3BP8C

Crystal structure of mlc/eiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative NAGC-like transcriptional regulator
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp8C00
3IPJA 3BP3A 3BP8C 1IBAA 1O2FB
chains in the Genus database with same CATH superfamily
4C3IK 4A3EK 1J98A 5M5XK 4A3LC 4BXXC 2PA8D 4BLAA 1TWAK 4G7ZA 1JVIA 1WOPA 5IOTA 2NVXK 5M5WK 3S15K 4KASA 4KM8A 3K7AK 3H3VL 2CW0A 2A6HA 1TWCK 3T02A 3TFIA 3RZDK 3S14C 1TWFC 1ZQ1C 3GTGK 2FQOA 5TMCA 5C4XK 2KWAA 5IP9K 1Y1VC 4G7HA 4ILDA 2R92C 4C3IC 3JSTA 3A8IA 3GEIA 4A3EC 4XLPA 2RH6A 5HL8A 3S17K 3S2DK 4A3GK 1ISEA 3GTMC 1TWGA 4YFXA 4GTDA 1X31C 3S15C 3HOUK 3OREA 5FLMK 5JFEA 2JA5C 2VUMA 3GTLA 4GFQA 5IYCC 4X6AK 3N0BA 1I50A 3N3YA 3G4CA 4BY1C 2A69A 3AD7C 3GEHA 4A3CK 1WSVA 4KB2A 5IP9C 1F7UA 2ZUFA 2NVTK 4XSXA 4A3JK 1K83C 1F93A 4A3GC 1VLOA 1I6VA 4GTEA 3HOUC 1YNNA 3AH5A 4C3HC 2R7ZC 3S1RC 3CQZA 1R9TK 3GTQC 1EFWA 1TWAA 4X6AC 1IW7A 1WIHA 1Y1WA 2NVXA 3Q3QA 3GDZA 1XZQA 4A3FK 2P8TA 2FQTA 3HOWK 1TWCA 1V5VA 2NVQK 2YU9K 2GAGC 1XXAA 4A3JC 3LAPA 4A3KC 1IS1A 4Y7NC 4G0VA 3RZOC 4KMDA 3SZZA 1PJ5A 3HOYC 3MMLB 1R9TC 5IYBK 3HOVK 5TMFA 3I4MC 3M3YK 2A68A 4KN4A 1VJEA 5EGEA 3TTGA 3FOFA 1PJ6A 5JVOA 1O28A 2YU9C 3GTPA 1J6VA 4A3BK 2E2IC 2ZFZA 2JA6C 2O5JA 3S1NC 1O2BA 3FKIA 4KC6A 2W7VA 4WJ3M 3SZYA 5IYBC 4BLBA 5IYDK 1YNJA 4A3IC 4XSZA 3GTJC 4LLGA 1SFOC 1WOSA 4LR2A 4QIWD 3S14K 1TWFK 3M3YC 1O24A 4J3NA 2R92K 5M5YK 4A3BC 5M3FK 4KMUA 4GZYA 2PA8L 4BBSK 3GTMK 4P5BA 2JA5K 5IYCK 5IYDC 1TWHA 4BY1K 4NOIA 3HKZD 3PO2C 2E2HC 1INNA 1YX2A 2XCQA 3VA7A 4Y52K 5D4DA 3AD8C 1I6HC 2PMZD 4Q5SA 3GIRA 1G51A 1WCMC 2V6UA 1J6XA 4GTCA 4P5AA 4KB4A 5IOSA 4YFNA 3GTKC 3S1QC 1K83K 2V6TA 1DCPA 3N0CA 4BBSC 3BUEA 4GTFA 2R93K 3FHZA 1WQGA 5CJ9A 2NVYK 4C3HK 1XZQB 4QJVA 3S1RK 2R7ZK 3GTQK 4KMAA 5C44C 5C3EK 2GSNA 1O2AA 4Y52C 2RGRA 1J6WA 3HOXC 5IOQA 4WILA 2WAQD 1XXBA 3ADAC 4FM9A 3CQZC 2PPBA 4G0WA 1TWFA 1Y1WC 4GT9A 2B63C 5IP7C 4A3KK 1XZPA 4C2MK 1Y1VA 4KM9A 4Y7NK 3GTOK 3RZOK 2R92A 2R93C 2JA8C 2NVYC 4P9SA 3HOYK 3OPFA 4KARA 1RU0A 3HXAA 4OIOA 3GTMA 1BDFA 5C3EC 2JA7C 1O27A 3PO3C 1BGWA 4LJZA 4MEYA 3I4MK 1B4AA 4YFKA 2BE5A 3GTGA 2E2IK 4C2MC 2JA6K 4OIRA 3GTOC 3S1NK 2O5IA 1EI6A 1F7VA 2XCRB 1IE0A 1K83A 3S1MC 1ZVUA 5M3MK 4A3IK 4MQ9A 3GTJK 1XPPA 2GSUA 1SFOK 3EQLA 4ZH4A 3H0GC 1PJ7A 1I3QC 4G0UA 2R7ZA 3GTQA 1VGXA 3AD9C 5C4JC 2V6SA 5FJ8K 4XLNA 2ZUEA 4LOWA 1USMA 1C0AA 4AYBD 3S16K 4C45A 3I4NK 4BBRK 3OEPA 3TFHA 3S2HC 1GE9A 4KN7A 1F9NA 4LQYA 2CFAA 2A6EA 1B4BA 4WJ4A 3PO2K 2E2HK 4QIWL 1BS2A 1R9TA 5CHPA 3LAJA 1WORA 1I6HK 1HI9A 3GEEA 1WCMK 3CAGA 2P5MA 2VUMK 3GTKK 4KATA 2WB1D 3S1QK 1JOEA 3S16C 1SMYA 1EQRA 4JK1A 4QJVB 4BBRC 2YU9A 3M4OK 3I4NC 3FOEA 2E2IA 1JQWA 4OIQA 3WODA 2JA6A 3NUHA 5C44K 1EK8A 1HQMA 3HKZL 2E2JK 3T01A 4Q4ZA 2Y0SD 3HOXK 1TWGC 3GTJA 4LK0A 2PMZL 4A3DC 1VH2A 4XCHA 1SFOA 4A3MC 2VUMC 3GTLC 1XZPB 3CQZK 4BY7C 4PABA 1Y1WK 1IL2A 1I50C 1DD5A 4GTLA 5IP7K 2B63K 3V4GA 3M4OC 3H3VD 1DCOA 2JA8K 1WQHA 2JA7K 1UV7A 3PO3K 2E2JC 2WAQL 2E2HA 1USOA 1ZBSA 1TWAC 5L46A 2NVXC 1YCLA 1WCMA 3K7AC 3GTKA 1L0WA 4KDDA 1TWCC 4AH6A 5EGHA 3S1MK 4LK1A 3A8JA 4KMHA 3RZDC 3GTPK 1O26A 4BKWA 3GTGC 5C4XC 3BP8C 3H0GK 2JA5A 1I3QK 2EBBA 3FKIK 2GSOA 5C4JK 3BP3A 1IBAA 3S0XA 3S17C 3S2DC 4GTAA 1DCHA 4KAWX 1KQ4A 2CFAB 5FLMC 4YG2A 3ERED 1O29A 4MEXA 3S2HK 4O2DA 2B63A 3QX3A 2XCOA 3L4KA 3A8KA 4OIPA 3GTPC 2R93A 4A3CC 1BJTA 2JH3A 2NVYA 3T00A 1O2FB 4A93K 3FKIC 2JA7A 2NVTC 4M1XA 1TWHK 3GSIA 3IPJA 1XXCA 4AYBL 2GAHC 3TFJA 1ZXOA 3HOZK 1WOOA 3DXJA 4A3FC 3LPXA 1EH1A 5IORA 2Y3PA 3GTOA 1O25A 5E68A 4PAAA 4C3JK 3G4AA 3HOWC 4A93C 2NVQC 1TWGK 1WQFA 4DDQA 1VRQC 1WSRA 5TJ3A 4A3DK 4A3LK 1AB4A 4A3MK 3GTLK 4BXXK 3H0GA 4BY7K 1I3QA 1TWHC 1I50K 1IQ0A 2WB1L 4RMFA 4OINA 3AQOA 2PHCB 3L4JA 3HOVC 3HOZC 4FZBA 1ZYRA 4C3JC 2D6FC 3AQPA 2Y0SL 1Y1VK 4GTBA 4G7OA
chains in the Genus database with same CATH topology
3IPJA 3BP3A 3BP8C 1IBAA 1O2FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPJ A;  3BP3 A;  3BP8 C;  1IBA A;  1O2F B; 
#chains in the Genus database with same CATH topology
 4C3I K;  4A3E K;  1J98 A;  5M5X K;  4A3L C;  4BXX C;  2PA8 D;  4BLA A;  1TWA K;  4G7Z A;  1JVI A;  1WOP A;  5IOT A;  2NVX K;  5M5W K;  3S15 K;  4KAS A;  4KM8 A;  3K7A K;  3H3V L;  2CW0 A;  2A6H A;  1TWC K;  3T02 A;  3TFI A;  3RZD K;  3S14 C;  1TWF C;  1ZQ1 C;  3GTG K;  2FQO A;  5TMC A;  5C4X K;  2KWA A;  5IP9 K;  1Y1V C;  4G7H A;  4ILD A;  2R92 C;  4C3I C;  3JST A;  3A8I A;  3GEI A;  4A3E C;  4XLP A;  2RH6 A;  5HL8 A;  3S17 K;  3S2D K;  4A3G K;  1ISE A;  3GTM C;  1TWG A;  4YFX A;  4GTD A;  1X31 C;  3S15 C;  3HOU K;  3ORE A;  5FLM K;  5JFE A;  2JA5 C;  2VUM A;  3GTL A;  4GFQ A;  5IYC C;  4X6A K;  3N0B A;  1I50 A;  3N3Y A;  3G4C A;  4BY1 C;  2A69 A;  3AD7 C;  3GEH A;  4A3C K;  1WSV A;  4KB2 A;  5IP9 C;  1F7U A;  2ZUF A;  2NVT K;  4XSX A;  4A3J K;  1K83 C;  1F93 A;  4A3G C;  1VLO A;  1I6V A;  4GTE A;  3HOU C;  1YNN A;  3AH5 A;  4C3H C;  2R7Z C;  3S1R C;  3CQZ A;  1R9T K;  3GTQ C;  1EFW A;  1TWA A;  4X6A C;  1IW7 A;  1WIH A;  1Y1W A;  2NVX A;  3Q3Q A;  3GDZ A;  1XZQ A;  4A3F K;  2P8T A;  2FQT A;  3HOW K;  1TWC A;  1V5V A;  2NVQ K;  2YU9 K;  2GAG C;  1XXA A;  4A3J C;  3LAP A;  4A3K C;  1IS1 A;  4Y7N C;  4G0V A;  3RZO C;  4KMD A;  3SZZ A;  1PJ5 A;  3HOY C;  3MML B;  1R9T C;  5IYB K;  3HOV K;  5TMF A;  3I4M C;  3M3Y K;  2A68 A;  4KN4 A;  1VJE A;  5EGE A;  3TTG A;  3FOF A;  1PJ6 A;  5JVO A;  1O28 A;  2YU9 C;  3GTP A;  1J6V A;  4A3B K;  2E2I C;  2ZFZ A;  2JA6 C;  2O5J A;  3S1N C;  1O2B A;  3FKI A;  4KC6 A;  2W7V A;  4WJ3 M;  3SZY A;  5IYB C;  4BLB A;  5IYD K;  1YNJ A;  4A3I C;  4XSZ A;  3GTJ C;  4LLG A;  1SFO C;  1WOS A;  4LR2 A;  4QIW D;  3S14 K;  1TWF K;  3M3Y C;  1O24 A;  4J3N A;  2R92 K;  5M5Y K;  4A3B C;  5M3F K;  4KMU A;  4GZY A;  2PA8 L;  4BBS K;  3GTM K;  4P5B A;  2JA5 K;  5IYC K;  5IYD C;  1TWH A;  4BY1 K;  4NOI A;  3HKZ D;  3PO2 C;  2E2H C;  1INN A;  1YX2 A;  2XCQ A;  3VA7 A;  4Y52 K;  5D4D A;  3AD8 C;  1I6H C;  2PMZ D;  4Q5S A;  3GIR A;  1G51 A;  1WCM C;  2V6U A;  1J6X A;  4GTC A;  4P5A A;  4KB4 A;  5IOS A;  4YFN A;  3GTK C;  3S1Q C;  1K83 K;  2V6T A;  1DCP A;  3N0C A;  4BBS C;  3BUE A;  4GTF A;  2R93 K;  3FHZ A;  1WQG A;  5CJ9 A;  2NVY K;  4C3H K;  1XZQ B;  4QJV A;  3S1R K;  2R7Z K;  3GTQ K;  4KMA A;  5C44 C;  5C3E K;  2GSN A;  1O2A A;  4Y52 C;  2RGR A;  1J6W A;  3HOX C;  5IOQ A;  4WIL A;  2WAQ D;  1XXB A;  3ADA C;  4FM9 A;  3CQZ C;  2PPB A;  4G0W A;  1TWF A;  1Y1W C;  4GT9 A;  2B63 C;  5IP7 C;  4A3K K;  1XZP A;  4C2M K;  1Y1V A;  4KM9 A;  4Y7N K;  3GTO K;  3RZO K;  2R92 A;  2R93 C;  2JA8 C;  2NVY C;  4P9S A;  3HOY K;  3OPF A;  4KAR A;  1RU0 A;  3HXA A;  4OIO A;  3GTM A;  1BDF A;  5C3E C;  2JA7 C;  1O27 A;  3PO3 C;  1BGW A;  4LJZ A;  4MEY A;  3I4M K;  1B4A A;  4YFK A;  2BE5 A;  3GTG A;  2E2I K;  4C2M C;  2JA6 K;  4OIR A;  3GTO C;  3S1N K;  2O5I A;  1EI6 A;  1F7V A;  2XCR B;  1IE0 A;  1K83 A;  3S1M C;  1ZVU A;  5M3M K;  4A3I K;  4MQ9 A;  3GTJ K;  1XPP A;  2GSU A;  1SFO K;  3EQL A;  4ZH4 A;  3H0G C;  1PJ7 A;  1I3Q C;  4G0U A;  2R7Z A;  3GTQ A;  1VGX A;  3AD9 C;  5C4J C;  2V6S A;  5FJ8 K;  4XLN A;  2ZUE A;  4LOW A;  1USM A;  1C0A A;  4AYB D;  3S16 K;  4C45 A;  3I4N K;  4BBR K;  3OEP A;  3TFH A;  3S2H C;  1GE9 A;  4KN7 A;  1F9N A;  4LQY A;  2CFA A;  2A6E A;  1B4B A;  4WJ4 A;  3PO2 K;  2E2H K;  4QIW L;  1BS2 A;  1R9T A;  5CHP A;  3LAJ A;  1WOR A;  1I6H K;  1HI9 A;  3GEE A;  1WCM K;  3CAG A;  2P5M A;  2VUM K;  3GTK K;  4KAT A;  2WB1 D;  3S1Q K;  1JOE A;  3S16 C;  1SMY A;  1EQR A;  4JK1 A;  4QJV B;  4BBR C;  2YU9 A;  3M4O K;  3I4N C;  3FOE A;  2E2I A;  1JQW A;  4OIQ A;  3WOD A;  2JA6 A;  3NUH A;  5C44 K;  1EK8 A;  1HQM A;  3HKZ L;  2E2J K;  3T01 A;  4Q4Z A;  2Y0S D;  3HOX K;  1TWG C;  3GTJ A;  4LK0 A;  2PMZ L;  4A3D C;  1VH2 A;  4XCH A;  1SFO A;  4A3M C;  2VUM C;  3GTL C;  1XZP B;  3CQZ K;  4BY7 C;  4PAB A;  1Y1W K;  1IL2 A;  1I50 C;  1DD5 A;  4GTL A;  5IP7 K;  2B63 K;  3V4G A;  3M4O C;  3H3V D;  1DCO A;  2JA8 K;  1WQH A;  2JA7 K;  1UV7 A;  3PO3 K;  2E2J C;  2WAQ L;  2E2H A;  1USO A;  1ZBS A;  1TWA C;  5L46 A;  2NVX C;  1YCL A;  1WCM A;  3K7A C;  3GTK A;  1L0W A;  4KDD A;  1TWC C;  4AH6 A;  5EGH A;  3S1M K;  4LK1 A;  3A8J A;  4KMH A;  3RZD C;  3GTP K;  1O26 A;  4BKW A;  3GTG C;  5C4X C;  3BP8 C;  3H0G K;  2JA5 A;  1I3Q K;  2EBB A;  3FKI K;  2GSO A;  5C4J K;  3BP3 A;  1IBA A;  3S0X A;  3S17 C;  3S2D C;  4GTA A;  1DCH A;  4KAW X;  1KQ4 A;  2CFA B;  5FLM C;  4YG2 A;  3ERE D;  1O29 A;  4MEX A;  3S2H K;  4O2D A;  2B63 A;  3QX3 A;  2XCO A;  3L4K A;  3A8K A;  4OIP A;  3GTP C;  2R93 A;  4A3C C;  1BJT A;  2JH3 A;  2NVY A;  3T00 A;  1O2F B;  4A93 K;  3FKI C;  2JA7 A;  2NVT C;  4M1X A;  1TWH K;  3GSI A;  3IPJ A;  1XXC A;  4AYB L;  2GAH C;  3TFJ A;  1ZXO A;  3HOZ K;  1WOO A;  3DXJ A;  4A3F C;  3LPX A;  1EH1 A;  5IOR A;  2Y3P A;  3GTO A;  1O25 A;  5E68 A;  4PAA A;  4C3J K;  3G4A A;  3HOW C;  4A93 C;  2NVQ C;  1TWG K;  1WQF A;  4DDQ A;  1VRQ C;  1WSR A;  5TJ3 A;  4A3D K;  4A3L K;  1AB4 A;  4A3M K;  3GTL K;  4BXX K;  3H0G A;  4BY7 K;  1I3Q A;  1TWH C;  1I50 K;  1IQ0 A;  2WB1 L;  4RMF A;  4OIN A;  3AQO A;  2PHC B;  3L4J A;  3HOV C;  3HOZ C;  4FZB A;  1ZYR A;  4C3J C;  2D6F C;  3AQP A;  2Y0S L;  1Y1V K;  4GTB A;  4G7O A; 
#chains in the Genus database with same CATH homology
 3IPJ A;  3BP3 A;  3BP8 C;  1IBA A;  1O2F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...