1HI9A

Zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
274
structure length
274
Chain Sequence
MKLYMSVDMEGISGLPDDTFVDSGKRNYERGRLIMTEEANYCIAEAFNSGCTEVLVNDSHSKMNNLMVEKLHPEADLISGDVKPFSMVEGLDDTFRGALFLGYHARASTPGVMSHSMIFGVRHFYINDRPVGELGLNAYVAGYYDVPVLMVAGDDRAAKEAEELIPNVTTAAVKQTISRSAVKCLSPAKRGRLLTEKTAFALQNKDKVKPLTPPDRPVLSIEFANYGQAEWANLMPGTEIKTGTTTVQFQAKDMLEAYQAMLVMTELAMRTSFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bacillus Subtilis D-Aminopeptidase Dppa Reveals a Novel Self-Compartmentalizing Protease
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase (protease)
molecule keywords DIPEPTIDE TRANSPORT PROTEIN DPPA
total genus 89
structure length 274
sequence length 274
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04951 Peptidase_M55 D-aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.130 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Dipeptide transport protein 1hi9A02
3.40.50.10780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dipeptide transport protein 1hi9A01
1HI9A
chains in the Genus database with same CATH superfamily
4O6VA 1JR3E 1OXMA 5L3VA 1JKMA 3I9MA 4BLAA 3GQBB 1FXWF 2QL7A 2FGJA 5CG1A 2Z83A 1JECA 3LY8A 4JSTA 4EZIA 2F17A 1K97A 3QHQA 3WIBA 2NP6A 2HWXA 1FUKA 2I7VA 8MHTA 2PLRA 1Y81A 3PIRA 4PZ0A 3ENVA 4MV9A 2YC4C 3OIVA 1AHNA 1S7CA 2P3QA 2NTYC 3JQDA 3K9NA 4H7IA 4POAA 2WE8A 1I2CA 4TSKA 3KOWA 1VGQA 2PT7A 4MV7A 3T5DA 5IM4A 3GFOA 5E4JA 2AWNA 3MWDB 2WI8A 3O9VA 3HYCA 4JA2A 4FFVA 2IU0A 4AKIA 4CLDA 2OO3A 3H2KA 4P8RA 5DCYA 3RRMA 4Q5IA 1K06A 1A27A 2ES4A 2EF1A 3IOMA 1DL5A 1SZDA 4MUHA 3A6DA 2G88A 4MZDA 1FDUA 3H8JA 2WMYA 2ZSUA 5ECGC 3TEJA 3T61A 2P4HX 5IJ9A 2YKGA 4FGKA 1ZJWA 1XPUA 2PO5A 5IT4A 1A97A 1KEZA 4LYAA 3ZBQA 2C4TA 1QLHA 1N75A 2L0XA 2XTMA 2I6QA 2RAFA 3CIFA 1AMOA 3UJNA 3EOZA 3RS9A 1XAJA 1GG2A 4RJJA 3A36A 3N0BA 1ZLYA 1JW9B 4OEHA 4JI3B 1DWOA 3A2LA 2QRHA 4IQ4A 5EHGA 1F2TA 2PZAA 3VR2A 1E2PA 3C5WP 1CZRA 2QD1A 3KZOA 2CL0X 3CUYA 4F4FA 4I1IA 3PS9A 3J81A 1CRPA 3STTA 4K88A 4TYPA 1W2GA 5TLSA 2FH5B 4BNNA 3CVYA 1K9VF 1I6HK 3C7KA 2PKQP 3TGWA 1JTEA 3IT3A 3FX2A 2BFFA 3GCGA 4WUVA 3A14A 1DG1G 3OQVA 3S1MK 2XBUA 1UBMS 4MYTA 4XIGS 3TUIC 4BCDA 1P0CA 1PS9A 2HPHA 4QOIA 1H22A 1LBSA 4OOFA 4XJVA 2JFWA 1P2BA 3RHSA 5CLFA 4PLPA 2GZ3A 1CYDA 1Q6YA 3J7AC 1G6OA 4BLOA 5JNUA 3V8VA 2FVXA 4J0QA 3PIDA 1U8FO 4MXDA 5KNCA 1OCEA 2P2DA 4XM0A 2XA2A 1CZUA 3B1XA 2DX7A 2A5YB 1I2AA 1U1IA 2O3SA 3KR9A 2P78A 5FLMC 1N92A 3LP8A 4KAXA 4O2BA 4P53A 4G0VA 4F8JA 2AEEA 3E3LA 5CHEA 2E5WA 2AB0A 4C22A 1Q1ZA 3G2QA 2ZI4A 2Z6AA 3ZZNA 1FLVA 2EZ8A 1UC9A 4V0KA 5J4HA 2H08A 4ZCRA 3D4PA 4IR7A 4KB5A 3OWOA 1UPCA 1QYXA 2R4TA 2REQA 3DEIA 3CUVA 3EZ6A 4O02B 1A8SA 4HDSA 4TVKA 1HM5A 3AIMA 3M3HA 4ZXFA 3JYOA 3K6JA 5A7GA 3JR3A 4CR6A 4U2EA 4E3ZA 1CRQA 3OX2A 1X7YA 3FWYA 2X5XA 2NU9B 3KLPX 3RZOK 4DLTA 3IKVA 1MQ8B 4OO3A 1LZLA 4RL4A 3KOXA 4N03A 3VR4H 4BYGA 4YRZA 4IFTA 1CDZA 4R2LA 1UF9A 3RK0A 3OZCA 2DSNA 2HLPA 5CFPA 1EUYA 4XDHA 2R2AA 1LVGA 5JY6A 3QX3A 4Q4AA 1B8OA 1XZHA 3WODA 2Z3VA 5TC4A 2EZUA 1EZ4A 1T9HA 3R4VA 3GELA 1UBJS 3JZMA 5CNKA 5EZYB 2W37A 5CHPA 2EFCB 3KAQA 4NKRA 2EGUA 2HGSA 3M6VA 1ULTA 4HQLA 4YAJA 5DN6A 5HG0A 5J4VA 4OHYA 2FJ0A 2R6CA 3T3NA 4FGJA 5BR8B 1BMFA 2O8DA 1KSGA 3PQ3A 1BDIA 3H5AA 3STXA 1P1HA 3OESA 3DFMA 4UM5A 3CG4A 1GU7A 3E05A 2LCQA 4DLXA 3TQSA 4A6PA 4S1WA 2RHJA 3EGXA 5G1OA 3OWXA 4IKPA 4U0JA 2BYTA 3UY4A 2ZYGA 3G9UA 3L6OO 4HNAB 4IIDA 4G37A 3RFXA 3CE6A 4PTLA 4EBFA 4F71A 5JUWA 4ZTUB 1Y33E 1XR3A 5BT9A 3O73A 1OA0A 1FDIA 3F6BX 4KGXA 4LVUA 4TLMB 5ULLA 5LP6F 4AQYB 1B1CA 1GTL1 1UJBA 2OCDA 1EUCB 1T9AA 2R3SA 3DOCA 5AXCA 3ZE0B 4CM4A 4N7JA 3V1MA 5KYWB 3X2EA 5A6SB 3NB0A 1ZGZA 1Y6GA 3ZDDA 1O6BA 1PT7A 3ZDEA 3R6DA 5AW6A 3ZGZA 2XF8A 3AETB 4HDNA 2C77A 1P7WA 4XX0B 2QD4A 3BMCB 3FMPB 3I1JA 4B4VA 3BAFA 2GGSA 1NE2A 2YX1A 2GQ0A 3WA6A 3ZBUA 2LDXA 3LH5A 5DLYA 2Z1DA 4NCIA 1BQ3A 3DTVD 5AM5A 1I3OA 1GPUA 4DNFA 4YJGA 2XUGA 2B61A 3IVMA 2JLCA 4FMDF 3VUEA 4AJ4A 2C2KA 3T0GA 1LX7A 3KL2A 4JJZA 2H5IA 5CVVA 3WYAA 3H05A 1L7NA 5K3FA 1W88B 1P4HA 1V5FA 1KERA 2Z2XA 3R44A 1JR4A 2FZVA 4GX2A 1YIDA 1P2UA 2V3VA 4DYVA 2QG6A 2WZDA 3H3XA 4M86A 5EE0A 2A9JA 4BLBA 5F1OA 1IHPA 2A92A 1CJMA 3WR5A 1RXWA 3VDNB 3QP9A 4DIBA 2QV7A 3HCPA 1F8YA 2PUTA 3JQFC 2PUCA 3C8UA 1XLTC 1JEYA 5ER6A 3AFOA 1G42A 4RK6A 1D1SA 3IMEA 4I46A 2VAXA 3NORA 2WJWA 5CB4A 3ZJVA 3OT5A 4G8CA 5EI5A 4XAQA 3K2QA 2O0LA 3IT2A 4XSVA 3T0FA 2XMGA 3INRA 2HA0A 1NY6A 4X3OA 3TKYA 1LPOA 3R77A 1B15A 1LF5A 3R6TA 4FMPA 4JMLA 4R98A 2D2EA 9LDTA 3U9TA 3LE8A 3SLGA 1DIOB 1IATA 3K8ZA 2E4WA 1DIAA 2RHWA 2BR5A 2G5CA 3C87A 3TI7A 3KKQA 1JU9A 1N6HA 1JG2A 1OGYA 3PXUA 4G4GA 4Q48A 1A50B 1HK7A 2JI6A 2XYGA 4E1BA 4CIBA 4R7TA 5G3ZA 4UD6A 4DE5A 3PLAE 3WSVA 5D5PA 3NAMA 2WSSD 3ZI0A 5BQPA 2OBFA 1Y3AA 3HRKA 4QT4A 3MRVA 3NIDB 1KVTA 3Q1KA 1QIKA 3S44A 4FLMA 2WD7B 2I1VB 3DKVA 3FHCB 4RK5A 1RYDA 5EZYA 3RTDA 4DCOA 1O96A 2A3NA 3H2JA 2BH9A 3HOYC 4MPRA 2BEVA 4BO5A 1O97D 1FPMA 2IYVA 3AFIA 4MCAA 3VR3D 2YU9C 3ZWDA 4EBBA 1N2GA 5D1HA 2IQIA 2A57A 1FX0A 2O23A 3I4FA 2ZE8A 4WKNA 2HBQA 3W3AH 1KH1A 3KU1A 3OFNA 5F73A 1VBNA 5BW8A 2DERA 3GTOA 2YFYA 5EPUA 3H2BA 2Z30A 1LFDB 4B6EA 3EDMA 3M3YC 3RS8A 4UBJA 4EKEA 4BNYA 5JO0A 2XMSA 4JP5A 4PQFA 2HMWA 3ANMA 2BI8A 1QRSA 4DNQA 2A4MA 3SF0A 3I04A 4OUKX 2P8JA 1YF3A 3WK8A 4XI9A 2AK2A 1VI5A 2KQUA 4B6RA 2H9AA 2J3EA 1A2OA 3PPYA 1DB3A 1M74A 4DMMA 1V8BA 3GGOA 4QDTA 3CHYA 3T7DA 5IOQA 1H6BA 3CRZA 2E2IA 3C3PA 4HTFB 4RLSA 2ZJ2A 5FBZA 4EA6A 4KV7A 2G9RA 1Z4NA 3MWGA 1MAHA 1AQLA 1HY3A 1TCBA 3FY4A 4L6IA 4MA0A 3ZE9A 4QG3A 1H4QA 2VH1A 3HDYA 1W1IA 4DMFA 1KE2A 1XU4A 2AWOA 3DS8A 5DYIA 1O6CA 4MEYA 1M83A 5C7LO 4BMPB 3NHBA 4XZ3A 4MR9B 1P4RA 3K0FB 2DUWA 1TLTA 4XD7D 3VRHA 1FW6A 3T9AA 1R0WA 1EEXB 3NR2A 5ILGA 2IY9A 3T4PA 6AT1A 5EHZA 1NBWB 2J9YB 1H0SA 1GRNA 2LV8A 3P2EA 5D3KA 2FPPB 2FZCA 1SUAA 1L3CA 4LJ4A 3RVNA 4TQGA 4BQQA 3HB5X 5F5LA 4M37A 1F9AA 1Z62A 2IE0A 3V8NA 4JKYA 2RCYA 4G0QA 3ZCTA 4EO7A 1Q2UA 5DNWA 3RJMA 3OFKA 3ERCA 5C37A 1IXRC 2AIRA 5FLKA 1NPDA 3RRNA 5C3MA 2FMFA 4BEJA 4F2PA 1DAKA 2GEKA 4CETA 3LRTA 3QXSA 3GCXA 3K30A 3SC3A 4P80A 3TD6A 2CJXA 1ELOA 4MVJH 2P2YA 2YU9K 1JR2A 2K7FA 3QBDA 3ND7A 4G4IA 4JLNA 2ILVA 2AZDA 4PRYA 4TLLB 2AJTA 4HZIA 5EHIA 3RQIA 4HVCA 3WO1A 1R9NA 3AUSA 1RXEA 3PQDA 4D57A 1FF9A 3TL2A 4OHRA 3FVWA 3FYCA 3T99A 4NZZA 2C4UA 5JPIA 2Z1MA 3R7NA 1BEUB 1EGMB 1USVA 3L05A 5ECDA 1JRLA 2MT9A 4KXYA 2B9VA 4YH1A 1LTKA 2O3TA 5IAAA 2PLAA 3LPXA 1Y5RA 1EDZA 5EFOA 4U7GA 3GYGA 2OM6A 3EMBA 4DHWA 5EJ7A 1U2GA 3CCCA 1JDBC 4QBGB 2ZI3A 4CMIA 4JYBA 4M1SA 1NSYA 3SI7A 5K6TA 3H3VD 4CLOA 2BEWA 3CSUA 2X41A 1PJ5A 3IB3A 3K05A 1OZGA 3B52X 1JQ3A 2IQ5A 5AUOB 3GLFA 3OPNA 1MVNA 4FOOA 4OIFA 2G63A 4NYMR 2H92A 2QT9A 3TVYA 4TMXA 2XBMA 3FHTA 1J1IA 1ULUA 2IYFA 3HJCA 3E5NA 2A86A 4OCZA 4P2BA 3W2TA 1QH1A 2BMVA 4UM8B 1H5QA 2O50A 5DRYA 4YJFA 2XCOA 4PV7A 5AI4A 5CYPA 4E6PA 1QH8A 5TY0A 2I6UA 2IBTA 1EZZA 5HIJA 4MEAA 1PS0A 4HWTA 3F5SA 3WGZA 2IV3A 4D8WA 3UHFA 4Q3BA 3PWTA 3IAS6 1MX3A 2WUDA 3E1GA 2W2NA 2O1EA 3AJ9A 2PKQO 4UC0A 4YP7A 3JAKA 4BRZA 1OAOC 2V4MA 1M3SA 2J0QA 3CR7A 2J0VA 3OKPA 3IIEA 3WG9A 3T02A 3H1PA 1OPRA 3BGWA 3NHLA 3VC2A 3QVWA 1PV4A 1JE0A 2PZGA 3WHPA 3AGPA 1QVZA 1I32A 3HQ4O 5SV2A 4YMGA 1P7YA 4I2NA 4V0SA 2OYRA 2DR0A 5DBFA 4LZLA 5DNAA 4C78A 1KAGA 4HH1A 4QNMA 2WWHA 4CLEA 2X86A 4YT4A 4MV1A 3WL7A 2UZ0A 3OC0A 4BKQA 3PCXA 4S1VA 1DX4A 2E48A 3DAPA 3MCAA 3MQ2A 3HJGA 5EGSA 3T01A 4WFKA 1RAEA 3QA3E 4KNYA 5IWAB 4RE6A 5ECYA 4P4NA 2H9YA 2Y1XA 4M1QA 3TNDA 2WABA 2I34A 4H7DA 3VHLB 3AP3A 3GWGA 1ZU4A 4WESB 1YCGA 4U00A 1E1CB 3F2IA 4GE0A 1E79D 2P5YA 4ARAA 3D3KA 3VTZA 4B80A 3PC8A 1PSDA 4GNKA 2XCUA 4ALLA 3HEMA 3U7IA 3OZRA 4ILDA 2ZJZA 4PLGA 1B26A 4F46A 5AJTA 1BEZA 4ND7A 5BW4A 3EF3A 5FR2A 4BJ5A 5BYKA 3VVBA 2JGNA 5TIIA 1E2KA 4WBSA 3RKSA 3RLFA 2PX8A 3VO2A 5FTMA 3WGNA 1I50C 2F9FA 1C9KA 3GJ6A 5TMBA 4TYYA 3EY4A 2RG1A 3PITA 5CIWA 5ISMA 3H8SA 1SXJD 2HWKA 1HYEA 2XADA 2TMYA 4C0BA 3HA5A 1K83K 3OKFA 1Y6QA 1FXWA 1S8OA 1MTZA 2FWAA 1Y3HA 4A93K 2YHBA 1R9TA 1P1FA 2ZYRA 2IYRA 3ELWA 3FKSD 3OCJA 4G8JA 2IYZA 4WCDA 6GPBA 1Z8DA 5IJZA 5AIAA 2JARA 3NLLA 4DJEC 1XHEA 1VA5A 2J31A 1G5RA 1PJ4A 1WMAA 4Z7QB 3EXFA 5EWMA 3GH1A 4D3YA 4EM6A 3P2JA 5JALA 3ED1A 3KB8A 1SEPA 2IWHA 1WWKA 3OZVA 3R23A 3W2GA 3ZIUA 4ATNA 5B57C 2DWUA 5CFNA 2IJGX 4EJ2A 1KKLA 4IDAA 3FCCA 3UT5B 3ZV3A 5JQWA 1ZBSA 1KS2A 2C4WA 1JYFA 4TQAA 4BEVA 4BMNA 5DXAA 1DHTA 2AD1A 2ZTVA 3FYUA 3IMKA 4JLSA 3O5AA 3LX6A 5A3RA 5E7JA 1E3WB 3WLAA 3U7EB 4OQFA 5F2NA 2JH3A 4JBNA 3KB6A 4KQMA 4PIVA 4W6QA 3U60B 4KDDA 1M2HA 3S1MC 4RTMA 1L5KA 3H4VA 1JFFA 3HCRA 1A7AA 2FPGB 3AFNA 3NP9A 1GTG1 3K1AA 2O3QA 5P8WA 3WJAA 1MHTA 1P5HA 1G51A 2NTEA 4G4SO 3N5CA 3GTOC 1DXYA 4LXYA 4EJSB 3REFA 1NOKA 1CSEE 4H7KA 4MQ4A 1WZCA 1RBMA 3GFVA 2VP4A 3JD3A 4FOPA 2ONYA 4G5RA 4UOQA 4PO3X 1CDDA 1ODFA 3EZXA 3PC6A 2IVFA 4HLUA 3B2QA 3FTEA 4YJDA 2JH8A 4JBGA 5AVRA 5FLMK 4F9TA 3EYWA 3OT1A 4PYLA 2IZZA 1TCVA 5KHLB 3AP1A 3QI7A 1H0HA 3B7GA 3SMQA 1X1EA 1ECJA 3OLVA 3DJYA 5I9BA 2I8AA 4ARZA 1ZM9A 1WLSA 1FMCA 4BWGA 5KOYA 3U0BA 4F2GA 3T38A 4LHXA 3ETDA 4TT3A 5ES4B 3PEYA 5K0BA 1QIGA 3HH8A 3UJBA 5CLJA 3WDLA 1P77A 3IB6A 1DDOA 2QSUA 2OHIA 3R3ZA 3VJKA 2WHPB 2AG6A 2IOQA 3AOEC 4IP0A 4D6XA 1G6Q1 3MINA 5AKEA 1YS6A 1LJLA 2NVBA 4ZMSA 1JLMA 2WAQD 3CB2A 2W2XA 5KTYA 1WSDA 2Q1WA 4DB2A 1YB1A 4DQXA 4NBSA 4A3GC 3L6BA 4TS3A 4MS4A 4URWR 1R8YA 4RKEA 1PL6A 1GE9A 4JOQA 3TGPA 4EG5A 4NU8X 3K1YA 3IAS1 3HE3A 2DQKA 1M1XB 3DF7A 3GRCA 3WKAA 3W1EA 5K8CA 1X13A 4FYXA 4WESA 4YC7A 5G0TA 3F71A 3JTMA 4ZHQF 1XDZA 3RVQA 1XLTA 1E1QA 1OAKA 2CL6X 3N39C 3KQVA 3V7NA 3VGPA 1DBVO 2YWHA 5AVXA 5IZCC 2AJLI 2XT9A 1RCFA 1ENYA 2GJ9A 4BXXK 4AUKA 4UMEA 5DV9A 4R1TA 4AUNA 4YUXA 2QSJA 3LVQE 1E0AA 1U1DA 4G1MB 2HREA 1SIOA 3C6MA 3PO2C 4ID3A 3UKOA 5EE5B 4AAYA 4BEBA 1UT8A 4JL8A 3J80A 2OQRA 3CZQA 2P30A 3ON5A 3R9KA 3OU2A 2HIAA 4X41A 3LQ1A 1A88A 2QMHA 1O0CA 4L6AA 1I5EA 2X9QA 2P9YA 5DT2A 3S1SA 1RE0A 1QOQB 2C59A 3FMGA 2I87A 2CD7A 1CS0A 1ZOIA 4CIAA 2DBYA 1HDIA 2GDZA 4KGZA 3VTFA 2ODTX 5B30A 2B25A 3G9XA 1QH9A 1J24A 3HOWK 1D0VA 1GPAA 1NU6A 1KDYA 1Y1TA 2FSPA 4YVFA 4BBJA 4NOJA 3A4YA 2WLSA 1Y98A 3KKPA 4PHFA 2OHXA 5CM2Z 4ZVTA 1AB6A 1T4DA 2NZUG 4RVHA 5ARDA 3VYRB 3RVRA 3GRUA 5FUBA 1LBTA 1TD1A 1G5TA 3L9WA 4LYEA 5DTJA 3VV3A 3I72A 3GJ8A 1CRZA 4TV8F 4UBNA 5BQ5A 2G06A 4LAFA 4NK4A 2PZJA 4EUEA 2ECPA 3G9QA 1SCIA 2ONCA 3FWHA 3KQWA 3FFXA 1L7BA 5K6AA 3IXQA 5IM5A 3LGAA 5LU8A 2DR2A 3EDCA 2C4HA 4G4SP 3T12A 1KYIA 2BZ1A 3BXEA 3N7AA 4M0FA 1U0EA 1L1FA 2F90A 1JLLB 2VT6A 1Z0KA 4PHTA 4N39A 4FYWA 3FVQA 3DFKA 3RYFA 1GWNA 4C87A 4Q1AA 2IYAA 4BOYA 1YS9A 1NP3A 2DQ4A 3RJ9A 3ZXSA 5TMCA 3PX2A 5IP7K 4CQNA 4UOEA 3QVVA 4DKXA 1XA3A 1KI4A 5J47A 5M2QA 3GEIA 4PYIA 2UZIR 1IZ9A 4Y2XA 1L4HA 3PA6A 1IQ0A 2Q7XA 1X6VA 3K0KA 3MJRA 1I80A 1DC7A 1ZGHA 5HWSA 3U62A 1NW7A 4KATA 4KXQA 3C8DA 3I6ZA 4GWGA 3WE7A 1COWD 1JSCA 2NSYA 2G6TA 4XSHA 4Y7DA 1HE3A 4MAFA 1NC1A 3EZ9A 1PFYA 4EGFA 2GN0A 1S2MA 1EM8A 1Z6AA 3BS4A 3OKAA 5K3SA 3ZN2A 1IZZA 4F8EA 2CV0A 3NYIA 1I0LA 3BD6A 1Q12A 2C5AA 2NTJA 1KK2A 4YFXA 2BFDA 2JF0A 2WWXA 1T2EA 2MSNA 4B85A 4I4NA 3AVXA 3PHLA 2BGMA 2QOEA 4D79A 3ZEIA 2X13A 1QG2A 2GA9A 3VPHA 3WXBA 3ZZUA 3IEKA 2WT8A 2ABWA 1G0OA 4G5OA 3JQ7A 2C8VA 3KJFA 3ZWVA 3G0HA 4KGDA 5C8XA 3D0QA 5JBIA 1RLIA 5LA6B 4EA7A 2X1MA 2BBTA 2GMWA 2AG1A 4EUSA 5K0JA 2E37A 5DYGA 5IZCA 1MDBA 1T36B 1FU7A 1M2JA 2VUTA 4J75A 1VSUA 3ZQ6A 1N2EA 3IDSA 3P94A 1ZK3A 3B6KA 4QEKA 2FJPA 1Z29A 4FFBB 5BURA 2NSJA 4B82A 4F21A 2DY1A 3DL7A 2ZBFA 2XUFA 1Z37A 3OP1A 4GKAA 4Q3DA 3TZEA 1N7GA 1OFUA 3PR2B 1QO0A 4GZ3A 4WOPA 3TIVA 3GXBA 4RVCA 3TQOA 1QBKC 2ZRNA 3GB9A 3BFXA 1PT6A 3HOVC 1XVAA 1Z16A 2YCLA 4GX0A 3W4IA 4EG8A 2JFHA 3QENA 3ECCA 3UN1A 5JDIA 3KEGA 2PD6A 2SBTA 5LR6A 2QAGB 1NBIA 4D6YA 2OLJA 1J8MF 4UNQA 3LDUA 2GAFA 3AM4A 3HM9A 3AZQA 3IP5A 5IC4A 4G0UA 4OJYA 4I6GA 2HHJA 4ZREA 2PA8D 1WUHS 1E6WA 1XXLA 3K70B 1B16A 4YRCA 2HZBA 2AZMA 4N8DA 1F8FA 1H94A 2ZR0A 3AX6A 1Z6ZA 1TCCA 1QV7A 4P54A 4Q3AA 3U31A 2O5CA 1KJJA 2DPMA 5GZ6A 2DHEA 2ZUTA 2R7ZA 3FPBA 3QLTA 5E9WA 3SQOA 2Y3IA 4ZRNA 4X24A 4D4MA 4WW0A 1M34E 4L7QA 2G1UA 4UZFA 4DYDA 4NBKA 2AZXA 2QR5A 1ONSA 4WK6A 3M4XA 5D87A 2JK1A 1NOJA 1IULA 3K72B 3OPFA 2PWZA 5M5XK 3I8OA 3ZK8A 1BH2A 1AQUA 1MIOB 4NCHA 4GMGA 5TVGA 4A0QA 1YZQA 1UUFA 2VDWA 1NNI1 3IQIX 3C15C 4KYVA 3HO8A 2QTNA 4HDMA 1ACJA 3K9WA 4HGRA 2HLNA 2OLEA 3O84A 2V6JA 1I3LA 3FWNA 4Z9XA 3FLBA 3HXTA 1BGVA 4Y2YA 3QVGA 4TV8A 3RARA 1BFDA 1YA6A 1U1CA 2WRZA 1PW7A 2EBFX 2CLSA 2ZB7A 3M2PA 3MMPA 4TVBA 1YIAA 1LS1A 1Z2OX 2D8MA 3NCTA 4L1KA 4KE7A 4R5HA 1BU8A 1QGAA 1H85A 3MTBA 3QV2A 2Z4TA 4GXTA 3TQQA 1WMEA 2CT8A 3G3EA 2B4YA 3EAGA 3N5KA 4YRIA 1KQFA 4R2XA 3HGTA 1TKCA 1R1DA 5E1DA 2EYUA 5J2UA 1ZJ6A 3FOWA 2VZ8A 4I8XA 4KXUA 2AEJA 3FCUB 3RG2A 3VPCA 1MEEA 4L3VA 2PX2A 3O2SB 4JI6B 1P2GA 4LXGA 1NJSA 1QE0A 1LLUA 1KORA 3HKDB 3O2NA 4HQOA 3EQLA 4WY8A 4DNXA 1PHPA 1C8LA 1MMFB 4Y2TA 4NH4A 2NU8A 2CNOA 4HR7A 2JBAA 1ODCA 1NYLA 3PTAA 3BE5A 3PNLA 3KXPA 2QW1A 3UT6A 3ZWWA 4YP1A 2IUUA 3U7FB 1OGJA 3FYSA 5LJLA 1JHRA 4ZRDA 2P4UA 5ECWA 4AO7A 2IDMA 3ZWPA 3AUFA 1PKEA 2G36A 5DM0A 5G41A 1PFQA 1GEEA 3BHIA 3I6QA 1DC6A 2P6OA 5AKJA 1NVKA 3I61A 2XKBA 2MYTA 2W4MA 4X61A 4Z0HO 1JI0A 2ID9A 5KREA 3G79A 5LUAA 2DCUA 2WQ6A 2UU9B 5I45A 3GK3A 2WTMA 2VUMA 2XOEA 1EXMA 1L8XA 1LSSA 1MJNA 1SA0B 3I6BA 3C3MA 4M87A 3HG7A 5B7QA 1D4OA 1ZFNA 1FU4A 3QVTA 4X92A 2HU2A 4YT8A 2RGGA 3QPUA 4XIYA 3DLAA 3FSGA 4C2TA 5I7HA 2IXFA 3PUWA 1N1EA 1H8HA 1RI4A 4BKUA 5DNUA 1TUBB 3Q40A 3HVJA 4XFKA 1Z82A 3RVDA 3FI9A 4KSCA 4BQIA 5ADUS 3PXCX 1XMSA 3U7QA 1Z9BA 2C9YA 3V1NA 5EJ6A 1SUFA 3N7TA 2E2HK 3GYBA 1MPXA 4BAZA 4JJ6A 4RMNA 4ZOBA 3S2ZA 1XCOA 4Q05A 3KZ1E 4S0XA 2A9PA 1UZLA 2VHVA 2G28A 3A26A 3HA3A 3ZDQA 3C6ZA 4X64B 4EB0A 2ISCA 4R1SA 2P91A 3SU8A 3HB1A 1WXXA 1ZI6A 2QF7A 4IV5A 4J1QA 1Y42X 4KE8A 3VOAA 2UZ4A 1FTGA 1GL6A 2UYHA 5JRJA 5T6MA 4IRMA 3CUEF 4COKA 5KYWA 3EFBA 1NXPA 4U7JA 4DHEA 3RYIA 4ENWA 3PGJA 2HBZA 4D3XA 2OCIA 1IIBA 5GZ1A 2FG7C 4E70A 4V39A 3WGOA 2JLQA 4HAWA 3IXLA 2HI0A 2JLSA 2QM7A 2BF7A 4RH0A 4RV4A 1R64A 2DU8A 5C4JK 2NO0A 3ILYA 4OHWA 5E1BA 4ZP1A 5TS3A 3EEQA 3QLEA 2N3ZA 1PNVA 2B2XA 2ZE5A 3A9UA 4DF3A 3RTGA 3QVOA 3BT7A 1RXVA 1O2FB 3DMTA 2VRCA 3R2JA 4RIGA 5H02A 2XB4A 3ZV7A 1RIFA 2Y93A 2AOUB 4WZ6A 3CLVA 4BCCA 3UA4A 3STWA 1AS2A 2X2PA 5A3VA 2HU5A 2PMFA 4GBMA 4BZPA 4L0DA 1J6VA 3BILA 2I55A 3K1ZA 3LUBA 4NBNA 3MCUA 5F9MA 3TTSA 5KYKA 3I53A 1U3CA 3SE7A 9GPBA 4YJ2F 4Z9AA 2A59A 1ZXLA 3QKRA 3AFGA 1XZQA 4Q4AB 2QRVB 3SJBA 3SY8A 3W0LB 5JWHA 1QCDA 2XDQA 1YH3A 5B53A 2JA2A 4WE3A 2BV3A 1RQGA 1T1JA 2IV2X 1UBFA 1B8PA 1ZMBA 4TTTS 3UBMA 3SZGA 2HIGA 4C4XA 1W5TA 3WFJA 1O94D 1ZGAA 3TRFA 3HUTA 4LOAA 1Z4OA 1GD1O 4LGVA 1JEQB 2BEKA 4M0UA 4KWHA 2IOYA 4ERXA 4UZEA 4K0RA 4HNUA 4Q01A 5FWYA 4UDOA 3RWBA 4YXFA 3NCHA 4G5YA 1ISPA 1WXHA 5JVDA 5IKXA 1N0IA 3AJAA 3DONA 4OL0A 5AI5A 3TEFA 1EHIA 5J63A 3SR0A 1DADA 2GEBA 5TT1A 3HCBA 3H9JA 2CJYA 3COPA 4OXIA 4PRZA 4TLEA 1NMQA 4TTAA 3L7YA 5FADA 5JJLA 1ONBA 2DMRA 4JFRA 2RH8A 4MVJM 1GUFA 2WSMA 2M32A 1FSSA 1CRWG 3DEYX 3FCOA 4KMUA 3TLYA 4E5SA 3ZDRA 4JI2B 3DVQX 4C08A 4PWYA 4CI9A 2GBPA 1RS0A 4EPTA 2FXIA 2F00A 3KK0A 2YBDA 3PE3A 4U6QA 3WYCA 3UBTA 2VZLA 3ACCA 4X97A 2IZ7A 3TUZC 1GKUB 4D6PA 3TSOA 2CUZA 1J99A 1Y9EA 3Q3VA 4UVEA 1AXRA 1DTWA 1TMGE 4WXMA 3VPAA 4ARSA 4DSTA 1WMFA 2D54A 3R7AA 3RC1A 4KDRA 3G8AA 3WIVA 5E3JA 4IHJA 3RK1A 3ORQA 4HQRA 2AJ8A 3L1IA 3JPWA 5FPQA 3RIHA 4E88A 3BIXA 3ELBA 4X91A 4AJEA 1G20A 1PCXA 1UT6A 1W4AA 2JI4A 4LDQA 3OE5A 3BE8A 4Y2JA 3TW0A 3WKCA 2VNJA 4MWCA 1X1TA 2CUKA 1YRLA 3L7LA 4Y6PA 1UINA 1XDWA 1XQXA 4JQCA 3H0KA 4GBED 4X1KB 2RH4A 4F4IA 2DTDA 3HLYA 5BSFA 4QDXA 1FPQA 2J9ZB 1KPGA 1SXIA 5C81A 1N33B 2CFTA 4PCLA 2LE0A 4B09A 1Z3CA 3TR6A 5TPZD 4CQMA 5ABPA 1RWWA 2ZRPA 4XH9B 3JTEA 2BC9A 3ZTWA 2QY9A 3GBPA 4ML3A 4FCTA 4PZYA 4B74A 4DDMA 2A9RA 1BZYA 2WT4A 1EFVB 2RCNA 3KEOA 2MMCA 3OEWA 4C7BA 3ZOZA 2E5LB 1BVUA 3GN1A 1KI6A 2DQSA 1L5FA 4LHSA 3ZZ1A 4LRTB 3DZCA 4MGZR 3GNSA 4YPOA 2XCQA 1G3RA 1W75A 1CXZA 2NU6A 1ACMA 1Q0RA 2H11A 4DDTA 3IUEA 2ZBEA 4KMAA 1Q5PA 3EIFA 1SMKA 1J33A 2Y1CA 1ESDA 1UV7A 2ZUDA 2ZXUA 2VDRB 2AN5A 2BE9A 2E5FA 1XZFA 4JS0A 4L8YA 4TWRA 4A3JC 4IIBA 4UTOA 3AXTA 4WXRA 3WP0A 1TLFA 3MD9A 4BV2A 5LQMA 4O4HB 4M0CA 2MSLA 4DBZA 2W71A 4EVRA 1HQMA 1H4SA 2PQ6A 3FPSA 2BCJQ 2NXJA 1X7ZA 5HILA 4LKOA 1EH1A 1PU2A 3OLQA 2HRDA 4PBTA 2XVZA 4LPKA 1UJ2A 2O5RA 1CHDA 5D6OA 4IPTA 1KOGA 2E1PA 3MGCA 4ZH4A 1F2VA 4PO8A 4R1LA 3S1LA 3GAMA 2C03A 2VDQB 1XO1A 3RT7A 4B3BA 3AKCA 2RC6A 5AM4A 1RYEA 2QTBA 2ZIXB 1E3DA 1IUKA 3NH6A 4QD3A 3I9KA 2QQFA 1IVYA 2H63A 1ZUIA 3DKKA 4QYXA 1UKBA 5FOTA 3WX0A 1GTVA 3CJQA 1FFAA 3G1UA 3HCDA 4C2MC 1NVFA 3DHVA 4ZT6A 3RJZA 4UFPA 4WLFA 4AKHA 4GF5A 3W2FA 3IBGA 1XD8A 1FW8A 3OQNA 3ZCVA 4YCLA 4OQYA 5H81A 2CXTA 3AEZA 2NYUA 3QFSA 4ZAXA 3RFFA 3SEFA 4CU5A 1GUYA 4PAAA 4R8SA 3U9LA 2Y76A 1U2SA 4MW4A 2JDID 3BEDA 2O2ZA 4AY2A 4HHEA 1PN3A 3W1WA 1JJ7A 1O9HA 3NQ41 4H59A 4RUKA 2CLFB 4C4YA 4C76A 2VXCA 1NZFA 4KMHA 3RS2A 3CC8A 2HCBA 1HDCA 1JDZA 2RI0A 2A1IA 3EBPA 3GGGA 2BW0A 3PUIA 3SNKA 2REXB 3KYJB 3A1NA 4MR8B 4BKRA 3BMOA 1T9BA 2FR8A 2WU4A 3C4VA 3MYYA 1W96A 4JBHA 2WLTA 3VPFA 1YR8A 5FPHA 1HTBA 3MJCA 2X7XA 4ALIA 5JNWA 2HA5A 3LHSA 5FAXA 4UZSA 4UDXX 3KSBC 3MN1A 3H2YA 4FYJA 3T3GA 4B3SB 3CH5A 4DC1A 1B0AA 3K9LA 4IIUA 3R7WB 4O33A 4IVNA 4CCSA 3GMDA 4D56A 3KP1A 2BJHA 4L22A 3WGMA 3WK7A 1IBRA 3RYCB 2JLUA 3M9LA 5G0VA 3WJ7A 2VDLB 3K0CA 3PYXA 3E7PA 4N9QA 4ER0A 1DTSA 4QSHA 3QIVA 1QIDA 3P52A 4KN5A 3KB1A 4RD6A 3Q87B 3TRDA 4DY4A 5B4TA 4LTMA 3NHPA 4HYQA 3D2CA 2R62A 4XYBA 5CXSA 1I1OA 1Z2NX 1D09A 1LBQA 3ELUA 4U7HA 1UBEA 3FMOB 4I3FA 3GUCA 1UZMA 5ALZA 1CUZA 1QF6A 2Q29A 1X31C 2QMQA 3HSSA 3JSAA 2Y0CA 2XNDD 3HDJA 4E08A 2A5LA 1U3FA 2R7LA 4ANFA 1TKBA 1W0KA 3GJYA 1ZOLA 4O2AA 1QYIA 5GAJA 3GTLK 1U3GA 3IJ5A 1RI3A 4B75A 1RHMA 5JCJA 4ZODA 4YALA 3PEUA 1P60A 1YGYA 4R1PA 4PFKA 3D1JA 1MH9A 1MRSA 4IF4A 2LCFA 4MVJA 4PX5A 4LV6A 3ZK9A 3AF1A 1UBCA 1R16A 1DKRA 4P5PA 1ZUNA 1IAVA 4PTZA 3IMCA 2ZULA 1FQKA 3N87A 4UUAA 4LSMA 2CLDX 3HKBB 2FZ4A 1DX6A 2NSHA 3RU3A 4BPBA 3AZOA 3B7PA 3NHFA 1M6YA 3HKZD 1O5IA 1YB5A 1QFSA 3A10A 4HQ0A 4OHMA 5DBIA 4KBFA 5B6IA 3SIRA 4KC6A 3Q0IA 2ZUEA 5DB4A 3WDKA 3ZKWA 4LK3A 4ARZB 1T6ZA 3NUZA 3TMAA 1QHXA 2WJ6A 1GPMA 1KO4A 1NXQA 4AYBD 4H4CA 5DTMA 4L4XA 5FRDA 2GM4A 1C7FA 3KHUA 2J45A 1C0LA 3LKZA 4A3DK 3JWJA 1FYEA 5CB4F 1JU3A 3RV4A 1AGXA 3UJHA 1E3TA 4F56A 4C3UA 3N2GA 2HT6A 4JSRA 1FNMA 1JJBA 2XODA 4U4AA 5HM8A 2VPYA 4L4RA 4JUFA 4WKPA 3PC7A 1BKSB 4YRRA 4NABA 3FPCA 4AICA 1Z8NA 3O75A 4OJMX 4B6JA 1ZIYA 2XNSA 1YRAA 1TCAA 5GM1A 4A2QA 5HEKA 4AN0A 2G9VA 4M21A 3U4QB 4YN3A 3QKSB 4F5DA 4LUCA 4EMSA 1ZC3A 3DO8A 2ZSAA 1DJQA 3P1JA 3VA7A 1FDVA 4J2TA 1W73A 4LYJA 4HWKA 4YRLA 1ZAKA 4CFSA 1H4VB 4OJKA 2IHVA 2D1SA 3V00A 3N2LA 1QOPB 4MEXA 2AD5A 4O2RA 3GUYA 1QF9A 1ZOPA 1JKJA 1Y37A 1X7XA 3F6YA 5L9AA 5MF6A 5LWQA 2J6HA 4MRAA 2G71A 5JXWA 1EUDB 3ZWCA 3CWQA 4LOKA 1E9BA 4IIGA 2YHSA 1L5NA 3RSSA 1WB5A 4E1VA 1S01A 1FMJA 3MT8A 4NMHA 5IK2D 4RETA 4UE6A 3N70A 3Q0EA 4DLLA 3H17A 3Q3JB 4PAGA 3RI3A 2Q6IA 2SICE 2WHPA 2BGTA 3CONA 5F4ZA 2RG7A 2LPMA 1YDHA 3PUYA 3TWOA 3CEHA 3GR6A 3JYLA 4EVQA 3D31A 2G08A 2J46A 3DDWA 4JVLA 1VHQA 3ODPA 5A2QA 4L51A 4WN9B 1FDWA 1SXJC 2R25B 1GSOA 3VBEA 2PJZA 2E55A 3VPGA 3VZPA 3WL5A 2EXXA 3QKSA 4MRMB 4QO7A 2QP4A 3WLIA 4S1NA 1MQSA 1KMHB 2XMCA 1N2CE 5JNVA 5BWNA 5CD1A 3ITDA 4LDAA 1J0BA 3GDHA 1PLKA 3SFZA 1YE3A 1UM8A 2WIFA 3MS4A 1WD5A 5FA6A 1X86B 2E1RA 5FPSA 3AKZA 3G0IA 5HRCA 4YT5A 2DULA 3DAHA 4PN3A 3AR3A 4O08A 4C0LA 1JT9A 2WAMA 3LXUX 4XX1A 1II0A 3H4MA 4GX5A 5DW3A 3KUUA 2DP4E 4JU8A 1T4CA 3WZ2A 2F8TA 1G9TA 1NMSA 3DLCA 1WMDA 2CFOA 2Z0MA 3JATA 3N0WA 1YUMA 2R8BA 4ZZIA 2I4MA 1VL5A 2GVDC 1G7CA 1U2EA 4Z49A 1AG9A 3WHIA 3BD9A 5D3ZA 1OXTA 3EUFA 4ZO6A 3VAAA 2X8WA 3LDFA 2JCSA 3UW3A 2HTFA 2RHDA 1YRHA 3COYA 1W46A 2VJKA 4J9UE 4E33A 4DBLC 1PEKE 1WA5A 3RBZA 1NKTA 3UFBA 3WTCA 1YC5A 3C6XA 3HRIA 2XVYA 2YIJA 2FX5A 3PDWA 5B4VA 5BOVA 2CSXA 4ZVPA 5E7IA 1XXHA 3WK5A 2CFSA 4KVAA 5HRAA 1SCJA 4BKPA 2NO1A 2ZUSA 1GPYA 2IPXA 3QMVA 5F76A 3ZYZA 5BXYA 1N6IA 5DWQA 1Q7GA 4KSYA 2YYSA 2W22A 1FNDA 4NBTA 3T3HA 2OBMA 1H0KA 2QUZA 4MW5A 3OF2A 4MINA 1YB7A 3TDMA 3NP7A 3C6YA 1RKBA 4MPJA 1VZ3A 3U6BA 3ILSA 4MQ9A 4GZYA 3KVNA 5GVSA 3VI4B 1R4MB 1BX3A 3ADAC 3ADOA 1E1DA 1UBUS 1T26A 3D8BA 4XQGA 4TXLA 3LFHA 1Z6PA 1E1MA 1ZK1A 1M2FA 1ZVQA 3I34X 1L5OA 3KR0A 4GBGA 2WTUA 5EQTA 2VLBA 4NOMA 1VDMA 4I50F 4XVCA 4KI7A 1E77A 2SKCA 3CUTA 4XLPA 1ORTA 5BORA 1GOTA 3OEPA 5JANA 3BP3A 2J0UA 3VKFA 5BVGB 3O8LA 4MV8A 1H2FA 1ZCFA 2BL4A 2AFVA 2R8RA 3F9IA 3GTJK 4HGPA 4ETIA 1CY4A 5ANRB 1N57A 2PL9A 2VKQA 1YZHA 1YQTA 2Y66A 3OCWA 3OF5A 1IHYA 4ZZ2A 1UT5A 5SY4A 3TTYA 4MRNA 3EPKA 3ADDA 3OLXA 1NMYA 4H77A 4L4ZA 3KJQA 2N46A 1Y4ZA 1Y1RA 3L1UA 3A6GA 2FN3A 4ZPXA 3K4PA 3O6VA 3MA0A 4HMOA 4OLJA 2VCEA 5KNBA 2NQ2C 4GOLD 5FJIA 3TTGA 3LC0A 4Q4HB 3D2LA 4OSEA 1FVHA 2QVZX 3G9TA 5IJAA 1R6XA 1Z5GA 3N8HA 1Q0HA 1W85B 1S4QA 3ZHSA 4BFLA 4EGJA 4L5JA 5JCPA 1NXOA 3KKMA 4OI2A 1JIUA 3TR0A 3CNQS 4ITUA 2EKPA 1IZ8A 3GTJC 2IHUA 1L1RA 1T9ZA 2HA2A 1GU1A 3RYHA 5CFLA 4UVIA 1QVRA 4FB5A 4H1VA 4MVJP 4XM1A 3B12A 1R9JA 3JQ9C 3WWEA 1E1YA 5FNVF 4RVFA 3AC0A 1D5CA 4G4JA 2R97A 4TSRA 2DFTA 3D5EA 1DG9A 4JJFA 5ADVA 2QNBA 4MS1B 3TW6A 4JDPA 5A0FA 1MRZA 3NTUA 3MTJA 4GUDA 1AUVA 2ZSBA 2OQ2A 3GLHE 3NHUA 4NESA 2KYRA 3U13A 5A3QA 5KKCA 3BDAA 4QZVA 1YB6A 3GDGA 1U3TA 2VHZA 2MSCB 3N07A 1TUBA 4QX6A 4DEXA 1UDXA 1XNQB 4PPFA 1T2VA 4PE5B 3IO5A 4QUDA 1O7JA 4CG3A 5K9ZA 1IXYA 2QMOA 4HG2A 2YWFA 1CS0B 1FX0B 1R9TK 1U2RA 2XD4A 3HMQA 2C3PA 2YJ4A 1V6SA 4KREA 1N32B 1NMZA 1N0WA 2J85A 2QW8A 2GNPA 2OM2A 1DEHA 1QSGA 2RHBA 3BIJA 4EGCB 1VTKA 3ENNA 3SOPA 3QU4A 1U90A 4AY6A 1OT3A 1NG9A 1E7WA 5K01A 4OFXA 2MCFA 1GV0A 2A9FA 1TC1A 3RRFA 2HK6A 3NT2A 4AZSA 1WCXA 3E5HA 3GCWA 3RU2A 4KR2A 4OY3A 3K9HA 2DBVO 2O8NA 5K09A 1HEUA 2JATA 1EA5A 4S24A 3U7HB 3NBMA 5NLLA 3MS2A 4MITA 1J2JA 3GEDA 4LYDA 4JCOA 1XEXB 4K2HA 3CEPB 5IP9K 1ICEA 2I4OA 1FJGB 2QSYA 2PUAA 2Q1TA 1UBKS 3ILVA 1CX9B 5K4GA 2M98A 1P4SA 3NZEA 4WCFC 2IW3A 2OCLA 2I6TA 4HF7A 2Y1FA 4WLVA 3UOAB 1SU8A 1WF3A 1I7PA 2CBXA 1WTCA 3JWHA 2FDXA 1G4UR 2RSLA 3I37X 1QTQA 2P2ZA 4HB2A 3N53A 1CFZA 1EKXA 3DQZA 1RWBA 2YDYA 2OV4A 2JW5A 4NJMB 1GGNA 3F7NA 3LVBA 2PUFA 4CU2A 3R5XA 2IKQA 2AUTA 2ZDQA 2B1IA 4II2A 4EFLA 6Q21A 1W9HA 5K3DA 2B35A 1SULA 2OC9A 4MOWA 3SYRA 2WIJA 3LUCA 3UG7A 1I4TD 3FYUC 2Z57A 1YQ9A 1CIPA 4M7RA 4NEQA 5TEVA 1TWCK 1PE0A 2IIQA 2XQGA 3EQ6A 3QXCA 4J94A 3ZWBA 3MGKA 4AKSA 4DV0B 4GTAA 1QZUA 2C2XA 3LCUA 1RRPA 4FN4A 4J0FA 5AQ1A 1XU9A 1PZHA 2VDNB 3RYHB 3GDOA 1D5WA 2Q3JA 4QGSA 1IHUA 1LJ8A 2GZ1A 2VPXA 4K87A 4F2DA 3CRW1 4YY3B 1C9DB 3VU8A 3W2EA 2P90A 5BYBA 3CF6R 4QXAA 3HL0A 2GI4A 1V3TA 2XOKD 3W3ZB 1T1SA 1TQ2A 3DVSX 3LT1A 2OD7A 4ZQEA 1XCPA 3IV6A 1W2HA 3IIMA 2BLNA 2DFVA 3H9QA 3S1AB 1HSZA 3W5AA 4JN6B 1CUGA 2GK3A 4L76A 4MP6A 1E60A 1I3MA 2B7CA 2QDXA 3MILA 4PANA 2PO7A 3PFCA 5ARCA 2CFCA 3ROFA 2ADMA 3HCFA 2WINI 1RR6A 3O3NB 1HFKA 1KYWA 3BAZA 4KSBA 2GHQA 4Z54A 1T4MA 4MPDA 2D8AA 1JLKA 1RJDA 5KYVA 3S5JA 2CHQA 4YCMA 4LNUA 4KPUB 4UMDA 5LD2C 3TG8A 2P6RA 4P9SA 4EKGA 2CLLB 5L3SB 3LT0A 2B99A 1DBIA 1P6QA 2JA6C 4MI1A 4IXDA 1OC4A 5CK4A 4WZBB 3JAMA 3N8IA 2ZRGA 2ATEA 5DIZA 1N25A 3QKRB 1P5FA 4UHBA 2GPSA 3DHWC 3NANA 1TMOA 2VWQA 4YRQA 4EW1A 1EX1A 1FRNA 3GOQA 5LP1A 4C7OA 1Q3KA 1Z74A 4M1KA 3K9CA 5D6NA 1Z8HA 2R8XA 2RK3A 3B5IA 3IUPA 3VZBA 4C43A 5K0ZA 1T2DA 2J32A 4NEHB 2PRYA 2I03A 1JU4A 3LYAA 1BMDA 3O4HA 1C8VB 4UD2A 1KGDA 2HNBA 2PRKA 3CNOA 4HEA6 3L6RA 1WCMC 3TFIA 5TE9A 3JWEA 1QM5A 3DG9A 1U0LA 1GYQA 2ZB3A 3T4UA 1RC8A 1CR0A 2WFMA 1QPGA 1TFUA 1JBQA 1X3LA 2LKDA 2OOKA 4FFOA 1UK7A 3W2HA 2BUAA 1HTWA 2VDWB 2FEXA 4OB8A 1Z3IX 2HSZA 1XVLA 3IQWA 3TPCA 5DWVA 2GJ4A 1KYTA 1UXOA 5BQ3A 2YYAA 3LI2A 3LC1O 3OZWA 1GZ7A 2YV1A 2HA6A 4S1OA 1U5BB 3FFBA 4BQOA 1P9LA 5A5DA 3DLHA 3H97A 4LJ7A 4A3BC 2B3TA 4F9GA 3L04A 4QFMA 4Y7NC 4XB1A 1NQUA 2C3UA 1ABEA 1N5DA 2VXOA 3GLVA 1G8PA 4TWJA 3WLJA 1GZ3A 5A4IS 4LS3A 2KI5A 3BA6A 2F1RA 3R3HA 5K6RA 3VJLA 1JF8A 1E63A 2YJGA 2XWBF 2VK2A 2G1PA 1XGKA 3HWSA 3RAPR 2OYCA 2OXCA 4M8NE 1BW9B 1PX0A 4TVOA 3GMSA 4DG5A 5BNWA 3DOJA 4E5MA 2HJVA 1KY5A 1AMNA 1KZ4A 4DGSA 4G36A 1WZIA 2RBEA 2YOFA 3LVFO 3SHWA 4ZICA 2YYYA 2ZRDA 2VDPB 3CO5A 3MW8A 4M8SA 3OJXA 1DAOA 3ZBTA 4J91A 4J2HA 2IHKA 2XLBA 4MWZA 2RAVA 5U4XA 3KV3O 2XF2A 2G80A 4LHEA 3S1RC 3OQBA 4C3HC 3RFUA 1B7GO 1ZCZA 3PLNA 1ZRMA 2TRSB 3JQAB 4IIXA 4X84A 1E92A 1O3YA 2RARA 4LZOA 3JSTA 4YEDA 3SXPA 1XMOB 2BMWA 9ABPA 3T7AA 4CV2A 1YVUA 5A5VA 2X0IA 2ZAOA 5K0EA 1FNBA 4KV9A 1R4AA 1FXUA 4ZHQB 3QEBZ 3PG5A 1VSVA 4LXTA 1YQDA 4Y6RA 1RTKA 2EC5A 4OTZA 1QYWA 4Q1CA 4Q3OA 1GGVA 3KYDB 1Y6FA 2BKEA 1P31A 4OLAA 1XSEA 2H31A 2JZNA 3BFVA 4CUZA 1W5AA 5JAHA 1N5JA 1XLWA 2A1UB 2OA0A 1G2QA 3EDRA 3IRVA 4ZOAA 3RUCA 3TPZA 4DVJA 4XOIA 3RSGA 5AI9A 4LSWA 121PA 3GRYA 4IH4A 1SCAA 1V3UA 3SF8B 4ZEVA 1PIWA 3A3YA 3S29A 4MH0R 3GLGB 4RTNA 1NVAA 3ZNPA 2FG5A 2ID8A 2QE6A 1H3EA 1H2XA 3O47A 5FD8A 4BO6A 5LP6A 3N3AC 4JC8A 3AI1A 1XCBA 2C9OA 1WPGA 2C8KA 3D6HA 3HYRA 1B4AA 3IKMB 4AJ2A 3UH1A 4LWPA 1ZIOA 1F4PA 4ZYZA 5B7NA 4Z8XA 5F78A 5K0LA 1AVTA 4FNMA 3VZCA 1D2NA 3E4CA 4PHGA 1Y8RA 4HDRB 4MWEA 3S8MA 3ENWA 2OYSA 4M0DA 4QJ3A 3CTMA 2RGUA 4DKJA 2HRCA 2PMDA 1BDFA 2Q2WA 2SECE 4KIJA 4PM4A 2M1XA 4TTVA 4PXYA 4ENPA 1NIJA 2YWEA 4AMVA 5LYJA 1HE1C 4AWXA 3OAAA 4BZZA 3HVHA 3L7KA 3NTXA 3VC7A 4AFNA 4KXVA 3QUCA 1D2RA 5CDSA 5HW0A 2EKLA 3GLGE 3D3WB 4D9JA 1ZR2A 4DA9A 2IHZA 4AP6A 2XB8A 3AT1A 5DLEA 3IP9A 4B3MB 3FR7A 3UJ8A 4MUIA 3BXOA 4BGVA 5L3ZA 2FSUA 1TX4B 3MINB 5G40A 3C45A 3WL4A 4ZC1A 1APBA 1KMIY 4R0MA 4LZNA 3CEJA 2A5JA 3AHEA 4YAGA 3Q5DA 4PAWA 1P9RA 2BRUA 9LDBA 5M34A 3LP6A 5I3ZA 5D8DA 4NIMA 2HCTA 4LZJA 1U7UA 4HBGA 3SQLA 1J8QA 4IF6A 4ZDJA 4OLBA 1FUUA 4L2IA 4NY1A 4CT4B 3PRJA 4JBIA 2Q3MA 1OWMA 1SCUA 1XRSB 1N2ZA 1E6MA 4HPXB 5L7WA 4ESVA 5J5VA 4ALNA 1JXMA 5JMWA 2FZLA 1FDTA 3O83A 5BXQC 3BKWA 4RHTA 3RADC 2F8MA 2MIIA 2OZLA 2HLDA 3V7UA 2GLUA 4NQRA 3ETGA 2WSLA 5C80A 1GZDA 2YZGA 1E3JA 3LPNA 3Q2KA 4M0KA 2HIHA 2I7CA 3G6WA 3ZKWB 2A1TR 2SCUA 3ANTA 10MHA 4UXJA 2OVBA 2IYEA 3O8OA 2PIDA 4DZZA 5AOVA 4D9HA 1R0CA 3BRCA 3NGMA 2V6UA 2OCBA 2RAPA 3KIPA 2J3LA 3N6VA 3O8QA 4BO9A 5DN9A 2VNAA 3MMNA 4LIPD 4H7JA 3E7XA 2JHGA 2FP4B 4CMJA 1YI0A 1S2GA 4H4DA 4MUNA 3LNCA 1LPNA 4MO9A 5JWRA 4DARA 1E9RA 1MF7A 3T7IA 2XE8A 3T3OA 1GPH1 2J5QA 4RD0A 5E1OA 1PZNA 4CCYB 4HPWA 4UREA 3QMMA 4YCJA 1OFUX 4BP9A 4MKIA 4K26A 5H4GA 1FFDA 1QG6A 2XVAA 3DV2A 4ZU1X 3VOSA 1K9SA 1XZEA 4MR7A 4IDEA 4BP3A 3BL6A 3OFJA 1DIGA 1PT9A 2F43A 3X44A 1OFTA 2W6JA 3UAYA 1BWSA 1YI1A 1XE3A 2A1UA 2IPOA 3RS5A 3V8EA 1WV1A 3ASVA 1EBBA 4ZEXA 1C30B 1ZNZA 1PR3A 4FDAA 3U4DA 3WC4A 2EV9A 3UK6A 3FPAA 2VF7A 5DVZA 5IAKA 7REQB 2G5TA 2DQZA 1E8DA 4AG6A 3EVGA 4REQA 5EE1A 1MT0A 3SN6A 3VKHA 1QBGA 4JVMA 1P91A 2VDKB 1XDUA 1UK8A 1Y1PA 1ZRNA 4J03A 2P9FA 4KQHA 4REMA 1GLNA 4R54A 5EJMA 4U2DA 3JAKB 3GEBA 4AH6A 4WLEA 4LF6B 3KZMA 4JODA 4YMTA 3PENA 1XVIA 5KJ1A 1LWNA 3DZKA 3OECA 1MABB 2R6GA 4AXBA 2I6XA 4HMPA 4TMFA 4A92A 2VPQA 4BMSA 5AW9A 1Q1AA 1GUAA 3PIIA 4JSYA 5HK9A 1XFAA 1OBHA 2WMOB 1GA4A 4EVSA 2HWUA 2GTIA 5FX2A 4DWWA 1Y5NA 3C5CA 5KJCA 4TS9A 1NN3A 3Q15C 3FAKA 4NATA 4IHKA 3C5VA 1T2AA 4QJ4A 4X7BA 4KI0A 4OUDA 1OFVA 3K1AB 5G2OA 3R8CA 3TCKA 4HAZA 1SB9A 4KAAA 3RANA 4BJ1A 4LRQA 4DM7A 1SUBA 3EARA 3C8MA 1OGIA 3NDRA 4AJKA 1BKDR 1R37A 4HOYA 3AKYA 1OU4A 2VJNA 2Q4EA 1DAIA 1ORVA 3NBAA 1OU0A 3E22B 3F6CA 2IPNA 1RLOA 1Q15A 1VPTA 4TV9F 4OXKA 4YR9A 3OBBA 1Y8ZA 3QQ5A 3RKUA 4RJTA 5ALPA 2CNWA 1XXHE 3NTVA 4FHZA 4NBUA 4YWHA 4EHFA 2KE5A 1X7ZB 1ZMTA 2ORED 4MYUA 4DIOA 5BV8A 5CEEA 3VAZA 1PJ3A 4HLQB 5I7OA 5THXA 1ZVVA 1VE7A 5ENDA 4OVKA 3EYAA 2IS4A 4IJQA 1DPFA 2C57A 5HMLA 3IBFA 4L73A 3COWA 4S1TA 1ZH8A 1GTSA 2OV3A 3TFJA 3DKIA 4RTOA 4RPLA 4JASB 3VO1A 4TX1A 1DKMA 4ZOQI 3N0CA 3HYLA 3JQ6A 4HFMA 3SE0A 1FFEA 2DBQA 4XCQA 1C2YA 3ELDA 5DT9A 6PFKA 4D98A 1A71A 1PFVA 4RTRA 4WFJA 2EDAA 1CZKA 1ISMA 4HY3A 1PTKA 4F06A 2QLTA 3OOEA 5GQSA 2VSOA 1U4OA 3EF1A 3T06B 3ZIAA 2ZB2A 5HRUA 3WNZA 4B6SA 5LOVF 4MJ3A 1UWKA 4IBOA 5JAUA 1YQQA 4DA7A 1F3OA 2B4QA 2QXTA 3KKLA 3BXFA 4DCCA 1PG2A 4D3ZA 4DUPA 5FBHA 2HQBA 2D7DA 3M6WA 3KQMA 2B7BA 2GASA 4NFLA 1T8RA 3OIYA 5EXTA 4HMQA 2C2BA 3F3SA 3OM1A 5KAPA 2CBZA 3X1DA 4BQNA 5LMZA 3T1NA 2VHWA 1IXKA 1UR5A 3LWDA 1A5SB 3WGUA 3OT4A 3IOBA 2ZWAA 2XD9A 3HCEA 4NE9A 4R84A 2ANCA 2QUKA 1U5AA 2NVQC 2G6BA 2H1LA 1N8SA 3B85A 4B79A 4G6ZA 1WU7A 4NCXA 4E2ZA 1M1NA 1S3FA 3DXXA 3MTQA 1YZTA 4WXEA 1WU8A 5AI6A 4JBXA 1KNXA 1DBRA 4OLFA 3U7RA 5CNIA 3UAXA 3BJRA 5DM1A 5IYZF 4UJ3A 3AM1A 3OTHA 5A1JA 1S8NA 2MHCA 1F93A 1OWNA 1E3IA 2NU9A 2QU8A 2ZPUA 3M0EA 1FRQA 4IINA 2OILA 3B60A 3PKIA 4IFEA 3GG9A 1R18A 3BMXA 2WSIA 1WEKA 3EIUA 5UKDA 1QYDA 1OXUA 4X1OA 5CCDA 1CY0A 3HY6A 1Y8CA 4I55F 1FFWA 4MVJG 1VCOA 1JA1A 4PG8A 1CDOA 3LMKA 2QLNA 3WK6A 4FJ0A 1O9GA 3S81A 2IYTA 1RPNA 2CWDA 3D6MA 3C7DB 4X45A 4YDRA 3WOVA 1GPLA 1FX1A 4YB8A 2PH7A 2FUEA 1GNQA 1BXGA 3ESXA 2IP2A 3NRJA 4B6FA 4QPPA 2V1UA 4DANA 1ECGA 4Y9RA 3WK4A 3GZNA 2ZJ0A 1LLFA 3FI0A 3K5WA 3GA7A 4HDQB 2X2FA 3GEPA 4IOKA 2Q5JA 2W58A 4CF5A 3QUBA 5DHTA 1QRTA 5J9FA 4PVDA 3ZV5A 2FPRA 5IYDC 3JD1A 4B6PA 4FU0A 1C1YA 4E4RA 3ZW7A 4UCFA 5KOJA 3TMKA 3OQPA 1U9YA 4GLFA 4Y9DA 1XKQA 3WQQA 5GADl 4NC9A 3LOPA 2OVFA 4MRMA 2HXYA 4PTYA 4HQNA 3HXAA 3R0IA 2BFDB 1L8LA 2AG8A 3DHYA 6YASA 3TIFA 1CUHA 3BBLA 3TPFA 5DP2A 1Y4UA 2FFRA 5K3OA 4O63O 1MEJA 1EGHA 1M6NA 2WDPA 4YAIA 3TECE 1HT3A 1LDNA 5C7OO 4JJ4A 2Y1DA 3T5BA 1GN9A 2O1XA 3D2BA 5ALSA 3LUAA 2CVQA 3AV0B 1JDTA 4QU9A 1VOTA 5K8IA 3OJOA 4JP1A 1K4YA 2ZRKA 2AX4A 3GPBA 2HX1A 2Q3HA 1IMJA 1KFKB 3WLSA 4B2YA 4IH9A 4MJ7A 1U0BB 4Q9HA 4F4HA 4YCDA 4QJVB 4JXXA 1H2EA 4BY1C 3H9UA 4QUEA 4PZZA 1SVLA 1V4VA 1NJ5A 1G19A 1R0SA 2CVPA 3D8TA 3DE1X 1L8OA 5ALYA 3HFGA 3EJ6A 4FCWA 1YR7A 3H19A 3SZYA 2QYHA 3AUYA 3LT5A 1FXSA 3M81A 1P75A 3Q41A 2Q49A 2RGBA 3GA0A 4DCTA 1J98A 1E4EA 1E3MA 3S68A 1QKJA 2E2JC 3LA6A 2FW1A 3ZGOA 4DV3B 4Y0NA 1T3GA 2QQEA 4HGNA 2IUFA 4U8HA 4X6UA 1IHXA 4OINA 2MSKA 1A5AB 2I78A 2Q9UA 3NRBA 3MPOA 3ZJYA 4WFQA 3UPTA 3UGKA 1P61B 4OAPA 3GY0A 3UWMA 4RHFA 1O08A 2HYDA 5AXDA 2CDAA 3PC3A 3HUUA 1G9XA 4P3YA 3GSIA 1H65A 5DOZA 1L5LA 3KUDA 1NRXA 2QJWA 3A3PA 4Z3DA 1OY1A 3OE4A 3AJDA 3TMYA 4C7KA 2QM8A 4U7DA 1RLTA 1O89A 2AVNA 4OP2A 2RH6A 4F5ZA 2GVNA 3A1CA 2KHZA 3MTIA 5DGTA 3SDBA 3SYTA 5KWVA 4C6RA 2GH1A 2JA5A 5JNLA 3TTTA 2PZFA 4IFIA 1YMVA 1C0KA 5ERXA 2VR1A 2EX1A 1G98A 1SCQA 3S2HK 2GXAA 4C2MK 4Z8YA 2PY6A 1DC5A 4E30A 3N59A 2GYWA 4W5OA 1AN9A 4MQEA 3GLSA 4BTEA 2J9FA 3IDZA 2VAPA 1FTNA 4OGFA 4QLOA 4IUCS 4KAWX 4QOJA 1VLLA 1GNVA 1Z7EA 3KLMX 3WMRA 3PJGA 5DULA 2XUOA 4N5IX 1O25A 5A05A 5BYJA 3OZUA 3THYB 4YAEA 3SK0A 1JQDA 3HKCB 1IVNA 4YJGB 4GI5A 1GNSA 2R4UA 2PLFA 3AGQA 1Q92A 1DEKA 2FWIA 4R7GA 4EJFA 1N9GB 3LG2A 4N9WA 2W6ZA 1WKVA 1DO0A 2RB5A 1QHHB 3DZDA 1DWQA 4Y98A 3OZFA 3S14K 1A96A 2ACEA 5JZ9A 4R4JA 4I1VA 2QE7A 1XEXA 2FB9A 3OX4A 1LWOA 1Y3FE 1DKNA 3JQ7B 4FIDA 1E3LA 3TOXA 1H9CA 1JZQA 4JC0A 4X5OA 1C9EA 3FGPA 1YK0A 1QC5A 2OCGA 4J6EA 4M60A 3FZNA 3HCCA 5C35A 1N2CB 2UVQA 1WEHA 2W2KB 4FCCA 3AI3A 2XA1A 1V3VA 1KSHA 1PFGA 3SKVA 4JGBA 3MB5A 4YJHB 3RRBA 1YZGA 1XZIA 4K28A 1Z4QA 2OHJA 3HEBA 4UAGA 2VJMB 4EUHA 3TLZA 1J07A 1FP2A 1MQAA 2Z2IA 3AXSA 3GT7A 2H2DA 3PNVA 3SBDA 3BCHA 4E7OA 1DAMA 1FFSA 2FMHA 3M1YA 1XQYA 3I6MA 1LA2A 4EHAA 3S6JA 3SCZA 2Y3PA 1HRDA 1WVIA 2RI1A 3AHGA 3DCIA 2DZDA 3Q2OA 3TLXA 2RE8A 5JJKA 4DA8A 1I50K 1HLPA 3IKLA 3V55A 3LM8A 2J3HA 4YAWA 4YR7A 5BUQA 4JI8B 1DTEA 5TQ2A 1GNRA 2ZRCA 2JEOA 3SHQA 5J1SB 4DCJA 3ZKAA 3NS7A 2J9RA 2XB6A 1E9AA 2EIHA 1YJBA 4B4KA 3KVVA 1Y1WC 2YTZA 1ZEJA 5FV4A 4TWZA 5IBPA 3RCBA 1OLXA 3IUYA 4DIUA 4C7VA 3FG9A 3OPYI 1CEXA 3NVAA 2X2OA 4G7HA 4QQKA 2PX4A 1HMYA 3IH5A 4QYWA 1XJ0A 3KR1A 4AM8A 1JMKC 2PUEA 4R51A 1SG0A 1ESEA 1GITA 2PFSA 3PTLA 4HUJA 4BHTA 1KSFX 3F5FA 3FKIK 4UPVA 5K3AA 4LTDA 1QK5A 5BWOA 1NAHA 4MKGA 4KQIA 1W30A 1ZL0A 2WHRA 3D2AA 3DZIA 1EWTA 4I9FA 3OZEA 4DXAA 2ENWA 3I2JA 1OPXA 2PA8L 1ESMA 3CNLA 3NOXA 4FUTA 4UOZA 3ZK7A 4P34A 3A58B 2P62A 4MWSA 4QOGA 2X6TA 3M49A 4RMIA 5L7TA 1GYPA 6NULA 2CGEA 2CNWD 4IV0A 2CV1A 1L7QA 2ISQA 3ZGVA 1IB6A 2XH8A 4CUKA 3OFSA 5SZIA 2Y71A 2QR2A 3M9WA 5DISB 4G0PA 2J9GA 2R8ZA 3OM9A 3OO1A 3V6MA 2V0GA 3DZ8A 3W6PA 4PBRA 1WX1A 4D4HA 3Q9NA 2CW0A 3PNOA 4BN4A 3HCNA 4UMFA 2GJAA 5FWAA 4RY2A 3E3MA 2JH9A 4MKXA 3D4IA 2BEUA 4R9UC 2PXAA 5KYGA 3UWOA 3OUUA 4DQKA 2BPOA 4GU5A 1XNRB 5HS4A 4ZYWA 1ESZA 1JT2A 1WSBA 3BK1A 2GSUA 3P9IA 4P83A 3TZHA 1J09A 4A5OA 1CK4A 1TF2A 1XUOA 2HF8A 2RGXA 4HS4A 3AH5A 4W82A 5A7HA 1P8JA 3NAGA 3FMVA 1K7YA 2QORA 4NPHA 2ZPAA 3KQQA 4D9IA 2PL1A 3F5MA 2IS1A 1G9SA 2I3BA 2QU7A 3PNMA 1PGNA 2XWPA 4U2CA 3L6UA 1XTBA 5DASA 4BGUA 5JCJD 4R8VA 1K92A 1QS0A 5K4AA 4JHXA 3WXMA 3YASA 3CVUA 1P74A 1Q44A 4RXTA 2ATVA 4EA8A 3ZQKA 3FCSB 3TFHA 3BSYA 5TX7A 3AB7A 4ND4A 1GKKA 1XZJA 2HC9A 4EHIA 2WM8A 3NNDA 5L3RA 2PE5A 2JG3A 4B3HA 1ZAYA 2SKDA 2IYLD 3F2VA 1HRKA 3PHBE 1UFRA 5AK3A 3P26A 4GTLA 2C1EA 2ACVA 3M82A 3V2HA 4KR0A 3DPIA 2FRXA 4NDAA 5KC8A 2VPZA 2J59A 2I3ZA 3MCZA 2ZZNA 2ZYSA 1SZCA 1KS9A 2OXRA 4YJ2A 2F9LA 5FYQA 3F4KA 2DE0X 3FOEC 1EQUA 2O7NA 4D9NA 1NBHA 1V96A 1DKLA 2X14A 3IMGA 1NI4B 2VF8A 4KG7A 4P98A 4EZEA 1P2TA 3IUJA 3TZ6A 1X74A 2V6GA 3TTXA 5LOVA 2O0JA 5EIXA 2YVLA 5GOZA 3AERB 4RADA 4S35A 4A0FA 4CHTA 2DKOA 5HM6A 4BASA 2FPLA 3NM6B 4DA0A 3EPLA 3OU6A 1KKUA 4G5QA 1Z45A 2JA7K 3CUSA 3DMRA 5DHPA 2NPFA 3L7OA 4TXMA 1Y3IA 2HDWA 2GEVA 1INNA 3DEAA 2BMFA 4J0HA 4RTJA 4E5NA 4DMCA 1HH4A 4K7JA 4DC9A 4DRYA 1RADA 2GN2A 2GPBA 4Q7EA 3RJ5A 1IHOA 3LT2A 3TVDA 1SCDA 1SUIA 4MP3A 2OD9A 1MAUA 2HLDD 3ACBA 3DFZA 3EXHC 1U0RA 3LC7O 4P33A 3WL8A 3EHEA 2I1WA 1PO7A 7YASA 4JOSA 4CMCA 2W93A 3IAFA 3P9NA 1YHYA 4DT1A 3TIIA 1M2VB 4QQNA 2W70A 4J29A 3LUKA 4BCBA 1PJ6A 1NONA 1EXDA 1I6WA 2A78A 2FUNB 3GBSA 2V7PA 4F5YA 5EY5B 3GJ3A 4LC1A 1NBMD 2W11A 4RC9A 4DSOA 4XWOA 4G7OA 3ANXA 3MRSA 1HBJA 1P33A 1KMNA 4G56A 4JVNA 3BMNB 3LIPA 5B7GA 2GBGA 3VH4A 1A8UA 1MJ5A 1NLYA 3LHDA 1YU9A 5JZMA 1M54A 5KKNB 1OFHA 5IT0A 1RKQA 1VIAA 1P7ZA 2B94A 2ZS9A 5IBCA 3HXKA 1KJ8A 4Q15A 3PD0A 4RVDA 2CNLA 3PA8A 4H4EA 1CQPA 5I01A 4XB6B 4KAFA 1YAJA 2G9NA 1SVIA 2EW8A 2EJUA 2IYQA 2RHHA 3U7JA 4CIWA 4IVQA 3FKJA 1E3SA 4KCGA 4QKQA 4G0XA 1KFBB 4NBRA 5HR5A 1E69A 3JASA 3PI6A 1IY0A 3F47A 4HDKB 5HX7A 4OMFG 2XDWA 1EQRA 2JBWA 3LWZA 3O91A 2VXYA 4NHEA 5CDTA 1HO3A 5ALGA 5CLGA 2YV5A 3RS4A 1MOZA 2Q41A 3A1VA 3DHEA 3BN3A 1NVUQ 1XAGA 3H87A 4AJLA 4BFXA 4F9EA 2CCKA 1UC8A 1KI9A 1QJ4A 5L8VA 4B32A 4WZZA 4P7JA 4H6PA 4W5RA 5I9LA 2LIPA 3ZGXA 1NPTO 1TIBA 4CDGA 4LOHA 1SHTX 4M3NA 3GTPA 4PCAA 1Q2XA 1PJZA 3F6SA 5D5HA 1BX0A 2R93K 3HXQA 4JXKA 4OK5A 1ICIA 2JIBA 4Q9IA 1QRAA 2VQFB 2LZ0A 1NHGA 1NF8A 3D81A 4G5HA 3H6GA 1WF6A 4MKFA 3ZI7A 3T7EA 1KZGB 4B84A 2F3SA 2QN2A 3IGFA 2JASA 5C0OE 5YASA 4A3DC 1JHOA 3P9CA 1QGDA 1Z5VA 4EWLA 5CPFA 1EGAA 3DUFA 4GIBA 1E2QA 3ET4A 3WQBA 2PCLA 2JEYA 2XQJA 1GKYA 2ZWOA 3RVPA 2VJLA 4M9SA 3KD3A 1JJFA 2F1KA 2AN3A 3L8DA 4FFWA 3JASB 3WHLA 5CTJA 2OGTA 4UPDA 1YO6A 2J0SA 1ST3A 1NSTA 3H9BA 3TD9A 2Y99A 4YK7A 2BEVB 4D8VA 4UE3S 4JVSB 5KQGA 4JKIA 3EA0A 1HG1A 2ZSHA 1YRWA 3BQMB 4Z86A 1IZYA 2QZZA 3IJPA 3EWAA 3AQOA 3IUSA 1J0EA 2PZLA 4P3KA 4JX9A 4KB4A 5EINA 4CGYA 5A06A 3EXG2 2V65A 4MGEA 1LDMA 1O9BA 1O28A 3UT5A 1FMLA 3NC1C 4ZGGA 5SYNA 1JYEA 4URVR 5BMVB 3OOSA 4JHLA 4RHCA 2BFCB 4F6CA 3PSAA 3Q9LA 1ZHHA 2NU7B 4HVTA 5L53A 3WKBA 3IEVA 1Z33A 1R5OA 4CEJB 1LLDA 2VYVD 1W4LA 1VMDA 3I5MA 4QDZA 5IJ0A 4K2AA 2G0TA 1YJQA 5ETJA 2WKWA 3H5NA 1Z5UA 2W8BB 2ZJAA 1Z7GA 3AOEA 3ETHA 3PGVA 3A1EA 4E21A 2GETA 2PAAA 3GNLA 5IBQA 1Z34A 3DT6A 3HKDA 4D02A 4I5IA 1FFCA 3KELA 2G9QA 3ZHYA 2UZAA 2EKBA 1HTTA 3BREA 2PSHA 5F52A 2WG2A 5TARA 2JVIA 1JX6A 5JSKA 4D99A 1ES9A 1J9GA 1PD1A 3CZ9A 4W99A 5H7XA 1K5DA 3U19A 3ZVRA 3EH1A 5LBTA 4H7HA 3WNCA 3M33A 4L4YA 2VS1A 1U7OA 1TYBE 3GTQA 1H8HD 3L4EA 1YIOA 3JYQA 4DQVA 5JMPA 3HBMA 6REQA 2UYYA 4QJBA 5HQ3A 1VQ1A 3OZGA 3WYGA 3O4IA 3PUXA 5CH5A 1BS2A 1DCPA 1SJ9A 1TVMA 2AEMA 3A05A 3NALA 3Q98A 3NX4A 4FEEA 1H66A 1ECPA 3EGEA 1M9NA 2VRBA 3QLUA 4KFTA 3KYDA 5EOVA 4C3ZA 2ZROA 2IP1A 1X19A 3T94A 2XJ4A 4ZCMA 1QR2A 1DV2A 2WVGA 2Y1LA 3QW2A 3NUGA 3KYIB 3QPBA 1Z0UA 2O7SA 4KVZA 4RX1A 2BGWA 4CT5A 4JELA 2NVYA 3CQZA 5P21A 3RVSA 1S3IA 3PYLA 1EYZA 2B8WA 2BI7A 2E6KA 4U8GA 3T15A 4AF6A 4XSXA 2C5LA 4TKVB 4E12A 4OGLA 3H3FA 4GXQA 3STHA 4RZHA 3SZLA 3U7QB 3EISA 4WPGA 3U3RA 4NAHA 1W19A 1C4KA 1OZHA 1PS8A 1IQRA 5FPTA 4AP5A 3WGIA 1P1KA 3BHNA 4AJNA 4F3CA 4DLVA 5KVAA 3HJRA 4XB2A 1PL7A 3T52A 1ECBA 2PANA 1KVRA 5IS2A 4TGLA 3DYIA 3L41A 4H1HA 4TKZA 4A9AA 4K9PA 4EI2A 5TQVA 1RI1A 2GHTA 2NTNA 3EC1A 3L8ZA 1BN6A 4MVWA 5FA8A 3OM0A 5H3CA 1WXQA 2QX9A 4PGMA 1BWQA 1I9GA 1X8LA 3C24A 5G0WA 4QFDA 1J9EA 2OCXA 4Y7CA 2C0PA 5REQA 3W7BA 4A3LK 5DBOA 2DPYA 2O0KA 2AQHA 2H4WA 3I9V6 4IJ6A 3BORA 4FSXA 2GBLA 2B2CA 2Y1KA 3C1OA 3W7AA 4J16A 4AMYA 3JZDA 1FP7A 3I6IA 2VUMK 5B4UA 5ALHA 1NI3A 4AJHA 1CP2A 3LY7A 5JQGB 1A9YA 4GRAA 2IYSA 3IHTA 3SD7A 3GLKA 4RKQA 1T3ZA 3ZNNA 5L95A 4EI7A 3DWEX 1M34B 3RAFC 4PCUA 1QV9A 2II6A 1WUKS 4JYCA 5AHKA 1OC2A 1V4NA 4BATA 4BJHB 4GOXA 1XQ1A 3HDGA 1QB7A 3WV5A 2AEFA 3UC5A 3GTMA 5ALQA 4JBWA 1E66A 4YAUA 2XRZA 5FJJA 3A3NA 3UM9A 3THYA 1J0AA 4LOIA 2HSGA 2R1TB 4BVKA 5EXDA 4U7FA 3E27A 3DP9A 4DYHA 1SHKA 2PZ8A 3ENKA 2ATIA 2EFHB 2PMKA 3N8DA 2P2SA 4GICA 2XQKA 3LV8A 4YRBA 1VP3A 3R24A 4LK2A 1CUEA 4G8BA 2EKQA 1RQPA 4N5MA 5F5NA 1ZN9A 3UH0A 5AVVA 1WW3A 1XT6A 3ZR4B 5HJ5A 2Q5CA 4EHJA 1U0SY 1JLLA 3DTTA 3ID6C 1T6NA 4UJ5A 3T9FA 3NT5A 3EWIA 4O59O 4ASUD 2O3RA 4Q47A 2BKXA 3HFSA 1Q22A 2CCJA 3DE2X 1SRRA 5JI2E 3QEAZ 2REOA 3WDSA 2WVAA 2VP0A 3Q9SA 3OLWA 3HVIA 1ZKDA 2Z8XA 2DR3A 3ND5A 1FS4A 4IZOA 2KX7A 4JJIA 2KS6A 4KH1A 3U09A 4E2XA 3G8CA 3IPJA 3IAUA 2V74B 3QK7A 4L5YA 3EVAA 3S2HC 3GZNB 2ONZA 1F17A 2G67A 2A0UA 4NENA 1ZYUA 2R9VA 3DUWA 3GJZA 2UUCB 3K9BA 2I1LA 2WNIA 5TV2A 2X22A 1SD5A 3GZJA 1SAYA 1ZM7A 4RPGA 1DC8A 3N0XA 2GS9A 3FLEA 4DLAA 3DZJA 2W6CX 4EYGA 2H1WA 5GJCA 2D1RA 2I2AA 1MX1A 4D4IA 5ED4A 2O8BB 1DQPA 1VFNA 3CGGA 3CPSA 1Z5WA 3MNFA 3LCMA 3NHYA 4L5IA 4BQSA 3RH0A 4ABTA 1SC9A 3QFHA 1SBNE 3IR6A 1TZBA 2R92K 1DO2A 4IUYA 2PX3A 4NJEB 2WZQA 5LXTB 2I65A 1U8TA 1D2MA 3AJEA 3ANNA 4JQZA 4KACA 4EEXA 4QATA 5CR9A 2IH2A 1KAOA 3EFHA 8ADHA 4PXSA 2DLCX 1VLMA 4AJJA 2ZXEA 4A3EC 1RYBA 3DMYA 1AQYA 1BWPA 3KCNA 1WSVA 3AB8A 4QPNA 4WDRA 5FYDA 1NF3A 4E31A 3NXSA 2QP3A 3PQ7A 2H17A 2O20A 2QN3A 3BRWA 4MWGA 4QASA 2CVZA 4ZYTA 5MGNA 5LZ5A 5DRTA 1K8RA 1F9EA 5FHRA 1NL3A 5AUPB 4CM9D 4GSKA 1ADGA 2FZ5A 3P0FA 3OOYA 3WIDA 3JALA 1H1DA 4I1YA 2H51A 4AXXA 4WRRA 3U7GA 1AZTA 1ZGGA 3AF4A 1E4EB 3IULA 3RFVA 2V5AA 2JHCA 3VM6A 1BD3A 4MUKA 5GJVC 4OFBA 4RA6B 3SM3A 5KU7A 1VJCA 2WV7A 3FMFA 4WT7A 5KX5B 1TM1E 4JYPA 4MYHA 5ALXA 2VQ6A 4FBMA 5IW8A 1WVMA 3TFQA 1FFXA 2WAQL 1RACA 3NBXX 3A37A 1GGHA 4HK4A 1G6HA 1SVOA 4UHCA 4XASA 3P19A 2W48A 1PAUA 1RWQA 3ETNA 1N7HA 2VJMA 4Y6OA 1GQRA 2D3WA 4ZQIA 5E3HA 1Z22A 3H99A 4OKNA 5CFOA 4YREA 2NSLA 2AOTA 3FNHA 4XWKA 5KZMB 3ZE6A 2OSVA 4DTCA 2ODPA 4IGFA 2OC4A 3U39A 1TF7A 1M1YB 1NTRA 1H1TA 3BIFA 5ENZA 1AD2A 1F06A 1YRYE 5AM1A 4AWBA 2V7VA 1ULZA 3QKIA 1MIOA 1K86A 2PL3A 4GYJA 1ISEA 4DJFC 4YRMA 4J4TA 5GV7A 4N76A 3E8SA 1UBRS 3P9XA 4IY1A 4KQ1A 5HTKA 2BGUA 3HBFA 3EE6A 3LO8A 4B3CA 1CQZA 1V1RA 5DEOA 2F8LA 4ISCA 5J2TA 4PQYA 1ZH6A 3B13B 4UATA 1UQRA 4OD0A 2CK3A 4EF6A 3OWHA 4IXNA 1RXYA 2A69A 1TT7A 5IK2A 2H7VA 3IHKA 2Q46A 1CJVC 4HFRA 4MDHA 5JNTA 2P9ZA 1DAHA 1BA3A 3SJUA 3NYRA 2OE2A 5EZ5A 3MJHA 1WNFA 1FS6A 4PLYA 2FUKA 5DYNA 2CWWA 3L1JA 3KHKA 4BLVA 3K70C 1LH0A 4BKOA 3CN9A 2ZOSA 3B78A 3ACDA 4BLUA 2NACA 1FEZA 4MGIR 3RDPA 1WPXA 3GDFA 5CLIA 5C8DA 1OILA 2JIZA 1AMUA 3FDZA 1GIAA 2Q4RA 3JVUA 4A0GA 2GKOA 3WMWA 2BMJA 5K8JB 3G2OA 2OZPA 4XSZA 421PA 1R15A 2XNCA 4RV9A 4B4WA 2XSZA 3QKTA 2OCKA 3I1FA 4FMCF 4HXYA 4MCHA 4Z3KA 4Z5XA 1VCNA 1XCLA 4Z4HA 1COWA 2PGDA 1GZVA 5AK5A 1D4AA 2VBCA 4AJPA 3ILHA 3EPRA 4GZ6A 3M1LA 2FRDA 3TINA 3DKRA 2VT3A 1I0ZA 3PPIA 4NCJA 4UCWA 2O8EA 1U2TA 3LW8A 4AKEA 4F60A 5GMOA 2C5FA 1YXMA 2ACWA 1KH3A 3M70A 1KZ6A 2VOJA 3UF0A 2QG9A 5JE8A 5T67A 2UXBB 4ND5A 2JKVA 1NXWA 4IMPA 3DAOA 4KQ9A 2W2LD 3ZCUA 4Q7KA 5TMDA 5CB8A 3PUZA 4J4HA 1MPTA 3KWJA 3Q8MA 3SJZA 4V0QA 4ND2A 1N2BA 1F0PA 2AQ8A 4PC1A 4YQFA 4U6NA 4H3KB 1CVRA 1JFLA 1LI7A 1U7WA 1O54A 2ISSD 1EPUA 1S8FA 3N86A 4XA8A 3VDQA 3V46A 1QIIA 5ALUA 2FZKA 2DFKB 1NVBA 3EIHA 4C3OB 1QP7A 2C84A 3PYMA 5TQ2B 2D62A 2O2XA 3W6UA 3OPQA 1G1AA 3BK7A 3FSEA 1ZXOA 4I7EA 4O2BF 4DA4A 1NVTA 3OJLA 2G1JA 4JVOA 3WAJA 2HHHB 2DTEA 4A3IK 4YI5A 3IBSA 3CYFA 3O7WA 1UANA 4MJLA 4EP1A 1CY6A 2O8DB 2V4ZA 4OBXA 5A4MS 4MPPA 3TAHA 4KXFB 3AEUA 1OLOA 3ENZA 4LR2A 1KYQA 4GPIB 2OXTA 1NUQA 4N18A 2C3YA 3BMQB 5GZ3A 3M6MD 5F2KA 3BJEA 4Y1EA 2JHAA 1DVRA 5GM2A 4DV5B 1Z25A 4I19A 1IPEA 4KX5A 4O3FA 4HNRA 5NULA 3DTYA 3X2SA 2JAQA 1X7WB 5FTJA 2B4TO 2WKRA 4AI6A 2XNDA 4GYWA 2PVSA 5CB0A 5FNVA 1UBHS 1Q20A 2JCGA 4H7PA 4RY0A 4OI1A 4E2YA 3KKNA 4W4TA 2OT3B 3KOZA 3OSUA 1VBKA 2BM1A 4BNVA 3I05A 4Q93A 2VTKA 3A32A 4QYIB 4OF4A 3JVIA 1XTRA 1TEZA 3I42A 1Y5MA 1NFQA 3E58A 3LQKA 3TYXA 1MGOA 1O8CA 4ZI7A 3O95A 4DIMA 2OHHA 3G0BA 3VDXA 4ZCIA 1SBQA 3B1VA 2G1KA 1JAZA 3D4OA 3L01A 4V0NA 2OFWA 4RNCA 4DRXA 1KOFA 3FDZB 2H57A 3DOIA 2PVPA 1P1CA 1KNQA 1Y6ZA 1SQGA 1M6HA 4NWIA 4WA8A 4G9GA 2J4FA 5IP5A 1I4WA 5JTUA 4I8IA 4P92A 4UNSA 3IBCA 1QGUA 4CQLB 4R31A 3ZDAA 4YJ2B 2X1HA 3G2NA 4FJ2A 3TBFA 1BOFA 3SHVA 1QU2A 2PRSA 4GGOA 3SDZA 1CKEA 4JUAA 2ZT7A 1QCCA 4QSMA 2J4CA 4DV4B 2OL4A 1KQNA 1E2MA 3M5WA 1VL8A 3A4TA 1HDGO 1YR9A 2HMSA 1J20A 2VSNA 1PFWA 3NRCA 2MJLA 4ZI7B 1PK9A 3BM5A 2G72A 4U1RA 4QQRA 4JT4A 4XIIA 2JDIA 3D8SA 3MWDA 1LEHA 2GSNA 1KEPA 3HP4A 3FYDA 4RO0A 2QRQA 4Z4GA 3L4JA 4RK4A 3I0ZA 2CVHA