1HI9A

Zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
274
structure length
274
Chain Sequence
MKLYMSVDMEGISGLPDDTFVDSGKRNYERGRLIMTEEANYCIAEAFNSGCTEVLVNDSHSKMNNLMVEKLHPEADLISGDVKPFSMVEGLDDTFRGALFLGYHARASTPGVMSHSMIFGVRHFYINDRPVGELGLNAYVAGYYDVPVLMVAGDDRAAKEAEELIPNVTTAAVKQTISRSAVKCLSPAKRGRLLTEKTAFALQNKDKVKPLTPPDRPVLSIEFANYGQAEWANLMPGTEIKTGTTTVQFQAKDMLEAYQAMLVMTELAMRTSFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (protease)
molecule keywords DIPEPTIDE TRANSPORT PROTEIN DPPA
publication title Structure of the Bacillus Subtilis D-Aminopeptidase Dppa Reveals a Novel Self-Compartmentalizing Protease
pubmed doi rcsb
source organism Bacillus subtilis
total genus 89
structure length 274
sequence length 274
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04951 Peptidase_M55 D-aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.130 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Dipeptide transport protein 1hi9A02
3.40.50.10780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dipeptide transport protein 1hi9A01
1HI9A
chains in the Genus database with same CATH superfamily
1C41A 3OPMA 4ZD6A 4G0VA 4A7PA 3EIUA 1GTVA 4R69A 4Q7LA 1A8SA 3MJEA 3EPHA 2XYHA 1ZOLA 4V1CI 5KWEA 1Z2NX 3KT8A 4U2FA 3HYCA 3S68A 4E07A 5M3MK 4GAEA 4KQHA 2RGWA 3PKIA 3SYLA 5CK4A 3DYBA 3QA3E 2BEUB 1DC7A 4B35A 2JS7A 1EU1A 3IA2A 5DW3A 3ES9A 4NBRA 4EJSC 3OEHD 1UKYA 1XSEA 1OFVA 2GARA 3TLGA 3NVAA 4WKCA 5HBGA 1ZRSA 2CLIB 2ZOSA 4KXWA 1A95A 1BRTA 1LTHR 2ZR7A 2XMZA 3FB4A 1RM0A 2ZRMA 3N7AA 3TQFA 1FDWA 1VRWA 1S1CA 3CM0A 3CQ9A 4FR2A 1DT5A 4HP8A 1R50A 4C0LA 3TD6A 1E9EA 1ZGAA 1IVNA 4PX2A 4KR3A 2ST1A 2C0QA 4G81A 1WB6A 1SXJD 3EXIA 4GX1A 5GPBA 5ENZA 4JITA 1XEXA 5E3IA 2Q5QA 4JIGA 1JXOA 3M6FA 4L8GA 3SICE 3IKJA 2X2FA 3SGLA 2A69A 2I6SA 3LW7A 1KDYA 4I4TA 3HZHA 3NAMA 5IAOA 1Z4NA 3FHLA 3OQ1A 1BGWA 3FHJA 1IUOA 4LXYA 4YRJA 2H1SA 1TWFC 3FFBA 4FFBB 3L4BC 4MRMA 1Z47A 1KL7A 1VB5A 2R4TA 3MMXA 3WYCA 1E4EA 5K8CA 3HK2A 5AW2A 1I6WA 1XYGA 3EEFA 4Y2TA 1LSJA 2CT8A 3LT4A 1PD0A 2DR3A 1J2EA 1ND5A 3UMCA 1Z25A 2J4CA 3GCXA 4PABA 4QREA 1ZI6A 4JR2A 4CG1A 4CTKA 3GLIB 4FT2A 2XQVA 3I4CA 3U3DA 1AKNA 1E2MA 3WYEA 5I7EA 3I2GA 4GMXA 3LVRE 2EFDB 4WY2A 1ETUA 1WXGA 5K4HA 3DFKA 2GAFA 2VYND 5TMEA 1ZUD1 1QV9A 3AR7A 1J22A 1C3OA 3L93A 5DXFA 2JBWA 4RQUA 1WV0A 3TXYA 2JASA 3KXPA 2W2MA 3V4FA 5JY1A 1NXQA 1T2EA 5IP9C 3TKYA 3W4IA 1NMXA 1BKYA 2C7GA 2HKIA 3S15C 3BMOB 4PO8A 5CT6A 5BNFA 4EA8A 1Q0SA 1ZNWA 5AXBA 4EKGA 2TMKA 4J0CA 2QEQA 2ASVA 2UZIR 2GPBA 2J31A 2OR3A 3DDUA 2HIAA 2OESA 1KSHA 4O1IA 4P58A 4P93A 3SSNA 1TQ8A 1SPXA 3HXTA 4BL5A 1YNNA 1ZG3A 2IHYA 3GDHA 1TZCA 2OZEA 3GGCA 1M67A 4S2UA 2PV0A 4YDRA 4X20B 4PSVA 1BNCA 4MVJG 4TUYB 2VHQA 2XB6A 1UFKA 3ITEA 3MJCA 3GJSA 4MUAA 1N9KA 2VA9A 4QJIA 3VDXA 2Q29A 4CMEA 2WSSA 3IP8A 4OUKX 1GGMA 4I50A 9GPBA 3T4EA 4D46A 4JZKA 5KWVA 2QDXA 4OVKA 3I8SA 1SCDA 2QPTA 1TYZA 4CDMA 5JR3A 1YJBA 3ZX5A 3B2EA 3H1BA 1ABEA 3GCGA 3N0RA 2DHRA 3MT8A 4I8IA 1U90A 3KTFA 3BXFA 4MWZA 5AHOA 2B25A 4EYSA 1ZN9A 3C3EA 4OCZA 2QG9A 2R65A 4LWPA 2GA9A 3RUPA 4JLBA 4CQJA 4D9GA 3ZCQA 3RT9A 4XUDA 4X8OA 2DFLA 1KO4A 1WPQA 1NUAA 2B21A 2Z5GA 3F67A 1JIXA 4OBWA 2A3RA 5AI9A 3TSCA 3UK7A 3FSEA 3I4LA 3ZWNA 1PFKA 4HB4A 1MX9A 4RTPA 3ZY2A 4D3DA 4WL0A 4L1KA 2G0NA 4F38A 1VPTA 1YA4A 3MAAC 4Y0NA 5FOWA 1PHRA 3HOVC 2FX5A 1EINA 1OXTA 3ML1A 4DDVA 1ODLA 2R47A 3RVJA 2KI5A 3MBKA 4C0SA 2OHIA 3TNDA 2Z6QA 1YB2A 3FVVA 3Q7TA 2OG2A 4GL2A 3LG2A 1GPWB 3T5CA 3P9PA 1TDJA 4JP3A 1KHTA 2WTEA 1ORDA 4R8RA 2OMKA 4WKOA 5J3JA 4XCHA 2I3GA 3C8DA 3RC2A 1E59A 3WYFA 4TTVA 3LPAA 2F00A 4NZNA 1TUGA 3FPKA 3VNRA 2G4VA 3D3EA 5B2EA 1M0SA 1W8IA 2C31A 4R5MA 5JCOA 5HJEA 2ID8A 4KBFA 4J0EA 4EJ2A 1J09A 1WDKA 2G08A 3AG6A 1XJWA 3AZOA 1FQJA 4HH0A 4M8LA 2ORWA 2FF7A 4K40A 2OK7A 1MH1A 3EGXB 2AIRA 3IP3A 3ST7A 2WKQA 5F64A 2XADA 2IOQA 4YUXA 2PH3A 3AU8A 2I2WA 4PXSA 5TGDA 2FW6A 3UHFA 1OU4A 2XYVA 4REQB 3Q11A 4KC6A 4GI5A 4X63A 4PBRA 3ABZA 3LO5A 3AWDA 4UZSA 3TLAA 1WQ4A 5GONF 3TQCA 4DLKA 5JNLA 2EFJA 4ZYXA 5KSYA 1NR1A 1OFIA 5K8UA 2ZXEA 4YCJA 3EVGA 3M83A 4V39A 4G4SO 2PMZD 3NVDA 4E4YA 5BRNA 2JL1A 1RE0A 4NABA 3E9EA 2O8VA 3KZCA 1CQPA 1FRNA 1BU5A 5A0FA 1WMEA 2FGJA 1Q77A 3KPYA 4BUZA 3MTBA 4TXJA 4CM5A 4PX5A 5E9QA 5H4HA 2CCKA 3FPEA 4QDXA 3SC4A 4K0KB 4OGGA 2Q6KA 4CGYA 4G5SA 3DDZX 3G1TA 1VSBA 3S6JA 2J0UA 2YIJA 4HFMA 5CK5A 3EUEA 1MABB 1ESCA 1TYCA 2H9YA 5BW6B 4OQFA 1KFBB 1XEWY 1NMYA 3AKCA 2A5LA 4DCUA 1FCJA 3X44A 3RLFA 4D8VA 1Q0ZA 3ZGZA 4A8HA 4X6AK 3OOEA 1IH8A 1H3FA 5IYZB 1WOYA 1EVKA 1RBMA 3KQSA 3OPYI 4N47A 1J7KA 1R0WA 3DMTC 3IAEA 5BQXA 2GYYA 1E9DA 3U0VA 1Y8QA 4BNKA 1JIJA 1ISPA 1Y1LA 1AN0A 1MC4A 2ODTX 4MVYA 3FGZA 2IYXA 5CUQA 1WEHA 1NP3A 3FOBA 3GZNB 3SC2B 3ZE7A 4BKPA 5JJBA 3DV2A 1HE8B 1YDMA 4AYXA 2RHRA 1GA4A 4WCVA 3FZNA 1Z6TA 1VBMA 4TYQA 3LE8A 4AY4A 5LU8A 3GELA 1GAJA 1ORRA 3D1LA 2BP7B 5DX0A 1EFUA 4ARUA 1LGYA 1IXKA 5BV7A 5JXJA 2O8BA 1WOOA 4Y2QA 4YONB 5CEJA 3K0FB 1G7CA 4MROA 3SVZA 1NJSA 4K05A 3CX7A 1MV8A 3D3NA 2A5FA 2WIAA 5IJWA 4BU1A 4AF8A 4C0KA 4ZVKA 2QL6A 4G1BA 1DJLA 4HOYA 5A6VA 1V26A 2PCJA 3GCZA 3IE2A 5B6PA 3EGEA 5JAQA 4G6ZA 2GEFA 3AV0B 3UUWA 3ZHZA 4F5ZA 5H82A 5EY5B 521PA 3L40A 2XMQA 3Q9NA 4A0RA 3DCIA 3U6BA 5MN5A 1SVSA 3EFBA 1WKCA 3H2KA 4RADA 4B3JA 5GIOE 2HQSA 4EKYA 2OFOA 2FJPA 4FP9A 1PWEA 1DIGA 4DM7A 1C4XA 4R8SA 1M7BA 1J1IA 2VH5R 3RAPR 1E64A 3VUFA 3JARA 5D00A 2NV0A 1IN1A 3KOYA 4JT9A 2XY4A 2JW5A 3KL2A 1LX7A 1XA0A 3EDMA 3FPGA 4OB7A 2I67A 3SBDA 4A3FK 1CQWA 4JJ6A 1C2TA 3AOEA 5KYXA 2FPIA 3B8EA 4K28A 3QJ5A 5EXEA 4RSRA 2VNAA 3L06A 4LVOA 3WIOA 4IRXA 3AKEA 2P2DA 3KQVA 3LM8A 3MQ4A 2IPXA 5BOVA 1O8CA 3HB0A 4WA7A 3IBGA 3RKUA 4MS4B 2ZT8A 3QLUA 2JJYA 3P9QA 3C5HA 3NDPA 4KACA 2WP0A 1VBKA 4G0OA 1FU7A 4M1MA 3QX9A 4ISBA 2A0KA 2VR1A 3M3HA 4K9RA 3WA6A 2HWYA 3R0VA 2AFIE 4UVDA 2ZU0C 1CVRA 3K70C 4WN9B 5J2TB 2PQ6A 2HRZA 3N2NA 4Q15A 2V6JA 3K5PA 2GF9A 5L3QA 4D8UA 4ESOA 2M2IA 2QN6A 4CFYA 5EJAA 1PV2A 3Q0TA 1MO3A 1Y5IA 4UFOA 3M6VA 3COYA 4L3OA 2PZMA 4QNNA 3D2LA 1ZRMA 2PRZA 3C3XA 4FGKA 4U2BA 3N0WA 4CQMB 1PG0A 3VX4A 1GL9B 1RXWA 2R7ZA 5C1IA 1K4MA 1DHRA 3WLRA 3KOMA 2BMFA 2XAAA 3QV1A 3QVUA 4L74A 4L8WB 1MQAA 2HXYA 3EAQA 1N2CB 1NN0A 3LLCA 5TQ0B 2CSUA 1QORA 4LJ7A 1H5QA 4N12A 3EXAA 4L22A 4GBED 3ZZ1A 5JUWA 3DDNA 1OASA 3MQFA 4JT2A 2IZ7A 1AA9A 4NYMR 5G0TA 4DVJA 3BE8A 5KC9A 2O23A 2ZXUA 1Z4JA 3MQ2A 3O2QB 4RXTA 1S3SA 2J08A 4CBVA 1B26A 1UDAA 1ZQ9A 1I7SB 5IVHA 4GX5A 4FOSA 3JQGA 2ZIXA 4AJ1A 2IUEA 4CFSA 5SZKB 1Z74A 3O03A 2JGLA 4DZRA 1X0XA 4JD5A 5EP1A 4BNNA 4RTOA 3DTYA 3IQWA 3TTYA 3C6MA 3LFTA 1K27A 4OP1A 1U7TA 3HKDB 4MUBA 4RPLA 3K9WA 7AT1A 3I1FA 3QVTA 2F8SA 1W4BA 3PTZA 5HUHA 1KI6A 1H3NA 1EYZA 2AB0A 3BE4A 3FCEA 3EY9A 4IW3B 4PGMA 3GEPA 4WZBE 1Q7TA 2E85A 3J7TA 2IYFA 3TMAA 2Y66A 2JFOA 1CU1A 2XI4A 3HUTA 4N3BA 4GR4A 2FMTA 5CVEA 2NVQK 4ZKEA 4MP3A 1DFIA 1ORWA 4DHWA 2YVAA 1JJIA 3QYJA 4X85A 1ZK0A 2H92A 2ZT7A 3HBFA 2O2HA 1R8XA 1WF6A 1RKQA 1T9GS 2GN9A 2YXNA 3CLRC 4FWBA 5AI4A 2JI4A 4J2TA 3CPEA 3GGGA 3HXOA 2PXXA 3H5RA 1Z26A 5LXTF 1HFKA 3HKCB 5KVAA 2HPAA 2BBWA 3BL6A 4HQ6A 4O2RA 3C97A 3GL9A 3CNQS 3DZCA 4K6MA 2O4UX 3UCFA 5BUCA 4BO5A 3ZU2A 1OTHA 4XSZA 1EE9A 3OP1A 2DPXA 2I7TA 4UEKA 4XRRA 1SCIA 3G8YA 2ZIUB 4KN6A 4A8JA 2QGZA 2UXCB 1R15A 5ADVA 2CFOA 3NYIA 2YVUA 3H04A 4H4EA 1AVTA 3CGWA 3EIFA 1DBIA 4L85A 1UDBA 2WHEA 3TLZA 3NHKA 3IFSA 4GX2A 1SXIA 3H9GA 3I2KA 1SG9A 3KQOA 3IOBA 3JVEA 2WTMA 1Y34E 4BVAA 3DVLA 9ATCA 1VGXA 1BXGB 5F77A 1Q44A 4X3OA 1Z2OX 3PXDA 4XASA 3R24A 3AH8A 2BDUA 3CB2A 3FKQA 5AH0A 2Z8YA 4JP8A 1LVGA 2PTHA 4H7IA 1EBFA 2O2DA 2NWQA 3INTA 4YLGA 1UK9A 4G86A 1LLFA 2HADA 1VSTA 2ZFUA 3MOSA 1FRZA 3D6NB 1WU8A 3L02A 3NT5A 1AT1A 1M6HA 5FWXA 3FTFA 1GAQA 4IYJA 2RHDA 1AF7A 4P4TA 1E6UA 2C2XA 4OKNA 3HUDA 5GV7A 1KEEB 2FP4A 4AVYA 2E2IA 1ORIA 5K0FA 2DBRA 2FR8A 4M7OA 3KAPA 1HKUA 1IWBB 3U1VA 1OXMA 4EF4A 5E2IA 4F04A 1G8SA 4R9UC 4XQ9A 4NF2A 4C03A 1QF6A 4DQ0A 1U0BB 1QU3A 4MGYR 1GKKA 4LS3A 3EXFB 1ADYA 1OWPA 2AZTA 2CNWD 2O48X 3BA1A 1P77A 3G6KA 3LYUA 1MO5A 4E3WA 4RF5A 1CJSA 1K7FB 2ISCA 5A3SA 2J48A 3V2HA 4UQLA 5JJIA 1JE1A 3A2LA 3GBVA 1A9XB 4L0MA 2CYCA 3H1TA 4R9NA 3E48A 3IH5A 5KC8A 4PLWA 4LI0A 3S1SA 1RP1A 2X8JA 4EHHA 4LSWA 3A2KA 3DC2A 3GVCA 4J6EA 4B3CA 5HRAA 3PDCA 5PNTA 4H2DA 2ABWA 1BCSB 1JEQA 3LQ4A 4KWTA 4P86A 1CUFA 3AP2A 1DCTA 4IY1A 3AFOA 1HPLA 2IPOA 5M5YK 3H86A 3ID6C 1XCBA 3KM0A 2VTVA 4HF7A 3N87A 4I55B 1PV4A 2CNBA 5KTSA 2HBZA 1N2BA 2YJNA 4K9KA 4KYUA 4TXNA 5AVOA 2JKVA 1N34B 4AJ4A 2C96A 4LJSA 4W1PA 3GTGK 5EIBD 1UBGA 1XRLA 2Z2IA 3AEUA 3QA9A 1U2ZA 3TNJA 4IIJA 2I7XA 1FDSA 3GTJA 2BMVA 1QE3A 2NZXA 2RIRA 2AKAB 2VL7A 3EA4A 4UVHA 4YFVA 4BFTA 4BO9A 4A27A 4HVTA 3ZWAA 4D9HA 1VLVA 3IB6A 4PZLA 1D0SA 1V1JA 2DSNA 3TI9A 4JB8A 5FUVA 5JZ9A 1XKQA 3MAJA 4BQSA 1XWFA 5KTKA 2HUNA 2F8LA 2ZDGA 1DO0A 4J1NA 4URYR 5IG2A 2QSYA 1DC4A 3TRIA 4UFNA 3A1UA 3MTQA 4ZREA 2VPQA 1PR0A 3PPYA 1I13A 4G9EA 4ZGWA 1T4MA 3L0SA 4EJMA 4CT4B 2YCLA 3H99A 4MVJP 3M8KA 3SR0A 2QUZA 3K3PA 4LHEA 1SVKA 2JJ2D 2PLRA 2RCNA 1W0JD 2ZI3A 4EKIA 4EL0A 1EZZA 1FFBA 3QVVA 3Q2IA 4BLQA 1RQGA 3KKLA 2LD4A 1Z2DA 1CUJA 3R3JA 4TYYA 2RHCA 3BCUA 3V1LA 2IH2A 3PL5A 2IYPA 2QR3A 2VHJA 4ZTZB 2FQOA 1H2EA 1PFVA 1U9IA 1YVDA 4XARA 2P67A 2A4MA 4HDMB 1HTWA 1WVIA 2WJHA 3HJHA 4B4WA 5ADWA 1JFTA 1P9NA 4WDRA 3TQRA 4KO4S 2WM8A 4EECA 2EEZA 5JC1A 5HSGA 2X0IA 4UJ3A 4QOSA 4GLFA 3G2HA 4HTFA 4F5DA 1OCEA 1Q7CA 1DIBA 2C2WA 2YFYA 3D5EA 1WDMA 3F5FA 2Z1NA 5KVCA 2WZBA 4PW0A 2AEJA 2PX3A 4AQYB 4M38A 3SLGA 3N70A 2YINC 5B4TA 3D9QX 1IZYA 2QK4A 3CNNA 4OIMA 1FSZA 2NYUA 3O4GA 2A5DA 2BUBA 3TIXB 5ECWA 2W48A 4ZV9A 3RYIB 2ZRLA 2Y9PB 4K1LA 1ACJA 3AQ4A 1WSRA 1WMSA 2GEDA 3K2EA 4M55A 3EEIA 3ORFA 4HXEB 1OILA 1ZY2A 10MHA 1E5LA 1XTZA 3TIIA 3QVKA 3TSWA 2NO9A 4PZ0A 1XRJA 3D8BA 4WZZA 1BJKA 1DQSA 1ZA1A 2ZUDA 3MYRA 3TEJA 4U5XA 1PQYA 4RM2A 2H9AA 3T3DA 1Q0TA 4I1RA 4E5YA 2C2ZA 5ESRA 2UYHA 3KG2A 3O74A 3EC7A 1EVEA 3FDZA 1J23A 5K5EA 3EA0A 4B76A 5EHGA 4QOHA 3TTTA 4UCXA 1P8AA 4O4LA 5ERYA 1Z35A 2RBGA 4UE3S 2A9KA 4JI4B 3Q1LA 4KPFC 5TR9A 3RJTA 4KOAA 5LR6A 3HEMA 4AI6A 1IVYA 1W88A 2OLEA 4ZVQA 2FUEA 3S1RK 3VUEA 3ZE8A 1G1MA 1TAHA 2PBFA 4FGUA 1XD9A 3BGVA 3BD6A 2BFEB 4OUDB 4J0IA 5FTWA 5JNUA 1IOWA 1JNXX 2JFUA 2PTGA 2XCSB 1T5HX 2WB1D 1WDWB 1PJ2A 1BMQA 4CL8A 4QQKA 3ZGOA 1MZPA 5M3BA 1QF9A 3KALA 1VBFA 3T3OA 1Q57A 3REFA 1SULA 1R4MB 1A04A 1X77A 3A1NA 4UD2A 5A3VA 1U0GA 2AYYA 1CF9A 5DXAA 3SX4A 3V8EA 4C14A 4R0MA 1QF7A 2Q0SA 3ELUA 1RADA 1V96A 2H29A 3G85A 1M0WA 1MG0A 4TQAA 1Y8RA 1WTCA 1EBUA 3H2YA 1A4RA 4MQLA 3ZW8A 4CJXA 4EG6A 2OM6A 2HHCA 1ML3A 3A1EA 4O2LA 1N6HA 3ELBA 3DZIA 4FCCA 2PU7A 4K81B 1KPIA 1S2MA 4FZJA 3S0JA 1VI5A 1GGHA 3F6CA 1FMJA 2JVJA 3EF1A 5F4BA 4BMVA 1XHEA 3TZQA 1C8VB 1IY0A 3FCUB 3NDIA 4TTJA 1A3CA 6CHYA 2CYBA 4NFSA 1D4FA 3KJIA 1FU8A 2MCFA 4H7PA 2XNDA 4MUNA 4YP6A 4X93A 5CDHA 3QF4B 5FI1B 1W5AA 1AQIA 3GVIA 3OEED 4GEGA 3KQHA 2H1HA 3MEQA 2FSVA 1U7XA 1QYCA 1K5DA 2HK8A 3EDCA 4OU5A 5EPUA 1A82A 1Y9EA 2G1UA 2ZBVA 4YUYA 1RCUA 2F4NA 9MHTA 2BKUA 4TKZA 5YASA 2G70A 1O9GA 2X22A 5E95A 1MAWA 4HC4A 5LZ8A 1SXPA 2C3MA 2DKNA 4PX9A 3JR3A 5GVSA 4JYZA 1E0DA 5EMNA 1KJ8A 2EJWA 2IIQA 2PXCA 3OCUA 4HWTA 2XGOA 2Q7DA 2QZ9A 2P79A 4MV1A 4LXIA 3R7AA 1G0NA 4LV6A 2DF8A 5BWBA 1NBWB 1VKZA 5IAAA 3ZJ4A 1DQPA 2IYQA 4HNHA 3JYPA 3PYMA 4BLPA 5J23A 3ZHCA 1NQWA 4G5GA 1OBFO 1OXUA 3LH5A 4YQYA 4ZYYA 2D4HA 2DJIA 4FYJA 3T3IA 3GOHA 3G9QA 1XC7A 3BCSA 3KYJB 4LX8A 2G8NA 5HZMA 2YVQA 1BA3A 4OHYA 5AVQA 2NAFA 4ZN6A 2Y76A 4OHRA 1S8NA 2VXCA 3HOUC 2CE7A 3K31A 1RYMA 1VJCA 1RP7A 2WSBA 3RQSA 4EZIA 3CE6A 1GSOA 1N8NA 1ULZA 3MTIA 4OQLA 2HF8A 3KWJA 1MAAA 2NZUG 4LGMA 1RPZA 2OXTA 1V7CA 3PSAA 4ZAZA 3NG1A 2X40A 2GNPA 4K86A 3BP3A 1I1HA 2DRIA 3LW8A 4W1SA 4JR1A 2NXEA 3EGIA 4TL9A 3QKTA 3VGJA 4X1IB 1N5RA 3C3KA 1EHCA 4G23A 3ROPA 4U5QA 4D8TA 4NWIA 4UKDA 5SZHB 1RZRA 2H3HA 1RC8A 1JPVA 2EGGA 2WM2A 3BZBA 4UMVA 3DDSA 4OB8A 4WH0A 2IY7A 3TTXA 4E22A 4ZICA 2ZWOA 1JHXA 2W8BA 5IYCK 3IIJA 3R0XA 4JWTA 3W9BA 3QVWA 5DT9A 1JKIA 1M3SA 4IM7A 4PPFA 4TLDA 2DHQA 3CZ5A 2BEVA 1EP3B 3G2MA 4UCFA 4DXAA 3KKEA 2EL7A 3TMYA 5CNJA 3H5NA 3AB7A 1JA1A 1X8KA 1Y4UA 3DFMA 1EQUA 1TQHA 2EJVA 2GK4A 3DL4A 2XNJA 2PKQP 3EHDA 3NAGA 3BZUA 3VKVA 1O5TA 3SHTA 1L5HA 3WWYA 1JIIA 1RQRA 2P75A 3W5CA 1DWUA 3L8FA 1N8SA 5DLDA 1E2LA 2QN2A 4DWOA 3HDHA 1G8FA 1KOFA 3D81A 5GV8A 3M33A 4ZDWA 3M1YA 1LXCA 1O4VA 2DKOA 2HPVA 4RENA 4YJKA 4E7OA 3W05A 4EUSA 3U5TA 4QKQA 2IEZA 5ULLA 2CFSA 3HU3A 2CW0A 4BEBA 5JRDS 2Y1LA 3H9UA 3A10A 3V8PA 1KFJB 4B7UA 1YL5A 3S99A 1T10A 1EFLA 2X7HA 4GLLA 3ITKA 2D6FA 4DQLA 4KXYA 2UZ1B 1RI4A 1UIMA 4G65A 2QN3A 3O31A 2EARA 2OCGA 1OFUX 2ZUCA 2QAGB 1YBAA 2Z2KA 3ZWDA 5JCOC 5K2OA 3S17C 1S7GA 2BKAA 3RWMB 4HYYA 3O7WA 3Q8KA 3PNKA 1NM5A 4DZZA 5JWRA 4IRMA 3BERA 2VAWA 5E4TA 3E7XA 4QGBA 3ZK8A 1V4NA 2E4UA 2EDAA 2GKSA 2ZTUA 3DB2A 3HKBA 4P31A 4UU0A 3V1UA 1G4HA 1YQDA 1PGJA 3TAXA 3F3KA 3I0ZA 3LHDA 4HCJA 1E2HA 3O21A 4X91A 4KDDA 4OXNA 1EVZA 2HJSA 2I9PA 5FJJA 2OY0A 4E6EA 2A88A 3F3SA 3OZ7A 3QWAA 2EOAA 3ZZMA 2FPMA 1UBEA 4JVSB 2A1TR 5JEEA 4QM6A 1CQIA 4BYGA 4J4BA 1PNOA 1IB0A 2QMEA 4F72A 3AVXA 3QW4B 2PBRA 2R6JA 4PCVA 3ZHYA 1TZKA 2BFBB 2QRUA 2HH9A 3V32A 4H4CA 1IM8A 1RKUA 4DV6B 2W83A 3TN7A 1O2BA 3TIGA 2ZW9A 3FOFA 4HO1X 2NPFA 4EMBA 3V6MA 1TXGA 3R9XA 4LX0A 1RW4A 2QX4A 1NJ1A 3C7TA 4HNQA 5CM2Z 4AY5A 4RTQA 3FGNA 4WNYA 4OHUA 1PWZA 4ZOLA 3GLHA 5HYVA 1XTPA 1C7EA 3A37A 1XRNA 4EI2A 1PKXA 3FPBA 4K6HA 3ZD9A 4BYMA 5LKRA 3EBOA 1EH1A 4FPXA 3WY9A 2ATVA 2O3JA 2TECE 1JQ3A 3C5CA 1PJ3A 1R6TA 3O4HA 1QCYA 4MS3A 5TPWB 3SCZA 4B7XA 2XD4A 3CN7A 4LQ4A 4AL4A 5C1BA 5JBIA 4A36A 4CM8B 1K4KA 4YJDA 1JDVA 2RCYA 1E69A 2GAOA 2H0AA 2HWKA 3M7IA 3VBCA 4BUJA 3G0HA 2P9CA 2ZITA 1QO0D 3GF4A 2E87A 5B5SA 5E6UA 2AOUB 4DUGD 3Q6IA 4NCIA 3B1YA 4KSYA 5C3EC 3ESBA 1OLSB 4MLDA 3DAPA 2P9QA 1KMQA 1YZ3A 3WLNA 3L7AA 2W2VA 4XVRA 2NYAA 3A9WA 1OGJA 4WNIA 1OXSC 3I12A 1MZVA 3M4JA 3G8BA 1EGMB 1XVLA 3CYFA 1NYTA 1I3NA 4KPUA 2EP7A 1WZUA 2I8AA 2OGWA 5M5XK 4FS8A 3TQOA 4LOJA 5DEOA 1G3UA 2OCDA 2R6AA 1QHXA 5CP8A 3ENVA 3KYBA 2HAEA 4ILKA 3H1PA 3U62A 2ECKA 2C7BA 2QENA 4I2NA 4XWKA 1CR4A 2PRSA 3GZ4A 4HPJB 5KDLA 4H7FA 4EFDA 1SIOA 3GARA 4M8SA 4B3DA 3Q3JB 4U7HA 3RJ9A 1UZNA 1EFRA 2ZK7A 1SA0B 1GZ6A 3FYUA 2R8PA 2X0FA 2ZE5A 5G0UA 1TO2E 2GN6A 2PUWA 3ZNOA 4AYBL 5D5HA 3FKIA 3H97A 1ZD2P 5NULA 4C4AA 1IAVA 4TLMB 4EUEA 2Y99A 1GN8A 1YCFA 1YOBA 1GLNA 1Y37A 4KO3S 3TR6A 2JFNA 3QE4A 3PQDA 1I6HC 2F62A 1J90A 3RZDC 1GFSA 2Y93A 2DFPA 2JK1A 3AOEC 3G7NA 5JPIA 4BX0A 3ZJUA 2RHGB 1FFCA 4ZO8A 3GEDA 4G8JA 3VAYA 3JQCA 2UYYA 4PC7A 2B8JA 5LYJF 4L08A 2C5GA 4MICA 2JGMA 1POXA 4DMFA 1R8JA 2IE0A 1SN7A 1WVMA 4H59A 4QUDA 1P6XA 4Z7QB 1D6SA 3QOWA 3U81A 4H27A 4POOA 3FBWA 2ODBA 5JAUA 1KWKA 1Y33E 2PAFA 1R0RE 1U9JA 4QOJA 1NATA 1R5BA 1N6IA 3ASZA 5EGSA 1K9SA 1M73E 1JH8A 4DADA 3H2HA 3WAJA 3S16K 2QTZA 2X5XA 1IE3A 2BFCA 2XVAA 1KH3A 4JJGA 4KYVA 1QQ6A 3V1KA 4CU5A 2YMPA 1M2VA 3A6DA 3D64A 3R3ZA 4JS0A 4M83A 2A5JA 4NV1A 8OHMA 4M8IA 3GC6A 5I7OA 2BYTA 3G49A 4P98A 1FLDA 3PHHA 3QE2A 3W06A 5B7NA 1UMBA 5L4LA 4RXMA 4JA2A 1JQKA 4JMLA 2BIFA 3CF2A 5GAJA 2DJ5A 3L46A 2Y3IA 1BE6A 3AK4A 2AL7A 2GOYA 1ICIA 2GK7A 1KZHA 1ZM7A 4OXQA 4JJZA 2PGXA 8ABPA 3ELYA 4BGDA 3CLUC 3DUFB 4MRPA 1GZSA 1E60A 1YQXA 3GJ3A 1NT4A 3BM5A 4IIBA 4BFSA 5K6AA 5L8VA 1HDGO 5ALSA 3AOGA 4TV9B 3KFLA 1V71A 3O4RA 4E31A 5LCXA 3AR5A 1Q92A 3K9GA 1NBME 1S01A 3WSVA 3ZOZA 4EA7A 1A5TA 4EW3A 5LA6A 1EG2A 2RAUA 1FYXA 5F5XA 4B84A 1Q1AA 5KEIA 3B7GA 4RGYA 3ZQJA 4MDHA 4X92A 4D56A 1GLVA 3RODA 1IL2A 1HT0A 2EWWA 3NATA 5DSTA 1AKUA 4KK3A 4JI1B 5CA1A 2IBMA 3U60B 4X8LA 4CCYB 3CX4A 3DKPA 1C7QA 4QRIA 5DM4A 7YASA 1EUQA 3KPVA 1DUSA 1GCIA 1WXDA 2PD6A 2V8BA 3VRHA 4OGWA 1P7PA 2H5IA 3PXGA 2BE7A 3GEEA 4H7DA 1Q12A 1MC1A 1Y5NA 4MPTA 2V9PA 4LRWA 4MDFA 2G9UA 1ZCAA 3C5WP 3WISA 3ZEIA 1XNQB 2QDKA 2J3HA 2P2SA 3NGMA 4IXWA 2V6TA 2OP0A 4D8XA 4OL0A 5FUQA 5EWLA 5EIXA 2BC9A 1VL2A 4PLYA 4C7VA 4MKGA 3L6UA 5BV1A 4H4DA 5J4HA 5JQGF 4C30A 5F73A 1JR3A 4AJ2A 3R0IA 2X4LA 1X39A 5HDQA 2PPLA 1UDRA 3GLFA 1RPNA 3CRNA 2HRBA 4WILA 2GHIA 2QL5A 3IKLA 1KMHA 2A33A 4H6WA 5HILA 2HHHB 4MW0A 1JFVA 3R5JA 3R6GA 1ZCBA 1I50K 3BF7A 5KNCH 1Y1WK 3RTDA 3L49A 1ZL2A 2P7IA 1F4VA 3W0LB 4NCAA 1HTBA 3DT9A 4C0WA 1QJCA 3GPBA 1QIHA 1D2HA 3N58A 2ZJ0A 1KXZA 1XTBA 1YOVA 3K8ZA 4MDEA 2V0NA 1M76A 4G5YA 1LDGA 5EIFA 1CXZA 3NDJA 5E8JA 3TRHA 3QHQA 2D2VA 3IYLW 4RDHA 4D8WA 4CLOA 5JT1A 4UBLA 1JEYA 4O3MA 4GDMA 1E8NA 1KNQA 1XN4A 1FFYA 2P62A 2MTBA 2FPXA 1L5WA 2R1ZA 3W34A 4WX2B 4K6OA 3QE0A 2GPYA 4Q66C 5AKKA 4ZHQA 3AVUA 1FNMA 4EYGA 2IUSA 3LLSA 2XKJE 1CKEA 1UWLA 3AY3A 2RSLA 3ZV4A 2VXYA 1C3JA 3K8YA 1YRHA 4YJ2F 2GD0A 2BGJA 4DC0A 4UNSA 2OO3A 2RI1A 4DDWA 3AILA 4WBNB 1TLFA 4G56A 3SZMA 1T0BA 2WD7A 1R66A 4HGQA 5DGXA 3WXMA 2VOJA 1XA4A 1RU3A 4N0DA 4Z4FA 4YAEA 1H85A 1KBQA 1I33A 1XLVA 1XZQB 2WHXA 3LCMA 4I8XA 4O08A 1ZU5A 2DE0X 3E2IA 1PUJA 3K70D 1S96A 2FCRA 4NCXA 1PR6A 3FG9A 3IV6A 3KEMA 2E2IC 1IB6A 4I3GA 4O33A 1CUGA 2FR8C 3ROXA 4HT3B 1QMGA 1YR3A 2EJCA 3KYCA 2B4RO 4BGEA 3KUKA 1U5AA 1DAKA 4IWXA 4TTRA 1BDHA 3GO4A 4O5AA 1B42A 3RS0A 3FVTA 2FWRA 2YYAA 3GHYA 3H9QA 1Z82A 2FPLA 2EJTA 3KRTA 1ZD5A 4I5DA 4J49A 4RZIA 4EMUA 4ZQEA 1R8YA 1UZAA 4IKEA 2VAVA 2W2QA 3ZQUA 2QQ5A 2IUFA 1GNVA 2FZEA 1ZSVA 3AVTA 1QYIA 3E3MA 1JLLB 4RGQA 4Q9JA 5FAXA 4KSBA 3X1MA 3W6NA 3CKMA 5JHGB 4CHGA 4CGZA 3FNIA 4MUHA 5FKJA 1TWAA 4WKPA 3OU6A 4CNQA 1JFFA 2IXEA 3H2GA 1E5TA 1MXHA 3EAGA 3G0IA 4Q9IA 1E92A 1JEJA 3CZPA 4RL4A 3INGA 4BZPA 4MVJD 3WNZA 5FDFA 4IIUA 3E8XA 2YWCA 3K2IA 3TLEA 3RBXA 2UYCA 1EK6A 1ML4A 2IZ6A 4QECA 3QOXA 4ZDJA 1Z4OA 2QT1A 3BB4A 5EKDA 1WXQA 3CGGA 2HA6A 4QQRA 3QIAA 3K15A 1E9BA 1W59A 5IMBA 3VR3A 5H70A 5EZQA 2X0NA 4LOLA 1EQ2A 3PHGA 3JASA 5ESWA 3QE3A 2YUTA 4XVHA 4ZRNA 3UATA 4PG8A 3AFIA 3PK0A 4ZQHA 3ZI7A 3W5UA 4HDRA 1QFXA 3AYZB 4Q3EA 5BPFA 1QU2A 3K0CC 4PSAA 2LWIA 3HR7A 4NCHA 5CM8B 2EF0A 1PT6A 3ABIA 4Q48A 4BMZA 1TMGE 1Z28A 2I65A 1J0DA 5DHFA 5BSMA 4EW2A 1JTEA 4JX9A 4BLOA 2I91A 2M32A 1KKMA 2QRZA 4FN5A 1RXCA 3JQPA 1QE5A 4I9HA 4IEIA 3UV7A 1WNTA 4IVRA 4PWZA 1OH8A 3CLRD 3QKSB 4ESEA 4IGEA 3Q5EA 1TUBA 3MF4A 2NO7A 3M6AA 2CFCA 4XTRA 2EXXA 1Y1KE 2XUHA 5DZSA 3NWJA 3VZCA 4N5DA 4EF5A 1OFUA 1SXGA 3RI3A 1EJ2A 1M8JA 4NJEA 4PIMA 4YP5A 5JSFA 5LQCA 1PEKE 5FWNA 2DU8A 3WV4A 3LZ6A 4TN5A 3TE7A 1U9IC 4P7FA 2ZXFA 3A05A 1K06A 1E6LA 3OZRA 1A69A 5CX4A 1B4BA 5D5QA 3W4JA 4DLBA 1QGZA 3C5VA 4OAOA 2VTDA 3K73O 3P19A 3FR8A 3TIVA 5C7LO 3OZAA 4UNRA 4YROA 1TVKB 3VZQA 4Z4HA 4GSKA 1UDWA 1XQYA 3SMQA 4ZKDA 4BJ5A 2V6SA 4X84A 3WDMA 1F60A 1T5OA 1U6JA 2WQZA 4KN8A 4NSNA 1H6CA 1B73A 3EZLA 5K3CA 2IX3A 3W7AA 3I2JA 4TLAA 2V7EA 5FOQA 1A8IA 2J6IA 3NYQA 1FYFA 1RAIA 2ZLBA 3BGSA 3GLHE 4IYRA 4QYMA 1QCZA 4M0KA 5EUMA 1IOLA 2GHQA 2K87A 2G88A 1M6EX 1USGA 2VDKB 1CYDA 1C3XA 3OFKA 3OQJA 3OZTA 2ZQZA 5COAA 4B8YA 3DONA 4PZEA 2DBYA 1GUDA 4DQKA 2GZ1A 3U9TA 3WLIA 1F0YA 3VKUA 3HL0A 3FOEC 5EMJA 1N57A 1JKJA 3DVAA 4EYQA 3QY9A 3NS7A 4RM3A 3WHKA 1TAQA 1X80B 1XZFA 2ZSUA 2QRMA 3MTJA 3NRCA 1GTSA 2NVTK 1YQEA 1E1LA 4X6AC 2QRVA 4OQ4A 4PTLA 5EE1A 3CZMA 3JD2A 3FYDA 2YY6A 4JLUA 2XQKA 4LV5B 4HAOA 3LQKA 3PJFA 5FX2A 3HU2A 4PPNA 1OMOA 5TVKA 3D1VA 4ZYUA 3FA2A 4TV8F 2ORVA 1DKUA 2WWXA 1L7PA 3VR6A 3PNMA 1WQHA 3QUAA 3U4QB 2M1ZA 4HATA 3I2HA 4JQOA 2C4MA 4QIHA 5H80A 4UHBA 1YS7A 2CZQA 5IDXA 2HA3A 1Z4MA 4QO8A 1QO7A 2Z98A 3PHIA 4BLSA 3WK4A 2PWPA 4EHNA 4IZHA 4ZJUA 3JRNA 2D7DA 1P9LA 4M7RA 4E1BA 4FNAA 3I23A 1DEOA 1BKDR 1TEZA 2R4QA 2ZIZA 2O6LA 2J3KA 4MVJH 2H2AA 2BE9A 3TXXA 2UXDB 1TKCA 1OI4A 3MM4A 4P2GA 4EEKA 2DT8A 1SU6A 2V7VA 4L75A 4W82A 1O3YA 3VXKA 1BXRA 3I45A 4C78A 1ZUIA 1MQ8B 1NXOA 2PJDA 4MGEA 3FUVA 1N3LA 5B2FA 1EGAA 4Z3DA 4OJNA 3JCZA 4KNYA 1PYDA 2BKEA 3FKSA 3AVPA 1TWCK 1B8UA 1Y8AA 5AP9A 3V4ZA 3MAGA 2OV3A 3BJMA 3MSCA 4YCAA 2BPOA 1UXKA 3OLVA 3O93A 1JECA 4PGAA 4D9NA 2KBEA 5IVPA 1UT6A 1QH9A 1V41E 2V4ZA 1U7WA 1R2QA 1WXHA 1XZNA 2WZDA 1C1YA 1MB3A 2YCBA 1FTNA 2VAMA 5KI6A 5KYYB 1H2RS 3DJYA 4UREA 1ESEA 1LK5A 2HIHA 4WNAB 4PYQA 1GILA 1DC6A 2OC4A 2R86A 2ZRCA 3OX1A 4A3FC 1DTEA 2B7CA 3PE4A 3GJ6A 4GSLA 3UMVA 3S1MK 4KO8A 5J2UB 4AXBA 1LWNA 1DGQA 1ZD4A 2VDQB 3LIIA 2H6EA 4R1SA 3OPVA 1NOKA 4MQUA 1CE8A 2CJWA 1LDMA 1GZ7A 4HWRA 3CVOA 1D2CA 5DV9A 2XGJA 4V0MA 3W1EA 4QQNA 5AW5A 3U4DA 3RVBA 1O0BA 5JH7B 3I4MK 3CZ9A 3QZUA 3EEYA 3REQB 4YV2A 5E6RA 3HE3A 3KKZA 3QHAA 1CS0A 2QNBA 1E3LA 2YJZA 4C6TB 1NG9A 1VI2A 3ZUGA 3T41A 3ZEAA 4CV1A 3LX5A 3OX2A 5FNVA 2NU6B 4B48A 4BVBA 1NUPA 3IP1A 2M6SA 2W6JA 5HP4A 4CMHA 1W4RA 4QVIA 1V3TA 3HA3A 3V1YA 1JA9A 3QU5A 5DTQA 5AXCA 2CLFB 1FJHA 1UBMS 3WMRA 5B30A 3IMKA 3NR2A 1J2YA 3C3AA 2CFRA 4FW9A 3PFIA 1SHLA 3V5NA 1G5HA 4YMLA 4HDKB 2IY9A 2D06A 1SCAA 5GY7A 4O1HA 4QLOA 4RHYA 2F8TA 3N7TA 2FQTA 1FXUA 1JYFA 3TK1A 3MLBA 2IKSA 1Q95A 2DY1A 1UKBA 3R5XA 2AHOA 5CLHA 5H3CA 3U9LA 1E1CA 2WT9A 5U1PA 4CU2A 1QKKA 3T4UA 3DCYA 3IDFA 5TQ2B 5JYEA 1MLDA 4QUJA 1I3MA 2I4OA 3KLBA 1RZVA 4KQ9A 5FTJA 4KPYA 2WAQD 2YC4C 3HJCA 2FQWA 3DBLA 2IEIA 3LQQA 4MUYA 5KJ1A 3RF7A 4LDPA 4L02A 4DJDC 4QJ3A 1RRGA 2FTKE 3HN6A 3RADC 1I01A 3ABSB 2WSMA 4J0KA 5SY4A 1NVUQ 5FLXA 3IT2A 1DG3A 5LJLA 1WA5A 1H66A 1V5GA 4AG3A 3P32A 2C0PA 2ONKA 2AEFA 1CHNA 2IKQA 3IT0A 2ENWA 2LW7A 5CHYA 4JGIA 3EZ6A 1SU7A 4RHCA 2AI3A 3TX6A 3GLFE 5C18A 3C8ZA 3IV9A 4KVAA 5K45A 4AJ9A 3KJGA 1O29A 5P21A 2C54A 3WJAA 2E0IA 3EWAA 2X9QA 4YUAA 4UNIA 2IX9A 1HL7A 3OIFA 4JOSA 4ZMBA 1I30A 2FZKA 2XCQA 3K0BA 3FSRA 4AJJA 4HNUA 3A6LA 1GPUA 4QLAA 1PFUA 1SU4A 3LL7A 4FDVA 2P6MA 1EFDN 2NVQC 2VYVA 1KOJA 2DT5A 3A3YA 1F5SA 1NM5C 3DAGA 2ZYTX 3QXSA 2XSZA 1FP7A 1W75A 2W2TA 4IDOA 4K1XA 1MXFA 1AS0A 1W49A 1P9OA 1K75A 2XT0A 2B5OA 3RRMA 3UK1A 3L9WA 4BN0A 1Y1WA 2DWUA 3S0XA 1R6DA 1Y3DE 1ZKDA 2C9OA 2FOXA 2VCEA 3MG9A 4FOPA 4IIVA 3V1TC 5JVDA 4B32A 2Q6TA 3EPLA 1QE0A 2P77A 4W5RA 3QUTA 3AUTA 1C29B 2POCA 3BGDA 3D59A 3IBCA 1F9NA 4IS2A 3OPYA 4Y7NK 1XCGB 4KN5A 1RLIA 1FXSA 3JVUA 4ZOBA 3I6BA 1LF0A 4IHAA 4P32A 4KQJA 4QFCA 1F5NA 2IF0A 4MCIA 1MORA 4DV7B 2F1KA 1KI4A 1YBVA 1IW7A 2QLMA 2X5JO 4AN4A 2B1IA 5CW2A 3RGGA 1V5FA 1Z5WA 3NJ8A 1N5OX 4QJVA 1NASA 3E81A 1BDBA 4WE3A 1AQUA 4N01A 5IH3A 4JBIA 3FOFC 1JHMA 4FCVA 3SC3A 1WNFA 3LYLA 3WGOA 1E20A 1H2BA 2NUPA 1II8B 1MAHA 4YP0A 4D25A 1VHDA 2ZVJA 4AULA 2F6RA 2BZ1A 1YKGA 1GG8A 4HWOA 1O9BA 2Y0DA 1M34B 1SUPA 4O4JB 2Y8EA 2UYOA 4PHTA 3LHKA 4A6DA 3JSTA 1LBIA 1V4VA 2PSSA 1TMKA 1W0KD 4RZ3A 4XX0A 1PDWA 3B82A 3X1DA 2BEKA 3NTVA 3GDZA 1L1RA 1ISSA 4TRMA 2ZB2A 1G5RA 1T1RA 4UM8B 2OD9A 4CMKA 4YMVA 1FS5A 2AK3A 1N6OA 4WFKA 3DE6X 5KYKA 3EQ8A 4NS4A 2YIVX 3AF6A 1CG6A 4HFNA 4UUPA 3PZRA 3VQTA 2K2WA 5KOYA 1ZOOA 1E1QA 2XVYA 1ZHOA 5AKZA 5HCIA 1ZM3A 1QGOA 4CUZA 2VNSA 2VBGA 4AMUA 2N0SA 1I4EB 1JDBB 3CLTC 3RS8A 1DMRA 1QPZA 2GXSA 2NIPA 2IODA 3NDBB 2B4TO 1U2DA 3LPCA 4IOLA 3T1OA 1HLGA 3NDRA 4QSHA 1EUYA 3DG9A 4KNWA 1OB5A 2ZS9A 4MQFB 2G40A 4G89A 4Y6GB 3VNQA 3HMQA 1H5UA 3HV0A 4CCAA 2EHDA 3RVQA 1CNMA 3IHTA 4WXYB 2YXPX 1K0FA 1ZGZA 4GH5A 2HSJA 3HL4A 3KOOA 3MJDA 3JVDA 4TXMA 1XJ0A 1RJ9B 1TT5A 2RONA 3CG0A 3NI2A 1DTWB 1R9TK 1UK7A 1JFLA 1IPEA 2IV3A 3TGPA 5J4LA 3DEKA 3GTGC 3AH5A 3BSSA 2H57A 3LXUX 2RJ3A 4JCOA 5JEDA 2PZFA 1Z5NA 3KQWA 4EVRA 3WNQA 1UEJA 3IR5A 2YN0A 2HHJA 4Z49A 3AB8A 3KDSE 5K8JB 1VIDA 1CBUA 3O2NA 3VYTB 1NQ5A 1W96A 4ZCIA 4RJKA 2ZSFA 3QGMA 1I3LA 3QVLA 4DBLE 2RHBA 4C7OB 4DJJA 2XDWA 5FO0A 1K5GA 2YUIA 3PFHA 4KBGA 3V34A 2XWBF 3IPRA 1TB4A 3K0AA 4OP3A 3FRJA 5C7IO 1H69A 5FJIA 1PSZA 4CE6A 4YJHB 3A1TA 3WTBA 1DC8A 2PD3A 1CC1S 1K08A 2Q46A 2PWZA 3V2GA 1M66A 1IZZA 1N25A 4K9LA 2WPNA 3GROA 4C1BA 2XCOA 1AJEA 2R6FA 1QDEA 1RFLA 2BFMA 1RAHA 4YRGA 1E2PA 1KMMA 4BWYA 3HOXK 1LX6A 2XZPA 3DQPA 4N6NA 4GI1A 2VAPA 4F1WA 1DKPA 2HDHA 3W2GA 2XF8A 1APBA 4XCXA 3IE1A 2R68A 4BO3A 4ZZ3A 3BEDA 1KDVA 2H17A 1QCCA 2CNLA 2WVAA 1XTJA 3C7KA 3JD1A 3PCTA 4O4IF 4DCSA 3ZDCA 4U7WA 4GR5A 1BMFA 1NULA 2Q6VA 4M49A 4CL3A 1P75A 1SVNA 1P80A 5M29A 1EFVB 2H4HA 1UWCA 3HDTA 3KSMA 1D04A 1MN6A 2I3BA 1S9HA 5DGHA 4UFPA 3F7TA 5BT8A 1JHYA 4AAYA 1T2VA 2VSQA 1MOSA 1RQNA 2HF9A 5DLEA 3UJHA 1GFIA 3DZFA 4HMPA 4RV5A 1IQPA 1YRYE 4BDSA 4WBXC 1QKIA 5DXJA 3O3CA 2CXRA 2I4LA 2QD5A 2CDRA 1O57A 2DQYA 2P0EA 4QVKA 4D9BA 4XX1A 1A77A 4FQ5A 3ZY3A 5KNLA 2ADMA 1USKA 2I6GA 5JDCC 3ZTWA 5B37A 3SEAA 5CH8A 2C5HA 1ZUWA 3ZIDA 4P0QB 5ALFA 4IMPA 4GBGA 1PJ6A 5JSKA 3R4CA 4DLPA 3MUOA 4JSRA 4TVKA 1Q83A 1S0UA 3SR3A 3ASYA 1IC6A 3UGKA 1Q2UA 5BVGA 3V55A 3JX9A 2AEMA 1QGAA 1F06A 1F4LA 1TVEA 1KYQA 1D8TA 1SR8A 2BHNA 2YWFA 2RHOA 1BTOA 1FNDA 3LKVA 1BHJA 4L4RA 5AJHA 4ZEMA 1H1LA 1VKNA 4EJ6A 4B74A 5B12A 1Z4KA 3HSSA 3NBKA 2COUA 4KL8S 3C5EA 1KO7A 1YDWA 4KIJA 4KKXB 4LPKA 2GSNA 3S1RC 1WCMA 1CHDA 2OQRA 4JUIA 4NE7A 5BYBA 2O5EA 4PR0A 4TROA 2PUFA 1JF8A 1CUHA 5L7TA 2XECA 2JB9A 3H4IA 5TGZA 2H7CA 1I1QB 2VHUA 3RYTC 3LGSA 5DSZA 2XYQA 1M2NA 1U1DA 1ZUNB 3SZUA 3ZCUA 5KS2A 5JHHB 5BNZA 5MFZA 2WHQA 2Z3WA 4XGNA 2JZCA 1PEYA 2VXOA 3I05A 5IK2A 3I3SR 1SCNE 2J1LA 5FFMA 4F7WA 5B6IA 2EERA 1F38A 4AP6A 1P39A 3BA6A 3R7FA 2E55A 2CDCA 3CTMA 4KARA 3NOOA 2LR0A 3H2SA 1TJYA 4HDQB 1QFJA 1I4LD 2ZFZA 1JXAA 2I6TA 3CN9A 2D8AA 3KJNA 2BAGA 3P0JA 3QNWA 4UMEA 3RG2A 5ED0A 1JALA 1WB4A 3PX2A 4FJ2A 4YG2A 4Q1EA 4TM8A 2ATIA 3K0SA 5AQ1A 5DN6A 1P4JA 4TT8A 1ZCFA 3RRZA 4P0PB 3QSYA 4BLBA 4HXFB 1NXSA 4R40A 5EJFA 4TRNA 1GU0A 1MD9A 5TPZA 3DAYA 1JUDA 4F12A 5LJIA 1UANA 5MF6A 8LDHA 4FVTA 3F7OA 3PR1A 3TW8A 2QN8A 4D80A 1IDOA 2GAJA 4LV8B 2A14A 4K2AA 2HV8A 1W46A 3BBPA 4ERNA 2P4UA 4IDQA 1HUQA 4ETNA 5HQTA 4W5NA 1IZ7A 2X5KO 5JROA 4V0ME 4DEYA 1FP1D 2FHPA 2HRCA 2FPGA 4Y2RA 2FUKA 3VPAA 1A72A 4DYVA 2REQB 1LBQA 2YHSA 2YJ4A 3KV1A 5H3HA 3D4LA 3U13A 3PXUA 3EZ7A 4D81A 5IJ0B 1ENZA 3QUBA 1U8UA 3D0RA 4L3VA 4DBVO 2XKBA 3BT7A 4MLPA 4EFNA 4MYRA 2WE8A 4N48A 5I7RA 1WR8A 2P2GA 3SYKA 1T9BA 5EZSA 3OE5A 3P45A 4QJ4A 5CDUA 2WMOB 4P7GA 5BT9A 4NESA 4YI5A 3HFRA 3I9LA 4UW9A 1K83K 2O0LA 3SQWA 4QOEA 5HFNA 3PIRA 1ZJZA 3GFRA 2CDAA 4EHDA 3QBTA 3RFCA 1E3IA 3SD7A 1TK3A 4JVOA 1LV7A 2QJFA 1T8TA 1WXWA 4ND6A 1XZBA 4BAUA 1YA6A 4Q4LA 3LDHA 5C8YF 1AGNA 3DO6A 3FKJA 3NHBA 2FE1A 2QMQA 1VECA 3CLUD 2DB3A 2AOXA 3VBEA 4ZXFA 1DAIA 2C1EA 2P0YA 4X6LA 2JA5A 2ZTHA 2DFVA 2ZSDA 4IDHA 2AC4A 2W2NA 5H4GA 4B2IA 3UMBA 5IJZA 1CJMA 3Q3HA 3KD2A 1G2QA 3PCRB 4Q37A 1JZSA 5EHIA 4DLNA 5M04A 1N75A 4LSMA 3FCXA 5D5PA 1Y8CA 3HOWK 2CLSA 1TCAA 2ZR8A 4FD2A 3X1ZA 3H8VA 4HXYA 5HRCA 1CB0A 1MAVA 3KQYA 2VRWA 1C7ZA 4I1IA 4QU5A 3TUZC 5BRAA 2QPAA 4GOJA 5I8ZA 3F0TA 5M3FK 1QQTA 2AJLI 2N1MA 2PH1A 3CZQA 3ZLBA 3EASA 1SQFA 3RPEA 1AO0A 4ZCPA 5IYCC 4WXRA 2ZJZA 3HBLA 2G36A 4O8ZA 2M6KA 3NM4A 4LWOA 1J2UA 5DASA 4ALMA 4PTYA 4ER7A 1BFUA 5JNSA 4CF4A 1PZXA 5FLEX 4KITB 1T6XA 4XZ3A 1TU3A 2D13A 3PU6A 4JLSA 3NTXA 2M98A 5FRDA 4HRYA 2VZ9A 4BNZA 4BFLA 2OD7A 2XTJA 3TGLA 2CKDA 3V8BA 2W8ZA 1SQSA 5EIOA 1IUNA 4MIEA 3HO8A 4RA9B 2XODA 1S8OA 1C5KA 4O2AA 5JBQA 1GR1A 3KSZO 4ZK6A 3ZLJA 4TX1A 5KTOA 4AKHA 3NHAA 4DCTA 5K0JA 4JLAA 3GIWA 4BVFA 5HS6A 2OHXA 5BN3A 1YULA 3ZKWB 5A5FA 1J0BA 3H6KA 4R2IA 3LAJA 3MS4A 4ZI7B 4PIVA 2G5GX 2ASEA 4KZPA 4IH4A 5AVJA 2FWPA 2PGIA 4HDSB 3S40A 4P8RA 3RM3A 3TJMA 5BQ3A 3VU8A 1TIPA 3LPLA 4OMDA 1A1SA 1NYRA 1QQ5A 1YR1A 1BMDA 3ROMA 1RBYA 1M7HA 2ALJA 4DCNA 1YE5A 3VO2A 1L1QA 1KEKA 3ICEA 3W5JA 1CUDA 1T3ZA 2QL7A 4MA4A 3OT1A 3RFTA 4A3LK 1EFTA 3SF8A 4E5SA 5LIPA 4PLPA 2O8EA 3I52A 2YJ6A 4GG1A 3C3YA 1Z2EA 4Q1DA 4F2WA 5BV2P 5IASA 4ZC8A 3K6SB 1BXZA 4LSZA 1OLXB 3U9SA 4P08A 5FUYA 4KQWA 1EVIA 5D3MB 5ALEA 1HXHA 4ND5A 1OZAA 4C7JA 3AINA 3NBZC 5HG0A 5A06A 2J3EA 1V5WA 2PWAA 4BNDA 1FRQA 2XIJA 2P69A 5A62A 3DUWA 2Q62A 2O0HA 3OFSA 3R44A 1J9ZA 2YJGA 3ZLUA 4Q00A 3ESYA 2Z6VA 3CV3A 1U0OC 4OJKA 1FSPA 1U0HC 2D5CA 1CR2A 3I6IA 3LYAA 3QPUA 5FTNA 3RK4A 4E70A 3KSAC 2I99A 4J3NA 2QP3A 4ZJYA 5L3ZA 4FGLA 1E0KA 2XMDA 1ZO8A 1GU7A 3TAUA 5C35A 5ABPA 2PCLA 1P1HA 3IUQA 2SKCA 5CW1A 3D4IA 3GRCA 3SX2A 2FZ5A 1X7HA 2BF7A 3E7WA 5KVSA 3OQNA 2PKWA 4YAJA 5K0GA 2F1OA 3KU1A 4M7PA 4ZYZA 4NS1A 4YJ3B 2O3QA 4GVLA 4O2BB 1DQRA 2KLBA 5CA0B 4HDNB 4BO4A 3QE9Y 4A6EA 1SQ0A 4G0PA 2X0EA 5MGNA 1YZQA 3IMCA 4QARA 4BTEA 1ST3A 1YS4A 3H9CA 1Z15A 4MRNA 2A9PA 4L4XA 1PL7A 3AERB 4QU9A 2HSZA 5EMLA 3UK2A 3TFJA 2OVBA 2PUVA 1PSWA 3E05A 3QU2A 1NSFA 4K6FA 2HMWA 3RC9A 5KNDD 4QG3A 2CW5A 2FE4A 5TMCA 1PJAA 2OQIA 4Y7DA 2R8OA 2J3MA 3LFHA 3ZN2A 3W6UA 4B5KA 5CVCA 1ZL0A 3DHEA 4TWZA 1N2JA 2O2GA 1PKEA 2MR6A 3REOA 1D2RA 1VL8A 2IP2A 2CB9A 2PJRA 3KTAB 1G8PA 1JYSA 1PE0A 2EKZA 2G1JA 2JANA 3BMQB 4GR9A 4Y18A 4L8LA 4RTNA 1HQDA 3U0BA 2PMCA 1RJWA 2D1FA 3BMXA 2EBFX 3D43A 4A3GK 2C4HA 2MIIA 4PZUA 3SY8A 3RJZA 1M2OB 2C5EA 2SECE 2XCTB 4RIFA 3ESCA 1X2BA 4RACA 4R7TA 1RACA 4J16C 3NOXA 5ERGB 2IXAA 5C5EA 2WABA 4QHSA 3T1NA 3V3TA 3F2VA 3GLGA 2DFDA 1C0PA 2ZI6A 2B83A 1TMYA 1XXHB 4MK4A 5EKXA 4UBNA 5JXIA 3CURA 4NOMA 1R0LA 1NXVA 3A6ZA 4E4RA 5FXMA 3ZXSA 4Y2JA 2Q41A 1GZ3A 1VMDA 4B8WA 4E4TA 1P17A 3RUIA 9ABPA 4Y2PA 2VPZA 4LXXA 2OB1A 4C45A 1IUPA 3RQIA 4IIXA 3UXMA 5DRYA 2I66A 3EFOB 3D4PA 2V5UA 2JBAA 3HHPA 4Q1VA 2X3FA 4KRFA 3RSFA 1CEQA 2XXAB 1QVAA 5F23A 3ECAA 1R1DA 4GUAA 2ZULA 4IJKA 3LPMA 3EXHB 4UQPA 3VV3A 4CM9D 3PLNA 5LYJB 3S16C 1DIHA 1LTQA 1VJDA 2D8MA 4MYTA 1OREA 1MUUA 2OXCA 3BDVA 1VE1A 2XNHA 1ZM2A 3IQXA 3OOWA 5FPQA 2ZUTA 1T4CB 2CV1A 5IVKA 3WL6A 1JLSA 4US1R 2O7VA 3O0DA 1W4LA 5DM0A 2VP0A 4JB2A 3TWOA 3OREA 1KI7A 1C9KA 2ODWA 4N1AA 3OQBA 1ADCA 3HDVA 4I1YA 3HLYA 2AOTB 1UPBA 5C81A 5FBZA 1F0NA 3QQ5A 1E79A 1HOXA 1BHO1 2ZAMA 4EJFA 4UAGA 1B43A 4UHKA 4KQMA 4PZDA 4X60A 1NQUA 1XMXA 3L84A 5CVUA 4EATA 1N33B 1PV1A 3A8IA 3E3NA 3FW1A 2JGFA 2ZUFA 3DLAA 4DV0B 2QYOA 4BECA 2WV9A 3NLLA 1DX9A 2ECOA 3CWQA 1NVGA 3M4NA 3EXHC 4QU0A 4BVGA 2B30A 3RRFA 1SUSA 3THYB 1P73A 2AG6A 3BQ9A 4YC7A 1NQTA 2XNKA 1REQB 3JYHA 1RQ7A 1DU4A 3W2HA 4FOOA 3MT9A 4J7UA 3U44B 1HC7A 2YQZA 5CB8A 5D3QA 5DH9A 4CTMA 2NTVA 2VSNA 1JQDA 4HBGA 4J90A 5AJUA 4A16A 1TJ4A 2AFIB 4HNAA 4FHZA 2V54A 4ZCLA 4G09A 1OAOA 1WULS 3HJTA 1YS1X 2GPSA 3DMNA 1E3WB 3KFVA 4X90A 1KKUA 2PUAA 1U0LA 2P11A 3FBTA 2DEUA 2KSQA 2JPDA 3VPCA 5DBEX 3OTQA 2OBMA 3BJEA 2VJLA 3V80A 1B93A 2HI0A 2JCBA 3G23A 4V2IA 2OUKA 1ZBQA 4GDFA 3DE3X 4CMIB 1N2OA 4FI3F 2OCPA 5DK6A 1X2EA 3LO8A 2DBZA 4UARA 3OZSA 4LNHA 1NE7A 1A9SA 2J41A 2E2JK 3AEYA 3I42A 1CY7A 4ZV7A 3A6KA 2VHEA 1NNUA 1UOPA 3AESA 2W11A 2FRDC 5T4BA 4FS3A 4IGFA 5LZ7A 1JDJA 3UHPA 4OINA 1LEHA 1I50C 1Z7YA 2QTCA 1Y1WC 3PKZA 4QFDA 4X54A 3W9UA 3VMFA 2XGSA 4LDJA 4O02B 4ZHSA 5AM5A 2Y92A 4PANA 4DCOA 4HGYA 1KVQA 2PS3A 4Q7EA 4JDPA 3B1KA 3X43A 2FPRA 1HDYA 5EMMA 3JD0A 4ANFA 5J1SB 4B4DA 4HEJA 1T8WA 3AQOA 3V00A 1P5RA 3DD1A 3HJGA 2X0RA 2JLZA 1DX6A 3MD9A 3QUSA 1ESZA 5EE9A 2Z58A 1AXGA 1QGUA 2H2IA 3PDHA 4FX5A 1JXQA 3FPFA 2NT4A 3FCSB 3DFIA 4P34A 2EEPA 3EX7C 1N5LA 2B63A 3T4PA 2PGNA 5TGTA 2PZBA 2GHTA 2YY5A 4R9SA 2BMJA 1GYPA 2C5BA 2QD1A 4WZBB 3QVOA 5AUQA 1KBZA 2WTUA 3LDGA 5AESA 2WFAA 4ZZ2A 2I2DA 4D0NA 3B5IA 4QICA 3HBAA 4YV1A 1NN1A 5F35A 1SZCA 3HVJA 4UUNA 3TLCA 1SEPA 2UVPA 3EUWA 4LOWA 3CS3A 3W8DA 1YVRA 3O73A 3N28A 4QBTA 1GKYA 4W8GA 3HFJA 4CQLB 1UEIA 1NMSA 2WKWA 4G7OA 1K83A 2FFAA 2A5YB 2BGIA 1UJMA 2PS0A 4GFDA 5CG1A 2VZ0A 5L40A 3RAJA 2YWEA 2HWXA 3R2JA 2V6GA 2PE5A 2EKDA 4MRMB 4QBIA 1XPPA 2YQ5A 4JI6B 1E4EB 5HE8A 5U9CA 1RU0A 4QRHA 4CZ2A 3T5PA 4IHKA 4WT7A 2P41A 5IYBK 3TF5A 3RTGA 3BXGA 2V98A 3MWGA 4PAGA 3AJAA 3SFZA 2OGZA 3FYTA 1EX9A 1RXEA 4L50A 1E89A 3B1JA 4GWKA 2PKCA 4OGLA 1G42A 4RVNA 1VHLA 1YQTA 3OJWA 1PR2A 1LRLA 2QZSA 1NQAO 2EQBA 4FMDB 1A7AA 1U2DC 3AM3A 4F5EA 2OFPA 2XYPA 4JP5A 4CF7A 2I4MA 2H7YA 4JOBA 2VKQA 4B80A 4OFWA 3TKLA 4WJLA 2COEA 1BWSA 4MULA 1PGPA 1YZVA 1M1XB 1JIKA 2MU1A 1E58A 3F74A 4MHTA 1NAHA 3ONDA 4AKGA 2J3JA 4IIFA 4P83A 5L9AA 3IUBA 3GWGA 1R8SA 3KE9A 3MTAA 4RMGA 4CVNA 2R0QC 5J5VA 4OBXA 1II9A 4N18A 3UQZA 4Q1BA 5D85A 1KVRA 2YHIB 3IBFA 2JA6K 5BN4B 4CIXA 1XR3A 4CN9A 4F96A 4FCTA 4IEEA 3H3XA 2QA5A 1WKBA 5HQ3B 4E2FA 1DVRA 1C1XB 5CX1A 2P6RA 5U4XA 5HR5A 1UMDA 2QV7A 3B89A 3G0OA 1FFXB 1G6HA 2J9FA 3IXLA 4UASA 3NM5A 1I0ZA 3OOSA 3D8NA 4V0NA 3FJOA 2AT1A 3HG7A 5GOTA 5LL6P 4FWTA 2QJTA 3IR7A 2AMFA 1NOIA 3I04M 3X2SA 2LKDA 5IPFA 2AOWA 3TFQA 2I54A 3FZEA 4QJBA 2PLNA 3A6EA 4G8CA 4Q4HA 5H7XA 2F67A 3DL0A 2OORC 2VF7A 3LDUA 3GU3A 1I24A 2VZEA 3LCRA 2POQX 4LGYA 8AT1A 3OJFA 1N4AA 4I14A 5F21A 1I4TD 3OPXA 1I8TA 1VLJA 5IZCA 2GM4A 2E2WA 2JFHA 1BFKA 1T2UA 3DE1X 3Q3IA 4N39A 3TD9A 3URKA 4O4HA 1GZ4A 1QRAA 2J5BA 3UJCA 3R3SA 5IARA 2FMHA 3X1JA 5FI3A 4FE3A 4GUDA 4UUAA 5DWDA 1AXEA 2QD4A 4DVGA 4DDUA 2VHVA 2VKTA 2ZRQA 1F1JA 5HIIA 2AMJA 2VWHA 4AY6A 3CO0S 2XDAA 4NU8X 2ZATA 2DUMA 1SELA 1ZISA 1W85B 3OIDA 5KB3A 3VZDA 3CH6A 2EU8A 2W71A 4TMFA 3LUBA 5MN4A 5JOQA 2B5WA 3MPUA 3WGYA 1NIJA 4UBJA 1N0IA 3VAZA 1O0CA 4EZBA 1W87A 3TS1A 2DWQA 4ZI5A 5J58A 3R3VA 2C4VA 1RLUA 5C34B 3EB9A 1EIWA 1EX1A 3MUFA 3HRKA 1QIDA 1JB9A 3V8QA 1UZMA 3LVFO 4ZIRA 1AQJA 1WY7A 3MFYA 5G4KA 4F6RB 1P4RA 2VK1A 3AD9C 3NHSA 2RG7A 2QTAA 4KLZA 4LJ8A 4Q3OA 3KPJA 5HUQA 1XDDA 1MJGM 1FJ2A 5EYPA 4NI5A 6REQA 1K8QA 4FFVA 1EFPB 2WT4A 4NR0A 4XIIA 3DSRA 3DOCA 4L8FA 5LZ9A 1MENA 2ZKIA 1RKBA 1JAXA 4LDAA 3RUCA 4AZTA 2VI5A 4E21A 2NVTC 1PCXA 3BK2A 3PFNA 3TYXA 1ZWLA 5IDQA 3VC2A 4BJ1A 1DOHA 2CVHA 3UHJA 3U31A 3KCQA 4MRSA 2AJ8A 3F4KA 4NBWA 3CPHA 5UKDA 3CLTD 4O0LA 2F3RA 1T1GA 1IATA 1P3Y1 1C30B 4D9MA 3CPSA 2HHAA 1Q21A 1UINA 5K0BA 1GSHA 1SPBS 3LTEA 2BONA 4MAFA 4IDBA 4JB0A 1JAYA 4EGQA 4DNQA 3PA6A 4J3FA 1WOSA 2C8KA 4M0DA 4DA6A 3CA8A 3UAOA 2GAHC 3SKVA 2VC2B 5A9RA 5DMXA 1TW3A 2WSYB 3GCWA 2A67A 2FZLA 1EFRD 2HF7A 2KPOA 1VL6A 4H18A 4OSOA 4Q1AA 3UIEA 3UJ3X 4DUZB 3RFXA 2WIBA 3DF7A 4MVJI 3HVUA 3FX2A 2YRWA 5E1BA 2G06A 4BV2A 5AUPB 1CEEA 3WL3A 4MJ7A 1HDRA 2H11A 3AY6A 3EGOA 2DQSA 2CL0X 3N5KA 4RPCA 4BKUA 4IF6A 4N5NA 1Y8QB 2AG5A 4IO0A 3T1HB 3AI2A 3GLGE 2DUWA 3O92A 1RWVA 4OYRA 4FKMA 1OI2A 1VYVA 2CXHA 2ECQA 1TWCC 3CF6R 5CAEA 3BK1A 1KQ3A 3RHSA 2X15A 1WEKA 2XDQA 1OUMA 1EGVB 3AX6A 1QGYA 4RVUA 4FDUA 1ES9A 4HBZA 4U2CA 5TF4A 5KSZA 2O8BB 1MQ9A 5L7YA 4JK1A 4C4OA 3HXQA 1RT9A 1XCJA 1TWHK 3C4QA 3AP3A 3KB2A 1HLPA 4GZLA 4ENRA 3VDNB 2P5YA 3DBHA 1F7UA 1LSOA 2AQIA 2EJBA 4IOKA 4O3FA 4OXYA 3UWOA 4DE5A 3R3XA 3TCKA 1QZTA 3IBYA 4DLRA 5BW5A 3S1MC 1XV5A 3JYNA 1TWGK 1PS8A 2O54A 2XMSA 2XVXA 3H5AA 1T1EA 2HBRA 5B53A 3EZXA 2ZWAA 4AJNA 1E4YA 1VHQA 3E22B 3A0UA 3OICA 2FZ4A 3QELA 1GQRA 4KO1S 4M9XA 2J87A 1TA9A 3NFYA 4X44A 3I4MC 3WP0A 3K9LA 4ND2A 4G5HA 4CDGA 3FMGA 1Y6ZA 1U7DA 2HSEA 1R6XA 2VPWA 3RSSA 3DOFA 5FV7A 2X5OA 2R25B 1ORHA 4F7DA 4I5EA 1E2KA 3QEMA 4OLHA 4DIUA 1G21A 4FFLA 4PQFA 5EESA 4FONA 3VKGA 1JI0A 2ISSD 1GY8A 3ABRB 5DTEA 1B8PA 1T2AA 1FW6A 4HNRA 2FPIB 5A6SB 4IXNA 2C2GA 1THTA 1L8AA 3P2EA 1RCFA 5CLJA 3JALA 4RVFA 1BEUB 1GUAA 5EXTA 3JQ9A 2RGEA 4EDFA 4U6NA 5EKSA 2ECFA 4V0QA 3OEHA 5KOIA 1NUHA 2D5LA 4BBSK 2C83A 2JAQA 5E9JA 3MN1A 2EAUA 5KJ6A 4RMJA 1C14A 3SFTA 4WVLA 5F9HA 2X7JA 2GEJA 2Q8QA 2ANBA 1YB7A 2IGBA 4IXDA 3MGCA 4FE7A 4W4TA 5EVJA 3R7WA 3G89A 4Z3OA 1RRVA 3TVYA 1X7ZB 3F6SA 3WB2A 5HGXA 5FPPA 4B3BA 3OM9A 5CA0F 3VKHA 3K16A 1PG5A 1L5LA 3UKJA 1B41A 3D2CA 2WVHA 3OZFA 3CUSA 1SXJA 3C74A 4FC7A 1CZHA 1FP2A 5IF3A 1SD5A 4HKTA 5B1HA 5JAHA 1DXHA 1QQ7A 1YAJA 2O57A 1LY1A 5G0VA 5JNRA 3C8UA 3DKKA 3FETA 3PQFA 4G0MA 3OE1A 1KPHA 3N9IA 5FWYB 1QYDA 2QGFA 5JAZA 4QXRA 2NU7A 2O5CA 4XJXA 1EDEA 2YZ7A 3BD7A 3JWPA 4CNBA 3RYHB 3F96A 1PJLA 3JPYA 1I3QK 4K9PA 2V3CC 3L8MA 1VLHA 2J5KA 4LVUA 1GV0A 4BFXA 3A2MA 4YECA 1NSYA 4DGSA 4H6PA 1F2TA 3GLVA 1NN5A 2IS2A 3CH4B 5SY6A 5T41A 3G7SA 2GCOB 1N92A 3W5VA 5BWNA 5HW0A 2PT7A 2YKGA 5BSHA 1CT9A 4D1YA 1Q1EA 3I9OA 4ID9A 2R1UA 5ESDA 3RSCA 3VISA 3EN0A 4D2IA 3IUYA 4BJ6A 1G18A 4WASA 2B4KA 3BTUA 5DCYA 3H2BA 5HNKA 5ER6A 4X8MA 3FMVA 5EMHA 1SKYE 5BPHA 3RJ5A 1JOEA 3Q9LA 3F46A 5AK4A 1X7XA 4G0ZA 3W3AD 1KMNA 2D1RA 4P0TA 5J4KA 5B6JA 2Q3EA 3ZLTA 2HLHA 3O82A 4LDRA 3ZR4B 2VYNA 3TRFA 4ZV4A 4YYZA 3OD5A 2XNCA 1M54A 2V7GA 3O8OA 3PT5A 3HCDA 3B1XA 2AG1A 5D1HA 3PWSA 3DLBA 3PB3A 1L0WA 2W6MA 1PDOA 3Q40A 4MW6A 2IW3A 4Y7NC 3OZUA 1ZNXA 3L7DA 3HJFA 1AS2A 2BHLA 4P5BA 2I78A 2OLKA 4AWAA 2G77B 4DSOA 3PNSA 4ZMSA 5L4SA 5IF9A 2Q5FA 1BD4A 4R8KA 3GD5A 1P5ZB 2C2BA 4K7JA 3SE7A 3MELA 2UZ3A 3OO1A 5KAMA 1W29A 4GO1A 3PENA 4X97A 4YY3B 2Z57A 1E32A 4JCCA 1OV4A 1JQEA 4JEIA 5D51S 2DLCX 3GVXA 2W5UA 5HQJA 5B1SA 1W35A 1T35A 2CXXA 2AUNA 1FNBA 1L3BA 3BH0A 1N2GA 1XFDA 1TK9A 3DAOA 1NRJB 4B6SA 2JFYA 4N54A 1WMBA 3TQHA 1TF7A 2IZ0A 1KXJA 4NIMA 1PAUA 2HLPA 2HJ9A 2WP8J 5CFOA 3KQPA 3AL3A 4X94A 2JGDA 3AONB 3QHPA 4X1KB 4Y2SA 3PJGA 3SHQA 3FOAA 2ZM5A 3DBIA 2FWAA 5IM4F 1RJGA 4RV4A 2Q1YA 3OLCX 3VVBA 4A8JB 4XR4A 4U7DA 5F98A 4HLUC 3F98A 3PEWA 4Q6BA 2FLKA 1IEWA 2B78A 1DUVG 1DDIA 2B98A 2VPIA 5CFLA 4BNLA 4DN6A 1AMOA 1DTSA 3AHHA 3NBQA 4OHWA 4C3JK 1DX4A 1LVHA 2IZ5A 1FYWA 3HB1A 4DSZA 4DC9A 4KUHA 2IT1A 4RPIA 4Z1MD 5SZJA 4XCQA 4OI1A 2ZRJA 4RW0A 4X65B 3U7RA 3R5HA 1ZR4A 2GJAA 2WTAA 4M98A 4PVCA 4LCBA 2Q8PA 1QUFA 3IELA 4DJAA 4IUDS 4IDCA 3AI3A 2OZKA 3AGPA 1D4AA 4PO3X 4D5GA 4BX9A 5ESXA 2PKRA 5AM2A 4BP3A 1FRVA 1LZLA 4XQ0A 2ETVA 2B4YA 2G71A 2ZRNA 5C5CA 3GTOK 5DTRA 1JAZA 1FDRA 2IIPA 3AR3A 1M1ZA 2G67A 1US8A 3DEFA 3PQ5A 4MXDA 1O6FA 1KO8A 1TVMA 1X13A 1S2DA 1GUFA 2YL2A 1IXRC 3E2MA 3LAWA 4FDAA 2C5LA 2O8NA 1VQ1A 2QG6A 3ZGXA 3Q10A 3AUUA 1R9TC 2CK3D 3L4SO 5KX5F 3PGLA 1UFRA 2IYOA 3EY4A 3HNRA 2LCQA 1SKAA 3B9PA 4JLKA 1Z0DA 7ADHA 2WAQL 1E63A 4H6XA 1E3QA 4JHXA 4N41A 1TFUA 2WK1A 3E4CA 3CTPA 4LAFA 3ZWCA 4JJ8A 4EAQA 4BNYA 4PNPA 2XOEA 3T9AA 3G68A 1P1IA 3PHJA 3CJTA 4K6CA 3OSZA 3Q7IA 2FSHA 3KWLA 5H59A 4JLPA 3S4YA 3IKMB 1P2DA 2W6OA 2H1OA 4BWGA 1JEQB 2ZBFA 1PZMA 2YHBA 3D8RA 1ZYRA 4URVR 4XFJA 4CM4B 4F1KA 3RT7A 1SQ5A 2FNAA 2VNHA 3HC7A 3Q2KA 4EB6B 5DISB 4Y0AA 2X3YA 1I2DA 4AY2A 3ROGA 1J8QA 4FZVA 1PJTA 1U2TA 1RWBA 3KUXA 2FMFA 3W3AH 2YYYA 3AEUB 3NTOA 3ESRA 3NWEA 3ZV5A 4US2R 1Z83A 4IIJB 4PLVA 3F9RA 2PUGA 1R3DA 1QYVA 3EZ2A 2QORA 2PL1A 4HSGA 5M5BA 2XTAA 3NBUA 4L4UA 5EXSA 5LQNA 4G7ZA 3HOXC 3K35A 2X0DA 2ONJA 2ZSAA 1U4NA 3FF1A 1CQJA 2XYRA 4YMWA 5CYGA 1U11A 2Y05A 4ENPA 4KFCA 2W2KA 1XEWX 1FMFA 5CCDA 1W5SA 2IHVA 2C57A 2WIDA 3FDJA 2HDOA 1KO5A 3QP9A 4LF9B 5J5AA 3EQ2A 4LBZA 2D2IA 3FF4A 3HM2A 1W8DA 2ZUEA 3AT1A 2GCPA 3E7DA 3ND6A 4ESVA 4QYSA 5KPJA 2FDXA 5I7SA 2A9RA 4B81A 2WI8A 4UATA 1HETA 4I4TF 4R01A 2NYRA 3ORQA 2GAIA 3HBJA 2Z83A 2PRJA 1F6DA 3LDAA 4JP1A 3UMRA 5KTPA 1RAFA 2R79A 1QLWA 2CMHA 2QD2A 4MV8A 4A3DK 3UTDA 4D0LB 1WAMA 5F1PA 5HHTA 3HV2A 3G0BA 1MMFB 3CW2A 3NUQA 5DWQA 3M2TA 4OI2A 2DBQA 4JYCA 3KAKA 1Q7GA 3HVHA 5DHTA 5JO9A 4BO1A 4EHFA 3AY0A 3VOAA 4AF7A 1BDJA 4HTFB 1K8ZB 4WCDA 4X7RA 3QVGB 4MQEA 1NRIA 3N8HA 3VR6D 4M3NA 2XA1A 4Q7QA 3AM4A 2HTEA 1HM5A 3C41J 1SOVA 3IOCA 1RPAA 5TDHA 2JHGA 3QQPA 1OAOC 4TN1A 1UK8A 2B6HA 1D0VA 1NJ6A 1N0VC 1SIUA 2VJDA 3L7NA 1PJSA 1XDUA 1GCOA 3B85A 1J0XO 3EVDA 2G8LA 3PXEA 4XYEA 4GLOA 4CKEB 2VNJA 4F97A 1YFLA 1FP4B 221PA 1J6UA 3B53X 5A05A 3UJNA 1E9SA 3TSAA 2IW1A 1MRZA 3WAKA 2PV7A 4O5OA 4QGFA 4S1TA 5TT1A 1CUBA 1OE0A 4RMNA 4BMNA 2GO1A 2X8WA 2OEPA 1MH9A 4UEJA 4Q12A 3S2SA 2PZLA 3UENA 1Y0BA 1LJLA 1E2EA 1ZK4A 3NM6B 2JI8A 2VYCA 5KQPA 1F9EA 1ZVKA 3FZYA 2P2ZA 1XNGA 3ILXA 3S27A 421PA 2G3YA 2PMWB 5U4QA 2OPHA 4C43A 5ITZA 1CX9B 3TBFA 2QYTA 2QUBA 2VUHB 1RKXA 3TOZA 1E2DA 1QIEA 2QX7A 2NZYA 5KYNA 1XAJA 4HZIA 3K1JA 4KIUA 1EUZA 1GAWA 1SCKA 4M0MA 3S2EA 1SB8A 4PZAA 2RH4A 5DYTA 4IJUA 2NUTA 1YCHA 3SJCA 2XT9A 1I3CA 3FOCA 4R9RA 4OIFA 1W88B 3PFBA 1Z13A 3NXKA 5AJTA 3ZZNA 2GSUA 1RHUA 4NENB 2GVZC 5T6MA 3C3WA 4I50F 5DHSA 2XA9A 4G4JA 4ZO4A 1VFPA 2OZLB 1AQ6A 3A2NA 4B87A 1AZWA 3G17A 2PEYA 3CR8A 2DECA 5ALLA 1J9GA 2CUNA 1NLMA 4JKIA 4DQVA 3HGTA 5ES4B 1XZPA 2ZSKA 3CNBA 1WHSA 3KWFA 5ALZA 1P18A 3FUCA 3RD5A 2H3EA 2JA7K 1KSGA 1K5HA 5ARCA 1GEEA 3S5JA 2JFWA 3AJDA 3G5AA 3H9JA 1SCUA 1G17A 1SHJA 2J5RA 3KEGA 4GM4A 2N1BA 2ICAA 3KPWA 3V7NA 3DHNA 4ARCA 1LPAB 1OWOA 1AGPA 3QH4A 2P3LA 4F1JA 3TUIC 3ZWXA 2EYQA 1X1CA 3A8TA 3EOBI 3WLOA 4JXZA 2W6IA 3SU8A 3D5QA 1ONSA 2GDZA 1KSJA 4YHHB 5SV2A 2A2ZA 2H00A 1PJCA 3WK9A 3AHCA 2HRDA 1K83C 4BJ3A 4BXXK 2PMKA 4ZH4A 1OX4B 3NBMA 3NVMB 2VK4A 4CLXA 2W42A 3AFMA 4JBLA 4EQ6A 1LK7A 2CZCA 1YB6A 4HAVA 1VLMA 4ND1A 3BRCA 3NUZA 1Z2PX 1XA3A 3G0CA 1VXOA 3QRWA 3GPIA 3NASA 1BHSA 2QXUA 1SBIA 2H2FA 3OUZA 4GXRA 3BXHA 4G5QA 3K5HA 2GLTA 3PP8A 4MUGA 1JHPA 5LP6B 2HL6A 3HCCA 1PS0A 1QVWA 2B37A 3DZDA 4XDGA 3GMDA 4C1NA 5HTKA 3DMGA 1FX0A 4J0QA 4RD4A 4XM0A 1L7OA 1ZONA 2VJMB 2AA3A 3VAAA 1Z5VA 5JE8A 1ZQ1A 1ILWA 4PAAA 1L7MA 2WJ6A 3HOWC 1AK2A 2YWBA 2RKOA 3K9BA 3NC0C 3QTTA 5IAKA 1AZLA 2YU9A 1FTGA 1R9GA 2FKAA 4TS4A 3SN6A 3T61A 3W5BA 4YCNA 3G3EA 3S2GA 5C44K 2ZI5A 3PHBE 1OWMA 1SFRA 2FX2A 4ZI3A 1YONA 4DAEA 4KHPB 4BCDA 4YR9A 2PL3A 2PANA 1E7SA 3DFFA 4GNKA 3OZEA 4NTZA 5CXXA 3VR6H 4ARZA 2Q2NA 4MMXB 1S9DA 4HVLA 3PO2K 2V59A 3LHFA 4RAQA 5A9TA 3MUEA 4W5TA 3U7QB 2XGMA 5GJWC 2AK2A 4Q82A 4F9EA 2CVQA 1G20A 1CUAA 1ODTC 2L17A 5E6SB 2DMRA 4RBNA 3P2JA 1UK6A 4MTCA 1J6XA 2R7MA 2VDVE 3X2FA 1PW7A 3L6DA 2ZBEA 1T2FA 2IITA 5LYYA 2E9SA 3F7NA 1QONA 1WM1A 5AW3A 2HNBA 3JQ7B 2DQKA 3LGXA 2VYVD 1XZIA 3H8JA 3S55A 3WIUA 1I3QA 1FMLA 1G4AE 2IHNA 3BE6A 3K1AA 4PQEA 1NY5A 2W8BB 1PTKA 4PR3A 3S70A 4NBSA 1V37A 3UQYS 1JFSA 3AL2A 4YMGA 1KR2A 4C0AC 1LPBB 3QUQA 4D6YA 2PR7A 2BEVB 4XR9A 1VSUA 3IL2A 3EEOA 4C0HA 5FEMA 4PINA 1CQZA 1RRCA 3LBHA 1E99A 3JAKA 2XCRB 4LGVA 4H3VA 2ZBGA 1G8HA 3PWTA 1X7GA 1XO1A 2W37A 4HXGA 1SXQA 1PNVA 4OQMA 1KH2A 2O5JA 1DXYA 4WEQA 3HPRA 3DBRA 5DI3A 4ZT6A 5CDFA 2M1XA 3DEAA 4AIRA 5A0TA 4L78A 4A3LC 2WR8A 4FKZA 4UPEA 4DR7B 1TM3E 5L3SA 2ZSHA 3LL4A 2WWWA 4BFVA 1G55A 3SNKA 1PEAA 3IHWA 1MJ5A 3EIXA 3H3JA 4B46A 5JFGA 5L6LB 3N7UA 2WYHA 3EF0A 4QOFA 2ZANA 3WDSA 2ZWVA 3KKPA 4CDRA 5A03A 3NHYA 4KMSA 1A76A 1CY2A 1QRRA 5DRTA 1R4AA 3VA7A 1JR4A 2CNWA 5FBVB 3F3MA 2H59A 1GZVA 1C0AA 3VOSA 3V1NA 1S7CA 1DB3A 2IOFK 3D6JA 4IXTA 2C3YA 1OX6A 4DMUB 3ADPA 2DTDA 5A3QA 4F4UA 4KE6A 1HEUA 3KJHA 4IDDA 3G5UA 2FXVA 4J4TA 2QV0A 1DLIA 3TTSA 3JQFC 1D09A 3GJ8A 1HYEA