3BP8C

Crystal structure of mlc/eiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
b'MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NAGC-like transcriptional regulator
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 16
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp8C00
1IBAA 3BP3A 3IPJA 1O2FB 3BP8C
chains in the Genus database with same CATH superfamily
2Y3PA 3S2DK 2JA7K 2A6EA 1SFOC 1DCHA 4KASA 1TWCC 1TWGC 4P5AA 3I4MC 3S1QC 2PMZD 2R7ZC 3S16K 4A3DC 5M5XK 3S14K 4BY7C 2NVQK 1F93A 1I6VA 3BP3A 3GTOA 4M1XA 2R93K 1HI9A 3LAPA 4MEYA 1R9TA 4LR2A 1XZQA 3S1RK 1USMA 4GTFA 5D4DA 1WSRA 2NVYC 3GSIA 3K7AK 1Y1WK 2E2JC 2CFAB 4WILA 3S1NK 3L4KA 1IE0A 3AD9C 4GFQA 2JA5K 3GTJA 4A3BC 3RZDK 1IW7A 1XXBA 1BJTA 3ERED 4C45A 1V5VA 4A3LC 5M3MK 3S1MC 3AH5A 3AQOA 2B63K 5IORA 2WB1D 2VUMC 1F9NA 5FLMK 1ZQ1C 4A3IC 5IOQA 4BXXC 4Y52K 5IYCC 4C3IC 3MMLB 1WCMC 1WOSA 4PABA 4KMHA 3HOXC 5IP7K 3LPXA 3Q3QA 4QIWD 4NOIA 3SZYA 3QX3A 1WOOA 1O28A 1B4BA 1WOPA 2R93A 3GTQA 5C44C 1JQWA 1TWAK 3TFHA 1VLOA 1ISEA 3H3VL 1WORA 1SFOK 2RGRA 2E2HC 3HOZK 1TWCK 4GT9A 3M4OC 1TWGK 3S1QK 3I4MK 3HOWC 2R7ZK 2JH3A 4A3DK 4BY7K 3I4NC 3HKZL 2GAGC 1WQHA 4ZH4A 2GSUA 2XCOA 4OIOA 2WAQL 2JA6C 3OREA 2PHCB 1TWFC 3GTPA 2E2IC 1PJ6A 2EBBA 3CQZA 4YFKA 4WJ3M 2NVYK 1Y1VK 1INNA 2E2JK 3GTLC 3S17C 1C0AA 4GTAA 1J6WA 3A8JA 3BUEA 4GTCA 1TWHC 4OINA 1IBAA 1O2BA 3LAJA 4A3LK 1BS2A 3FKIK 2PA8D 1J98A 1ZBSA 2O5IA 4A3IK 5IYCK 4C3IK 2R92C 1EFWA 1DCOA 2ZFZA 4KARA 2PPBA 4XCHA 1VRQC 4KM9A 3HOXK 2JA8C 4AH6A 3FOFA 3N0CA 4LJZA 4G0UA 1O26A 5C44K 4KMAA 5CJ9A 4C3JC 3SZZA 5IYDC 2Y0SD 4XLPA 4LQYA 3HXAA 3N0BA 4QJVA 3T01A 2NVYA 3A8KA 1I50A 1WQFA 1Y1VA 4GTDA 2E2HK 4BY1C 4JK1A 5C4XC 3M4OK 3GTOC 4AYBD 4MQ9A 3HOWK 2NVXA 4Y7NC 1KQ4A 3I4NK 3H0GA 4YFXA 2CW0A 1XZPB 5TJ3A 2JA6K 1TWFK 4A3EC 2E2IK 4A3FK 3FKIA 3GTGC 2W7VA 3PO3C 2XCQA 3L4JA 1JOEA 5IYBC 4FM9A 3GTLK 3S17K 2FQOA 2JA7A 1JVIA 5IP9C 2KWAA 4P9SA 2D6FC 3N3YA 1GE9A 4X6AC 1I3QC 2RH6A 1TWHK 5JVOA 3OEPA 4Q4ZA 3G4AA 3HOYC 4A3GC 4YFNA 3GTMC 1XZQB 1EK8A 1I6HC 2ZUEA 4G7OA 3IPJA 5L46A 3T00A 2R92K 2FQTA 4PAAA 2GSOA 5EGHA 1Y1WA 2E2HA 3AD8C 2JA8K 3M3YC 1K83C 5JFEA 3GTQC 5TMCA 2JA5A 4KMUA 3GTKC 1G51A 4BBSC 3T02A 1PJ7A 4C3JK 2JA6A 5IYDK 4G7ZA 3AD7C 2E2IA 4A3MC 1O2AA 2B63A 4J3NA 2YU9C 1WIHA 5C4XK 4BY1K 1EH1A 3TFIA 3S2HC 4KN4A 3GTOK 1YCLA 1DCPA 4GTBA 4Y7NK 3GEHA 3HOVC 3GEIA 5C4JC 4KM8A 1DD5A 4A3BK 4LK0A 3GTPC 1UV7A 1TWHA 3CQZC 4Q5SA 4A3KC 4XSXA 2GAHC 4A3EK 4FZBA 1WSVA 3S15C 3S1MK 2CFAA 3PO3K 4KN7A 3GTGK 2VUMK 1TWAA 1RU0A 2NVTC 5IYBK 4OIRA 4BXXK 1XXCA 3FHZA 5IP9K 4BBRC 1SFOA 1ZXOA 1WCMK 4OIQA 1SMYA 4GTEA 1TWCA 5IOTA 2V6UA 1YX2A 1TWGA 4X6AK 2WB1L 1I3QK 3H3VD 2R7ZA 5FJ8K 3PO2C 1VH2A 5M5WK 3JSTA 3HOYK 1B4AA 4A3GK 5M5YK 3GTMK 2V6TA 3HKZD 1I6HK 3OPFA 4KMDA 4QIWL 3BP8C 3HOZC 1BDFA 2WAQD 4RMFA 1HQMA 1EI6A 3HOUC 4LK1A 1XPPA 3A8IA 1J6VA 4KB2A 1R9TC 3M3YK 4O2DA 1K83K 4WJ4A 3GTQK 4A93C 4OIPA 3GTKK 1O25A 4BBSK 3ADAC 4A3JC 4C3HC 1AB4A 1I50C 5M3FK 4A3MK 1Y1VC 3RZOC 3GTGA 2YU9K 1X31C 2VUMA 4XLNA 2NVXC 4LLGA 4KB4A 3S2HK 4A3CC 3GEEA 3H0GC 5C3EC 5IOSA 4C2MC 3GTJC 1EQRA 4MEXA 1IL2A 1WCMA 3HOVK 5C4JK 1VJEA 5HL8A 1I3QA 3GTPK 3CQZK 4A3KK 3FKIC 1BGWA 3S0XA 3S15K 1O24A 3GTMA 3S2DC 2A68A 4GTLA 2JA7C 2NVTK 3WODA 4QJVB 4BBRK 4KAWX 5TMFA 1USOA 3S16C 5EGEA 4BLBA 2PA8L 3S14C 2NVQC 1WQGA 2R93C 1IS1A 1K83A 3PO2K 3GIRA 1F7VA 3EQLA 1O27A 3S1RC 3GTKA 1L0WA 4YG2A 2PMZL 1TWFA 4P5BA 3DXJA 3K7AC 1Y1WC 3FOEA 5CHPA 1O29A 2YU9A 4DDQA 3HOUK 3S1NC 2JA5C 3GTLA 2A69A 2Y0SL 1R9TK 1YNJA 4BLAA 4GZYA 4A93K 3RZDC 1XXAA 1J6XA 2A6HA 2XCRB 4LOWA 2BE5A 4G0VA 4KDDA 2P5MA 4A3JK 4A3FC 4AYBL 2B63C 4C3HK 1I50K 3RZOK 5FLMC 1YNNA 4Y52C 3GDZA 1O2FB 4KC6A 3V4GA 2NVXK 4ILDA 1F7UA 4A3CK 2R92A 2GSNA 5E68A 1IQ0A 4XSZA 4G7HA 3H0GK 5C3EK 3G4CA 4C2MK 3GTJK 4BKWA 3AQPA 5IP7C 2V6SA 4G0WA 2P8TA 3TTGA 3VA7A 1XZPA 2ZUFA 4KATA 1ZYRA 3NUHA 1PJ5A 1ZVUA 3TFJA 2O5JA 3CAGA 1VGXA 1TWAC
chains in the Genus database with same CATH topology
1IBAA 3BP3A 3IPJA 1O2FB 3BP8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBA A;  3BP3 A;  3IPJ A;  1O2F B;  3BP8 C; 
#chains in the Genus database with same CATH topology
 2Y3P A;  3S2D K;  2JA7 K;  2A6E A;  1SFO C;  1DCH A;  4KAS A;  1TWC C;  1TWG C;  4P5A A;  3I4M C;  3S1Q C;  2PMZ D;  2R7Z C;  3S16 K;  4A3D C;  5M5X K;  3S14 K;  4BY7 C;  2NVQ K;  1F93 A;  1I6V A;  3BP3 A;  3GTO A;  4M1X A;  2R93 K;  1HI9 A;  3LAP A;  4MEY A;  1R9T A;  4LR2 A;  1XZQ A;  3S1R K;  1USM A;  4GTF A;  5D4D A;  1WSR A;  2NVY C;  3GSI A;  3K7A K;  1Y1W K;  2E2J C;  2CFA B;  4WIL A;  3S1N K;  3L4K A;  1IE0 A;  3AD9 C;  4GFQ A;  2JA5 K;  3GTJ A;  4A3B C;  3RZD K;  1IW7 A;  1XXB A;  1BJT A;  3ERE D;  4C45 A;  1V5V A;  4A3L C;  5M3M K;  3S1M C;  3AH5 A;  3AQO A;  2B63 K;  5IOR A;  2WB1 D;  2VUM C;  1F9N A;  5FLM K;  1ZQ1 C;  4A3I C;  5IOQ A;  4BXX C;  4Y52 K;  5IYC C;  4C3I C;  3MML B;  1WCM C;  1WOS A;  4PAB A;  4KMH A;  3HOX C;  5IP7 K;  3LPX A;  3Q3Q A;  4QIW D;  4NOI A;  3SZY A;  3QX3 A;  1WOO A;  1O28 A;  1B4B A;  1WOP A;  2R93 A;  3GTQ A;  5C44 C;  1JQW A;  1TWA K;  3TFH A;  1VLO A;  1ISE A;  3H3V L;  1WOR A;  1SFO K;  2RGR A;  2E2H C;  3HOZ K;  1TWC K;  4GT9 A;  3M4O C;  1TWG K;  3S1Q K;  3I4M K;  3HOW C;  2R7Z K;  2JH3 A;  4A3D K;  4BY7 K;  3I4N C;  3HKZ L;  2GAG C;  1WQH A;  4ZH4 A;  2GSU A;  2XCO A;  4OIO A;  2WAQ L;  2JA6 C;  3ORE A;  2PHC B;  1TWF C;  3GTP A;  2E2I C;  1PJ6 A;  2EBB A;  3CQZ A;  4YFK A;  4WJ3 M;  2NVY K;  1Y1V K;  1INN A;  2E2J K;  3GTL C;  3S17 C;  1C0A A;  4GTA A;  1J6W A;  3A8J A;  3BUE A;  4GTC A;  1TWH C;  4OIN A;  1IBA A;  1O2B A;  3LAJ A;  4A3L K;  1BS2 A;  3FKI K;  2PA8 D;  1J98 A;  1ZBS A;  2O5I A;  4A3I K;  5IYC K;  4C3I K;  2R92 C;  1EFW A;  1DCO A;  2ZFZ A;  4KAR A;  2PPB A;  4XCH A;  1VRQ C;  4KM9 A;  3HOX K;  2JA8 C;  4AH6 A;  3FOF A;  3N0C A;  4LJZ A;  4G0U A;  1O26 A;  5C44 K;  4KMA A;  5CJ9 A;  4C3J C;  3SZZ A;  5IYD C;  2Y0S D;  4XLP A;  4LQY A;  3HXA A;  3N0B A;  4QJV A;  3T01 A;  2NVY A;  3A8K A;  1I50 A;  1WQF A;  1Y1V A;  4GTD A;  2E2H K;  4BY1 C;  4JK1 A;  5C4X C;  3M4O K;  3GTO C;  4AYB D;  4MQ9 A;  3HOW K;  2NVX A;  4Y7N C;  1KQ4 A;  3I4N K;  3H0G A;  4YFX A;  2CW0 A;  1XZP B;  5TJ3 A;  2JA6 K;  1TWF K;  4A3E C;  2E2I K;  4A3F K;  3FKI A;  3GTG C;  2W7V A;  3PO3 C;  2XCQ A;  3L4J A;  1JOE A;  5IYB C;  4FM9 A;  3GTL K;  3S17 K;  2FQO A;  2JA7 A;  1JVI A;  5IP9 C;  2KWA A;  4P9S A;  2D6F C;  3N3Y A;  1GE9 A;  4X6A C;  1I3Q C;  2RH6 A;  1TWH K;  5JVO A;  3OEP A;  4Q4Z A;  3G4A A;  3HOY C;  4A3G C;  4YFN A;  3GTM C;  1XZQ B;  1EK8 A;  1I6H C;  2ZUE A;  4G7O A;  3IPJ A;  5L46 A;  3T00 A;  2R92 K;  2FQT A;  4PAA A;  2GSO A;  5EGH A;  1Y1W A;  2E2H A;  3AD8 C;  2JA8 K;  3M3Y C;  1K83 C;  5JFE A;  3GTQ C;  5TMC A;  2JA5 A;  4KMU A;  3GTK C;  1G51 A;  4BBS C;  3T02 A;  1PJ7 A;  4C3J K;  2JA6 A;  5IYD K;  4G7Z A;  3AD7 C;  2E2I A;  4A3M C;  1O2A A;  2B63 A;  4J3N A;  2YU9 C;  1WIH A;  5C4X K;  4BY1 K;  1EH1 A;  3TFI A;  3S2H C;  4KN4 A;  3GTO K;  1YCL A;  1DCP A;  4GTB A;  4Y7N K;  3GEH A;  3HOV C;  3GEI A;  5C4J C;  4KM8 A;  1DD5 A;  4A3B K;  4LK0 A;  3GTP C;  1UV7 A;  1TWH A;  3CQZ C;  4Q5S A;  4A3K C;  4XSX A;  2GAH C;  4A3E K;  4FZB A;  1WSV A;  3S15 C;  3S1M K;  2CFA A;  3PO3 K;  4KN7 A;  3GTG K;  2VUM K;  1TWA A;  1RU0 A;  2NVT C;  5IYB K;  4OIR A;  4BXX K;  1XXC A;  3FHZ A;  5IP9 K;  4BBR C;  1SFO A;  1ZXO A;  1WCM K;  4OIQ A;  1SMY A;  4GTE A;  1TWC A;  5IOT A;  2V6U A;  1YX2 A;  1TWG A;  4X6A K;  2WB1 L;  1I3Q K;  3H3V D;  2R7Z A;  5FJ8 K;  3PO2 C;  1VH2 A;  5M5W K;  3JST A;  3HOY K;  1B4A A;  4A3G K;  5M5Y K;  3GTM K;  2V6T A;  3HKZ D;  1I6H K;  3OPF A;  4KMD A;  4QIW L;  3BP8 C;  3HOZ C;  1BDF A;  2WAQ D;  4RMF A;  1HQM A;  1EI6 A;  3HOU C;  4LK1 A;  1XPP A;  3A8I A;  1J6V A;  4KB2 A;  1R9T C;  3M3Y K;  4O2D A;  1K83 K;  4WJ4 A;  3GTQ K;  4A93 C;  4OIP A;  3GTK K;  1O25 A;  4BBS K;  3ADA C;  4A3J C;  4C3H C;  1AB4 A;  1I50 C;  5M3F K;  4A3M K;  1Y1V C;  3RZO C;  3GTG A;  2YU9 K;  1X31 C;  2VUM A;  4XLN A;  2NVX C;  4LLG A;  4KB4 A;  3S2H K;  4A3C C;  3GEE A;  3H0G C;  5C3E C;  5IOS A;  4C2M C;  3GTJ C;  1EQR A;  4MEX A;  1IL2 A;  1WCM A;  3HOV K;  5C4J K;  1VJE A;  5HL8 A;  1I3Q A;  3GTP K;  3CQZ K;  4A3K K;  3FKI C;  1BGW A;  3S0X A;  3S15 K;  1O24 A;  3GTM A;  3S2D C;  2A68 A;  4GTL A;  2JA7 C;  2NVT K;  3WOD A;  4QJV B;  4BBR K;  4KAW X;  5TMF A;  1USO A;  3S16 C;  5EGE A;  4BLB A;  2PA8 L;  3S14 C;  2NVQ C;  1WQG A;  2R93 C;  1IS1 A;  1K83 A;  3PO2 K;  3GIR A;  1F7V A;  3EQL A;  1O27 A;  3S1R C;  3GTK A;  1L0W A;  4YG2 A;  2PMZ L;  1TWF A;  4P5B A;  3DXJ A;  3K7A C;  1Y1W C;  3FOE A;  5CHP A;  1O29 A;  2YU9 A;  4DDQ A;  3HOU K;  3S1N C;  2JA5 C;  3GTL A;  2A69 A;  2Y0S L;  1R9T K;  1YNJ A;  4BLA A;  4GZY A;  4A93 K;  3RZD C;  1XXA A;  1J6X A;  2A6H A;  2XCR B;  4LOW A;  2BE5 A;  4G0V A;  4KDD A;  2P5M A;  4A3J K;  4A3F C;  4AYB L;  2B63 C;  4C3H K;  1I50 K;  3RZO K;  5FLM C;  1YNN A;  4Y52 C;  3GDZ A;  1O2F B;  4KC6 A;  3V4G A;  2NVX K;  4ILD A;  1F7U A;  4A3C K;  2R92 A;  2GSN A;  5E68 A;  1IQ0 A;  4XSZ A;  4G7H A;  3H0G K;  5C3E K;  3G4C A;  4C2M K;  3GTJ K;  4BKW A;  3AQP A;  5IP7 C;  2V6S A;  4G0W A;  2P8T A;  3TTG A;  3VA7 A;  1XZP A;  2ZUF A;  4KAT A;  1ZYR A;  3NUH A;  1PJ5 A;  1ZVU A;  3TFJ A;  2O5J A;  3CAG A;  1VGX A;  1TWA C; 
#chains in the Genus database with same CATH homology
 1IBA A;  3BP3 A;  3IPJ A;  1O2F B;  3BP8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...