3BP8C

Crystal structure of mlc/eiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NAGC-like transcriptional regulator
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 16
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp8C00
3IPJA 1IBAA 3BP8C 1O2FB 3BP3A
chains in the Genus database with same CATH superfamily
1TWCC 4LK1A 3AD9C 3TFHA 3JSTA 2A69A 3GTGK 3HOYC 1Y1WC 1IBAA 1WSRA 5IOTA 4A3BK 2EBBA 1YNNA 4KMDA 4A3IC 1B4BA 2O5IA 5EGEA 1WSVA 3GEHA 3GEEA 4ILDA 2E2IK 3GTPA 1WQFA 1WCMC 3PO2C 3GTQA 4YFNA 2FQOA 4PAAA 4A3GC 4BBRC 3S1RK 3CQZA 1XZPA 3GTKC 1I3QA 1TWAC 4AH6A 2JA8K 1DCPA 3GSIA 4XSZA 3S0XA 1EQRA 2ZUEA 1J6VA 2JH3A 4XSXA 4FZBA 5FJ8K 4GT9A 2CFAB 4GTBA 1O25A 3IPJA 2NVQC 1TWFA 4G0UA 3FKIK 4XLNA 2R92A 5IOQA 4KMUA 1Y1VA 3GTOA 2YU9C 1WOSA 3FOFA 3HOXK 5M5YK 1X31C 2ZFZA 3I4NK 2FQTA 1F7VA 4KC6A 1R9TC 3VA7A 4A3LC 1I50C 2PMZD 1PJ7A 1BDFA 3GTJA 2D6FC 3RZOK 1BS2A 3S2HC 4Q4ZA 1KQ4A 1WIHA 1EI6A 4AYBL 3BUEA 4LR2A 3G4CA 4MQ9A 5IYCC 3AH5A 2E2JK 2Y0SL 2R93A 4QIWD 1INNA 2NVXK 1VH2A 1TWCA 4KAWX 3T02A 3LAPA 3S1QK 4A93K 2E2HK 3GTMC 1DCOA 1EH1A 1L0WA 1J98A 2KWAA 4Y7NK 1JOEA 1SFOK 5M3MK 1IQ0A 1IW7A 1WCMA 2WB1D 3HOZK 3A8JA 3L4KA 1TWAA 1VGXA 1IL2A 2PPBA 1WOOA 3TFIA 4BBSK 1J6WA 4Y52K 1O27A 4GTAA 1RU0A 4YFKA 1SMYA 3A8KA 2R92K 5C4XC 3CAGA 3GTLC 2W7VA 5IYBK 5FLMK 5C44C 4A3FC 1EK8A 2BE5A 4XLPA 4BLBA 2WAQL 4KMHA 3G4AA 2YU9A 3HOUC 5TMFA 1JQWA 1XXBA 3M3YK 3S2DC 4M1XA 1XZQA 1WORA 3M4OC 1TWHA 1I50A 1K83C 3PO3K 4A3JC 3I4MK 5IP7C 4A3MC 2JA6A 2V6TA 3S1NK 3HOWC 2PHCB 1YNJA 4OIOA 4A3DC 4BY1C 4LJZA 5EGHA 1I6HK 5C3EK 3TTGA 2R7ZC 3MMLB 4C3IC 3S15K 3GTMA 1VJEA 3PO2K 2JA7K 4BY7K 4BLAA 3OPFA 4QJVB 2VUMK 1PJ5A 2JA5A 1O28A 1HQMA 5IORA 3GTGC 3N3YA 2ZUFA 4A3BC 1F7UA 2NVYK 3FHZA 2E2IC 2PA8L 1TWGA 4AYBD 5C4JK 2XCRB 1XXAA 2O5JA 4GTEA 4KMAA 3S1RC 3H3VD 3H0GK 2GSNA 4G7HA 4A3KK 4QJVA 3HKZD 4NOIA 4LQYA 1BJTA 4BXXK 1TWHK 2P5MA 2B63K 2JA6K 5M3FK 4P5BA 4YG2A 4GTFA 1O2FB 4C3HK 3S17K 1ISEA 3FKIC 3N0BA 1K83A 5IP9K 3AD7C 4A3CK 2CFAA 3HXAA 3HOVK 4KM8A 3S16K 3HOXC 1O26A 3N0CA 3I4NC 4C2MK 4YFXA 4X6AK 3GTPK 4LK0A 1Y1WA 3RZOC 3WODA 3LPXA 3GTQK 2R7ZA 2NVTK 4A3EK 3CQZK 2E2JC 2JA5K 1I3QK 2XCQA 1BGWA 1I6VA 4MEYA 5TMCA 1VLOA 2NVXC 3AQPA 5L46A 2WAQD 1VRQC 3GTKA 3S1QC 3GTGA 4A93C 4KDDA 1TWGK 2E2HC 2PMZL 3OREA 1TWFK 4Y7NC 3ADAC 3S14K 1SFOC 5IYDK 4PABA 1Y1VK 3GTOK 4C3JK 2Y3PA 4ZH4A 1DD5A 2A68A 2GAGC 2A6EA 4GFQA 1IS1A 3HOZC 3S1MK 3RZDK 4G0WA 1ZQ1C 1YX2A 3HOUK 3GTJK 3GDZA 1USOA 1XXCA 3K7AC 5E68A 5TJ3A 4BBSC 4KM9A 4Y52C 4JK1A 2V6SA 1R9TA 1ZBSA 1ZXOA 5CJ9A 2R92C 2R93K 1JVIA 4MEXA 1TWCK 5IYBC 5FLMC 1AB4A 5HL8A 4KATA 3FKIA 2WB1L 5JFEA 3HOYK 1Y1WK 1DCHA 4A3IK 3OEPA 2RGRA 3M3YC 3AD8C 3DXJA 4FM9A 1EFWA 1WCMK 2XCOA 3PO3C 3I4MC 1O2AA 4A3GK 2GSUA 3S1NC 4BBRK 4J3NA 1WOPA 3GTKK 1TWAK 1XPPA 3Q3QA 4OIPA 1WQGA 2NVXA 3L4JA 1IE0A 1I6HC 4KN7A 5C3EC 1O2BA 4G7ZA 3S15C 2E2HA 2NVQK 1O24A 2JA7C 4OIRA 4BY7C 4GTDA 3V4GA 2Y0SD 4O2DA 1SFOA 2VUMC 1G51A 1C0AA 2YU9K 2JA8C 3GTLA 3ERED 5JVOA 4KB2A 2CW0A 4G7OA 2NVYC 1R9TK 4A3LK 1I50K 3NUHA 4BKWA 3S2HK 5C4JC 4KB4A 4GTLA 5IYCK 4KASA 1B4AA 3H0GC 3QX3A 4A3KC 4P5AA 3BP3A 4RMFA 4BXXC 1TWHC 1F9NA 4Q5SA 3GTMK 1ZYRA 2B63C 2JA6C 3T00A 1J6XA 2P8TA 4WJ3M 4C3HC 5CHPA 3AQOA 3S17C 5IP9C 4GZYA 1F93A 2RH6A 4A3CC 3H3VL 3HOVC 3S16C 3T01A 4XCHA 4KN4A 4OIQA 3FOEA 2GAHC 3HKZL 4C2MC 4X6AC 3GTPC 1HI9A 3GTQC 5M5WK 5IOSA 4WJ4A 3SZZA 1WQHA 2NVTC 4A3EC 3EQLA 2E2IA 3CQZC 2JA5C 1I3QC 5C4XK 3GTLK 5C44K 1UV7A 4QIWL 2JA7A 4A3FK 1PJ6A 5D4DA 3LAJA 1USMA 1XZQB 4G0VA 2VUMA 1GE9A 3A8IA 1TWGC 3K7AK 4LOWA 3S2DK 1TWFC 4P9SA 1ZVUA 3M4OK 4WILA 2NVYA 3S14C 2A6HA 1K83K 5IYDC 1YCLA 4A3JK 3GEIA 1Y1VC 3GTOC 4C3JC 5IP7K 4A3MK 4OINA 3HOWK 3TFJA 3S1MC 3RZDC 4A3DK 3H0GA 4BY1K 3GIRA 4LLGA 4DDQA 3GTJC 4C45A 1O29A 5M5XK 1V5VA 4KARA 4GTCA 2R7ZK 4C3IK 2PA8D 2V6UA 1XZPB 2GSOA 2R93C 3BP8C 2B63A 3SZYA
chains in the Genus database with same CATH topology
3IPJA 1IBAA 3BP8C 1O2FB 3BP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPJ A;  1IBA A;  3BP8 C;  1O2F B;  3BP3 A; 
#chains in the Genus database with same CATH topology
 1TWC C;  4LK1 A;  3AD9 C;  3TFH A;  3JST A;  2A69 A;  3GTG K;  3HOY C;  1Y1W C;  1IBA A;  1WSR A;  5IOT A;  4A3B K;  2EBB A;  1YNN A;  4KMD A;  4A3I C;  1B4B A;  2O5I A;  5EGE A;  1WSV A;  3GEH A;  3GEE A;  4ILD A;  2E2I K;  3GTP A;  1WQF A;  1WCM C;  3PO2 C;  3GTQ A;  4YFN A;  2FQO A;  4PAA A;  4A3G C;  4BBR C;  3S1R K;  3CQZ A;  1XZP A;  3GTK C;  1I3Q A;  1TWA C;  4AH6 A;  2JA8 K;  1DCP A;  3GSI A;  4XSZ A;  3S0X A;  1EQR A;  2ZUE A;  1J6V A;  2JH3 A;  4XSX A;  4FZB A;  5FJ8 K;  4GT9 A;  2CFA B;  4GTB A;  1O25 A;  3IPJ A;  2NVQ C;  1TWF A;  4G0U A;  3FKI K;  4XLN A;  2R92 A;  5IOQ A;  4KMU A;  1Y1V A;  3GTO A;  2YU9 C;  1WOS A;  3FOF A;  3HOX K;  5M5Y K;  1X31 C;  2ZFZ A;  3I4N K;  2FQT A;  1F7V A;  4KC6 A;  1R9T C;  3VA7 A;  4A3L C;  1I50 C;  2PMZ D;  1PJ7 A;  1BDF A;  3GTJ A;  2D6F C;  3RZO K;  1BS2 A;  3S2H C;  4Q4Z A;  1KQ4 A;  1WIH A;  1EI6 A;  4AYB L;  3BUE A;  4LR2 A;  3G4C A;  4MQ9 A;  5IYC C;  3AH5 A;  2E2J K;  2Y0S L;  2R93 A;  4QIW D;  1INN A;  2NVX K;  1VH2 A;  1TWC A;  4KAW X;  3T02 A;  3LAP A;  3S1Q K;  4A93 K;  2E2H K;  3GTM C;  1DCO A;  1EH1 A;  1L0W A;  1J98 A;  2KWA A;  4Y7N K;  1JOE A;  1SFO K;  5M3M K;  1IQ0 A;  1IW7 A;  1WCM A;  2WB1 D;  3HOZ K;  3A8J A;  3L4K A;  1TWA A;  1VGX A;  1IL2 A;  2PPB A;  1WOO A;  3TFI A;  4BBS K;  1J6W A;  4Y52 K;  1O27 A;  4GTA A;  1RU0 A;  4YFK A;  1SMY A;  3A8K A;  2R92 K;  5C4X C;  3CAG A;  3GTL C;  2W7V A;  5IYB K;  5FLM K;  5C44 C;  4A3F C;  1EK8 A;  2BE5 A;  4XLP A;  4BLB A;  2WAQ L;  4KMH A;  3G4A A;  2YU9 A;  3HOU C;  5TMF A;  1JQW A;  1XXB A;  3M3Y K;  3S2D C;  4M1X A;  1XZQ A;  1WOR A;  3M4O C;  1TWH A;  1I50 A;  1K83 C;  3PO3 K;  4A3J C;  3I4M K;  5IP7 C;  4A3M C;  2JA6 A;  2V6T A;  3S1N K;  3HOW C;  2PHC B;  1YNJ A;  4OIO A;  4A3D C;  4BY1 C;  4LJZ A;  5EGH A;  1I6H K;  5C3E K;  3TTG A;  2R7Z C;  3MML B;  4C3I C;  3S15 K;  3GTM A;  1VJE A;  3PO2 K;  2JA7 K;  4BY7 K;  4BLA A;  3OPF A;  4QJV B;  2VUM K;  1PJ5 A;  2JA5 A;  1O28 A;  1HQM A;  5IOR A;  3GTG C;  3N3Y A;  2ZUF A;  4A3B C;  1F7U A;  2NVY K;  3FHZ A;  2E2I C;  2PA8 L;  1TWG A;  4AYB D;  5C4J K;  2XCR B;  1XXA A;  2O5J A;  4GTE A;  4KMA A;  3S1R C;  3H3V D;  3H0G K;  2GSN A;  4G7H A;  4A3K K;  4QJV A;  3HKZ D;  4NOI A;  4LQY A;  1BJT A;  4BXX K;  1TWH K;  2P5M A;  2B63 K;  2JA6 K;  5M3F K;  4P5B A;  4YG2 A;  4GTF A;  1O2F B;  4C3H K;  3S17 K;  1ISE A;  3FKI C;  3N0B A;  1K83 A;  5IP9 K;  3AD7 C;  4A3C K;  2CFA A;  3HXA A;  3HOV K;  4KM8 A;  3S16 K;  3HOX C;  1O26 A;  3N0C A;  3I4N C;  4C2M K;  4YFX A;  4X6A K;  3GTP K;  4LK0 A;  1Y1W A;  3RZO C;  3WOD A;  3LPX A;  3GTQ K;  2R7Z A;  2NVT K;  4A3E K;  3CQZ K;  2E2J C;  2JA5 K;  1I3Q K;  2XCQ A;  1BGW A;  1I6V A;  4MEY A;  5TMC A;  1VLO A;  2NVX C;  3AQP A;  5L46 A;  2WAQ D;  1VRQ C;  3GTK A;  3S1Q C;  3GTG A;  4A93 C;  4KDD A;  1TWG K;  2E2H C;  2PMZ L;  3ORE A;  1TWF K;  4Y7N C;  3ADA C;  3S14 K;  1SFO C;  5IYD K;  4PAB A;  1Y1V K;  3GTO K;  4C3J K;  2Y3P A;  4ZH4 A;  1DD5 A;  2A68 A;  2GAG C;  2A6E A;  4GFQ A;  1IS1 A;  3HOZ C;  3S1M K;  3RZD K;  4G0W A;  1ZQ1 C;  1YX2 A;  3HOU K;  3GTJ K;  3GDZ A;  1USO A;  1XXC A;  3K7A C;  5E68 A;  5TJ3 A;  4BBS C;  4KM9 A;  4Y52 C;  4JK1 A;  2V6S A;  1R9T A;  1ZBS A;  1ZXO A;  5CJ9 A;  2R92 C;  2R93 K;  1JVI A;  4MEX A;  1TWC K;  5IYB C;  5FLM C;  1AB4 A;  5HL8 A;  4KAT A;  3FKI A;  2WB1 L;  5JFE A;  3HOY K;  1Y1W K;  1DCH A;  4A3I K;  3OEP A;  2RGR A;  3M3Y C;  3AD8 C;  3DXJ A;  4FM9 A;  1EFW A;  1WCM K;  2XCO A;  3PO3 C;  3I4M C;  1O2A A;  4A3G K;  2GSU A;  3S1N C;  4BBR K;  4J3N A;  1WOP A;  3GTK K;  1TWA K;  1XPP A;  3Q3Q A;  4OIP A;  1WQG A;  2NVX A;  3L4J A;  1IE0 A;  1I6H C;  4KN7 A;  5C3E C;  1O2B A;  4G7Z A;  3S15 C;  2E2H A;  2NVQ K;  1O24 A;  2JA7 C;  4OIR A;  4BY7 C;  4GTD A;  3V4G A;  2Y0S D;  4O2D A;  1SFO A;  2VUM C;  1G51 A;  1C0A A;  2YU9 K;  2JA8 C;  3GTL A;  3ERE D;  5JVO A;  4KB2 A;  2CW0 A;  4G7O A;  2NVY C;  1R9T K;  4A3L K;  1I50 K;  3NUH A;  4BKW A;  3S2H K;  5C4J C;  4KB4 A;  4GTL A;  5IYC K;  4KAS A;  1B4A A;  3H0G C;  3QX3 A;  4A3K C;  4P5A A;  3BP3 A;  4RMF A;  4BXX C;  1TWH C;  1F9N A;  4Q5S A;  3GTM K;  1ZYR A;  2B63 C;  2JA6 C;  3T00 A;  1J6X A;  2P8T A;  4WJ3 M;  4C3H C;  5CHP A;  3AQO A;  3S17 C;  5IP9 C;  4GZY A;  1F93 A;  2RH6 A;  4A3C C;  3H3V L;  3HOV C;  3S16 C;  3T01 A;  4XCH A;  4KN4 A;  4OIQ A;  3FOE A;  2GAH C;  3HKZ L;  4C2M C;  4X6A C;  3GTP C;  1HI9 A;  3GTQ C;  5M5W K;  5IOS A;  4WJ4 A;  3SZZ A;  1WQH A;  2NVT C;  4A3E C;  3EQL A;  2E2I A;  3CQZ C;  2JA5 C;  1I3Q C;  5C4X K;  3GTL K;  5C44 K;  1UV7 A;  4QIW L;  2JA7 A;  4A3F K;  1PJ6 A;  5D4D A;  3LAJ A;  1USM A;  1XZQ B;  4G0V A;  2VUM A;  1GE9 A;  3A8I A;  1TWG C;  3K7A K;  4LOW A;  3S2D K;  1TWF C;  4P9S A;  1ZVU A;  3M4O K;  4WIL A;  2NVY A;  3S14 C;  2A6H A;  1K83 K;  5IYD C;  1YCL A;  4A3J K;  3GEI A;  1Y1V C;  3GTO C;  4C3J C;  5IP7 K;  4A3M K;  4OIN A;  3HOW K;  3TFJ A;  3S1M C;  3RZD C;  4A3D K;  3H0G A;  4BY1 K;  3GIR A;  4LLG A;  4DDQ A;  3GTJ C;  4C45 A;  1O29 A;  5M5X K;  1V5V A;  4KAR A;  4GTC A;  2R7Z K;  4C3I K;  2PA8 D;  2V6U A;  1XZP B;  2GSO A;  2R93 C;  3BP8 C;  2B63 A;  3SZY A; 
#chains in the Genus database with same CATH homology
 3IPJ A;  1IBA A;  3BP8 C;  1O2F B;  3BP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...