 2RGDA 3EPPA 2HHHB 1X6VA 4B7ZA 1FYDA 3IEKA 3B1WA 3LRTA 4G5OA 3LKBA 2MSDB 4H15A 4W9NC 3TRHA 4DV3B 2I1QA 1KI3A 3INNA 4TKVA 5L53A 2PZBA 3VJLA 1J99A 1YQ9A 2CMGA 4N49A 4WLNA 3TSCA 3ZXXA 2W42A 2E4YA 1RYBA 2A6PA 2PX2A 1SHTX 2UAGA 1X1DA 2WJZB 4CEJB 2D06A 2CJFA 4O1MA 5JAUA 2VTKA 5EUBA 4XQGA 4ZXPA 3QLEA 2V1XA 3CCBA 1Q20A 5DWQA 3D8TA 3N05A 4NX2A 4U5QA 3SE7A 5FWNA 2IU4A 2FR8C 3UG6A 1IZ7A 4UJ5A 4BMCA 2PGXA 4CGYA 2FSFA 1LWNA 3SF8A 4FW9A 1RRGA 1KOGA 3MWDB 4ZOBA 3KLOA 4P7KA 3V1KA 1UAYA 2KBFA 3P2JA 4ZYWA 2VPTA 1OI2A 4B3GA 3PRYA 2REQA 2O8CA 2KS6A 4HDMA 5B4TA 4V39A 2P2YA 5DBGA 1IRIA 1RXIA 1SB8A 1TAUA 3VNQA 4ER0A 1NYQA 4HDOB 4MNTA 1D2HA 4NMWA 4AY6A 4UU1A 1ABBA 1NT2A 4URFA 4H08A 4KBGA 3VISA 2VEOA 2H29A 5EHQA 4H59A 4HD8A 4Z0HO 1WKVA 4W5QA 3F9CA 4M4SA 1YB2A 4KNVA 2Y76A 2GPJA 4M0MA 2GAFA 4K9LA 1IPHA 5M5WK 1PR6A 3O83A 2B92A 4JLAA 4RIGA 2OSBA 2V5AA 4J4TA 4E2WA 1PD1A 5IF3A 3MAGA 4H7KA 1PR2A 1WSRA 3ADAC 1OBHA 2DG2A 2RJOA 5EUCA 3Q8MA 4EW2A 1XD9A 3EDRA 3HP4A 5IH3A 1G8MA 2WP8J 1CQIA 2O6LA 3RC9A 2A9PA 2OK7A 4UM8B 2C2KA 3M6FA 2VXCA 3B7PA 1QFMA 1ENZA 5DRYA 3RKRA 3UYKA 3FRHA 4X7BA 1MPTA 2C1ZA 3PEVA 4GP9A 3VR0A 4EB0A 2H3EA 1BKYA 3EOZA 2X1VA 2H1SA 4MB0A 5F2KA 1X19A 4G3XA 1GXSB 1F38A 2Q9BA 4W1RA 5I01A 4M7OA 3U62A 3L8GA 5JSYA 3W04A 1GPYA 2PRYA 2WTMA 3DHEA 4L6IA 3DBHB 4GRIA 1JNYA 2QTGA 4RVGA 3ADKA 1YR8A 2G0TA 5JE8A 4DQLA 4BPBA 5BN5A 4ZQIA 4GPBA 4QYMA 1P5FA 4JR2A 1SUSA 1D1SA 2ZAYA 2XUDA 1E98A 4OHZA 6PFKA 3CE9A 4PN3A 4BP9A 2N3ZA 8ABPA 1OROA 3H5RA 1ATZA 3OA2A 1UBHS 4G0XA 3E9NA 3S16C 3HV2A 4IM7A 1PU2A 4RFSB 3TEFA 4CMBA 5L3SA 1XMQB 1IQ0A 3OWXA 9ATCA 1C9KA 1L7DA 4LDZA 3FUXA 5DBEX 3LO8A 4Q05A 4C45A 4JVSB 1U0NA 2J48A 3QYFA 4FYYA 3AUTA 1AF4A 3A6HA 3K6SA 1N2CB 1QYVA 1CY0A 2O5EA 4CR6A 2C77A 1KFCB 1LLFA 4FQ7A 3VV3A 1G55A 4MWSA 3LAJA 5C5IA 3F3YA 1JU9A 4QEKA 1N78A 4Z1MA 4JOQA 5U4XA 1Y80A 4NVRA 2XWJI 1E0DA 3NC0C 4G9EA 1A9PA 3GLUA 3O47A 6AT1A 3PPXA 2GN1A 4LKRA 1WHSA 3D1LA 4Z99A 2I91A 5ICGA 3BQNB 4KN6A 1ZBQA 2WY2D 4A8PA 1N5IA 1NMSA 2H54A 3VX3A 1T0PA 1TCCA 2P9BA 4QU9A 2GARA 2QRLA 1YE3A 5EXSA 3GD5A 2IODA 1EESA 5G0UA 2QRVA 1E4VA 1SU6A 4EG1A 2CY0A 1KQFA 2CXTA 3ZN2A 2QLJA 3Q11A 2BSXA 3AUKA 3JASA 1J24A 4TKVB 5GONA 4BFLA 4Z4HA 2HPAA 3QLTA 5D1HA 1QPGA 3VDMA 1JX6A 2GCGA 3WB2A 5JDIA 2ODQA 4RZQA 2PUGA 1E3MA 2VUSA 1B6RA 3K9QO 4PLVA 4ZVOA 4YV1A 3C4VA 3ZI4A 5BSFA 5C7LO 1IUNA 1P2DA 5IYDC 1I24A 2A9FA 1JR3D 2BD0A 2PWYA 2P9EA 3D7SA 4K46A 4OQLA 1U8FO 2V7BA 3A1SA 4NBLA 4UUAA 4BL5A 3PLRA 4MWTA 2CFRA 2C99A 3F7MA 4KZKA 3SF8B 1T25A 4R9RA 3PVCA 1JHYA 4QYXA 2Z2JA 2VP9A 3DCNA 5K3OA 2PS9A 2RE8A 2PR2A 1GDHA 3VR2D 2REQB 4D82A 2O8CB 4HDMB 2R93C 4PVCA 2N46A 4LHSA 1U31A 2GAHC 1U28A 2WBLC 3E3LA 3KQSA 1I14A 3UICA 3ZWMA 1MH9A 3AOEC 1VLOA 2G9NA 2G1JA 4R2XA 3VU9A 4QM7A 1G17A 3ZWWA 3E3AA 1H3NA 1H23A 4XQEA 5DCWA 3IBSA 4YJKA 3JVEA 4U9UA 1TJ5A 3B51X 3PX3A 4Q3EA 4X91A 3VYTB 3SN6A 3KJXA 1L7VC 1XXHA 4KFSA 5T3UA 2PT9A 3QMMA 5A9TA 1PHPA 1FRZA 1UCFA 2EP5A 2IDJA 3P9XA 1FUEA 4GZLA 4EPYA 2IPAB 3CMMA 1I3NA 5B7QA 4GX1A 4V0LA 2R4TA 1JJBA 3AI1A 2GNOA 1G60A 2ZANA 3GRKA 4KC6A 3T8YA 1O6CA 3VGPA 3A4NA 3SS7X 3K4HA 5EZ5A 2LCIA 4UREA 3Q5GA 4PLHA 5KSYA 4JP8A 3UCXA 1CQIB 1N8KA 5BWLA 2AR0A 4O3MA 3SEZA 3CVJA 3I6YA 3AUJB 2FFAA 4QBFA 1UXGA 3LE8A 4YIHA 3A25A 2XEDA 2I87A 3CH4B 4G9BA 3NP7A 4TTQA 1U7OA 2H8GA 3DVLA 4HDRA 1B15A 1JLRA 3KZXA 2PX3A 2WSSA 1XCBA 3IR6A 1FNNA 4GR9A 5LA6F 4TWZA 3UO8B 3VPGA 3WIUA 4K9MA 1V3VA 4BFWA 4BNVA 2FPGA 4AS1A 3WBJA 1Q3KA 1K5PA 4IDPA 3LHDA 1E5DA 3SC2B 1L7AA 2QMZA 3WL8A 5HZMA 1I2ZA 5BN5B 1NY5A 1OXVA 1QQ6A 1W4BA 3CRMA 5A3RA 4UDOA 3E23A 3SBEA 4E31A 1C30A 1SKBA 3MUEA 3EA0A 4QUEA 4B81A 3HVIA 4IIFA 5IK2A 1T8WA 3WISA 5L3SB 4JCCA 1P7ZA 1E66A 1NPYA 5H68A 1RWVA 4ILEA 3LY8A 4N03A 4MWBA 5JFOA 2C3OA 1N33B 1A4UA 1I6KA 1NNUA 3K6SB 4HLUC 3O8RA 3IXMA 2OBBA 3BCSA 4A3MC 3WAKA 1T4BA 1ND5A 4B09A 5K3FA 4Q82A 1YRBA 2FJ0A 1MJHA 4KXYA 2O3TA 3U1BA 4BMDA 3WSWA 2UXBB 4JLDA 1YGPA 2BMAA 3K2IA 3U5ZB 2HSJA 2PWPA 2RJ3A 1PHRA 4TMVA 1WHSB 2AW3A 3U60B 4FKMA 4JODA 5AKIA 3WRYC 4YAKA 3FIUA 4C2TA 5H0IA 1OI3A 2OQVA 4B7CA 3OFKA 2FSUA 1R0YA 2EZ9A 3CLSD 1EFLA 3FTFA 4H1TA 4N40A 1OHHA 4ND4A 5BNWA 3S2SA 2QRVB 3MGKA 4ARAA 1NQ5A 4ZCIA 3WG9A 2AN4A 3JASB 2AMYA 4KVGA 5GONB 2WF8A 1RW4A 1Z5WA 1T5SA 3CLTD 4ES6A 5K09A 2Y9PB 4IVNA 2QTMA 1SC3A 4B4WA 4Q3CA 5K20A 2JBAA 1TUIA 1ZR2A 1IY9A 3JD4A 3HZOA 1OGYA 1GZDA 4CI9A 4DIMA 5BV8A 3ONEA 3NUGA 1AA6A 2JLSA 2YHBA 4E09A 2VUMK 4I5DA 5IYZF 4B71A 1OOEA 2JNWA 4OIOA 4KO1S 4IWYA 5IBQA 4WH0A 3VSEA 2JLUA 3OX2A 3ZCRA 3RSHA 5MGBA 4G86A 5KQRA 2I7CA 1JHAA 2D1FA 3TLAA 3ZDCA 1WVIA 4JKIA 3O3NB 5BWCA 2AA3A 4GLJA 2FWAA 2VBIA 4JEIA 4G5YA 1BRTA 4XX0A 1VTKA 1UKEA 2NXCA 3NH6A 4TN1A 2BMFA 3FHOA 2OYRA 3SC6A 4F2GA 2XZOA 1I2CA 1NN1A 2EFHB 3VU9B 3KQWA 1E18A 2VHJA 2RGNC 4CDMA 3B1FA 2GLTA 1H2YA 4WCFA 4YA6A 2Q0QA 1IBAA 1RI2A 1PZEA 2R1ZA 4MVJA 5SYMA 2QUHA 3H1PA 1IUPA 4AF6A 4F3TA 3CB4A 1YZVA 4Q02A 1XXHB 2BBWA 4UM5A 2B6HA 3U80A 3E81A 3DEZA 3M4NA 1S3FA 4E5KA 4O2LA 3L04A 4NICA 1ISSA 1MA0A 2RH8A 5T4FA 1X86B 4OK3A 2QX9A 1ZIYA 4CHTA 3W5SA 2G9RA 3MJEA 3KVRA 3TFJA 2OHGA 1TNDA 4A3FC 2AUTA 3IQXA 1J2EA 3PF9A 3BUEA 2AQKA 1ZM4A 3DNPA 4PBTA 5EFOA 3T6KA 2VBFA 4B17A 3QWAA 2YWEA 3AQPA 2B2NA 1R6UA 3T0GA 3CQZK 3RGWS 3DV9A 3GUVA 4HDRB 1ZKMA 1ZITA 4DLYA 1AG9A 1LPBB 2NO7A 1YMQA 3EXG1 4RMFA 3CUUA 1PWEA 4GC9A 4OQ4A 1X80A 2VZ8A 2OLKA 2P8SA 5IN4A 2FPGB 2UU9B 1OZFA 2B8EA 2A78A 3LK6A 3L1IA 4GTEA 4OIQA 4QXPA 5IKEA 3D6NB 3GTJK 1XDUA 1RVDA 1C30B 2ZJ8A 5D6OA 1T91A 3CRQA 5BPFA 1W49A 3AHGA 2VHCA 1V1JA 3W06A 1GTMA 3KEFA 3RG2A 1ICIA 3IIMA 4L74A 4A26A 2Y1WA 1AKVA 2Y0SD 3H6GA 2BMDA 5F98A 1TWFA 3PRKE 5SZKB 2P2CA 3ENVA 4GWKA 4JDPA 1TGVA 4Y98A 3P9RA 4Q0MA 1OX5A 2I71A 4KITB 1M10A 2C83A 3NTRA 4G4GA 4LZWA 4PYRA 4BV2A 2UZ1A 4XGIA 5KJCA 5K0ZA 2G76A 4RQUA 1GZHB 3QLUC 1PR1A 1Z07A 5K3FB 2IY8A 2FEOA 3BRQA 3R0ZA 3EXHA 3OM1A 2Q6IA 3NWJA 4FM9A 1CJUC 2QGFA 2QPOA 5J63A 3PHBE 2W2KA 3T7IA 3CX6A 1PNTA 1OE0A 4ZYXA 1JKIA 4BQSA 4C3IC 1W4LA 2WAXA 3HOZK 1DQRA 4Y7DA 5CX4A 5F4BA 3X1YA 3ZUGA 3ZBTA 1T1EA 2J0UA 4EI2A 3E84A 4Z3DA 5EGHA 1MAUA 3ETCA 1CUIA 1P3Y1 2J3EA 2PN1A 4FCTA 1F0NA 1NNI1 4JHXA 4K3UA 1GGEA 4M8KA 4PWYA 1WY7A 1XTBA 4OGFA 1YV9A 2JAQA 5DULA 1QHNA 1BS2A 2WHQA 5B4UA 5HM8A 4CDRA 3UK1A 2Y0DA 4FYVA 4JZYA 4MV4A 2JDIA 3VBEA 1O8BA 1TZMA 3PUXA 1HG0A 3V8QA 1HURA 1VJ0A 3M1IA 3M6AA 3PGMA 3H0CA 4MDYA 4B3SB 5BSEA 4TYNA 2WM2A 4JBYA 3GTMA 3O95A 4KWCA 3ZWCA 2HEGA 4R7ZA 2TMKA 2AEMA 1P1CA 2JBAB 4L4YA 7GPBA 4FZ3A 1TVKA 4DREA 3EY4A 3AW9A 3N8NA 2F3UA 3ZWVA 4DJAA 5CURA 1FNMA 4AU1A 1LH0A 1M1XB 1IBMB 1X38A 4ZTUB 2QMYA 2PMDA 2YOHA 1P1HA 1SFRA 3FJ1A 4L73A 4YMLA 3IUYA 2HQSA 2JJ1D 2FLKA 1QKIA 1XZJA 3QTBA 1FVOA 3C8MA 3IESA 5FOWA 2EX1A 3ZE1B 4J9VA 2J3IA 1JEDA 4R68A 3LUPA 1INNA 1U1FA 4XX0B 3W3ZB 5LZ9A 1IL2A 1RIIA 2R8ZA 3P5SA 2A0UA 1GPNA 1MGOA 3LI2A 1N5MA 4XZ3A 3AJ8A 4H35A 1LDEA 1KJWA 1KZ9A 4LXXA 5CJJA 5BN3A 4QE3A 3K8QA 3JZFA 4HGZA 1ODCA 1TCAA 2LR0A 1FTWA 3BGVA 3DDWA 4R2KA 4UFNA 4WCFB 4P33A 3LUFA 5T5QA 3T7KA 1RTKA 1RKVA 1U3TA 4OP2A 4AYXA 5A05A 4Z4GA 1EJ0A 1U1EA 2XTNA 2QTBA 2XZPA 3QI2A 4H3VA 1UH5A 4HAZA 2GO1A 3HCFA 5E1OA 2QRPA 3DL2A 5GV8A 3VZDA 4LTMA 3TF5A 4WJKB 1QIDA 4MIYA 5LBTA 4HB2A 3TUZC 3REGA 6ABPA 4ZQFA 2WU4A 2CD9A 3KETA 4OQEA 1K2VN 4ZHQF 3JR7A 1E9BA 3C5CA 5AK3A 1P0PA 3DKVA 1C5KA 3EDOA 4IBOA 1AQUA 2CLEB 4U7PB 1PV4A 1BX3A 2PGAA 3KUUA 3OQPA 2JGMA 1VDZA 4G1MB 3MTBA 3F6BX 4AWBA 2XE8A 1I30A 1R0SA 4BO8A 1QPBA 1GYRA 3DZGA 3OETA 4P6VF 4DIKA 1CZRA 1E2LA 2M9MA 1K86A 1R4ZA 1IE0A 3A3PA 3H6KA 2AG6A 4IO0A 4PPQA 4ZVSA 1X80B 2LTAA 4GTBA 1ZINA 3Q7TA 1MNQA 3NYQA 4F06A 3ZWAA 2P9QA 3BCHA 2P9GA 3N0BA 3VYUB 1L4EA 2H6EA 3T38A 5CXQA 2XAAA 1T0IA 3HV0A 3DBOB 4B45A 2CBZA 1YNJA 5I45A 3AVYA 1ODTC 2PVCA 2P35A 4DMKA 3T9CA 3S1RC 3ORQA 3DE3X 4OB7A 3ZD7A 3Q9SA 4FDLA 3SQNA 3S70A 2BGIA 3DAPA 4L6AA 4YCMA 3B82A 4B3TB 3B1XA 4IVPA 4GBED 4NY1A 1DOHA 1E9DA 5F1PA 5HQ3A 3R0IA 3IPAA 2HBZA 3P0RA 4A2PA 5JBQA 3UMCA 4XSGA 3FWKA 3SX2A 1W96A 1ZYRA 1QUFA 1BA2A 1U9IC 3THSA 5HUHA 3N5KA 2R68A 4RA6A 1LPNA 1M6HA 2XAUA 3GR6A 1NVMB 1R0WA 2UZ1B 4EY6A 1TM3E 2NVYA 1U2TA 2JK1A 3BCRA 3C6YA 2QI9C 3PFHA 3QUCA 2XKBA 5DHSA 5IC5A 2QSZA 1Q15A 3EXHB 3GJYA 3TFOA 3WRWA 4YCLA 3A4TA 2YXDA 2J32A 2AFIA 2DPGA 3M4XA 2ID8A 2W2KB 3R5FA 3B8EA 3VJMA 2WWRA 3VQTA 1NZDA 4GHWA 4F4DA 1KI4A 3AV3A 2J0UB 4P84A 4TTJA 3K35A 4ICIA 4CIWA 2E2IK 3DMRA 3HEMA 3GCDA 3SJBA 2EJVA 1LNQA 3MC1A 1C4WA 3IMGA 2Z5GA 4TS3A 2F8MA 1FPMA 1KJ9A 2OB2A 2I6XA 5F78A 1AUVA 1YA4A 2XRYA 3O1JC 1XDSA 2AH5A 3GDFA 1ST3A 1JU3A 4PLFA 2JIOA 4AKEA 2DMRA 3GLQA 2QW8A 1C7QA 3E82A 1VZ3A 2DHQA 3OX3A 1QORA 1HSOA 1R9MA 2DOKA 2YJ6A 3GH1A 1FYEA 3MXOA 4M53A 3VJRA 1DUSA 3N6XA 1DSSG 5TX7A 1RHJA 1TVKB 1TU0A 1TYEB 2JF0A 2L69A 2MINA 3NIGB 4GSYA 3TFHA 1BVHA 1A7UA 1I13A 1R2QA 3DW1X 4JQZA 5F73A 3ZIAA 4CLOA 1XV5A 1ZM2A 1CDZA 3R7AA 4W9MC 4LZJA 3ZJUA 4X44A 2FEKA 1R0XA 4FMCB 4L72A 2WR8A 3SFZA 4CMKA 3M4OC 4CTNA 1Z35A 5FV7A 5A4FS 5HKAA 3ZCXA 1JLKA 4Q9AA 5EMKA 3I6QA 1KSFX 5K3BA 1OLXA 3IERA 3IMCA 4XWOA 5BN3B 2PMWB 4GT1A 1NE7A 2IHVA 1GKIA 2KQUA 4N54A 1WXIA 1EWKA 2NZ8A 2JCGA 4W82A 1DDGA 1RZVA 1E2GA 1BAPA 4N47A 4UQLA 3L0ZA 4B43A 4GYWA 5LU9A 1ZK0A 5BOSA 3IDAA 3PFIA 3HLKA 3L8MA 1QZTA 1HQMA 1EQUA 1XQ6A 4W9NA 3GJSA 3ZOZA 4EB6A 4IQFA 1EWRA 3P27A 2X0EA 3TEMA 5B5SA 2BT4A 1ZJYA 3J7TA 2XDAA 3D7NA 5F64A 1YQDA 5JLAA 1USOA 2VDKB 3EQ8A 2HSDA 2FG6C 3ESBA 4EUSA 3F6SA 1FSGA 1UEJA 3GOQA 1FDSA 3H8WA 5FOSA 2YJ3A 3FPCA 3OT4A 2ISCA 5KREA 2B0CA 2PUWA 1UDXA 1HDEA 1XZAA 2O2SA 2VHVA 3O7MA 5LVAA 6ADHA 4E51A 1JEQA 2HT1A 2PXAA 4DCCA 1KC3A 1E2UA 1ZS9A 3FBTA 4A0QA 3FNBA 4KAAA 5DLPA 3ILSA 4JI3B 4D42A 3W8FA 1A9TA 1TIKA 3F46A 2JD2A 4B6PA 1MAHA 1HTTA 2EYUA 2D5CA 3AQIA 3DTVA 5F5NA 1G9TA 1UKCA 5A5FA 2WUFA 2E89A 4I4CA 1M75A 4RD3A 4GKBA 2Y9MB 1HWYA 4PYIA 1I6HC 3CJQA 4GMKA 3L3BA 3C6KA 4C03A 5KOIA 4ZC8A 2FUEA 2GBGA 4PX5A 2HL6A 4NCKA 1O2FB 1M2JA 3E61A 1UMDA 1RHQA 5BW5A 3QF7A 3AD9C 1ZM3A 5JCJA 2ZQ5A 2GR9A 4IF4A 2ZB7A 2CUNA 1WL8A 5HQ3B 3LWZA 3AVXA 4MTLA 1BVRA 2M2IA 3KNZA 3OHPA 1H2WA 4LRUA 2IV2X 3UV3A 3SYMA 4WW0A 4X3OA 1O5IA 1VE9A 1Z2NX 1DT3A 3RVPA 4RA6B 2JCSA 3PX2A 3ZCQA 5IZCC 4A3KC 1T0BA 2QY6A 3F2IA 1DEKA 1FXWA 2YMPA 2AFIB 3E05A 4AWXA 3T3NA 2PBZA 3DOJA 1TWAK 2JFNA 4QGHA 4WX2B 3I0MA 4IUCS 5H7XA 3DAYA 3QPUA 2DU8A 2ECKA 4NV0A 1QRAA 1SM4A 1ZXBA 1ZK2A 1NIPA 1FBNA 3KSZO 3NHZA 3HCBA 4GOKA 5GOZA 4LBZA 3VO8A 2EW2A 3L82B 4A3DK 1KH1A 1J7KA 1UK8A 3ICOA 4KRGA 2H1LA 3BJRA 2VAWA 1H3FA 2VPQA 4JS0A 3VXKA 5SZHB 4YAGA 4Z1MD 5L8VA 1EJ2A 1Q0RA 1QF9A 1YDWA 4P83A 4S24A 2R8RA 3DXFA 3PI7A 1QK4A 2W93A 4MRPA 4PZDA 4QHSA 2I3DA 2NU8A 2Z98A 3IAM6 1YRAA 1WXEA 2IP1A 1XTZA 3ZGOA 3KB8A 3HZZA 3GY0A 4L3VA 4RFVA 3L8HA 2OHJA 3ZCVA 1VGVA 4IRXA 2ORVA 4W4TA 1SVNA 4A93K 1A0OA 3Q0IA 5D8DA 2MINB 2G4CA 4EUFA 3AJEA 5CGQB 3WHIA 1VL2A 2VJNA 4CG0A 3KLNA 4P0QB 5ISMA 2V7WA 3E9CA 3M6MD 1O9HA 4KYUA 1WB9A 2ZSEA 2P75A 4CLOB 1L0WA 1PJ2A 3PSHA 3U4AA 2YVUA 1C0LA 2WG2A 3LBNA 5FHRA 2WMOB 5D4DA 1B76A 4N9WA 2FPUA 4D9MA 4F5EA 3FVVA 1B2LA 2E4VA 5LKAA 4BLSA 3FHLA 2DKFA 2MJLA 3FHCB 4K3VA 3MQ2A 4XA8A 3RASA 4KRXA 1JT9A 5JZVA 3FB4A 4R69A 1OLXB 3G7SA 2E4AA 3KOXA 4RPCA 4D3DA 4E94A 2GT1A 3N75A 5CDYA 2D00A 2BKEA 1E62A 1TQ6A 2FOXA 3S44A 2Q4EA 2WF5A 2OHXA 3ESXA 4FEGA 1SG0A 1VPTA 4AICA 3QXJA 2Z95A 1JAHA 4BNWA 4Q21A 1LK0A 4RAOA 5BOSB 4R4JA 1JA0A 5J2TB 2ZQYA 4EB6B 5EJ7A 1XMXA 1NN0A 2VQ6A 3R5KA 3HS3A 1MW9X 5BSTA 5B55A 4BO5A 3OEED 2IXGA 1Y6FA 3I01M 5A0TA 1MFPA 3KT8A 4KQ6A 2QRNA 4KFTA 2JW5A 1YRHA 2VKQA 4QDOA 4OSPA 4FNGA 1BMQA 2ZUWA 2HHJA 1SUBA 1PGQA 4WECA 1WTCA 5I8PA 1FFAA 1U3WA 4IDQA 1Y6ZA 4LE0A 4OO3A 4HWGA 2YHIA 4Q24A 2XCTB 1DS6A 1YKSA 1JEQB 1R8YA 4B2PA 4YRDA 2PX4A 3ZTWA 3N3AC 2OV8A 5KO2A 3C1OA 4BO4A 2GF9A 4Y2RA 2QD2A 4EVSA 1MOSA 3QUBA 2QYTA 5FBLB 1DC8A 1L8AA 3NW9A 5D5HA 4U1RA 5BUSA 3DTVB 2YIMA 3BREA 4V02A 1O96A 3SZOA 2VEDA 2YBEA 5MN5A 3U17A 2KWAA 4Q9JA 4RE6A 5AO9A 3BFVA 5HNKA 3I9NA 5FPPA 2OXFA 4Z7JA 1OXUA 1YRYE 1U0FA 1LPSA 2FUNB 3PQ5A 1CUBA 3VPHA 4AKGA 1R27A 1UMDB 3OH8A 2WSSD 4LOKA 4IMPA 3K70D 3UTDA 4X7MA 2QGZA 3BSFA 5AD1A 4IIEA 1WETA 2N47A 4BP3A 3M9WA 2H1OA 5BWBA 1I80A 2RGXA 5FA6A 3BK1A 4ZCQA 2XX3A 3DB2A 1SKQA 2W7TA 1PZXA 3OPYI 4R1UA 3HY6A 3ENKA 5L3ZA 1ML3A 3ND7A 2VF5X 4FYWA 2YZGA 3DM5A 4WLVA 5JXJA 4Y6RA 3E1SA 1KSJA 4GZ3A 4C1BA 4YFKA 4I9FA 2QTCA 2ZEJA 2A9KA 5F5LA 5CRIA 4JI5B 1K7EB 3SI7A 4Z4EA 1T3GA 1YDEA 1U3FA 5F3WB 4A2CA 2C42A 3S55A 3FVRA 1G2QA 1Z4KA 4C0XA 2AFHA 3DLTA 4MRVA 4DV7B 1XZCA 3T7CA 1SQSA 4YACA 1X7HA 3JYQA 2D54A 3GA7A 3QBVA 2Z4TA 4K6CA 1QNLA 4LZZA 5AOVA 2D0DA 1E1NA 2XSZA 2VK1A 2EQAA 3MUFA 2Z5FA 2ZE6A 1KI1A 2NU8B 2C5SA 4JC4A 4OIFA 1RTTA 3T99A 3UWKA 4GGPA 4AZ3A 4LMAA 3PEUA 3NHYA 2R79A 5HYVA 3FETA 5T4BA 3F6RA 1KMMA 1GTL1 2GCIA 2GHIA 4RHCA 4O33A 4R2HA 2HRBA 2QR3A 2VSNA 3L2OB 4KO2S 5KVAA 4BAUA 4N5HX 3DFFA 1P19A 3I1JA 3PD1A 3P9CA 4URXR 1GADO 1DO8A 5CCBA 1WXHA 2RK4A 4JKOA 5EIXA 4KXLA 4UTXA 3SJAA 4EO7A 1QGAA 4XVRA 1P1RA 5FO0A 1YZNA 1NATA 3BICA 4CM5A 1NC3A 4WIAA 2ZYVX 3NEPX 3TL6A 1YE8A 1FSZA 3FTCA 3O4VA 4LA4A 2P65A 4R2IA 4DCTA 2B25A 3ANMA 3ICCA 3RZDK 1D2RA 2H7YA 1UT6A 3OO1A 2HSZA 4RL6A 4UQPA 3T61A 1RXEA 1VPVA 3A04A 4QIWD 2DYKA 4Q1EA 4DZRA 3WRYA 1QU2A 3CYFA 3ZE9A 1EHCA 2JIMA 3K09C 3WWDA 5MN4A 3ADDA 5A4KA 1CQJA 2O3UA 3TDNA 3GVHA 5LMUB 4R16A 3JSXA 4F2PA 3E3NA 2PRJA 2GD0A 4AJOA 4NULA 3L46A 1ISIA 4L50A 4A8HA 1JFTA 5DI9A 2J9RA 5T41A 1CDEA 3B60A 4G0NA 4DWVA 1UBTS 1GSIA 4YV7A 4N3GA 1L7MA 4CUKA 4F3NA 5A5VA 3HO6A 1ML4A 3E9DA 5DHTA 5EIEA 1QHEA 3IAXA 5K2MA 5CB6A 3I6IA 4A3GK 4HYYA 1OXTA 1G18A 1TT7A 4FTWA 4AMBA 1TKBA 4C3JK 2HX1A 4OXIA 1CLEA 3SS8A 3T3EA 3QVTA 3A6DA 4G8JA 1F5NA 1QHXA 3OCUA 4RMGA 5EJIA 5FPSA 4X61A 1G9XA 3A2NA 2YHIB 4JA0A 4KQCA 4ZICA 3K5HA 3U26A 1U2DA 3PXGA 3GEIA 3BIXA 4AZ0A 2UYHA 1UIRA 3ONNA 1QGOA 1KQ3A 1MIOA 4XAQA 3UWSA 3IGFA 1KVSA 1WKBA 1YASA 1ONNA 1PL8A 3O75A 1W29A 2NYVA 1O96B 2FMUA 2H2IA 5C34B 2PX6A 3M3DA 3UJ6A 3ZS8A 4F8JA 3L79A 2VSXA 4JENA 4XYGA 3QHQA 4AN4A 1VFPA 2R96A 3KSMA 4G5QA 4LOIA 3MIZA 1U5BA 3RJTA 2RGNA 1MO5A 1JIKA 4JLNA 4MI9A 1DMRA 2QZPA 3JWHA 4QKQA 2VCYA 4OJKA 1QHIA 2RIRA 2E4WA 4BECA 1O5TA 5CB0A 5IBCA 4D4JA 1SXJC 2FXIA 1TPZA 5KC8A 4F9TA 2JFPA 3SYTA 4DCOA 3HNPA 3S1NC 1CXZA 1KAOA 1T2CA 2MWMA 1XDWA 4HB3A 4L5CA 1BDIA 4YMGA 4Z5XA 3AHIA 4W7HA 2YIJA 2RHJA 4I9GA 1JEJA 2Q6VA 2APJA 2ZB8A 3CLUD 1GVHA 4MKHA 3NM4A 4OH7A 5H4HA 2X8WA 5JQWA 3R7SA 2IDMA 2R6JA 2XITA 4H7HA 1NBIA 4Q7EA 1ESZA 3DR5A 1L5QA 1Z39A 2ZJBA 4JL5A 1GPJA 4ZQEA 3UUGA 5K0LA 2E4UA 2QD3A 4BFXA 1V7CA 2I7DA 5LNK6 2AFHB 4MITA 5EZQA 3WMWA 4AF7A 1WS6A 1E89A 5TEVA 1MHTA 4FGKA 3TTWA 4JELA 3ERED 4WOCA 3LDUA 4C43A 4ZYYA 1G8AA 5CFPA 1SZPA 2CCKA 3OZRA 4KAWX 1FFHA 4UHCA 5TARA 3IT1A 3AF6A 1U99A 2GK4A 1BFUA 3HXPA 3PPYA 2WWIA 4GXRA 4UXHA 1U7HA 2IIVA 4PPYA 4XLTA 1GQRA 3B7WA 1TM4E 2IPLA 1F48A 3RZOK 4LDAA 1KVTA 2WIKA 2Y99A 5FKJA 3VPDA 1WKCA 3OZWA 4IFIA 3GPLA 1HV8A 1ZN9A 3DVAA 1R7RA 2MYNA 4AZ3B 1A96A 1Z8HA 3BH0A 4OGGA 4OXXA 4MYCA 3RBZA 3SHTA 3GRVA 4DUZB 2V0NA 2L82A 3LT1A 3A27A 3C41J 4EHKA 4CETA 1Y5MA 1D03A 3E22A 3R3UA 4RZ2A 3HOVK 4IW3B 1NTOA 1NYLA 4E21A 2DPMA 4LSZA 5HOEA 5IASA 4EY5A 2HF9A 5TJ3A 3RAGA 2H2DA 4PLZA 2FZ4A 3TPFA 5AVXA 4URVR 5FL7A 1VOTA 1TF2A 2Q3EA 2V45A 3KAKA 4BMYA 3HGMA 2CUZA 5JMPA 4BE7B 5ALQA 4TVSA 1YCDA 3KIPA 3RU3A 2TS1A 5KYNA 1HMPA 3LC7O 4G0ZA 2WD8A 2AOWA 4I8XA 4JSRA 4I7EA 3DAHA 4HXYA 5EJ2A 1RPJA 2FW1A 2X7JA 1MENA 1THGA 5AJXA 3VMFA 1CW2B 2PZGA 4NH0A 2WHXA 3UOGA 1W73A 1CQJB 2IHTA 2RBGA 5KNLA 2A3RA 3FOEC 4ZAZA 4Y2UA 4UVHA 4HNUA 1NW3A 5IDYA 5JNWA 3AIMA 2X6QA 1RLMA 4YUZA 1T5OA 4KXNA 5H70A 3ZK8A 2RSLA 5KNCH 1FFGA 1T6NA 2ECOA 2H7VA 4KQKA 1MV5A 2FP3A 2ZSUA 3FN4A 1C3XA 1W85A 3INTA 4C9BA 2MYPA 1GRCA 3OKPA 4GYYA 4MWCA 2IX9A 3THYA 2GYUA 1P2FA 3BXOA 1FW6A 3T9EA 3WGIA 3K05A 4O4JA 1M34A 3DAGA 2QUBA 4GPD1 1TMYA 3EUWA 1QH8A 5F77A 1YDGA 3UMBA 4BY7C 1RQNA 1X8JA 3DJFA 2WA2A 4ZC1A 2XADA 2FN8A 4B9AA 4TYYA 3T7RA 1EH5A 4AZ0B 3Q12A 5AVJA 4B74A 3AHFA 3FOFA 1MIOB 4E32A 3ZY5A 5DNEA 4EF4A 3IL2A 4LW8A 4OH1A 4KR6A 5ERGB 1MLDA 1Q6YA 4CTJA 4QDJA 4XD7D 2AS0A 1N34B 3D6HA 3SKXA 3TTUA 2BFMA 1NXVA 3HK2A 1JIQA 4FGSA 5EXPA 4QLBA 3F3SA 1ODLA 1FYFA 3DBLA 3E35A 3GFVA 4ZCMA 1U5BB 1H8ED 1OFHA 4QG7A 4ZDJA 4B33A 1XQ1A 2XT6A 3QVJA 3FY4A 3IRUA 3BZBA 3I2GA 2YY5A 1EB9A 1WP9A 1R15A 2PGLA 1MO3A 4RQBA 2JFGA 3W77A 3HCRA 2H4YA 2HF7A 2ZQZA 4ZAWA 3S68A 3U6BA 3NJ4A 2VJDA 2WWFA 4JGGA 1ZD5A 3DDOA 5ENDA 5EMHA 2QE6A 1YACA 2F67A 2J30A 5AK6A 3H9EO 1CRZA 2YS7A 1WMFA 4LJ8A 3ST7A 3ZTYA 4PX3A 2Z8XA 5GV7A 2QT9A 1FRVA 2EQ5A 2GJKA 4XASA 2IEDA 3DTNA 3LQRA 3LUBA 2EZ4A 1GCOA 3RODA 3HA5A 4BLVA 5DCLA 4J7AA 1Z8NA 4JLBA 1Z4OA 5FLMC 3MTGA 1KKMA 2G5PA 3C1TA 4Q5IA 4OY3A 3G79A 4WMLA 2M1ZA 3DONA 4G0VA 5C1OA 1XF1A 4M0DA 4KN8A 3RYIA 3NIBA 3UK0A 1ACLA 1OFIA 2BM1A 3VTFA 4JAVC 2JAWA 3A1WA 3Q3JB 5INTA 3N59A 1HETA 2I4TA 3INRA 4M76B 4C0SA 1DBQA 2H1WA 2XDWA 3I45A 5DHQA 3W6UA 4OYLA 3DVAB 3VGJA 1CQPA 3ENQA 1RNLA 2YFKA 4M1ZA 3VYVA 4BUJA 5DGDA 5HUQA 2XCIA 2NPOA 1YX2A 1FP4A 3G89A 1DJQA 3I23A 1UK7A 4CMIA 4YCCA 4OYHA 4NYMQ 2I4OA 4XWGA 4DDUA 4R01A 3LXXA 4FYXA 3DT9A 3E22B 2WQ6A 4NXNB 1U9IA 3F3KA 3IKTA 2XYVA 4FHDA 3RFVA 1JA1A 4KRFA 5F4ZA 3SPXA 3CTMA 4YMVA 1IRXA 4AW9A 4KSYA 1XQWA 2XRFA 3H4VA 4HCJA 5EKSA 4ASUD 3PEFA 3ES9A 4L5IA 4MA5A 4NPHA 1TADA 2QJTA 2ZTMA 4JWKA 1Z08A 4K7JA 2OV3A 2C3MA 3V1LA 1FRNA 2J5BA 5F5XA 3VV2A 5IVIA 3T3GA 5KQMA 2O1EA 1NF2A 2W2TA 4RSGA 3C5HA 3BA6A 4W5RA 1PDVA 3ND8A 4G1CA 3F5SA 1S2DA 3BH6A 4URHA 3GVCA 1ZMXA 3WL7A 5AIBA 5AHXA 3JQEA 3RC7A 3KJZA 1TWFK 2OHFA 2OOKA 3ZK7A 4JKYA 5HP4A 1AGXA 1O8CA 1J2YA 4LGMA 4RF2A 3T3OA 2ZUFA 2ZUEA 1W85B 4QJBA 1KWGA 2BI8A 4UASA 4C2UA 2DFNA 3U49A 3N7UA 3I2IA 4UDNA 3SYNA 3WVNA 1FUKA 1TO6A 1NM5C 4L22A 2PYIA 3BORA 3Q87B 4Q19A 3S29A 3VR5H 3THYB 4B3RB 1B74A 4G5HA 1C8KA 3KZNA 4O4JB 1P39A 3TK1A 4C7JA 2O8BA 1QH8B 1EM8A 3Q9UA 1K9SA 3PU6A 4CYMA 3B1JA 1P4JA 4WKCA 4CMJA 4CQNA 4J0GA 2D1YA 1GTG1 3FM9A 4D41A 4JSYA 2AXEA 2H51A 3HJNA 3NEYA 3ILVA 2RD2A 1I7SB 2QQFA 3RCBA 3DMPA 2BCGY 4PO8A 4XGRA 5EJ8A 1QGDA 1TM7E 4R7GA 5FI5A 5DM70 2QN8A 4PTLA 3T0FA 1EVYA 2CFOA 4K6KA 2ERXA 2PZKA 3CX4A 1EX9A 4RC9A 1AKMA 1IHDA 3M2TA 1PF7E 1X92A 4YLEA 4YROA 1MO4A 3MUNA 3Q9LA 4RD4A 3DBLB 2AE2A 4EJSC 1TQ2A 1TTPB 5SZIA 2GVNA 3MCUA 1RCUA 3DKPA 3VKVA 3GTGC 2VI5A 3OPVA 3C3KA 1PBNA 1PR3A 3F47A 3C3JA 1ZC3A 2V6IA 3TSAA 2A4KA 1KZ6A 4OF4A 3EG9A 1ZEJA 3I9MA 5IXSA 2OK8A 5IKMA 1VBNA 2NGRA 2R2AA 5EE0A 3CNNA 3K8YA 3Q85A 3TQCA 5JQGA 3U56A 5IVKA 5B12A 1GV0A 3Q7PA 3L5KA 3I4MK 5BV7A 5H1YA 3ECCA 3AO0B 4OLFA 1HNXB 1XMSA 5HCIA 3RUEA 1M6VA 4F1KA 4Q4HA 4YJHA 2XZTA 2ZJ2A 2YX1A 3RRNA 2AZMA 3K73O 2QGNA 4TZ0A 3ITDA 3A0RB 3AY6A 4IUDS 1EXVA 3GUCA 1JXOA 1U7UA 4C4RA 1J98A 3WDLA 721PA 1TECE 4KH1A 5LQSA 1P4SA 2IXBA 2FZWA 1W88A 3EEQA 3HA7A 2P62A 4HAVA 4LK3A 4G0QA 3D8SA 4FJ1A 1SRRA 3FMFA 4HWPA 3U4GA 4BQPA 1IXYA 3EF0A 2HLPA 3RKSA 3BXEA 1X15A 3FXAA 3HDQA 4L0QA 4TTVA 3M81A 2I62A 3K9LA 1N2BA 2OHOA 3OLYA 3RYIB 1BOOA 2FK8A 4WV3A 1D9ZA 3DYVA 5HRAA 4BMNA 4G0MA 4BO7A 2ODWA 4JVLA 8ADHA 3S5UA 3N6VA 1EK5A 3H0EA 4MX8A 4D92A 4I50F 2WPNA 3F6YA 5KSOA 3U16A 1RC8A 2Q5HA 3VO2A 3ZDFA 3F8WA 1W7AA 1V2HE 2E4ZA 1NW8A 3IPCA 5KTSA 1PZFA 3IBCA 2WM3A 1Z18A 4BMZA 2VBGA 1GG8A 4CMIB 1FP4B 3EJWA 4QDTA 1VFNA 1YH3A 1IL0A 1AU9A 1Z6PA 2W9XA 3FUWA 4HMQA 3S2YA 4B6QA 5M04A 1SR8A 2FEPA 3H99A 2V59A 3NATA 2ZE5A 4JK1A 2VHUA 1N2JA 3QM1A 5ENZA 1EB8A 3HJUA 3OQJA 3SIWA 2CNDA 4KXVA 4MS4A 5IZCA 2BEUA 4LUCA 4QRDA 5C8XA 1OIVA 5ESWA 4CNQA 5EP2A 4B2LA 1G7SA 2CXSA 3CCCA 3LRXA 5L3RA 4XCVA 4GIBA 4HX2A 3ZQ6A 5BV1A 2BR3A 2ZRFA 3WZLA 1WEHA 2Z9CA 4KIFA 2DC1A 3TEJA 3CF6R 3CH7A 2H85A 1YRWA 3I6MA 4H9GA 4TWRA 1G21A 3GI1A 1D6SA 1K5GA 3KQMA 4R83A 1IAVA 4JT9A 4EG8A 1EGVB 2R66A 3AHHA 2H00A 3G2KA 4TZKA 3ZQ4A 2CNBA 3VYSB 2CKMA 4PABA 5ESDA 3Q6MA 1URPA 2PMZD 3CS3A 3A1EA 5HBRA 2HMUA 5KQPA 2ID9A 4MGEA 1U7DA 3FCSB 3I1YA 4KV9A 5JT1A 5HRCA 4JBXA 4OLJA 5FULA 3TOXA 1GU1A 4PZEA 4TSKA 3KZ1E 1TWHA 2NVYK 2XGMA 4X3PA 3Q72A 3V42A 2NVUA 3LNCA 3O4JA 3PE6A 3W7AA 3REOA 1B4AA 3LXRA 3OCYA 3P4YA 2O8BB 1EM8B 1OIWA 1P0MA 2G1PA 4G65A 5HMMA 3OHSX 1ZOOA 2DCUA 2G28A 1ZNZA 4YRFA 5TPWA 4MYTA 4E2XA 5ECYA 3S1AA 2QRZA 3Q41A 5IXJA 4AJIA 2R6ZA 3QEOA 2AYYA 4IJMA 2HFKA 4IVQA 4MAAA 4ROTA 2A0WA 1WQ1R 4KH0A 5HF9A 1XRNA 3GJ7A 5CEFA 4LRSB 3DZBA 3ANNA 2O05A 3H86A 4XCXA 1DG1G 1AGYA 2BUCA 3EN0A 1XR3A 221PA 2C8JA 1Y5LA 3B1YA 3IKJA 3PUHA 1ECBA 1UBKS 2N42A 4MRAA 1G2OA 3BRWA 4R9NA 1JW9B 3I0NA 1O0SA 3EIFA 3UCFA 3WJ7A 3ZI0A 2GUGA 3T15A 2WWGA 2E0IA 1C4OA 4XWWA 2CXNA 3T5TA 3OU7A 5FYDA 1RPNA 1OC4A 1WX1A 5EINA 4MUXA 3INGA 4X1YA 3EXEA 3EG9B 5TJHA 1MPXA 3N76A 2ZTLA 1ZIXA 4AK9A 2PAAA 3HFSA 3KKZA 4R9VA 5JQGB 3BD8A 3C8ZA 3K0CA 1M76A 5EJMA 1VJEA 2VK4A 3RAJA 4NONA 4JJ7A 3DQZA 2BFOA 3VVBA 1M6VB 4Q4HB 1LFDB 1YB5A 3JR3A 3EGVA 4YJHB 1F0PA 4ZVPA 2C84A 2A33A 4ZT4A 4Y52K 2AKYA 1VRWA 2PEYA 4BQEA 2P6UA 4KDDA 3A3KA 4HH4A 4MUNA 4UXIA 4WXYB 4I5EA 1W88B 3AX6A 1SUEA 2OBMA 1ZMOA 4RNCA 4YRMA 3HBMA 2G6BA 1N2IA 1MD9A 2LDXA 4IDFA 1AHPA 3NV9A 1VYTA 2B34A 1ECCA 3L9XA 2P5MA 3EVZA 4PYNA 2QYOA 1KO5A 2ZYUX 2DZDA 1DRWA 1VLQA 4KPYA 2B8JA 3LDAA 4L8FA 3P96A 5CDFA 1RAIA 3HDJA 3KOZA 4OHBA 1U2EA 3RS3A 3G5LA 4MCIA 5HFJA 1KE1A 4LTNA 1P75A 1PEYA 1TK9A 2BGKA 3K3PA 1W4RA 5HKKA 1GZSA 3MCZA 4RCZA 2FR0A 5IKOA 4HL6A 2AD5A 3CCFA 3KQUA 3OUZA 3VC1A 2PH3A 1KWKA 2ZAGA 3AR4A 3RUIA 4B2IA 5IAKA 4ZKDA 3DLCA 2XKJE 4YFVA 1RXWA 1R8QA 1UZAA 2JA5A 4EI7A 3NCHA 4JEHA 3KVYA 5ESXA 3SBOA 3EW7A 4Z53A 4AIIA 1JR3E 2F1RA 6NULA 3U4MA 4MS4B 4EPWA 3A1FA 5KWJA 2PRSA 5KYGA 2BEUB 4LRWA 4TS1A 3NBKA 2A9OA 4IIJA 2GN0A 1AY0A 2QOEA 4TVBA 1A5SB 2LV8A 2H1CA 2QN7A 1YZGA 4NOKA 2IP2A 4LF4B 3RRFA 1S2LA 5CXSA 1ZSVA 1HPLA 3UGTA 2OECA 1KO1A 1N7IA 4JJ6A 1ADGA 1G21B 1ZNWA 2BLLA 1NDHA 2UYQA 4EKNB 2INGX 3F4LA 1QANA 2XNCA 2EP8A 3CEPB 4HNQA 4MSUA 4PHFA 4F6RA 2OGTA 1EK0A 2YDXA 3WLMA 1O95C 1PT9A 1N5JA 1XTIA 3S6JA 4AD8A 4WXMA 4MI1A 1JEYA 4FFDA 1YQGA 3EA5A 3S40A 3IELA 1YS9A 4H6WA 2VA9A 3BE6A 4Z7QB 2ZWPA 2AE1A 4ESOA 3CSSA 3ZJ4A 4OREX 3FZYA 2NVUB 1SRQA 3NNNA 1N1DA 4BMOB 1DXHA 1TCVA 4EKIA 1E7YA 2QD4A 5CBPA 2G07A 1F5SA 3OIGA 1JR2A 3BS4A 2XOXA 3KZCA 5TPWB 3KEQA 2PZAA 3JZMA 4IYJA 4PQYA 3S1AB 4LTDA 2IV3A 3W5CA 4HQOA 2VQFB 3GRZA 3IALA 1F1BA 3F73A 1IAQA 2VHZA 4Q4AA 1TE2A 4Y67A 1E9EA 5COAA 4LKOA 3A9TA 4BMSA 2NO1A 4B44A 3G2JA 5IVHA 4G36A 5GP1A 5M34A 2ZCUA 1VIAA 3QY0A 2FQWA 4R6XA 3WZ2A 4PTZA 1L5SA 3OQOA 3E7WA 3K09A 1FC0A 3HABA 3RRYA 3OY2A 1NF8A 3T41A 4Q7QA 2PUEA 1QU3A 1N8NA 4ER6A 1UZNA 2QY9A 2RG7A 4X1YB 3EXEB 4RZIA 3RFXA 1JHVA 2HRDA 3S5JA 1V6SA 5J4HA 3FZEA 1W9HA 4KLCA 4BRUA 1WV0A 3VNVA 2H9AA 3UHFA 1O77A 5D3KA 5F1KA 1EVKA 3T7SA 1FU7A 1N1GA 1VG0B 3PD7A 4FDVA 3DWGA 1N3IA 4MO9A 4TT3A 4OI0A 3BTOA 5ES3A 1OI4A 1H4TA 1RJWA 4B6EA 5CNJA 4P36A 5J1TB 4RH1A 3S27A 3NMUF 1XYVA 1WCYA 4E14A 4TRMA 4LV8B 5IG2A 4QVGA 2LVBA 5L4LA 2Z2ZA 1RI5A 5CA1F 2MOKA 3VI3B 2DKOA 3F8SA 1K8XB 5BYBA 2QVBA 4KE8A 2B6NA 1E32A 2F90A 3FE2A 1XZEA 2YINC 3V4OA 4BLUA 2CXPA 4OHKA 4DUGA 4Q9DA 5C35A 2OFFA 3GRRA 5TMPA 1DO0A 3UJCA 1K5HA 1RC1A 4ENVA 3O8OA 2H1RA 1CHDA 1KSGA 1Y89A 3QMWA 3INYA 4C08A 4S1WA 3NWPA 4F46A 1XA0A 4EY8A 1PS9A 1KPHA 2B7LA 4QXOA 5I4BA 2C7QA 4HLQB 4KREA 1JP7A 1JTVA 1BTOA 4L5AA 4NNJA 1ETHA 1K8YB 3ZUPA 4LIPD 4PCUA 1KL7A 1AMOA 5DNYB 4GKJB 5K3CA 2FV8A 3QEAZ 2XWPA 3VDQA 1ZD9A 4IKEA 4M9QA 3NHAA 4IF6A 4D96A 2P7HA 4KR7A 4LLGA 1FJ2A 1MV8A 1NUUA 2Q21A 4FX2A 4S2UA 1PJ5A 2WJPA 3IQFA 4C88A 1OWMA 2GJ4A 3AF3A 4BP1A 1AHIA 4C5AA 4GUDA 1X70A 4A3LK 2KMLA 2O0HA 1EWVA 2PYDA 3AR2A 3KZKA 3U3DA 1ZIPA 2A57A 3GGJA 3P2KA 4L5JA 1NN5A 4MINA 4E4YA 4J6EA 3LY7A 1BYIA 4IIJB 4K9OA 2Y1EA 4OD0A 1KQNA 3SFTA 4ETIA 2BKVA 2PRIA 4EFLA 3CU5A 5BWNA 3A4VA 2AMJA 4NBSA 4GO1A 4TM8A 3ZVRA 4F21A 4ZJZA 1YC2A 2BFNA 2BUAA 3C3BA 4DTIA 4JOCA 2O8EA 5C7YA 2IYAA 3HU1A 1QGUA 4P9NA 5KSWB 1QTQA 4CL0A 1PWYE 1AO3A 2A9QA 1DB3A 2ECQA 2W58A 2WE8A 3HHPA 3OQHA 4WPGA 1NDQA 1NOKA 4X3CA 4CL3A 1F4VA 4LJ7A 2Q3MA 5E7QA 1KBQA 5FL7D 3GXOA 4FYIA 1LC0A 4J75A 3MTIA 1Z17A 2GWRA 3LC0A 2GD6A 2OFXA 1C9MA 1CR1A 2DECA 4TLDA 5C44K 4OP1A 4W7IA 1JEYB 3EMVA 4X95A 5K0SA 1XPJA 4URZR 3B38A 4I6GA 1WDLA 1EMDA 1SBNE 1XKXA 2VPPA 3M70A 3GLTA 4NCXA 1C9EA 2DB3A 4HGPA 4PN7A 1D5WA 3FSJX 3JVUA 3O4HA 5FUQA 5CIYA 1BN6A 2WJYA 2O7RA 4LZOA 4QULA 3ZX4A 1GPDG 2BDTA 4QGSA 5CBPB 3CKLA 3DMFA 1SVIA 1C0AA 3M9LA 1XKTA 3LOUA 1NW4A 1K0UA 1ULAA 2QQ5A 4W5HA 4YRQA 5DX1A 1R8SA 4ARUA 3LQFA 3PRJA 5EZ6B 4CG2A 4F3CA 3F8TA 4YV0A 3QYJA 3WLRA 2CVHA 4Q4AB 1ESDA 3LFUA 3TLMA 3GJ6A 3R2JA 4L4SA 2PUCA 4Y7NK 2YUIA 1MB3A 1VLLA 3JQDA 3WOHA 1HYEA 1YZLA 1C7FA 2ZYDA 4O4IA 4D8YA 3I76A 2ZT6A 1AKNA 2JVIA 4RHTA 4OHVA 3UXHA 4IIYA 1XTQA 2EBHX 2RHMA 4LC1A 1CK4A 5CFOA 3RRJA 1EXNA 3AZOA 5ADVA 3DHYA 3DEJA 3C39A 3UANA 2O07A 2G40A 2ZUDA 3T5PA 1NVGA 2ZDHA 3PNLA 4H7EA 1GZ6A 3SZLA 1Z2OX 2W0SA 4E5PA 4YT2A 1RXUA 1YS7A 2YJZA 4HNSA 3AKZA 4WKGA 1W75A 1IONA 2DR0A 4FXPA 4LHZA 5CA0A 5K3AA 3RS5A 3EFEA 5TB5A 2W2NA 1NFRA 4ZVNA 1N9ZA 1SHKA 5KTYA 1R0RE 1QO7A 1SCJA 4KBFA 4R9SA 1V25A 4A0FA 5HE8A 2P8JA 2WA1A 3O1LA 5JSFA 3ZU2A 3GJ3A 2WT4A 1SD2A 3PCRB 1ZDMA 2QUJA 3QXCA 3RS4A 3GUZA 3TUIC 4DLAA 3SIPA 5IVPA 3S8EA 1JGTA 3HE3A 4M46A 4Q3DA 2JFYA 5JH7F 1BWQA 1ZZEA 3S1SA 4AB1A 2AEJA 2ZXUA 5AUNB 2YWHA 2ZWAA 1J8QA 4OHCA 3L0SA 1I3QK 1OH6A 1F7VA 1JB9A 2IF0A 2QRQA 3HN6A 5FTMA 3TLCA 1CQWA 2CDAA 5LZ7A 3WLLA 4FKBA 3O8OB 2Y92A 3SX4A 2QE7A 3DVRX 2B5WA 1Y81A 4P5BA 2C04A 5E4FA 3SHVA 4F6RB 3ZWOA 5LR6A 1M2OA 3LW7A 2YN4A 1CUDA 4Q3KA 5I9SA 3ZD8A 3LS2A 1R0LA 3I04A 1DCHA 3FPKA 1XT6A 3X1DA 1CY2A 3U9LA 2SKEA 1LF5A 3KQVA 4LNAA 2AJ8A 2IGTA 4ND6A 3EPKA 1G38A 3DQQA 5IUJC 2IYOA 1YCLA 2N0SA 3FFBA 5EQJB 1C9JA 2VCEA 2WAYA 4OXRA 2CZGA 1D4ZA 1ZICA 3NBMA 3PC2A 5THKA 4ARBA 1DC7A 1ZW6A 2NZYA 1GG5A 3DOUA 3HNRA 3PNSA 4P4LA 5EZSA 1PT5A 2QPTA 5IYCC 1UDRA 4J0CA 1QWOA 3W2FA 1FDRA 3U19A 3SOPA 1EG7A 2YRXA 3NXKA 3WY9A 4M83A 1OSNA 1II8A 3CNBA 5CB4A 3FCUB 2QMEA 1MU0A 3GLSA 4FGLA 4GKAA 4QELA 1TYCA 4IFTA 3K9CA 1WUIS 3RO7A 1GYPA 1DELA 2OD2A 4CF4A 1YOVA 4MV5A 2H18A 4OI1A 1H2XA 3MAJA 4AKSA 4G5RA 1KDRA 4AO8A 3MYYA 1FJXA 2O8EB 2JRCA 1QGUB 3S0JA 4ADSG 5H80A 1CE8A 1ZGZA 3ZNNA 5JAOA 5IC6A 1A98A 3WYEA 3ZXSA 4UCXA 1E2KA 1QOQB 3T1QA 3WMXA 5AKLA 4Y2SA 2C7OA 4IMIB 5D84A 3H5WA 1DAOA 1LS1A 2WVJA 3LCMA 2PSEA 4NCJA 3H8SA 4QNNA 3SYLA 4P38A 1FLNA 1NAHA 5JD4A 3F7TA 4HGOA 2HMSA 1F2UA 2HYDA 2QV0A 4FOSA 2G8NA 1Y5NA 3IBGA 4GOOD 3CZQA 3VSCA 1UADA 4XM2A 4ANFA 5IU6A 3IQWA 1XAGA 2J0VA 1B8VA 4LSWA 4PPFA 4IH1A 1ESEA 2I3GA 3CO5A 3ZV6A 2DLCX 1BO6A 3LDGA 1JKJA 4M36A 4ZO6A 1OX6A 5EVJA 2WOOA 4GOXA 2FSGA 4ZTBA 3TZ6A 2O19A 2GZSA 2R1TA 1VCMA 4UUOA 3QWIA 1IHYA 3AM5A 3QVUA 1KSHA 5IYBK 3QW2A 1QKJA 4JLUA 4K9NA 1EXDA 1GL3A 1XN1A 4O4IB 1QO0A 2QTVA 5IVDA 4IYRA 2QG6A 1OPXA 4PXYA 1C0PA 1YMVA 2QN2A 3FCXA 5IDWA 4OBXA 2WG0A 3LUCA 3TTXA 2A8YA 2FPLA 1RMTA 1ZMBA 4UOEA 4HS9A 4EFKA 4YYEA 5KCZA 3GG2A 1WD7A 1Y48E 2ABWA 2P79A 3GWGA 4KWIA 4CM9A 5EIFA 1DAMA 4ND8A 1WZIA 1H5NA 4C5CA 5C81A 2H63A 1YZHA 1LQTA 3LY5A 3ASUA 2Z0MA 2ECPA 1I2AA 3GTQC 4AX4A 5CA0B 3GAMA 4I55A 1YXMA 4A4DA 4EDHA 3CG0A 4HNVA 4RZXA 2EL9A 3JW8A 4EPTA 3HKZL 4QT0A 1IK4A 2I3ZA 2B1IA 2IHKA 2YWXA 3IBFA 3T35A 3O8CA 1GRQA 3VO9A 2IK8A 1AK9A 1GFIA 3PDJA 4FT4A 4COOA 4YMUA 5HIKA 5LLTA 1HT1E 4GVLA 4IQ0A 1LV8A 2ZS8A 4G41A 4C3IK 1UDWA 3QVVA 2QL9A 3C4QA 3H0GC 1OBCA 3IVAA 4OKSA 4D4LA 1W36B 1UQTA 1QR2A 5C18A 4CL2A 2NVBA 2UDPA 3WSTA 4PCVA 5JV5A 1SHLA 2ORYA 1KYWA 3U2QA 3PWZA 2ZVPX 1V3UA 4QQ8A 2NZUG 1N2CE 5CLHA 1Y8AA 2J9ZB 1P9WA 2PWBA 4KVAA 4TKLA 5GM1A 4M1YA 1M2OB 4V1CI 2GUWA 1CSEE 4DSNA 1PR5A 3OQ6A 5K0JA 2X5JO 2C4NA 2JFZA 4OFBA 4EJSA 4EA8A 3ND5A 2P9CA 2GK7A 3IMKA 1I0IA 1YZ3A 2UUPA 3E6AA 1Z9BA 5DBOA 2PV7A 2P2GA 3IV9A 4AJ1A 2C7BA 2C9DA 3FA2A 7REQA 5GAJA 2GPYA 3EVAA 1HXHA 2CT8A 4WLFA 1T1IA 1SPBS 2PEZA 2XB9A 4ZT5A 4ZV9A 4CNBA 1Z06A 1L2TA 1PK8A 2P11A 2QZZA 4NCIA 4NYIR 5COBA 5CG2A 5JZ9A 3D0OA 2GD1O 1GO2A 3IP6A 4IGAA 1II8B 3LECA 5EFZA 3VSDA 2FF7A 1E5LA 5ALSA 1N6LA 1FP2A 5LXTF 4MQ5A 3UC5A 2E21A 2Q5LA 3GK3A 3I5UA 4BNDA 4C3ZA 3WK9A 5BP7A 1IY0A 1EFTA 2XNSA 5KS2A 4PSVA 2OGUA 4PONA 2JA6C 1YOVB 1FS4A 1NMQA 2J1LA 2ZAOA 3G0BA 2QA5A 3WJ1A 3WMEA 3D8HA 2ZI4A 4N48A 4Q9HA 2IIBA 1O25A 3Q2OA 3R7NA 3ZHUA 4ZOEA 1CE8B 2D0PB 2IHBA 2XUFA 3COWA 3KWJA 4A3IC 3ACCA 1EBUA 1VSUA 3EVGA 3GT4A 3BMOA 4FI3F 1X7WA 1ZOSA 2PVPA 2P2ZA 1SJ9A 4B5KA 2W5UA 4ECAA 2WHRA 1B23P 3CEHA 4GRDA 4PRLA 1BC5A 4ARVA 1F2UB 1Z28A 3QEBZ 3R8FA 3DL4A 4NZOA 4WI1A 5MFZA 3E1GA 2Z9DA 2ZRHA 3Q1LA 2QG4A 3VNRA 3A7EA 2LCFA 4WEOA 4JGIA 1YNNA 3AM4A 4LI3X 4GTLA 4WXEA 1GUBA 3W34A 1CVRA 5BR8B 1JKJB 4UOQA 1JH9A 2VIIA 3ILYA 4G2TA 3CNLA 2BF7A 1U02A 4I0WB 4MGZR 2R1TB 1M67A 4CLXA 3EZ7A 3W6NA 3WK7A 4WUVA 1K66A 3F9IA 1JZSA 1ZVVA 3T01A 4DMMA 3GLVA 1PK7A 5AQ1A 3C8DA 4Q93A 1LQ2A 1AH2A 5DYWA 3GCXA 1CIPA 1VCIA 2J3LA 2H31A 2QTVB 3K6JA 4LGVA 5FJIA 4YJ2F 1PWHA 3ODGA 1YVRA 3PXBA 2MSKA 3F3MA 3AFMA 1VA5A 5FNZA 2O5VA 2R7MA 3ON5A 1JS1X 1R5JA 4ZOLA 4DGSA 4CXMA 2Z8ZA 1GR1A 3M33A 2AG0A 4PNPA 5FPQA 2QTFA 5SYNA 3KWFA 4ND8B 4B9EA 1QIEA 2DBVO 2J67A 4HAIA 4R41A 2XXAA 1RAHA 2NT3A 1YIOA 1Z12A 3G2PA 4QSHA 4YRAA 5KTTA 2WTAA 2ZTHA 2V8BA 3LBFA 1QRSA 4QLAA 4I55B 5FYQA 1B8UA 2ROQA 1MKYA 1QSGA 2QNBA 1XMVA 1L5LA 3ASVA 4O2AF 1OTHA 2ACVA 4YCBA 3RVBA 1E8DA 1J09A 4L8WB 1E2BA 3L92A 1I4LD 5A3SA 4DDWA 4LVNA 2XE6A 5ALOA 2QXUA 3GLHA 4GLLA 4Q3AA 4MUIA 1PJ4A 2PSSA 2CDNA 3PUKA 2J9XB 3VVLA 3QVLA 1VHJA 3EVEA 1SVUA 1EVEA 1KZ1A 2HJRA 2ONYA 1W4AA 4V24A 1A9RA 2PAFA 1PYGA 4YJ3A 1Z0KA 2PLAA 4UAGA 4Z0PA 3UAVA 3X2EA 3SMVA 4V2IA 3ZGVA 1WZ2A 4C3HC 1FOEB 1WZUA 4PAWA 2X0FA 4B7UA 5BQOA 2WF9A 5AKXA 2G25A 2SHKA 4NYJR 2AEFA 2KHZA 3D6TB 3LYAA 1II0A 1UKBA 4O6VA 4R1TA 5AK0A 4YP7A 4ZEWA 1Z33A 1Z2DA 1SMKA 1EE2A 2ID7A 2KE5A 3N0RA 2QZ9A 3QF4A 4LF9B 4CG1A 3G2HA 3I1FA 3RVDA 2RHLA 1NTRA 1GQOA 1VQ1A 2B5OA 2GZ2A 3NHKA 3V6LA 4CM3A 3BK2A 4EJSB 4YX9A 2GAIA 1WA5A 4J3FA 2VWPA 2BR5A 2CLKB 4QXMA 4TXJA 4XWYA 5EXTA 1FJHA 1GEGA 1QXSA 1W1IA 1FTSA 2C0PA 3R3ZA 5DNDA 5I7AA 4DPMA 3AJ9A 3MMNA 3RVLA 2IXEA 4ND5A 4YN3A 3MJSA 2KJQA 4L1KA 1BEZA 5DP2A 5I7RA 5K5EA 3OOSA 3OEHA 3V4SA 4DDMA 4MV3A 1K89A 3AUFA 4JQOA 1V2GA 3I5MA 3KUDA 4NMHA 1PX0A 4XTRA 5THXA 1IEXA 3H3FA 3NUZA 5FQNA 3T5BA 1NX6A 1SUPA 4UAUA 1Z22A 5F3DA 3WIBA 3HRKA 5K8TA 1U0BB 2HK7A 3QMPA 4OGLA 1E96A 3GRAA 3V00A 3M4OK 4BNDB 4BXXK 4PGGA 3HDYA 3RW9A 3WBFA 5CCXA 1E1RA 3C16C 4LJKA 4Y0NA 4I66A 4D7AA 3IBTA 3WB9A 5FFMA 2GBLA 2IXDA 2QEQA 3BRSA 1M8JA 3C5WP 4NCHA 4BJ6A 1A5AB 2ZS9A 4UQOA 4TUYF 5CLIA 2AHOA 1SU4A 3PQFA 3THRA 4N7RA 3LYLA 1QVWA 4RTKA 1T0UA 5TQVA 3BMOB 3OTQA 1X7WB 3LLMA 3V2HA 4GEGA 3G3EA 4HLCA 2EDCA 4XEUA 4QODA 4CW7A 4DUPA 5EQFA 1KRHA 4FIDA 1OAOA 3C7CB 1JBEA 3GB9A 2ZI5A 5LNK1 5FTNA 2H5EA 4OHPA 1DWPA 2MIIA 3QXSA 4PG6A 3ELYA 4CM4A 3BAFA 4DR6B 1ULUA 1VJGA 4FHFA 3ZNQA 4GTFA 1JFVA 4DLUA 3AOGA 4QOFA 4AY4A 2SNIE 3KL4A 3HDVA 4II3A 3L77A 4RYLA 2W4MA 2PK3A 3SK0A 4WBNF 2NO0A 2CCGA 2ATIA 4P7FA 3X1MA 2VDRB 3SCZA 1W34A 3TLYA 3SYKA 3HOUC 3O6VA 2DSNA 4MULA 5K9ZA 3A32A 3MJHA 4HDQB 2GZ1A 1MB0A 3VUFA 2P67A 2DQ4A 4G81A 4RABA 1DBRA 2KPOA 1V26A 3VPCA 5B7PA 3A9UA 3HJAA 3RSZA 4JUDX 5D5PA 1JR6A 2QN1A 3TKAA 3S14C 4ZOLB 3SSAA 2GM4A 1JIXA 4DA9A 2GSUA 1AUXA 5AI4A 4AULA 1L3CA 4OLBA 2XXAB 5EPOA 3EGCA 2YJ5A 1O95A 4AYTA 1TQHA 4WDQA 1R0KA 5F1OA 4A0RA 2CZQA 1IBKB 1LLCA 4MCHA 1R50A 5M3BA 4WXRA 4OL0A 4CV0A 3ZD6A 4L5YA 2XQIA 5L6LB 3JWJA 4JX8A 2HDWA 4A6EA 1ATIA 2BTEA 1JIVA 2Z1DA 4PHTA 4XFDA 3WTBA 3GLHB 4EKGA 4UBLA 3GAAA 3NLLA 1M66A 2J3HA 5C3EC 2RHGB 5IM4A 2DQSA 4WJ3M 4YJ3B 3ZHZA 4Z2YA 3DF7A 4I8DA 2Q5EA 5DGHA 3U3RA 5BR1A 4WJZA 1WZCA 1X1EA 3SM3A 2WWYA 4B40A 4D26A 4EO9A 3EQZA 2YXNA 3U7QA 2W2XA 1KU0A 1RBYA 1JQ5A 1VKOA 3CMCO 4GBGA 5DTRA 3UAYA 1X1QA 3UGQA 4YREA 2R25B 3HP1A 3MEQA 3QF4B 4U7TB 4RK4A 1EK2A 5B6IA 1V11A 1B00A 5DF1A 4R5HA 1DCKA 1LDBA 1KQOA 4RU1A 4BX2A 1N5LA 1TWHK 1UUFA 2VT7A 2ZUVA 3BEDA 4IX1A 4CV1A 4YR9A 1VPDA 2CB0A 1PJCA 3I52A 2HU2A 2O23A 1X9GA 5KAMA 4U8HA 4BP8A 5DHUA 2XOKD 1MG0A 3KDSE 4RENA 1E0JA 1E1KA 3B5JA 2DAPA 2EKZA 2EC5A 3HSYA 1GA4A 3D1VA 4GGMX 2XMQA 1PFGA 4TSRA 4OFWA 3H3VD 1E4EA 2E5FA 1HK7A 1GILA 1ISFA 2O2HA 3R23A 1NJ1A 4REOA 2XZDA 1QTIA 3L7KA 1C1XA 4IHQA 1W35A 2X9GA 4HN4B 2IUEA 4FU0A 4ARIA 4EDFA 1NDUA 3WLAA 5HIAA 3RLFA 2AF4C 1MX5A 2JFFA 1NASA 3ICWA 2Y2VA 1YB4A 5M3FK 4CBVA 5CX1A 2P3QA 3UMRA 5A9RA 4IFBA 1J0DA 1HH4A 4HGQA 3OTOB 2I67A 5BUCA 1NRIA 1SXJD 2YU9C 1BCRA 1I1NA 2NUBA 4DDKA 3PQ2A 1MJGM 2QP4A 2V0GA 4X66B 2PPLA 4Q66C 3L1VA 1TTQB 4BNXA 1E2NA 1WTAA 4TXLA 5FWXA 4OXNA 1U7PA 1WQFA 4O1IA 1DRKA 5CHEA 1ABEA 1BGWA 3PXUA 5IOQA 3TGWA 3ZU5A 3IQEA 1A8QA 4G56A 3HSSA 4L3WA 2WAQL 2XUJA 5AJTA 2D2FA 1S6YA 1ZK3A 2VUUA 2YNMC 5EMMA 5AVTA 4NOIA 3UWPA 5CW2A 5FAXA 2W90A 3DEFA 4PC1A 4BNNA 3PEYA 1P73A 1TUEA 2P5YA 3IUMA 3IURA 4CM4B 1NLFA 3WLPA 1ZH0A 1NXPA 1F2DA 2II6A 1U9ZA 2P5UA 3E18A 3A6LA 2Q28A 4N0DA 3I01A 5GJBA 2WJAA 1TW3A 1T3ZA 1NRJB 1NONA 2Q3BA 3CR3C 3LOQA 3MCVA 3A11A 5AOAA 4PO9A 4X65B 1GUYA 4G0YA 3PUWA 1X1TA 3V4ZA 2XYHA 5GZ6A 3RS0A 1NR1A 4UUBA 5K0TA 4DV4B 2LKCA 1T29A 3D4BA 5CVDA 4JNCA 3SP1A 4D6PA 4Y2VA 4RDXA 5LMNB 3KTDA 1NR7A 1YIAA 3DCJA 5I9NA 5LN1A 2CVPA 4EJFA 2YV1A 2B82A 2JBWA 2O2DA 4REQA 1WCXA 1LK5A 4EG6A 1LK7A 1CQZA 2JI4A 4GWGA 4OHWA 3WFZA