1HI9A

Zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
274
structure length
274
Chain Sequence
MKLYMSVDMEGISGLPDDTFVDSGKRNYERGRLIMTEEANYCIAEAFNSGCTEVLVNDSHSKMNNLMVEKLHPEADLISGDVKPFSMVEGLDDTFRGALFLGYHARASTPGVMSHSMIFGVRHFYINDRPVGELGLNAYVAGYYDVPVLMVAGDDRAAKEAEELIPNVTTAAVKQTISRSAVKCLSPAKRGRLLTEKTAFALQNKDKVKPLTPPDRPVLSIEFANYGQAEWANLMPGTEIKTGTTTVQFQAKDMLEAYQAMLVMTELAMRTSFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bacillus Subtilis D-Aminopeptidase Dppa Reveals a Novel Self-Compartmentalizing Protease
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase (protease)
molecule keywords DIPEPTIDE TRANSPORT PROTEIN DPPA
total genus 89
structure length 274
sequence length 274
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2001-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04951 Peptidase_M55 D-aminopeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.130 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Dipeptide transport protein 1hi9A02
3.40.50.10780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dipeptide transport protein 1hi9A01
1HI9A
chains in the Genus database with same CATH superfamily
5AVVA 1YFZA 2ZE7A 1XNHA 1KSGA 3A1CA 4ZOLF 1U94A 1X8KA 4S1VA 1S89A 4LS3A 2DWPA 5I5GA 4Q7MB 4UEWA 5I9NA 5DNWA 1J4AA 1E2QA 1N2EA 3RVPA 1AKWA 2XXBA 2BSAA 1TJPB 2DUJA 1C81A 1ETHA 1HOTA 2G8NA 2HXYA 2YHIB 4LYJA 1JHYA 2XDYA 4EHKA 1RWQA 1KAEA 3R5XA 5I9LA 2YIMA 4LE2A 5DTRA 1JDZA 2OLEA 4QEZA 1CFJA 3P2IA 2W11A 3UA4A 1XF1A 4JASB 3T5AA 4I36A 4BYMA 2WQZA 5F1YA 3AR9A 1PLLA 4MAAA 5DK4A 2IHYA 3BF7A 4ZJPA 2FHPA 2BCGY 4GT1A 3T7CA 4MW9A 5B3KA 3PGKA 4LEIA 3GUYA 2J9XB 3DL0A 1C7RA 2H1HA 4KTTE 1DDOA 2R6ZA 3BD9A 1FSPA 3JVVA 1YMVA 4A6XA 5DXJA 3B2QA 3QUQA 5IORA 2QR3A 1O28A 3CVJA 4D6XA 5KUTA 4DV1B 4YUZA 5IYDK 1VRVA 1ZVQA 3PT5A 3T7KA 3I9FA 3HEAA 3OPFA 3PXUA 2ZJ8A 1USVA 4B6RA 2V6TA 3DTVD 4DIFA 5D3MB 1AF4A 3C5WP 2UYCA 1N5LA 1JKIA 4UHEA 4CKWB 1COWD 4UHHA 1GZ7A 4LY3A 1ZD2P 4CXMA 2JGRA 3LJKA 4LMPA 4DUZB 2ZSUA 5A5VA 4ZOQI 3E9YA 2YV1A 5EXPA 5MFPA 2E4WA 4ZYXA 4JYZA 4HTFA 1CRPA 1QK4A 1ZGZA 3DOUA 2IY8A 4HAZA 6REQB 2C61A 1XRQA 3X0DA 1WEHA 1Z0DA 4YMLA 3VSAA 1RABA 2UUCB 2P8TA 1X3SA 4PO1A 5D2CA 4EKGA 1V2GA 3IIIA 3WFJA 3V4FA 4B3FX 4C7KA 4X97A 3BWEA 2QIPA 4MA4A 2YIVX 4DMMA 2JI6A 1NG1A 5AVOA 5AD1A 3CF2A 4DR5B 4PZYA 4LKRA 3TDMA 3D5QA 4C7XA 3PWZA 4Y6GB 1QVZA 3ZY4A 1ZA2A 2C58A 5JQGA 1N6NA 2XE4A 3AXTA 3HYSA 3P52A 5IS2A 1L8QA 2B5OA 1LPNA 2IYTA 3MSCA 1U5BA 3BGIA 2VHUA 3TIXB 3HA7A 3SX2A 4FBMA 3GOHA 4QGBA 3OCJA 4F1WA 3DLCA 2Q3CA 1W4BA 4ZYTA 1VL0A 2CW5A 4MRMB 5DE3A 3R9IA 2Q6OA 1PJSA 3TBFA 3ZHOA 4HLNA 1FVXA 1NG9A 4CMIA 3D3JA 4XWOA 3FOFA 2P0YA 3AP3A 5K8CA 2FXVA 4YRGA 1H94A 3CPHA 1G16A 1XCMA 1RKVA 4YWHA 4F6CA 4CIYA 1XTZA 3I6MA 4L2IB 4N8DA 2ZIZA 4EJ2A 1YJBA 1T36A 3OLVA 4ZV9A 3TIVA 4LOAA 3KZ1E 5K51A 3VSEA 1YS2X 2L19A 2VI5A 4YJHB 4C3JC 1XEWY 2IUTA 5EJ8A 3T4XA 1GE9A 3OT1B 4ZICA 4PGMA 1JXAA 1VRCA 4PGHA 4XRGA 1HLPA 3RS5A 5BSWA 4QG3A 5BO5A 4IDBA 2XTJA 3KELA 2DR3A 3BSFA 3QWFA 1BWQA 1V9SA 4E6EA 2X22A 3DZJA 3VDRA 2Y92A 4KBYA 5A03A 3GY0A 1S3FA 1M34E 1OV6A 1TYAE 1JLRA 4PWYA 2V7PA 4RHXA 4ZU6X 5A0VA 2GILA 1YGYA 5ECGC 1XN1A 1SG0A 2WZCA 2D1TA 2IPMA 3LBAA 4CGZA 4GKVA 2B4RO 1XQWA 3WRYA 4WIAA 5HQ3B 3G1TA 3NKLA 4ZI7B 5J3JA 4L7QA 4MYHA 4FOTA 1G7TA 1BWRA 3UPDA 2YN0A 3CLRC 3HOXC 3BMOB 1XNQB 4EYGA 5TPZA 5TMDA 3ZTWA 3TIFA 4MR9A 1BDHA 1GGEA 1JHDA 4JA0A 4A8PA 3R5JA 4WSOA 5BR1A 1ZXXA 3R75A 3IP6A 3QEOA 1OZGA 2HHLA 4LI3X 4ZT6A 2P9ZA 1NP7A 3IV6A 4G9GA 4B6QA 3SZUA 2GKSA 1A76A 2YV2A 1DWQA 2DPLA 2QVXX 3M70A 3G0OA 4MV6A 4BJHB 4BQPA 4HB0A 3ICVA 1WW2A 4DM7A 5JAOA 1LWNA 4W7SA 1Y4DE 4RA9B 3L02A 4EYOA 3EVBA 2FPUA 5DHQA 2AYXA 1XKQA 1JA1A 1X8LA 3FF1A 3TTYA 5AI8A 1Z2NX 4RO0A 5LPNA 1CRLA 2GBLC 5J1TB 3TBKA 3ZTTA 3Q88A 5IJ9A 1BGXT 1G66A 4OU5A 2OCYC 1DJPA 1KZ9A 3N2EA 5M29A 3BVPA 3NWPA 2QM8A 3LV8A 3REFA 3ND6A 3U13A 4O3FA 3GG2A 1T5LA 4KYTA 1PNVA 4HAWA 5JAIA 3KB6A 4NV3A 4E0BA 4QJBA 2BEUB 2B99A 3EZGA 3L7AA 4KFTA 2CF5A 3BSYA 1DZIA 1BVUA 3HXAA 1L7EA 4OK3A 1GYQA 3HDVA 4RS4A 5LLSA 1MA3A 1QP4A 3S70A 4GKJB 1VL5A 2CGEA 4JKYA 2Q6VA 1GEEA 1Y7LA 3LO5A 3NTVA 3MTJA 1AH2A 1Q15A 3T6KA 3N0WA 3B70A 1BCSA 4BC1A 4FEYA 1UMDA 2NYAA 3HB0A 1JJBA 2OC4A 3O1IC 3TLAA 4ENPA 4OL0A 3OPMA 3GXBA 1SBYA 4F86A 2C0QA 5IAOA 2AJLI 3OF5A 4TZ0A 2FW6A 3NYQA 5EXSA 4IG4A 1JDBC 3L6DA 4UBIA 5FV7A 3GLGE 3ISVA 2UZIR 1V6CA 3WHPA 1PHPA 3MNFA 4LHVA 1C9KA 2FWAA 3JQBC 3ABRB 5AXCA 4A6PA 4CQLB 1OI4A 2VDPB 2TYSB 3OU2A 3VU9A 2XUHA 621PA 3DNMA 1QOQB 2DGDA 5M5YK 5B7GA 1IAVA 5C8YB 4KH1A 5KKAA 3ZGOA 1SO8A 3NC4A 4QYSA 4DYVA 4B76A 4UASA 2WA1A 1EDZA 1T2CA 4FW9A 3F67A 1DEHA 2QRVA 4OKNA 3L93A 4L85A 1EM8A 4RJTA 1CS0B 4IX9A 1P0IA 2FU5C 1HETA 3NWJA 3CZAA 2RKBA 5HTKA 3PWSA 3NT2A 2QM0A 1U2ZA 4WJ4A 3DOFA 1UBGA 4UZSA 4ZT5A 4B2PA 2FCRA 5I9IA 2VKQA 2J4CA 3HVRA 1U04A 2HMAA 4H59A 2EKDA 1C4WA 4P3XA 5AXDA 1EX7A 3QSGA 1HYEA 5D3QA 3VXKA 3AD7C 1UJ5A 1U9CA 3L1KA 3NIBA 4GYWA 4ETNA 3LOPA 2ZLBA 1T5HX 1EXVA 3EX7C 3IQEA 4HNSA 2QZSA 2R4QA 2V7UA 1TJNA 2APJA 4O5AA 1C8KA 3L7YA 1KGDA 2C59A 2E2HC 4ID3A 3DXJA 1G7CA 4Q7JB 4RV5A 2MYUA 4YAIA 4L1KA 1Q7TA 3HSSA 5EJ5A 3HDQA 3Q3JB 3V8PA 1RKQA 3LGAA 3EXG1 1G5HA 1T0UA 3ZVLA 3HKDB 4N5IX 4NDZA 4DN6A 1G20B 3COPA 7REQA 3DFIA 4HUTA 1K4MA 4D0NA 2JLAA 3DBRB 2HJRA 2P4HX 4FYXA 3UXYA 3AU9A 4FCVA 4KRFA 3PQ7A 4RK4A 1U2DC 2Y1WA 1C4OA 2A68A 1KXZA 1Y80A 2PSEA 3KOYA 3L4SO 3S5UA 4BNXA 2VQ6A 1JR4A 4L2IA 1ZICA 2Y0PA 3CQ9A 4UUOA 1PK7A 3TW6A 3EVTA 4HHEA 2HRRA 4RPJA 3UXEA 6ABPA 2QDKA 2CUKA 5K4HA 4GMXA 3GPDG 1YS1X 3ZTYA 4HWPA 1XVIA 1JDTA 3OZWA 1DWPA 2VHQA 1QDEA 1BEEA 1X9GA 4FZRA 5AJVB 3GTOK 2PMEA 1MJGA 2IUSA 1YC5A 3DAFA 4LHYA 1U0BB 1GCIA 2F67A 2E85A 5BSMA 5FBVB 4KXNA 1KO4A 4JP3A 3DTNA 3PBKA 2VK1A 4ESOA 4QOJA 1VGQA 4V0LA 1EJ6A 2Q5OA 3T3HA 4BVLA 4F96A 5BOSB 4RV9A 4Q4DA 4LRTB 5L3VA 3L0SA 5HIJA 1PZGA 3WIBA 4GZMA 2BSQA 1CNMA 3PSHA 1ML4A 4Q3DA 3DD1A 3K20A 4X65B 4WFIA 1L6RA 2Q6LA 3V34A 1CLEA 2CBGA 2YV4A 3L6EA 3GJZA 4GSYA 2E2IK 3M5DA 4MIYA 3SICE 1YB2A 1NMQA 1PWZA 2ODQA 3PDUA 3WQQA 2QLJA 3FI9A 5IKPA 3MCZA 2QE7D 3FKIK 1TW3A 2QU7A 3RBAA 3DLHA 2IEBA 4OQXA 1KZYC 4MGYR 2IODA 3QG5A 5CLJA 1UFKA 4QIHA 2FQXA 1XXHE 3O2SB 4FYVA 4QM7A 3H4MA 1M76A 2OZPA 1FQJA 3S1SA 2I4IA 3N6VA 1QONA 2QD3A 3GRKA 4DQ0A 1F8XA 5KKCA 1R88A 1NQ5A 1TD9A 2QVLA 3BJRA 4LV8B 3WGHA 1WKCA 3KJEA 1CUCA 1VPVA 5DKFA 5EJEA 4MVJI 4QYIA 6LDHA 1ZJYA 2H54A 2QJRA 1X7YA 1G98A 2ETVA 3EQ9A 4TV8F 1H05A 3KALA 1BE6A 1QGYA 3E22A 4FMDB 3V4RA 4IDCA 4BZXA 1ZLXA 2C8KA 4LK3A 3KNZA 3DDHA 3I61A 4IP0A 1V1MB 2JEYA 3S8MA 1VYHA 3QV1A 2O0KA 3MTAA 4GNRA 1NFRA 1XT6A 4TQ9A 3D54D 5EG5A 5A4JA 1BJRE 5KX5F 3II6X 2DBVO 1QVWA 3QEKA 2HPZA 2L82A 4HGNA 4FW8A 1EUQA 1RCFA 3KYDA 5CB6A 1F51E 1LPAB 3DFZA 1USOA 1NXTA 4JVOA 5CFMA 1CSEE 3HLYA 1CY8A 4X7MA 3A6DA 5LB2A 3B20A 1UKBA 1RPTA 1P9OA 2QK4A 3OKFA 2ESRA 2VNIA 4QQNA 2CK3D 2WD7A 3BIXA 2BTQB 1DXOA 1P7PA 2AOVA 4WJLA 4B3GA 1XELA 3DFKA 4Q0MA 1DL5A 2GNPA 4JSYA 4WXMA 2VJQA 3VGJA 4ZGGA 2PM8A 1N5MA 3DOJA 1E9FA 3Q7RA 5AVRA 4JB0A 3NBZC 1H2RS 2VQEB 5AK3A 1YS7A 2BGTA 4Q4HB 3TNYA 4DARA 3WLJA 4DCTA 1VPLA 3U4GA 1IL2A 1U2EA 1V25A 2HA3A 3HOVC 2GX6A 4BCBA 4W5WA 1KIMA 4A3MC 1GVHA 3VISA 5LOVA 3MRVA 4K6CA 4C04A 1YQDA 3A4YA 3RU3A 1ZNQO 1OUMA 3UMGA 5KSZA 4TV8B 4JBGA 3W1EA 5ARBA 4NBSA 1PYDA 8LDHA 3ESCA 1NM5A 3TIIA 3ADDA 4DR6B 4EVRA 1RAGA 2BMDA 3CJRA 1OBVA 4E46A 1BH6A 4Z51A 1CIVA 2IYLD 2VXOA 2QQEA 1F20A 2QUIA 4HPJB 4V0QA 3KX2A 2RHLA 3K1ZA 1SEVA 3EJ6A 3HBJA 4WXPA 1I7LA 2RI6A 1NULA 5KPDA 1ONNA 2XKKA 1XTPA 4RY9A 3RR2A 3G85A 5KO2A 3QK7A 4FE7A 4ZHQF 1QOZA 3BWDD 4GQAA 4ASUD 2JKVA 5A04A 1MH1A 5CHYA 4TGLA 1G5IA 3IOMA 4JOCA 3UW3A 1VHQA 4RTJA 2A35A 3MPOA 2RCYA 3HTXA 4MCHA 1BH2A 3RTEA 3WE7A 2J5XA 4PLGA 5CXXA 2R93A 4JYPA 3VZPA 4I6EA 3KXPA 3LBYA 4B82A 1Q1GA 4KVAA 2CJWA 1L3IA 1P2TA 4MPJA 4QGGA 1IWBB 2HHAA 2DT8A 3AYZB 3DBLB 4R98A 3Q9LA 1G20A 5DHSA 4OMUA 7REQB 4MR7A 4WRRA 4DLLA 1LRKA 1L4HA 2WWHA 3SEAA 4EB3A 3U49A 3KK0A 3AKZA 2G8LA 1RQ2A 1JU4A 3G82C 3BB3A 3NR2A 2QUHA 1VSQA 4JBIA 2B1IA 1XF9A 3TZEA 1LUAA 4UM9D 1AQNA 4UAGA 3W8NA 5BXYA 1Y63A 2O5VA 3GNLA 4BV8A 1VXOA 2GK3A 3DGFC 2PYZA 2W2LA 3MS4A 2CXPA 4HDMB 1UWVA 2CC2A 3B3FA 1S1CA 3I5AA 4H08A 2JFGA 5C31A 5GJVC 1AB5A 2KLHA 1T25A 3P0IA 4Y1RB 1I3QC 4G65A 4ITUA 4XM1A 1ZH0A 1USKA 4CT4B 4EVIA 3GLKA 1VLOA 5DOZA 2J09A 1AMOA 1EM6A 2AI2A 2GTPA 3QPDA 4DIKA 1XROA 5DISB 5U4XA 2GWHA 2E82A 2HO5A 4FZVA 1EK6A 2BM0A 4JSRA 1TW2A 3PA6A 4XX0A 1Q1QA 4L95C 4GLLA 2Y1XA 3PGVA 2AZXA 3BFVA 3ADAC 1RC8A 2X42A 3DMGA 4JJ6A 3THWA 5JD5A 4ZI5A 4G1CA 1PYGA 2H2FA 1H8ED 1USUA 2CXXA 2HCRA 4XAQA 4ZOAA 1E3WA 3FX2A 5E6RA 3LFUA 4KPYA 4FFNA 3AM4A 4FQ7A 3B82A 3H5TA 5BVGA 1KI3A 3B7GA 3L4BA 4MJLA 5I7AA 5B4UA 1PNRA 3O6VA 1HC7A 1OR8A 4IVRA 5EIBD 2ZWVA 3B1ZA 4ZU1X 3B5EA 4UUAA 5A3SA 5BN4A 3ZQJA 3BD6A 4GX1A 1Q91A 4IIJF 1W4RA 4ZCPA 1VE3A 3HB9A 4MI1A 3EXAA 1GCAA 1X7YB 4Z9XA 4EDFA 3PF9A 4JHLA 1U7XA 3QOWA 1KH1A 4TLMB 1F0PA 3ZWBA 2GYVA 2OO5A 2QZJA 1NW9B 1PL7A 1Z29A 4KCGA 2NT3A 4MXDA 1FUUA 1KOJA 1QZUA 1V1MA 3FHLA 3NBKA 4LA4A 4Q19A 1DEAA 1D2NA 1A7KA 1F9EA 2FPXA 1SVOA 4J16A 4P58A 1FP4A 3KYIB 4IXTA 4TSRA 3S1AA 1A7AA 5EWMA 2FAXA 4ESEA 4UBNA 4C6HA 4KR6A 3B12A 4NMWA 4G81A 1J0DA 1FDUA 2YDXA 4P83A 2E2HK 3T3GA 1U11A 4BLQA 3JQ7A 13PKA 3CF0A 2G4CA 3OE7A 3OJOA 1UJCA 3OIVA 2IKSA 3C5CA 2W4IA 3EW9A 3CCBA 5B4TA 4KOAA 1GZUA 2C4NA 4MJXA 4RY8A 2D54A 1IIRA 2X40A 4BAUA 4WXEA 3T0FA 2HOQA 3JW8A 3W6PA 2QRUA 4BNYA 1WUIS 1KZ6A 4PHTA 4COOA 3AD8C 1UOPA 2Z5FA 4US2R 3FFBA 2IOYA 8GPBA 1JHQA 3E18A 5TMPA 2HF8A 4AKTA 1XEXA 1YKFA 2CY0A 3ROXA 1BQ3A 2YU9A 1FRFS 2W4QA 2WJVA 3AQOA 1SPXA 2O2GA 3PHGA 2QUKA 3QJGA 3LSYA 4GM1A 5ALYA 2TS1A 3D02A 5H68A 1TA4A 2AE2A 3CURA 3KKMA 1GEGA 2CCGA 3F5SA 3CW2A 4HWGA 3DZIA 5L4LA 2QM7A 3NBQA 3R3WA 4RA6B 2YBEA 1XDDA 4EY3A 4OSEA 4AWXA 3HS3A 2C3PA 4PPGA 4WILA 4MUAA 3T95A 3LBFA 4CKXA 3K0AA 2AVNA 1DIOB 1X7WA 3H7IA 4JL8A 4NDNE 1NGSA 2WE7A 1I6HK 3GTQC 3WDKA 3AJAA 2R7AA 1MOQA 2YMLA 3I05A 2LR0A 1JR3A 2C7VA 5JAUA 3NP9A 3TG2A 2ZB2A 4HF7A 2C03A 5EIFA 4ZHQA 4EPWA 1C50A 5E6UA 4N0QA 3UC5A 4GD3Q 3CUTA 4BE9A 3VMMA 2QP4A 3LUBA 2EV9A 3LYAA 2YXNA 4V0MA 1TIKA 1G3MA 2Q21A 3WMEA 2YHBA 4GLOA 5HE8A 3WODA 1NYTA 1TMKA 1VI2A 4KDEA 3WP0A 3SIPA 3U0VA 3STWA 1JQKA 2R93K 4M76B 4C89A 3UBTA 4MEJA 4U00A 1JPJA 3OJEA 3UM9A 1FB5A 3LPNA 2PD4A 3IHLA 3M9LA 3CAGA 4M1KA 5P21A 4FC6A 1SCQA 4D9JA 1RLUA 4F9GA 2FG7C 3GLIB 1J06A 2A9QA 1IK6A 2X5XA 3AYXB 3IKJA 4QBHA 4DQLA 4MP8A 4EG8A 2Y0SL 4AY2A 4C5AA 2RK6A 2YZKA 1VL2A 3LSTA 3WIEA 2W6JA 4L0QA 1PNTA 4BQOA 1L1EA 2JFXA 3PB3A 4UCWA 5H80A 3TEJA 2OFXA 3SVLA 1V5IA 1A9TA 2CB0A 4HGRA 1A1VA 1W581 4OIPA 2EKQA 5IKMA 2VJNA 3NATA 4MDYA 3GDWA 1N77A 2YXDA 1XQXA 3CZ5A 5K0FA 4O0MA 2M1XA 3R40A 4OEHA 5CX4A 3SVZA 2PQ0A 3I23A 4JCOA 4KFRA 4U7GA 2HLNA 1W75A 4QOGA 4AB1A 2XQVA 4DB4A 3H6HA 3HBLA 1G8GA 4A3IK 2P5UA 4ILDA 2F9LA 4KQEA 3RS9A 1KDRA 2P1ZA 4K2HA 3TOSA 3IR6A 2ZI3A 4PYNA 4BQSA 4DREA 1BE1A 2Z8XA 3MFYA 3DBOB 3QHAA 1VZ3A 4WL0A 5AHWA 3RZDK 2WKSA 4DIBA 1FW8A 1Y48E 1OLOA 2R97A 5I7UA 1U1CA 1I0LA 2YOGA 3EEIA 1C3OB 1Z47A 1EAMA 2ZR8A 4OMCA 2DWCA 2NU9A 3GJ0A 4OV6B 5HTOA 2HMVA 2VQFB 3NFYA 3QPAA 5D3KA 1DAKA 2WPNA 3LK6A 2CMHA 1YQWA 3TL2A 2XMZA 4HNQA 3SFVA 3ENWA 1ZVVA 2V6JA 3OC6A 3V9PA 4GF5A 3Q7IA 1S5PA 4HDSB 3VO8A 5HKKA 4KIFA 5B1DA 3JZDA 1FZQA 1BS9A 5KYYA 1TWHC 4QTXA 7MHTA 2BHNA 3PNLA 3UT0A 3AFOA 3W8RA 4UM7A 2WHQA 3QEJA 3U61B 5L46A 5BN4B 3DLTA 5ALUA 1BEUB 1Y4SA 4X1KB 3D6HA 1I4TD 1MXHA 2ZB4A 3HOZC 4IRXA 4L0DA 4OHCA 4R68A 1L5NA 5HOEA 1Y3BE 4A73A 3OU6A 4KXWA 4UFPA 2ETXA 1T4DA 3U44B 1ZNWA 5CLQA 4A0SA 2PCLA 5DU2A 3GLGA 5D87A 4DPLA 3KZXA 3QUSA 2C1XA 1H42A 2X0JA 1WNTA 2WUDA 1FDTA 1OAAA 2BGMA 4URUR 2QHXA 5EP3A 5JWHA 3RTDA 1YT5A 3UENA 4GS5A 1TEZA 1GDTA 3ZDBA 3ITKA 3SSOA 1NVAA 4K6OA 5FOWA 4YXWD 4BVBA 4HXEB 5LNK6 3MMNA 2DULA 1LTQA 4ND4A 4BMSA 3LX4A 3MEQA 3I6IA 1KKUA 1POWA 3T9CA 4EBFA 1D4OA 2ZYWX 4C7MA 4ZT3A 4CL0A 1EJBA 2I29A 4K9NA 2X8JB 1ZGCA 5JSZB 1XKTA 2NZWA 3DMNA 1Z5WA 2GPTA 4JU8A 1LBTA 5JNLA 4Q4CA 4MLCA 4CYMA 2IGTA 2QB5A 2PMZD 3E4DA 3JWIA 4IFBA 4J0HA 3RANA 3VSCA 2R8YA 3RJZA 1N5JA 3JRWA 1EQRA 1L7DA 1UF9A 2JLZA 1VRQC 4F38A 2FFRA 3P2YA 2Z30A 4KYIB 4WA7A 4FZJA 4I1OA 1CJMA 1F6BA 3FTQA 3WWOA 3K0SA 3WL6A 2F7SA 3K1AB 4OHMA 1FFEA 3EY9A 4KDRA 5GY7A 3N70A 4CEJB 1I4WA 2O0HA 2CXRA 2XZLA 4Y6SA 5IW8A 3CF6R 1A9ZA 3ZV7A 1GARA 1DIHA 1UPUA 4EFDA 1UPTA 1AGRA 1CQPA 3V55A 3T5MA 1GTMA 4Y2RA 2GM4A 1FLAA 4D8WA 2B0JA 3M3YC 2W48A 4FN5A 4KKXB 4JJIA 4M7OA 4O0LA 2WVJA 2J3HA 3CEPB 3GLSA 3HWRA 2O5EA 4AKSA 4JT8A 2G36A 4QDKA 4CMHA 1OFGA 3PYMA 4WOCA 4DDKA 5CAEA 3FDFA 3FPGA 3I6BA 2NSYA 3UHJA 2W8ZA 3OT4A 4LF6B 1ZH2A 2ZR9A 1PV1A 2E55A 1SMKA 3OCVA 3TUIC 3AFMA 4UNPA 3VR3A 5AVYA 2HIMA 4YO7A 5E6UB 3JWJA 3NYRA 2CL0X 3RREA 4OXRA 3K6JA 3LQYA 3WB2A 4UUBA 3I5MA 3DE6X 2FW1A 3D1VA 5D7BA 4B3RB 2GCIA 4FOSA 3ONEA 2NZVG 1WQGA 2W2KA 4ZC8A 4R2MA 3S2DK 3NWOA 2MMGA 3SI7A 3QNWA 4YCMA 3A3OA 1E2HA 2WUVA 3LQ4A 3I8OA 2O6HA 4J0IA 4WBSA 2DPMA 5JSKA 1NVBA 2CDBA 4C4AA 3OJWA 4X20B 4MKFA 1YK0A 5E4FA 1TM7E 3RAJA 5KVQA 4KAAA 4GVPA 3MRXA 4KWIA 2H7YA 4EYKA 1V43A 3GU3A 4KQXA 1R12A 1TMGE 2FW7A 4G8JA 4IIGA 1AN9A 3C98A 3L0OA 1CP3A 1RI2A 3W3AA 4NHOA 3DKVA 5LM3A 4GFDA 2GEJA 2G70A 3HV2A 4F84A 4F3CA 1B3RA 3R3ZA 3V7NA 4TYNA 2R6HA 4ND5A 3B53X 4B7ZA 2CZCA 3FR7A 1X1EA 4B31A 5C80A 1ZQ1C 1VI6A 1YR9A 1YS4A 4NSNA 4YRJA 5F1KA 1G8FA 5FWXB 2IUEA 5LJIA 2NVXK 1SQSA 2OV3A 2C5AA 4IMPA 1BHQ1 2ZOSA 3IQFA 3GNQA 3B85A 2F8LA 2X1LA 1EHIA 2ST1A 3H1AA 3NHJA 3W5HA 4A2PA 5IRCD 2JGFA 3ILHA 3C8HA 3G9UA 4LYDA 4GTEA 5IVIA 2O8EA 1W29A 4G1FA 2PSHA 4EFNA 1N34B 2AN3A 2WNSA 4YFXA 2AQ8A 3M5CA 3O8QA 4Y7DA 2PRJA 1T34A 4OQYA 5C2JB 3MXTA 3IT3A 3TFIA 1T8WA 4F3KA 4MW6A 1IBMB 3N2KA 3JQPA 5DX1A 3MMPA 4UPDA 3S40A 3LAJA 4IV8A 4C3JK 3UAZA 1G6Q1 3OE7D 1WMDA 4J9UE 3R7WB 1B6SA 5DYIA 3BMXA 4EY6A 4JLJA 3Q5DA 2BF7A 2OBLA 4DEYA 5A4AA 3HUUA 2Q1WA 3FSRA 4MUMA 3IAS6 3M6IA 1YOVB 2IHUA 3PEFA 2WF5A 1E1NA 1E8DA 4IZOA 1XWFA 2A59A 4CPDA 1O2DA 2M6LA 4F8EA 4IDEA 1N2CA 2FFAA 2FHSA 4IJ5A 3AG5A 5KTMA 2J3IA 1OH8A 3HKZL 3NJ4A 1I2ZA 4FLEA 3UATA 2O8DB 3ZGNA 1H1DA 4J4BA 2H00A 4RACA 3GFRA 2WWYA 1R0BA 3O91A 3O8LA 3KPWA 5JHHB 1KVQA 3K30A 3NB0A 4HQLA 2QN9A 3PZBA 4MGEA 1JR2A 3QXXA 1EXNA 4F9FA 3H5NA 1SZCA 3GRCA 3KQYA 3QU5A 4Q82A 4KXLA 4YGXB 3SQWA 5GGYA 1W49A 5EWJA 3PDIB 3T00A 1Y8AA 1XQVA 2QQ0A 2C5LA 4LTNA 4Q7LA 5A3QA 3WWCA 3F7OA 1NBOA 1AHHA 1MO5A 3DAHA 4TXMA 2EFJA 3UJPA 5ADHA 3KCNA 1E2DA 1NR7A 3ZQ6A 1FNMA 1R6UA 2GARA 4KPUA 4GX5A 4XJSA 3L8ZA 5F76A 4BASA 3OZUA 1EZZA 3HVJA 3MCUA 1GSIA 4G1BA 5JLJA 1CQIA 5EE3A 5F2EA 4MW1A 2QRGA 4PS1A 4D99A 3P9SA 3TNDA 5ELMA 2FQTA 3O75A 4QODA 3SR4A 4NR0A 3C45A 2H2IA 2X4IA 3R7FA 3OFNA 5IF9A 4PIVA 3RYFA 2HHHB 1K7YA 1Y5MA 5C3EK 4Z3DA 4ID9A 4ZOBA 3K9NA 3FPKA 4MCIA 1U4NA 4COKA 4IHJB 4UTZA 1RNLA 1QC5B 1KKLA 1S8OA 2QWXA 4C5BA 4D44A 5HZKA 4M8IA 3ZDDA 2NZUG 4IH9A 4U63A 3DVQX 2CFTA 2REQA 1LW6E 1B8OA 2BE9A 4CLOB 4H6VA 1M66A 1VLMA 2FSSA 4IQGA 4RVUA 2V7XA 3PA8A 1SRQA 4TZKA 1IE0A 1VQ1A 1ZEMA 1B73A 4TLLB 5GPBA 5CITA 4R2LA 1IVNA 1H1LA 1UPXA 4KH0A 4YRFA 1E2FA 2HY7A 2A9PA 1D6MA 4GPIB 1NTRA 4GIBA 4I3HA 3RC3A 4NCXA 3UFXB 2JFWA 4PM4A 4CCWA 4EYQA 1ZD1A 1HSOA 3IT0A 3UKOA 2XNDA 5DV9A 3A1WA 1H22A 2NIPA 4IRUB 1Y8ZA 2HV8A 1XFAA 3IT2A 5DWVA 3CEJA 3BIFA 3HH8A 4IH4A 3V42A 4EGFA 5FOQA 3V1UA 4PNHA 3H0GK 2AOWA 4TYQA 4A3EC 2XOKA 1S02A 3IEPA 3IH5A 2P91A 1CUVA 3ZWNA 3GTGC 3IJ5A 1XPRA 2BONA 2I7CA 1JH9A 1T1SA 4B6FA 4TV9B 3HI4A 1X1SA 3CISA 4RULA 1YSCA 4CN9A 4PLPA 3PI7A 1I94B 1HYHA 3A8IA 2IZZA 3FCXA 5PGMA 1W0KD 5F7JA 5IYDC 1RZUA 3KOWA 2I2FA 2AXEA 4X6XA 3QQ5A 5G53C 5THQA 4B6SA 3ZWVA 2JGMA 1EB9A 2I65A 3PXXA 1QIMA 3CUUA 4B32A 2EL7A 1Q7CA 3HB7A 1OWMA 5CJJA 3TW0A 3OX2A 5LWQA 1QGED 1E5VA 4K05A 5KTKA 2J0VA 4YJDA 2EQAA 2ZB7A 4M86A 2E2HA 2RGUA 3FCOA 3VNRA 3WA7A 1OPXA 1XC7A 1RAAA 1S2DA 2NUTB 3CO0S 3KUKA 4JJAA 4L9SA 5A1TA 5JS6A 4MRNA 3U3XA 2EX1A 5IOQA 2I4OA 4BTLA 4QULA 4X24A 1K63A 1RADA 3C1UA 3U3KA 5LQAA 2H51A 3D3NA 1HFKA 3ETLA 4JODA 4MA0A 4WKPA 1ISEA 1P8AA 3G3EA 3QV2A 4KMSA 1W5BA 4IOMA 1WCIB 4NMXB 1NUHA 4QJIA 5FYQA 2J3JA 3DDWA 1TYEB 4DJ5X 1W9HA 1UJ6A 1TI7A 3ZHQA 4F46A 1FTSA 1CF2O 2XY4A 3H19A 5A02A 5I4CA 3C3AA 3NBUA 1T43A 3BGVA 1SC9A 3ICQB 1REQA 2O3SA 3C14C 2NMVA 3KVRA 1T3TA 2E4ZA 2ZJ3A 4PANA 1Q1NA 1XD8A 3WK7A 1DCTA 5IP9K 3H5LA 4C4OA 1T6YA 2H31A 5DZSA 3HGQA 5FWYB 3GUHA 3KVNA 4MQ9A 1O0SA 4OOEA 1U2PA 4QAQA 4FJ1A 3I01A 3BC1A 5T6BA 2YJ6A 3F7NA 3DXXA 1CF9A 2AJCA 5C8VA 4P32A 3KVOA 1A98A 1DBPA 5CMLA 1DB3A 3A27A 4OINA 3A3NA 3L6CA 1XVUA 1JR3E 2P8SA 2GRJA 2SBTA 2VJDA 2CL6X 4A5OA 4B34A 5CBKA 1GTL1 1SUIA 1IEQA 2FPPB 3IVCA 3H83A 5EAIA 1M7GA 3W3ZB 4MW0A 2YQ4A 4NKRA 2D0DA 1G1AA 2R5NA 3EIUA 1IATA 2J6CA 2WF6A 3OTGA 1UANA 2I4RA 2PVCA 1OX4B 1XU9A 3SHVA 4DS3A 2IBMA 1ZYRA 3I9LA 1GUFA 3A14A 4HB4A 1KZHA 3OQIB 4B7XA 4MWCA 1QOPB 4XB6B 2O8DA 4PAMA 3HKZD 4A3FC 3FLMA 1BZYA 1HLGA 1SY7A 1Z3CA 2GT1A 2PIAA 1P3Y1 5DTEA 2CLOB 3RBXA 2XUGA 3MILA 2QQFA 1EVKA 5EWLB 4Z0NA 3TM4A 2VZLA 1BW9B 4P54A 5EGNA 1ZU4A 3A1EA 2MDTA 1QHNA 4IMJB 4YY3B 1CERA 9LDTA 1SXGA 4LGMA 1H23A 2ZBVA 2I03A 1CNFA 5IG2A 3KE8A 1DJNA 1MABA 1Y1RA 3VSBA 4JGGA 4R1NA 4EPRA 5AW8A 2JVJA 1IL0A 1NPDA 4B80A 2I8AA 3ORSA 4EIWA 3KKQA 1SNYA 4E4YA 1FLNA 1JG2A 1Y4ZA 3FOZA 1XUOA 5FPHA 2ATVA 5JRZA 2CT8A 3HJFA 2NAPA 2D4HA 1FRZA 1RJ9A 2X0RA 4KQ2A 3H2SA 4PPQA 5G4KB 1B1CA 2QTNA 1MAVA 1KQNA 1PV4A 1WV0A 1HNWB 3EXFA 3ZX5A 4ENWA 2PNFA 4G8CA 4EF6A 1X7ZA 4PLFA 2M6SA 3UUFA 3ZNOA 3Q0TA 4RZQA 2FOIA 4Q4LA 1HL7A 4Q37A 2B21A 3AM1A 2C8JA 1RRVA 1I80A 2Q6IA 3GLQA 3OD5A 4WECA 1T1EA 4F1JA 1X1QA 3E9RA 2IP1A 2A58A 4Y1GA 5AI4A 3RS0A 4BEBA 2DQSA 2GEVA 1KEKA 1VJCA 2XECA 1JA0A 1HX7A 2RDMA 3R2JA 5JSUA 3HGTA 3TW8B 2I1WA 1MZPA 1CULC 5IK2A 2CE7A 3NDIA 3EGXA 1CRWG 1BYUA 5KSPA 1DKNA 5TMEA 3HU5A 3K9GA 4BVJA 1NR1A 1Q5PA 2BFBB 2G25A 1NXQA 3NUZA 1EUCA 3AL3A 1XWWA 1PR2A 1P1CA 3FMPB 5H1YA 3I6YA 2XGJA 3D5TA 3HXKA 3E6AA 4MS3A 1WLYA 1SQ6A 3KYJB 1RKUA 2EWMA 1UFOA 3VZDA 5KREA 1W19A 1O54A 2DFTA 2VPZA 3M4JA 1CETA 3GK3A 4RPCA 3TSAA 3UCEA 3JASA 3A6EA 3DXYA 3RC7A 2C20A 4JI6B 2YWXA 6REQA 4TUYB 1JIQA 1WOSA 4LXQA 3TLZA 1ZK2A 1DT5A 4KLRA 4X5OA 2X0EA 2EYQA 3TTXA 5FTJA 3VR5H 3DFMA 4PAGA 3FTDA 4RTRA 3BBPA 3QOFA 3WRVA 2EDAA 4G5RA 4D8UA 3PFNA 3WYNA 2GF9A 4LECA 4X66B 1U9IC 2QDXA 3CRVA 4X8OA 1DAHA 4IFEA 1FFXA 2D1YA 4OQNA 3OQVA 3AW9A 4S3MA 4G5FA 3D4OA 2A2ZA 1FTNA 5ALSA 2HPAA 5EPEA 1IN1A 3QFFA 5ALXA 3ZI0A 5AW1A 4A2CA 4NTZA 2ORIA 1DC6A 1OOEA 4Q9NA 5K7SA 1CZRA 1IFXA 3PFFA 3NCHA 5H59A 4L8LA 5IMSA 3UK1A 5JALA 3JATB 5FOXA 3U26A 2JA2A 4R2XA 1SBTA 1JHMA 2QTRA 1VTKA 3D8NA 4TLCA 1EFDN 1P4SA 4LFCB 1L8LA 1AD2A 1Y8RB 2NACA 2PMKA 2ECPA 4US1R 3RIXA 4NBLA 1AXGA 1T3SA 1GNSA 4DHWA 2VBIA 4FEGA 3S1MK 1FFCA 3NEJA 1XMPA 3SU8A 2Q49A 4DQKA 3KSAC 2FF5A 2FE4A 5JCJD 4RAQA 5GINE 1G5QA 2HIGA 2ZJ4A 5B64A 2BDUA 2VCYA 2XGGA 3FPBA 3ZOKA 3L92A 1WS6A 2XGOA 2UAGA 4E70A 4D5EA 5BSRA 1BKYA 1RXIA 1THMA 1WUKS 2ZJYA 1OX5A 1C7ZA 1VLZA 2I9KA 3ODGA 2IOFA 4NE2A 4BQQA 3G59A 4WXHA 4D8VA 3LZDA 3IILA 5HSGA 1TKRA 2XUKA 1GSOA 1W88A 1I3QA 2OTCA 3HRHA 1ENYA 3RC9A 4NU5A 4JX9A 3RFCA 1CHDA 3JD2A 3HN2A 4P0PB 2DRIA 1Y7HA 1W94A 2DLCX 4ERNA 4CDMA 2WJZB 3CCCA 2X58A 3DS8A 3PUZA 1ECBA 4FVTA 1GG9A 3KKPA 3RRFA 4HDNB 4KE7A 4O8ZA 1DPFA 3IDQA 3PQ6A 3H9UA 4AP5A 4KAWX 1FW6A 2B2CA 4JBLA 2IE8A 3A58B 1KZGB 2OGSA 3B1VA 4PYOA 3WGJA 4PZLA 2PUDA 4TXLA 4AUNA 1Y8QB 3RSZA 4BVFA 4YMVA 1ADYA 3IT1A 1LVGA 2ZI5A 5EPOA 5LZ8A 1PT5A 2YN2A 4QLBA 5HM8A 1SVMA 1NN1A 3OLZA 5FNZA 3EWSA 3W05A 3ZE8A 1W36D 2YX1A 4Q3KA 1Z0JA 3OIFA 4O8CA 4F2PA 3LHDA 3IEXA 4RVNA 3BMOA 1BAPA 3AP2A 4C43A 3UT5B 2C3MA 3AEKA 4FJ2A 3UNXA 4CG0A 3TSZA 3PFKA 3LE8A 1Z5GA 2NO4A 3IVAA 4IJKA 4KAXA 4RYDA 4TN5A 3EXG2 3F46A 3T61A 5ICGA 2AR9A 4L3VA 3N0VA 1Z15A 2VPTA 3EXEA 3ZY5A 4J16C 1BE0A 3S16K 3GLVA 4AG3A 3EXFB 3FDIA 4AO6A 4MINA 3ZI7A 4DEVA 3DMHA 1PFQA 1XA4A 4ENTA 1Z0SA 1I30A 1HYBA 2A30A 5IJ9B 2D3TA 3CRNA 4B81A 3EPKA 3HR8A 1JL3A 3H04A 1LDEA 2AI3A 4QFDA 4R1SA 3ZKWA 1NE2A 3GT3A 1TEVA 2A5YB 3T5PA 3FPSA 4NS4A 4RGQA 4QTTB 2XA2A 1BCSB 1AGYA 2V55B 1Z6TA 2ZI7A 2GDJA 4DSNA 3UPTA 2EYUA 4NXMB 3NHWA 1HE8B 1NVGA 4LHEA 1P74A 1WDWB 2BEUA 1OC2A 1ZN7A 3ZK9A 5DNUA 4I9FA 1PR0A 4L9WA 1QG0A 4A9AA 2MSDB 3PZRA 2XTAA 3SC3A 4DTIA 5EZ5A 5MFZA 4IV5A 1QH1B 2VKTA 1C4XA 1TZMA 3LY5A 4UU1A 1T1GA 3PC2A 4KQHA 4P8RA 2YU9C 1YKGA 4KJXA 5UKDA 1D9ZA 4ZKEA 5CDFA 4Z9BA 4WMLA 3N7TA 1WCV1 2HEIA 1E89A 5C8YA 4AW9A 3EASA 1WUJS 5HMMA 3UMRA 3P0EA 4F21A 2GESA 2PGXA 3ZUPA 2J0SA 2EWVA 3DMDA 4HYTA 1RQ7A 3A8JA 2P8JA 3N2IA 5ALPA 3WOHA 3UUGA 2WQ6A 1IQRA 1Y6ZA 1K4YA 1R7RA 4MW4A 4TUYA 4ZVMA 4MUFA 3UJCA 3PHJA 1PEKE 3SZOA 2OXEA 3HEMA 4RMJA 3MGBA 5JYBA 4L3OA 1L4MA 1LV7A 3RIGA 5I47A 3AZQA 2FKAA 3I9V1 4RMHA 3WHLA 2C0PA 4QNRA 4LQ4A 1E1LA 3BMQA 4B87A 5J47A 3N39C 1VJTA 4ZTZB 3AH5A 2FMXA 3HNRA 5TF4A 4OKIA 5LOVB 4LAFA 2CUTA 5JRDS 2XMSA 1RXVA 1EM8B 3HP4A 4GL4A 1XXHA 3TCXB 5K8IA 1KA9H 4MUJA 4PHHA 4YAJA 3CXRA 4I55B 4UDNA 3X1YA 2VSOA 2P0EA 4DDWA 2IA5A 3I28A 2CHGA 5L6LB 1Y8RA 2O4CA 3ES9A 3W8FA 4UXIA 5LQNA 1Z83A 1Z2AA 4NPHA 2OCKA 3DBRA 4ZT2A 5KX5A 1PWYE 3FJ1A 3KLNA 4R01A 4JEMA 3QBJA 1R4AA 1P4HA 1KK1A 4DUGA 5A1JA 3LC1O 1P2UA 2PKEA 5AJUA 5B1SA 2O7QA 2SCUB 3ZGYA 3F4KA 1NY6A 2X7HA 2GEDA 4Z5XA 3HKDA 3F1LA 1PLKA 3PJFA 2NVQK 1OASA 2KPOA 3NPAA 3AUKA 3NASA 3TD6A 4ZYLA 2QTCA 3VVBA 5DTQA 2R1ZA 4G5YA 3AM3A 3VO9A 1UWCA 2H2AA 5EXXA 2IWRA 221PA 1M5TA 4BNLA 2OXRA 3E9MA 3I1YA 2B1RA 1RWVA 4EA9A 4DYHA 4H4CA 4IHQA 1VP9A 3B52X 1JYSA 3GLFA 4QC2A 4FFMA 3HOYK 2D74A 4KC0A 3LPAA 4Q05A 1U8TA 1R4ZA 3E81A 1T5SA 2FJ0A 2ZYGA 5C4JC 1SUBA 3EDQA 1Z6ZA 3UANA 3GTKA 1GU0A 4H7DA 5LOVF 3H3VD 1H2XA 5C4GB 5IJXA 2GVDC 2GBGA 3LWNA 4XCXA 3TKLA 1TO1E 3VX3A 2HBRA 2YUTA 3LI2A 1TWGK 1TAGA 3B9QA 2A67A 1Q83A 5IAEA 4K0KB 3KR1A 3G0GA 4JHXA 1FDVA 2J9FB 3J7TA 1ZCJA 1XDBA 5JCOA 2Z2KA 2B8NA 3OIGA 1HURA 2O2DA 1YZLA 1P1JA 1TVMA 2WG1A 1P3DA 3NNDA 4L4XA 2WY2D 2MR5A 3BEOA 2VJLA 3IAS1 1NSTA 1Z4NA 1T9AA 1PHRA 2X5JO 4V0OA 4XQ9A 4PHCA 5FKJA 3UJ6A 3OZSA 1KYZA 1RZRD 2PRKA 1FU7A 2C57A 4C2MK 2P68A 4TKUA 3IQDB 5ERXA 1BCRA 4KBFA 3FYCA 4HGOA 1U8EA 3AEXA 4EOGA 1XIVA 3F1KA 1C3JA 2QGNA 5I9MA 1IZYA 2FV8A 4TRJA 2MIIA 5CGZA 2P40A 5CH3A 4IIBA 4OLJA 3C6KA 1QUFA 1ZONA 2N1BA 5T57A 1CVRA 1QGUA 2GA8A 3QH4A 3TB4A 4ZJUA 2CYCA 2C2KA 2Q7XA 3QVVA 3AUJB 2VDLB 2KBEA 3FYUC 3PTZA 4RDIA 4TKMA 2G1JA 4CN8A 3E05A 4L5YA 2C8LA 4ZOCA 4CV0A 4OX9B 2VJBA 2VZ9A 2Q41A 3JD1A 3V1TC 1GTJ1 3RVOA 1E4OA 1RMYA 2IY7A 2CFOA 1PU2A 5HIKA 5FPTA 1SU8A 4UEQA 4XLNA 2Q3FA 3ZKWB 3GA7A 1P5JA 5LQSA 2O2ZA 2Z98A 4NZZA 3JQ9C 1ZISA 3SHQA 3W2IA 4AJIA 1JG7A 1KRXA 3H1PA 1FJHA 3EVAA 1Q20A 3TRIA 4W1SA 3ROZA 4MWGA 1J2UA 3OKPA 4MO9A 4Z54A 1TVKB 1KSFX 2EJTA 4IOLA 3PNVA 4AKGA 2R84A 2DR0A 3V2IA 4U3JB 2H5EA 4EB6B 2FZLA 3TAHA 3JX9A 2XVZA 1QH1A 2VCEA 4Q3NA 2VTBA 3VOBA 1T5OA 3AKCA 4A6DA 4QPDA 4LNUB 1DOHA 5P8WA 4X1KA 4C3VA 3WYEA 1E3IA 4GMGA 1E58A 2PANA 4MROA 2XQKA 1ZYUA 5DBEX 2NLOA 4EB0A 1EBFA 5H83A 4ZRMA 4UPVA 4CR6A 2GA9A 4RIIA 4E5VA 3COZA 1XPPA 3CE9A 1HDOA 2VRNA 3O74A 3K8OE 3KCQA 1RAFA 5EMNA 1JLKA 4D2IA 5L3SB 2XBMA 4QRHA 4A91A 3RZOK 3UMJA 4XSXA 4CMGA 2D8MA 5IWAB 3I4NK 4LJ6A 2R751 2AJ8A 1SXJA 1GKLA 4WFJA 1U6JA 3KS9A 3SF8B 1KJIA 1W2WB 5G3YA 1DJQA 3UJBA 5C4JK 1USIA 3AVPA 3ROGA 4LQYA 3QLJA 2O3QA 3G5MA 3CX8A 2GAGC 5CD1A 2OBFA 1NU6A 1QHHA 1V48A 4N12A 1GTRA 5TQVA 1U8ZA 1X7DA 2VNJA 2IDJA 4JI1B 3IP3A 1W87A 2QNBA 3EFBA 4GYJA 2QMEA 4ZMRA 5BQ3A 1ZXBA 2J3QA 2PR7A 1G8HA 2A1UA 1XZIA 2J5QA 2VAXA 3C70A 3HV0A 4FI3F 2G72A 2W6OA 3TTVA 3CR8A 1KDVA 4Z3OA 1I4EB 3A1VA 2QX9A 2GEFA 4CU5A 1IOZA 2IXBA 2PLNA 4IIJA 1NOKA 1W76A 2E48A 4IKOA 4LRYA 4QUJA 3KT0A 2FETA 4X3CA 1PX2A 4PSDA 2Z09A 2FWBA 3L0BA 3A7DA 3FB1A 3DW3X 3REGA 3TLGB 4EI7A 2XCRB 1JW9B 3KTAA 3NM5A 3UW1A 4MQEA 1E7WA 3JQAB 1M8FA 4XB2A 1W7AA 5J4HA 4JXZA 1NYQA 4MR7B 4UXJA 3QUTA 3U7IA 1U3FA 2NWQA 3PD0A 2J0UB 3M1IA 1FUYB 4DT1B 2AWOA 1MMFB 5HCIA 4N1AA 2AQHA 4L08A 1YH3A 4BFLA 3RIYA 2ZEJA 1D8AA 2EP8A 2PIDA 4ED9A 4EJFA 2VHCA 2X7JA 3W3AD 2PRZA 3N8HA 4TN1A 1TX4B 4ZOEA 2R2AA 1JHAA 1RFLA 1MDFA 1NSFA 2BI7A 1G2QA 4CIDA 2DJIA 2ZZKA 1EUZA 4QT0A 3THSA 3ZHYA 4MKIA 4E21A 2HHCA 1O4WA 4TL6A 1IH8A 5T4BA 3OQHA 2QD2A 5FJJA 1GM5A 3A1FA 1D6JA 4AFNA 2PKYX 4DLSA 2OSVA 1TWGC 2ZS8A 1M2GA 2Y0EA 2R8EA 3IQZA 5E3IA 1EQ2A 1JE0A 1CE8B 4IMRA 3ITEA 4Z4EA 4UM9B 4AXBA 4YP6A 1GUAA 4ZN6A 1N32B 4OD0A 4MWBA 2ZYSA 5JWRA 5FBZA 1SHTX 3NOQA 5GJWC 3A9SA 2NXJA 4C01A 1IN4A 1A5SB 3PUKA 1E96A 4KFSA 3G89A 2HGZA 5FUVA 4ZYZA 1JHXA 1RC0A 2J4DA 2OE2A 3NHUA 2BFWA 4I50F 3F5DA 4UVEA 5CM8B 5C34B 3OQBA 4UCXA 4HAUA 2J67A 3KD3A 4UHFA 4B3HA 4QYWA 5IM5A 1IRXA 1KDPA 2C94A 3LA8A 5FXMA 4NFLA 3WNQA 2EX0A 3NHMA 2N1MA 4TMXA 3RRYA 3A1NA 3ONFA 1IONA 3E2PA 4ZEWA 2FCAA 1V4NA 2OBYA 4K28A 5SY4A 5A9RA 2JEZA 3CY6A 4GBED 4CKBB 1I10A 1QQ7A 1BMTA 2OBMA 1AKNA 4LOWA 1V3UA 5DHRA 3GLTA 3U4QB 1UJNA 3CLRD 2E2JK 1WCMC 1U0LA 4HAOA 4JB3A 2P4UA 2WWTA 4QDOA 1GLGA 4IS2A 1SEPA 3LVFO 4LWPA 5MGNA 4RTPA 4U7WA 1E1YA 4LMAA 4B9EA 3RB8A 5C1PA 4LZWA 1LSOA 1H4VB 1ID1A 1GVNB 1O5IA 3O8OA 4D96A 2WIBA 1XX6A 3Q9NA 1MVOA 5BQPA 1DVRA 1PEAA 1GKUB 5H9VA 5DCUA 3BA1A 4DXDA 3SE7A 4Z6KA 4D4LA 2YVAA 5FHRA 3K1TA 1JKJB 3WICA 1PGNA 2L18A 3GUUA 5EP2A 4DG5A 3H9JA 1JMVA 1J0BA 1SVUA 2JA5A 2IVFA 3RGWS 3S55A 1JG6A 4HVCA 1NTOA 4JLBA 8ADHA 1C7JA 4JT4A 3KFXA 4CTKA 2FPGA 2QMUA 4D4HA 2P9JA 1X1BA 2RHWA 4TMVA 3Q5GA 1NIPA 1GPDG 1PUJA 4O4LB 3R6WA 4R84A 3VPDA 4NCBA 5A0TA 2HNAA 1OXBB 3SAJA 3NEAA 2VPIA 1AO0A 5H7XA 5GAJA 4NU6A 2EFYA 1Z35A 3ABSB 3T8YA 1KEWA 3CKMA 3AGPA 5M2QA 3TGPA 1PGOA 1TLTA 2CDNA 1KAQA 5FF9A 3VPSA 4EX6A 1WMBA 2ZG6A 4QFBA 1T0PA 4LOIA 2L0XA 3GJTA 3L7IA 4Q6BA 3FOCA 4XIFA 3L9XA 5F7XA 4A0GA 2HGSA 2A1TR 1T4MA 1JALA 1F3OA 1TT7A 1Y3AA 2H1RA 1EGAA 2N47A 2QN3A 3IP9A 5E38A 3IPYA 5FNVF 2OHFA 1Y4AE 5A7HA 1RYZA 2A1UB 3IB3A 4DBVO 2R4UA 4A3JC 1G63A 3FSEA 5JTTA 3HJTA 1HOXA 5JJIA 1GL9B 1J8FA 4BLRA 1YA8A 3QQPA 2WAXA 2CDAA 4FEEA 4E03A 1GQFA 2FG6C 2BI4A 1U81A 4W8OA 3U16A 2FQYA 4YP1A 1G21A 2Q8NA 4J94A 3RE1A 3TLGA 1WBBA 1H85A 1UM8A 3AH8A 3K35A 2VN8A 3LLVA 3MW8A 4TZTA 1U8YA 3N6RA 4ZJZA 3D6TB 3ZLUA 2UZ3A 4C4TA 1GNLA 4HEA1 1HE3A 1FMCA 1U6KA 2PX6A 2VP4A 3LFTA 4PLZA 4DXHA 4UTPA 2H85A 1WETA 2ERYA 5K8UA 4DT1A 4JIMA 4ZI7A 1DARA 4HVAA 2IOHA 3WLRA 4FGJA 1LJUA 1YZQA 3WC4A 1J5EB 4E3WA 1HE4A 2K87A 2R87A 1P6XA 4PS0A 2CYBA 4BU1A 2RK4A 5K99A 4V39A 5F33A 1WIWA 1MVLA 3AERB 4TTTS 4RSMA 1C3OA 2I87A 4C4YA 3PIRA 4PG8A 5JECA 3FD8A 2E2IA 3KU1A 3A32A 4ZWNA 2C2BA 3QX7A 4NV0A 2CXHA 5J58A 2Y6UA 1GRRA 2JGDB 4QQ8A 2I66A 4MLDA 3Q7PA 4Q1CA 3DCIA 4KXXA 4W7HA 3FHZA 1AO3A 1ZAYA 1UOQA 1X0VA 5IVPA 1C9YA 1DBQA 4CFYA 4BBJA 4BLPA 1YVDA 3D64A 4XR9A 4EKIA 1UMCB 4BBZA 2YL2A 1KP9A 5I7EA 2JAOA 4V0KA 4K9QA 1BVHA 1TWFA 4O33A 1NXWA 1BX1A 3EVNA 3EBOA 2DHEA 4HB2A 3DOHA 1EFPA 1MKYA 1TCUA 2GLTA 2JFOA 1TCCA 2NVTC 2NTYC 3BGDA 4HI0E 3VX4A 4D9HA 4EHAA 1XMIA 2C29D 2ODTX 2UZ1A 4RSRA 1AMUA 4D0SA 5ECDA 1Z36A 1SUFA 1OLSB 1VYTA 4ZDWA 1DRWA 2GKGA 4J76A 3UMMA 1TVCA 3KTOA 1UJ4A 4KI0A 3KLOA 2Q0HA 2I3GA 3L5KA 4G8BA 3MCWA 1H2YA 1TWHK 1XCOA 3GCWA 3FHJA 4HDQB 2D6FC 4X54A 4AJ2A 5DWQA 1G1MA 1RHMA 4E2YA 2YFQA 1KDOA 5FA6A 4CMAA 4DCOA 3RS7A 2IPLA 2HSZA 3QVXA 4RD6A 4DXAA 2C31A 4M1YA 5IJZA 4DDQA 4DEXA 1WUTA 4GOLD 4RLSA 3B6EA 4DBLE 4DCNA 1KEEB 2KE5A 3F98A 4HZIA 3VVMA 5ITWA 4K3UA 4WOJA 5DVZA 4KARA 4Q4ZA 2GPBA 2O52A 4J8PA 3DEIA 4L5JA 1PRYA 1YCFA 4M38A 3BJMA 1KU6A 4PWZA 1UC8A 5IYZA 2P9HA 2V6UA 3FWYA 1RRFA 1NLZA 2ATCA 2QX4A 3KZVA 4W1RA 3AT1A 5F3RA 4D97A 4EKEA 4XWYA 2UZ0A 2IOFK 3EUEA 3LBHA 4TMFA 3ELWA 3F5FA 4RLHA 1S0UA 3IJRA 1KEUA 2AW3A 4R0VA 3V7YA 4B4VA 1JFVA 2GD1O 1LF5A 2Z3VA 2QRQA 4INZA 4EHHA 2AFHE 4MS4B 1AKVA 2WW8A 1JQAA 4MI3A 5I48A 5DM1A 1G3IA 1ZL0A 4HNHA 3N58A 4YA6A 4NAUA 5IWCA 2O07A 1M2EA 1J8QA 5FLXA 4RJKA 5DNCA 1KORA 1CZKA 4GE3A 4RTQA 2AI1A 3A6PC 2ZBDA 4MB0A 3NAZA 2O23A 3BDIA 4WZAE 3MUOA 4ZOLB 4E3ZA 4KR7A 3QXHA 1N5KA 3IAEA 2BR4A 4U9UA 1L7PA 2E6KA 1Q95A 3AF6A 3N3YA 4D9FA 1J2RA 1YB5A 1Y1VA 4GOOD 3WV5A 4CIWA 1X86B 3EGDA 1A27A 3HVHA 3HZZA 2HMWA 4J2HA 3CZRA 2BSXA 4WKGA 3ZEAA 5BNZA 4IYJA 2HM7A 3AVYA 3VR4H 1Q1ZA 4UTOA 2GK4A 3N8NA 1JG4A 1N9KA 3QM1A 1R6AA 2OCXA 3GW8A 1UZLA 3C8ZA 3UXHA 3V4GA 1NQOA 3ELUA 1KTIA 2JHAA 3S8YA 4WT7A 2COEA 3L46A 1FFDA 5ESXA 1ZBSA 1POXA 1DWOA 3KZCA 1TOAA 4HYYA 4LJ9A 4DA6A 5AMXA 4IHAA 1ZJJA 2ZIVB 3M49A 3NRJA 4XYBA 5K3DA 2HWUA 3K9FC 3M3DA 5KOYA 4V1CI 3HYLA 3TL3A 3EVZA 4YP0A 5JMTA 4RFSA 3K6SB 3E70C 3RO7A 1XTTA 3I5UA 5BUQA 4H31A 1EXWA 3L79A 4AN1A 5A4KA 4Y2JA 1ZDMA 2JI7A 4W5NA 1E2BA 3D9QX 1P0CA 3NKVA 2IYOA 4RTKA 2ZPTX 2BEJA 3T1NA 1VPTA 3G2KA 3IBCA 4UULA 5TV2A 1Y6RA 1QG4A 4MEAA 4Q9JA 3U7JA 2ZXUA 4PN7A 4A8JA 4YPOA 4F3NA 2ZYHA 1E59A 3ONNA 1SCUB 3TNLA 4JMLA 4BNHA 4DCJA 4RADA 3I37X 2FN3A 2X6TA 2C97A 4IGKA 2OKGA 1LSSA 2IEAA 4QYMA 2GSWA 1ISRA 2Z3ZA 3ZDYB 3OBIA 2DPHA 4BBPA 1J0XO 1PFWA 3SYRA 1DKUA 1W35A 1D9XA 4IDGA 3BXHA 4HQNA 2Y2UA 3D2AA 3BXFA 3QE3A 2HRDA 3A04A 2OZVA 3MJHA 5AHXA 4BB0A 3ZWCA 4CMJA 3VOTA 4E1AA 5F52A 3KE9A 5TIIA 2WHXA 4CM3A 2O3RA 4B3MB 5KC8A 3O8QB 4LE0A 3GB9A 2RGCA 4LV5B 3WK9A 2DHDA 2RK3A 1IYZA 4CG1A 1GYRA 2ZREA 4R2JA 5THKA 2IDKA 1CQWA 1OBOA 2FPLA 3PLNA 3TINA 4ZZIA 5CXUA 1T2AA 5GP1A 3EVDA 2P2NA 4GWKA 1TTPB 1WOPA 1U0NA 2HU7A 2YHUA 3QOXA 5JCOC 5ALOA 1NJGA 3COJA 1YAJA 1CP2A 1K7FB 2AKAB 2QLBA 2JA6C 2PZ8A 5IM4F 1X8JA 2C2GA 2F1RA 1WQHA 1YOVA 2IYNA 2EZTA 3BIOA 3O4RA 4FDMA 1Z7BA 1PFYA 1NYLA 4NVRA 5AKHA 3LT4A 4JLKA 4MEBA 2HADA 3F8SA 4HZUB 4JK1A 2ISSD 5DGIA 3FZEA 1KIAA 1Z0IA 1Q11A 2Y1LA 2QN2A 3MF4A 4JC8A 4NZYA 3WWEA 2ZUFA 1WSRA 2Z6AA 1G0NA 2XEXA 1NI5A 2WJHA 5E1MA 1S9HA 1RE0A 4G7ZA 1F0KA 5BT9A 3OEHD 2BFDA 1DC3A 1CYEA 4NI5A 4ALNA 1XK6A 1YA4A 5BP7A 1OLSA 4JXJA 1SVNA 1NJSA 3BP3A 2E2JC 4I8IA 4ETIA 1AGNA 3GDZA 2RBGA 3GNTA 3KSDO 3PDIA 2BFOA 3QF7A 4HQKA 5FULA 4F3YA 1DG1G 7YASA 4QTUB 1INLA 1XMSA 1C9NA 1WB9A 1KY4A 4AVYA 3PQ2A 3R44A 4FXPA 4MVJH 4BXOB 4MRRA 3LXUX 4XLPA 1VE9A 3QUAA 3KXIA 1MN6A 2I6QA 3P0RA 2I55A 4QXQA 3VI4B 4PZCA 4N3BA 4NCAA 2V45A 3JQ9A 4A3LC 3OEYA 3GQBA 4JI7B 2FSUA 3CB4A 1G8SA 2Z6UA 4I4TB 4WJKB 1J7JA 1RLIA 2WV9A 2QTAA 4JVNA 1E3MA 5AM2A 4R7ZA 2XDAA 1EXDA 4PCLA 1N7JA 1XBTA 5FBKA 4MAMA 1E6CA 1H0SA 2PUWA 1WU8A 3PR1A 4AN4A 3U3OA 3OM8A 3MCAA 1SUSA 2A6HA 3O93A 2FEXA 1MGPA 3W0LB 5ERYA 3TQTA 1M7HA 4DYDA 1J00A 3WBFA 4HH3C 5K6AA 1YE5A 3JSXA 4CTOA 1TCVA 4KMHA 1AUVA 2H4XA 2NUBA 3G2HA 3ZIAD 3TSYA 4CEIB 1IK4A 3ZNPA 4OHPA 4IVNA 4KEAA 3RYFB 3WGUA 4FGSA 1V71A 1Z37A 4I0WB 1E6EA 2OCBA 4UE3S 1J21A 4GP6A 5I9SA 1C7QA 2BGNA 4GR9A 3AUTA 1WZEA 3O0TA 3OX4A 5HDQA 4Z49A 3OPYI 4P1ZA 4P0QB 1B74A 3IIMA 2JAUA 3JYQA 3RQIA 1R2QA 2QY6A 3S2FA 4A4DA 1JB9A 5EJFA 4WN9B 3S1LA 2CHQA 4HNAB 4RW0A 2WUWE 4R8RA 1D2AA 1CW2B 1FS5A 1EFCA 1YHZA 3H2ZA 3AB3A 4S2EA 3W2TA 1C3XA 3L7DA 3LPXA 1QK5A 3N2NA 4WKOA 4WCDA 3P20A 3EIWA 1TM5E 4XFDA 1PL0A 2VO1A 3EEFA 2WDZA 4GPD1 2V6MA 4KB2A 2AN1A 1KY3A 4LMRA 4L76A 2WB2A 2ZSAA 2FSHA 4G0YA 3IFSA 2NADA 4MUHA 3TRJA 1O27A 3F49S 4ZVKA 3K6SA 2YYZA 5DM60 1GQ2A 3KPYA 2B30A 1QGAA 4XLTA 2XB2A 1QV9A 1ZK3A 2OXCA 3R23A 2EARA 4Q00A 4UHKA 4XSGA 1RYYA 2H1FA 1JEJA 1BDJA 1CG6A 1NDHA 1SC6A 2BEVA 5E2IA 4ZAFA 5IUKC 1F8YA 4X1IB 3M6WA 5DRYA 4I8DA 2P9EA 2NPIA 4A3KK 1YNOA 4MWDA 3PITA 1S2IA 2W9XA 1HFJA 1T4BA 2Q4EA 4UATA 3TBHA 3O82A 2QRZA 3MCVA 4Q3OA 3D5EA 3H5IA 4ZAZA 1PO7A 4NCNA 1KFJB 1O5TA 3C5HA 3WTBA 3NRCA 4EMBA 1QHYA 5I7RA 2WJ3A 3RS4A 4WY5A 2BF4A 3R6DA 3E9EA 3RDPA 4AIIA 4J6EA 2D6FA 3UOWA 3TOZA 2AKYA 5TGZA 4QREA 2Q99A 3T7RA 1E4VA 3BXGA 3N0TA 2CFSA 4J90A 1IUNA 1FA9A 3FY4A 1AN0A 1UH5A 5JAQA 1U0HC 2Z6QA 1Y5LA 1U0OC 2OB1A 4IGFA 2Z2YA 2ABWA 4LYEA 2FZWA 5KJEA 3TZHA 1R1DA 1D8TA 2R6FA 4WKCA 1SBIA 1NF8A 2UXBB 4FFVA 2G06A 1JVBA 4HX9A 3O3CA 2OUIA 2Z4RA 5J4LA 1L7MA 1H4TA 2QV7A 3AKYA 5LC1A 5CEEA 2V9CA 2W58A 3OQNA 3G7SA 1F17A 4CODB 3BL8A 1G5FA 2GJ4A 5KYNA 1P1BA 2VWQA 4M9XA 1IZ8A 1K0FA 3LLSA 4N3GA 4O4IB 1GU1A 1NF2A 3ADKA 2QT9A 4MPTA 4XH9B 5HKOA 2X9QA 2ZCUA 1V5FA 1RHUA 2XDQB 3H05A 2R1VA 1KJJA 1QB7A 3HEBA 3O0DA 5IAGA 2D00A 1BHSA 3DV2A 4RK6A 5AKZA 3S1AB 3ZVKA 4EF4A 1VBMA 5A2GA 4QIWD 2RE8A 2OV4A 3MTBA 2CW0A 1YTLA 3OJCA 4BY7K 3WO1A 5C1BA 1NVMB 5JAZA 5HBGA 2O1SA 5TSDA 5EIXA 1JI3A 3IPAA 2JL1A 4GWGA 4RZXA 4CM6A 1C9EA 1LDNA 3RKUA 4GU5A 3RUDA 4M1OA 4WASA 4BQFA 3FHOA 4ZCIA 1XJWA 2JJMA 2UZAA 1OY1A 3TZ6A 2YQZA 1VH2A 1L5QA 1S2GA 4IG9A 1N9GB 3AOEA 4CGYA 3ZU3A 4X0EA 3F74A 1PE0A 4ACAA 1XVAA 3TQOA 1NPYA 2RC6A 1QIGA 4F06A 4M9UA 3OZVA 2WSSD 1IQPA 1ZUNB 1FDOA 4R1MA 4HLUC 5EJIA 4GO1A 2OG1A 2R44A 3ROFA 1QHIA 2IHJA 4I1YA 1H8EA 1YR7A 1R9MA 3I73A 2VYFA 3TI9A 3IJPA 3DWFA 3SBEA 3V8RA 1XZPA 1JHUA 3AR6A 2NXNA 3SLKA 5GTDA 2DH6A 2DSNA 1PR1A 2I7DA 2QPLA 3LWZA 4GYKA 1YJCA 4N3CA 5AO9A 2XHZA 2O3JA 4KWCA 4IWNA 3VYUB 1FYDA 4KIUA 4QA9A 4BTEA 5C4IA 4OM7A 1Q0HA 1G8KA 2P3LA 2P41A 2XI4A 3ENVA 1O96B 1MX1A 4HFMA 1JFRA 1XZJA 1QZTA 3UOGA 2QTZA 3GROA 4F0JA 3S2ZA 5B2FA 5BUSA 1JX6A 5HZHA 3I39X 5G4KA 1U8FO 1MCZA 4CEHA 1ADCA 2VBGA 3D7SA 5IHXA 1NLYA 1NVTA 1G8AA 2CYAA 4HG2A 4KQWA 4FHZA 1JT9A 2PZKA 2A88A 1T1JA 1ZBQA 4E31A 3KQHA 1YGPA 2RGYA 1WWKA 1RI3A 2M9MA 1BTOA 1Q3HA 5JE8A 3U39A 3U0BA 1K8ZB 4S0ZA 3AILA 1Y6JA 2D7DA 4MRPA 2F9FA 2X15A 3QUBA 1SMYA 1N2GA 3F6EX 3IV9A 3KC2A 2EDCA 4WX2B 3C4QA 1I01A 5AJHA 2Q1SA 4CQMB 3S2HK 1UXGA 4CDRA 3AJ8A 1T2NA 1Z8HA 1TU4A 2BFBA 1OLUA 3GZ4A 3Q7EA 4MUYA 3H4VA 1RXYA 3GBSA 1EUDA 1K68A 4HEHA 5KYWB 4DWJA 4FLMA 2JJ2D 3U5TA 5AM5A 1EP9A 3O8DA 5TNXA 1D3AA 1YBHA 4DUPA 4EF5A 5IOTA 1AY0A 2QV0A 4MVJG 4CZ2A 4S24A 3L4EA 4YRSA 1KXJA 3IHTA 4MTCA 2F2TA 3KFVA 4H15A 1SG6A 4GYYA 1L1RA 3GTPC 3OT5A 3D7MA 3F8TA 5IH3A 2GAOA 2VNHA 1CBUA 1C3EA 2G07A 3L0CA 5E7IA 5TT0A 4AP6A 4L6AA 2AF3C 3GA5A 5EZ6B 3RSCA 4BPRA 2VWGA 1W59A 3JQ8A 2DUMA 3VHRA 2LNDA 3WJ7A 1E0SA 2BGJA 5DN6D 6GPBA 1G2OA 2BOVA 4M0CA 3A8KA 1EVYA 1ZMTA 3OOJA 2M1ZA 1YIOA 2BJWA 4I4IA 1F60A 1FFXB 2QSJA 3INYA 5EUBA 2G0TA 2WBLC 3A0RB 3ET4A 1YJ5A 1I50A 1F8FA 2NVBA 4C07A 5ER9A 3CJQA 1U7PA 1XG5A 1CY7A 1CJTC 2DTXA 3CNQS 3F47A 2G77B 1I3OA 1Q7BA 3NI2A 3K72B 1ZGHA 4CKYA 2GSNA 3VDXA 2EGHA 4BX2A 2FUKA 1E18A 8AT1A 2A3NA 3FSJX 4WK6A 3JRXA 4YIKA 1AKMA 5FLKA 4BO1A 2WTUA 1C1XA 1EK0A 1DEXA 4AJJA 1XRPA 3DSRA 1UDCA 1ZK1A 3A4TA 2GR9A 2OV6A 3EZ6A 3DQQA 5YASA 5BURA 4IDAA 1X38A 4U7FA 4CTMA 3C3CA 3J7AC 4YRQA 3QKRB 1JQDA 1EINA 3BWCA 1H3FA 4A3GC 3LUKA 1X7XA 2PZBA 3G0DA 3IKVA 1W88B 4IVPA 1XKLA 5EQFA 1JAZA 5FL7A 2XB4A 3S3TA 4DLKA 3I4CA 5JNSA 2K7ZA 3NVMB 1PEYA 4L4UA 4KWEA 1C1DB 2H5LA 5KNBD 1ISGA 1W85A 1N2SA 3LDAA 5GM2A 5KQMA 1J25A 3C8MA 4FFWA 4GWLA 1EZ1A 2WYUA 1IG0A 1DIAA 3AK4A 3CGWA 3CEHA 3NHPA 1S6YA 3OY7A 4KGZA 4KWHA 3UGJA 3W9SA 4J1NA 4HP8A 3T0GA 3L8MA 5T41A 3AQIA 1PSZA 1PJ7A 1P18A 3OU7A 4W5HA 2ZUEA 1SUEA 1E99A 2OFWA 1MDBA 1S3SA 2B25A 2R1VB 4NQZA 5AVSA 1TWFC 3HCOA 1X9HA 4L4RA 1K3UB 1OXUA 1RTKA 4HN9A 2WUEA 4PHFA 1TVEA 3WSTA 3UHFA 4C7OA 3ROTA 1WPGA 2GXSA 2MSCB 4LZPA 2DPXA 1O29A 1J9EA 3UUWA 5AM0A 2GZ2A 1DFGA 2GK6A 3KKZA 2C9BA 3WLLA 3OY2A 4KXYA 3PEWA 1NQXA 4EUKA 1SVKA 4J03A 1CZHA 4ND2A 2ZPAA 3BXEA 1K6MA 1R0WA 3NC1C 4QQRA 5AT1A 1VFNA 1Q16A 2ADFA 2XVAA 5IBPA 3UT5A 4BZPA 1P9NA 4OTZA 4AZ0A 4A3MK 2OGZA 2DLDA 2GH1A 4BFZA 5I7OA 5EIEA 1T2UA 3F6YA 3KWJA 1A5BB 1G8MA 4R8KA 4CHGA 4PFKA 4MRSA 1FJGB 1II0A 1ZUNA 2GZSA 4LJKA 1B6GA 1X19A 3X1KA 5JYDA 1MZVA 1V95A 1GA1A 3PICA 2L2QA 1KPGA 1M2VB 1X1CA 3THOA 4BMDA 3DFUA 3W4KA 2ID7A 5FI3A 4MARA 2X0NA 1LC0A 1JAXA 5CM9C 4XWKA 1FTQA 1BX0A 3L5OA 5EGSA 3SSMA 1Z7EA 2VYND 4MWSA 4HAVA 4IM7A 1OFHA 4CLXA 1QHEA 3WGOA 3WNZA 1AT1A 4U6SA 4QEDA 3KZNA 3HFRA 3A28A 3NJRA 4OJQA 4XYMA 4MDHA 1S2NA 3B8EA 3STVA 4F2HA 4BATA 1DRKA 1TJYA 2XYPA 4K9MA 1L7RA 5JT1A 1H66A 1KJZA 3N6XA 1I7NA 4G8DA 4YNBA 2O2CA 4GMFA 4KPFC 3SZGA 3TN7A 4N0DA 3UAOA 4BV9A 4DBLC 2D0IA 4KAFA 2VT2A 5HS4A 4PO3X 1N5IA 4D8XA 2QYHA 3GEIA 3OQJA 3H1EA 4PNZA 4KQGA 1APBA 3GAZA 4RHYA 5LXTB 2JNWA 4EL5A 4AMGA 5HRAA 3WTCA 3W6UA 4CG2A 4U39A 3S4YA 3TAUA 1QVVA 2XEDA 2CLIB 2YJ3A 4L8YA 4EVSA 4L57A 2TMYA 3L49A 4Q3BA 4HNVA 1GFIA 2FOLA 2WM8A 4ZFNA 1JAYA 2GYWA 3C6XA 4QPCA 2XIQA 1JSCA 2GCGA 2PX8A 1QH8A 2GTIA 3BM5A 4IIEA 4LMBA 2P62A 1CS4C 4U8HA 4RTOA 4DV4B 1XK7A 4NENA 3A4IA 3QU4A 4XVRA 5C1IA 2C99A 3DZDA 1ZHHA 1YI1A 3P26A 1SKAA 1KVUA 3DHVA 3JYHA 1LKZA 3WYDA 4YQFA 4KR3A 4TOIA 5JJBA 1IZ9A 3WIDA 3SC4A 2FQOA 4AYBL 2GFHA 1GR1A 5HQJA 4XOUA 4A3JK 1Y5NA 1ZD8A 2YRXA 1WU7A 3F3MA 5K3CA 3RWOA 3T3IA 5ISMA 2Z8ZA 5HG0A 3OF3A 5IOSA 2VNKA 4IDPA 1B93A 1U9YA 3MJEA 4G56A 4FDTA 3QWBA 2VUTA 1IDN1 4QJVA 3I32A 3JQ8B 4JC5A 3EUFA 1DHTA 4XZ3A 4C0KA 3TVTA 1U2DA 4OYLA 4KODA 4V0ME 1IBSA 2V9ZA 2BH2A 2POQX 4FB4A 1P1HA 2AMJA 1J90A 5COBA 4YIHA 4A8JC 1XXLA 1Y7PA 1I0IA 1Q1BA 4TL9A 2I2AA 4D45A 2LD4A 1I6WA 1LX7A 1O5OA 2BZ0A 2W83A 4OQLA 3T7DA 5DF1A 3MWEB 4DF3A 2GCOA 4M98A 4Z2YA 4BC0A 2WFZA 4NS1A 3E5MA 4X8LA 4EYSA 4BZZA 2BFPA 1WRBA 3AHHA 3BL5A 2XMCA 4D7AA 2B4KA 2Q3MA 4OGKA 4XGIA 1WTAA 3E7FA 4RV4A 5F4BA 3TAXA 5TQJA 2E1PA 5B1YA 2ZUVA 3U3RA 4E5SA 1K1EA 4M1WA 3IUPA 2XTMA 5AUPB 6AT1A 2Z58A 2XB9A 1DBIA 2XCSB 2V6IA 2P6NA 2YXPX 3H1TA 5KNDH 1WB5A 1IB6A 2Y9MB 3VZBA 3AVOA 1TUGA 1R0ZA 1FBTA 3GELA 1DRUA 4G4GA 4H3HB 2B9EA 1C0AA 1UKYA 5EKDA 3AVUA 3SJ7A 5ALRA 4EUSA 3M5PA 3R77A 3G88A 5AUOB 5EXTA 1SK8A 1QKIA 3LCUA 4I9UA 1OI2A 1GJRA 1US8B 2UZ4A 1XAIA 1CVLA 2H08A 2PZEA 2BRUC 1L5HA 5ALJA 2C2WA 4E14A 4Y2HA 1W8IA 3IEVA 5B58T 3EPPA 1Z5OA 4YJHA 1R8XA 4O5OA 1PF7E 4ND6A 5JARA 3RSOA 5M5BA 2C4UA 1L5SA 1HK7A 2HI0A 4BL5A 3UHAA 3O31A 4OA5A 5FPSA 5ILOA 3WFZA 1YDMA 4HADA 2OYCA 1X70A 5LDHA 3FOEC 1VB5A 5L7YA 2A9JA 1PLJA 4BNWA 2ZIWB 3ESBA 1KAHA 1LCIA 2OCIA 1KY5A 4MVJD 4LV6A 1C3LA 3QLTA 2O5IA 1T4GA 5EJ7A 5BYJA 4EHJA 4EPXA 2GHTA 1TF2A 3E3NA 1K7XB 2JHCA 3IA2A 2W8BA 2AW5A 5SV2A 2VUIB 1E2UA 2EL9A 4OP2A 3SHWA 3OEPA 3NPMA 4OSPA 3TZCA 1UBEA 3W4IA 5EGHA 3LT0A 5CCBA 2CFRA 3EN0A 3FG9A 3K92A 4MR9B 1RM0A 3U62A 3ZCXA 1MU0A 2ZJZA 4WKNA 2GAAA 3KQTA 3W77A 1ZOLA 2P6MA 4XDZA 3OHMA 1QFZA 4UKDA 1LSUA 4KSCA 1XVLA 4ZO6A 3ZWAA 5KU7A 2JW5A 3W2EA 3R3HA 5FUXA 3ZQKA 3UAGA 2IZ7A 3CZ4A 4PR3A 4BAZA 4DGSA 4S1TA 1OXSC 3QE4A 3HBFA 4EGQA 3TXYA 2PKXA 3OUTA 4OA8A 4WLNA 2AXNA 2HMUA 3GLHA 4HDRA 4OJTA 1H9CA 3G23A 1XMXA 4JYAB 4O2AB 1XTJA 1Z0KA 4OJMX 2BBTA 1NSYA 3OQ1A 5T6MA 4CLOA 2XSZA 4H1WA 3ZIUA 5T3UA 3VNVA 1U2GC 4BMPB 1PG2A 1ZCFA 3VSDA 2IOQA 1ELOA 2GASA 3FIJA 4BFWA 5I8WA 5K01A 1KPIA 1SZPA 2F17A 3NYWA 4HNTA 4HAIA 3MXOA 2YJ4A 5AK0A 3OLYA 2H2GA 3BILA 3EDMA 4RETA 2AE1A 4YCJA 2UYYA 1DWUA 2XOKD 4S1OA 1RZRA 1VIDA 4C0HA 1R0XA 2V0CA 2JFHA 5BQ5A 1F14A 4BQIA 1TADA 1U2SA 2YVKA 2NZ8A 5LMZA 1SCBA 1OIVA 5H70A 1NM5C 2CNWD 1UPAA 4KLCA 5BWLA 1U3UA 3I9NA 2V8BA 1GPH1 1WQ1R 1U3DA 1CUEA 3P9NA 1LVHA 2GAFA 3PRYA 2PKWA 1DKRA 2W2QA 3OFSA 1WHTB 4OBEA 5CK4A 2O2JA 4MQFA 4QU9A 4DZTA 4Z7OB 4HV4A 1R9TK 3CRQA 4HGYA 4WZBE 1CD5A 2PJUA 2V6FA 1SHJA 3RVNA 1QH0A 1W1WA 3A9CA 3GIDA 3OKCA 1I1NA 1CZUA 1H0KA 2NVUA 2I4MA 1M2OB 4FLFA 4R54A 1CUXA 4RKRA 4WDRA 2R93C 1IOLA 4A23A 1N33B 5TJ3A 3DM9B 2HCTA 3QU2A 3SMVA 3W34A 3C7KA 1W4ZA 3I62A 2YV5A 1XP8A 1LTKA 1A9QA 1YZNA 3PD7A 2J08A 4UNRA 4J0GA 3G2OA 1ZLYA 1GITA 3PE4A 2VYCA 3G2NA 3RH0A 1CS0A 2C1EA 5I4KA 1D0IA 2JD1A 1KARA 1Z63A 1EI9A 2WD8A 2LV8A 3BMNB 1KK2A 1MEEA 1I6MA 1YONA 2X8WA 4UVGA 4MGKR 4WLOA 4H16A 3H8WA 4ABTA 4ZVNA 4IF6A 1FFAA 5CHEA 2I8LA 3ZLVA 2IU3A 4NP6A 5E8JA 1M5RA 3IP7A 3W90A 2B4QA 2BEWB 3G2IA 1PWXA 4S1PA 4RZ3A 1QRUA 2LVBA 1I2DA 3EEQA 1C30A 2RGDA 1MF7A 1Z33A 3V4SA 2PT6A 1ATIA 1I4OA 2PBFA 2VSNA 3PTLA 4GPBA 3UQYS 3WNBA 5A9SB 5ALWA 5JS8A 1F48A 4RTNA 3PXBA 2ENUA 2Z56A 3HL4A 3JQAA 5CX1B 2FGJA 4M83A 1KJQA 4X93A 5JMWA 3C6ZA 1JQ5A 3J81A 1T2EA 3L0YA 3R7DA 4LXIA 1BMDA 4YI3A 1M8GA 3HA5A 3BYZA 1HRDA 3W6ZA 2ZKIA 4JDPA 4O4HB 4A3CK 2HLDD 1DCMA 2H7XA 3KYBA 1GRCA 4GHWA 5CW1A 5ALMA 1K5GA 4NZPA 1B0ZA 1N1GA 1HMPA 3CVXA 3GFQA 1NMSA 2VAMA 3HOWK 1AF7A 4IJMA 1TFUA 3RJTA 4DAOA 4PFSA 3DJFA 3I2JA 3MELA 2QNIA 3VTKA 4L02A 1AS0A 3LD9A 2A3RA 1A7UA 4HL6A 3JVEA 4BLAA 1UUFA 3PKIA 4HUQB 1VGVA 3NVDA 3UWDA 4KOEC 1MJHA 1U99A 2P3SA 3FBWA 2BBOA 4QDTA 3SP1A 5HUJA 1Z6YA 5LU8A 1V45E 3FKIC 3FMFA 3FTPA 2XXAA 3KPVA 5ILQA 1UK8A 3BHIA 2C4MA 2A0FA 3OO1A 4J0CA 1KS2A 4OGLA 4Q9DA 3RYIB 3WLPA 1HMYA 1MABB 2I3DA 2PZLA 3UN1A 2EJUA 4B75A 4ZVQA 4GPAA 4LSZA 4PSUA 4G6ZA 2OM2A 2BT4A 4GM0A 3ZY6A 3QLUA 2DPYA 3RHSA 1KAGA 3HCDA 1KU0A 4QUIA 4YV0A 1TRKA 3BRSA 1UMKA 1DELA 3MN1A 4J07A 4NH0A 1RS0A 2A5JA 5J4YA 1PJLA 1ZVKA 3ROPA 5JATA 5LP1A 3H5RA 2GQ0A 4MRAA 2PBRA 4BMZA 3I9MA 4GMKA 3U7FB 3A6ZA 2YDYA 2PV0A 4R71A 2BDEA 1XCPA 2VL7A 2OO3A 3BS4A 3CZMA 3P94A 4EFLA 4QLAA 2B7LA 4G1VA 4QO8A 3A9RA 3NG1A 3AR3A 4AF8A 1GKKA 1I50K 3KUDA 2BFCA 3AHGA 2V7QA 4QYIB 3PFCA 3P9RA 4HDRB 4MVJM 2SECE 4LNHA 1V39A 2DCUA 5CEFA 1XLWA 3C39A 3KU4A 3AMVA 1NW6A 4JR0A 2Q9BA 3T4UA 3CUKA 3I6QA 1R0YA 2XYQA 3TH5A 3X44A 4LZJA 3TGWA 5C1OA 4KVFA 1B43A 1J8DA 1NLUA 2FEOA 3BZUA 2VH2A 2QUZA 2XD4A 1SUAA 5AM1A 5IF3A 3KT8A 3O2JA 1D2CA 3DZBA 4XD7D 2PL1A 4MS3B 1IDOA 1RHKA 5ICEA 1GCOA 4OMFG 3O21A 1VIVA 3QVWA 2ZAOA 3VAAA 2RGGA 3KYDB 2GRAA 4DDMA 2DEUA 2GNOA 5EIBC 1PS9A 2Q9AA 2J5BA 3T35A 5ALFA 3O8OB 4AQ7A 2V1UA 1MNQA 3V3TA 4CNQA 1YHNA 4DIEA 3PQ8A 1YL6A 3TFQA 1ZSVA 3JR7A 1ZRSA 4KQ9A 4BHTA 1HI9A 1MVNA 1D1TA 3HCBA 4R6XA 3UMBA 3JV7A 1R4NB 1KI1A 1HL3A 2BELA 1LK5A 3L77A 3LQ1A 3VOAA 4O1MA 1EEHA 2HLHA 2J9GA 2VP9A 2WTEA 5JXIA 1MQAA 3U44A 4MUXA 3UV7A 2XUDA 2VR1A 4A93C 3IO5A 2QENA 4MUGA 5IN5A 3AL0C 2DJ5A 4HS4A 4AH6A 3TW4A 3K9BA 5EP1A 1L9XA 1QFSA 1QCDA 2I2BA 1KOGA 4Q47A 4TM7A 2ORYA 1CEXA 1D6NA 3EBLA 3FCEA 1N78A 4WLUA 2VQDA 3L7NA 1DQSA 3ICWA 4UZEA 1YA6A 5BV2P 3QIVA 1QH9A 2W2VA 1XZBA 3H42B 4J0KA 4E12A 4GP9A 1EE1A 1D07A 1ENPA 2ZYAA 3G2JA 3QITA 3WZMA 4QT4A 3E15A 3P2JA 1LZLA 3SKXA 3T0IA 3I9JA 1MG0A 3NIFB 4BFYA 3LW7A 4BLUA 3M83A 4YMUA