3BP8C

Crystal structure of mlc/eiib complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
MAPALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Putative NAGC-like transcriptional regulator
total genus 16
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3bp8C00
3BP8C 3IPJA 1IBAA 1O2FB 3BP3A
chains in the Genus database with same CATH superfamily
2JA6K 2R93K 1IE0A 2R92C 3HOXK 2E2JC 3OEPA 5IORA 4A3JK 4A3LC 3S0XA 2V6TA 4X6AC 4KB4A 1TWAA 4XSZA 4YG2A 4FZBA 3GTLK 5JVOA 3M3YC 2P8TA 3GTJK 3GSIA 4FM9A 4KAWX 3HXAA 4O2DA 1XPPA 3PO3C 3GTPC 2XCOA 3S1QC 3GTOA 1IL2A 1O25A 4XSXA 3HOYK 4KMUA 5IYCK 4QIWD 2A68A 2E2HC 4LOWA 4C3HK 3GTLA 4Q5SA 1O28A 1WCMK 2R7ZA 2JH3A 1VRQC 5C4JC 3M3YK 4KC6A 3EQLA 2XCRB 3AQOA 1WCMC 1O24A 3HKZL 1VJEA 3LPXA 3L4KA 2FQTA 1JQWA 5CHPA 3I4MC 2ZUEA 4J3NA 1WIHA 1USMA 3CQZK 3GTQA 3FOFA 5CJ9A 2XCQA 1G51A 2VUMC 4M1XA 4YFNA 3SZZA 1IS1A 1DCOA 1O29A 1DD5A 1WSRA 5C44C 1BJTA 4AYBL 1IBAA 4C3IC 1TWCC 3LAJA 5EGEA 4C3HC 4P9SA 3TFJA 5IP7C 3GTPA 3K7AC 2YU9A 4Y7NK 3S14K 3GIRA 4A3BK 4KM8A 5IP9K 3PO2K 1BDFA 1F93A 2PMZL 1DCPA 2PHCB 1Y1WK 4WJ3M 3TTGA 4WILA 4A3KK 4OINA 3GTPK 5TJ3A 4KN4A 1VGXA 1I3QK 3AD7C 5TMFA 3RZOK 1WORA 4G7OA 4MQ9A 2E2HK 2CFAA 3LAPA 1TWHK 2NVYK 3RZDC 3PO3K 1O2FB 1AB4A 4A3CC 3VA7A 5C4XK 4GTLA 2VUMK 4KARA 4AH6A 1UV7A 2WB1L 1BGWA 4GTDA 2JA5C 4C3JK 2NVTC 3GTOC 4P5AA 3S16C 4G0UA 4DDQA 5IP9C 5IOSA 3PO2C 1XZPB 4LQYA 1R9TK 3A8KA 3I4MK 1XXAA 3HOVC 4A3JC 2GAGC 2O5JA 1WOOA 3RZOC 4A3DK 1ZBSA 1EH1A 2WAQD 3S1RK 2CW0A 2CFAB 5FLMC 4WJ4A 1O2BA 1SFOK 4BY1K 1TWHC 3FKIK 5IOTA 5FJ8K 3GTQC 4JK1A 4BBRK 4A3FC 1R9TA 3GEIA 1K83C 4KDDA 5M3MK 1TWGA 3HOXC 1VH2A 3HOUK 3IPJA 1HI9A 1WSVA 2WB1D 1EK8A 4BXXC 4Y7NC 3S14C 3M4OC 3H3VD 1TWGC 4Y52K 3S15K 3GTKA 1TWAK 4KN7A 2ZUFA 1IQ0A 4QJVB 1TWCA 2PPBA 1BS2A 3BUEA 2Y0SD 1SFOA 3N0CA 2NVYA 3GTGC 2A69A 1XZQA 5L46A 3HOZK 2E2HA 3G4AA 4LK0A 3ERED 3S1MC 1XZPA 4GZYA 1F9NA 5IYCC 3OPFA 2PMZD 1YX2A 3GTJC 1Y1WC 4KATA 5C4XC 3N0BA 3DXJA 5C3EK 3BP8C 4KASA 2JA6A 1SFOC 4GT9A 4PABA 3M4OK 3S1NC 1WOSA 5C44K 4GTFA 5IYDC 3OREA 2RH6A 2B63C 2E2JK 2R7ZK 2KWAA 5D4DA 2B63K 1TWAC 4BLAA 4BY7C 2E2IA 1GE9A 1I50A 1J6WA 4A3MK 3AD9C 3JSTA 4RMFA 5FLMK 1I3QA 3GTOK 3S17K 3CQZC 1V5VA 1J98A 3QX3A 3S17C 4C2MC 4A3GC 3HKZD 3GTQK 4GTAA 1B4AA 1WQFA 4A3CK 3HOZC 2NVXA 1O26A 1I50C 4GTBA 1EQRA 5EGHA 5IYBK 2EBBA 1WOPA 3GEHA 2E2IK 3T01A 2B63A 1I3QC 4OIRA 2R7ZC 3S15C 1I6HK 3TFIA 1PJ7A 3S2HK 3TFHA 3GTLC 1XZQB 4KMDA 4A3BC 1JVIA 4A3MC 2ZFZA 2A6EA 4G7HA 1ZVUA 3S2DK 5IOQA 4QIWL 3NUHA 2R93C 4BLBA 4GTEA 2GSOA 1Y1VC 1TWFA 2NVYC 1TWHA 2JA5A 2RGRA 2BE5A 2E2IC 3BP3A 4A3KC 1INNA 3H0GA 1YNNA 1C0AA 1TWCK 3GTMC 2PA8D 2PA8L 3GTKK 3GTMK 2JA5K 1Y1VA 4A3LK 4A3FK 3AH5A 1K83K 1X31C 4XCHA 5IP7K 1DCHA 1Y1WA 3A8IA 4A3DC 4LK1A 2NVXC 3HOVK 4A3EK 1TWFK 4BXXK 2YU9K 2V6UA 4GFQA 1TWFC 1XXCA 5M5WK 1ZYRA 3GEEA 1J6VA 1J6XA 4YFKA 3S2DC 1JOEA 4BBRC 1O2AA 3S1NK 1SMYA 1WCMA 2JA6C 3S1MK 1F7VA 3I4NC 4QJVA 1F7UA 1HQMA 4BY7K 2VUMA 3V4GA 3ADAC 1WQGA 4OIPA 1R9TC 2Y0SL 4ZH4A 3GTGK 4LJZA 3K7AK 3SZYA 3L4JA 4MEXA 3S2HC 3FKIA 4A3GK 2GSNA 3H3VL 2V6SA 4Y52C 2P5MA 1ISEA 4G0VA 4A93C 1EI6A 4KMHA 5TMCA 3AQPA 1O27A 1EFWA 1I50K 2O5IA 4GTCA 4A93K 2JA7K 4A3IK 3MMLB 3GDZA 3G4CA 4KMAA 3FHZA 4C45A 1ZXOA 4PAAA 4KM9A 4AYBD 4C3IK 4ILDA 5IYDK 4G0WA 4OIQA 1TWGK 2JA7C 2JA8C 2R92A 5C4JK 1YCLA 4G7ZA 3A8JA 4A3EC 4BBSC 2A6HA 4X6AK 2JA7A 1VLOA 3Q3QA 1WQHA 3GTJA 3H0GK 1I6VA 2D6FC 1IW7A 3WODA 4XLNA 4KB2A 1PJ6A 4BBSK 1USOA 5M5XK 2R93A 1KQ4A 3HOWC 4XLPA 5M5YK 5M3FK 3CAGA 4YFXA 2NVXK 3GTGA 5C3EC 2NVQK 5HL8A 4LR2A 3HOYC 2FQOA 3CQZA 1K83A 3N3YA 1ZQ1C 4NOIA 3GTKC 1Y1VK 1I6HC 3GTMA 4BKWA 2JA8K 5JFEA 4C3JC 2NVTK 2Y3PA 4Q4ZA 2W7VA 1XXBA 2GAHC 3AD8C 3H0GC 1YNJA 3T02A 3I4NK 2GSUA 1RU0A 4OIOA 3FOEA 3S1QK 1B4BA 4P5BA 1PJ5A 3RZDK 3HOWK 4LLGA 4C2MK 2WAQL 1L0WA 5E68A 4MEYA 3HOUC 3S1RC 3T00A 2NVQC 4A3IC 3FKIC 5IYBC 2R92K 4BY1C 2YU9C 3S16K
chains in the Genus database with same CATH topology
3BP8C 3IPJA 1IBAA 1O2FB 3BP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 C;  3IPJ A;  1IBA A;  1O2F B;  3BP3 A; 
#chains in the Genus database with same CATH topology
 2JA6 K;  2R93 K;  1IE0 A;  2R92 C;  3HOX K;  2E2J C;  3OEP A;  5IOR A;  4A3J K;  4A3L C;  3S0X A;  2V6T A;  4X6A C;  4KB4 A;  1TWA A;  4XSZ A;  4YG2 A;  4FZB A;  3GTL K;  5JVO A;  3M3Y C;  2P8T A;  3GTJ K;  3GSI A;  4FM9 A;  4KAW X;  3HXA A;  4O2D A;  1XPP A;  3PO3 C;  3GTP C;  2XCO A;  3S1Q C;  3GTO A;  1IL2 A;  1O25 A;  4XSX A;  3HOY K;  4KMU A;  5IYC K;  4QIW D;  2A68 A;  2E2H C;  4LOW A;  4C3H K;  3GTL A;  4Q5S A;  1O28 A;  1WCM K;  2R7Z A;  2JH3 A;  1VRQ C;  5C4J C;  3M3Y K;  4KC6 A;  3EQL A;  2XCR B;  3AQO A;  1WCM C;  1O24 A;  3HKZ L;  1VJE A;  3LPX A;  3L4K A;  2FQT A;  1JQW A;  5CHP A;  3I4M C;  2ZUE A;  4J3N A;  1WIH A;  1USM A;  3CQZ K;  3GTQ A;  3FOF A;  5CJ9 A;  2XCQ A;  1G51 A;  2VUM C;  4M1X A;  4YFN A;  3SZZ A;  1IS1 A;  1DCO A;  1O29 A;  1DD5 A;  1WSR A;  5C44 C;  1BJT A;  4AYB L;  1IBA A;  4C3I C;  1TWC C;  3LAJ A;  5EGE A;  4C3H C;  4P9S A;  3TFJ A;  5IP7 C;  3GTP A;  3K7A C;  2YU9 A;  4Y7N K;  3S14 K;  3GIR A;  4A3B K;  4KM8 A;  5IP9 K;  3PO2 K;  1BDF A;  1F93 A;  2PMZ L;  1DCP A;  2PHC B;  1Y1W K;  4WJ3 M;  3TTG A;  4WIL A;  4A3K K;  4OIN A;  3GTP K;  5TJ3 A;  4KN4 A;  1VGX A;  1I3Q K;  3AD7 C;  5TMF A;  3RZO K;  1WOR A;  4G7O A;  4MQ9 A;  2E2H K;  2CFA A;  3LAP A;  1TWH K;  2NVY K;  3RZD C;  3PO3 K;  1O2F B;  1AB4 A;  4A3C C;  3VA7 A;  5C4X K;  4GTL A;  2VUM K;  4KAR A;  4AH6 A;  1UV7 A;  2WB1 L;  1BGW A;  4GTD A;  2JA5 C;  4C3J K;  2NVT C;  3GTO C;  4P5A A;  3S16 C;  4G0U A;  4DDQ A;  5IP9 C;  5IOS A;  3PO2 C;  1XZP B;  4LQY A;  1R9T K;  3A8K A;  3I4M K;  1XXA A;  3HOV C;  4A3J C;  2GAG C;  2O5J A;  1WOO A;  3RZO C;  4A3D K;  1ZBS A;  1EH1 A;  2WAQ D;  3S1R K;  2CW0 A;  2CFA B;  5FLM C;  4WJ4 A;  1O2B A;  1SFO K;  4BY1 K;  1TWH C;  3FKI K;  5IOT A;  5FJ8 K;  3GTQ C;  4JK1 A;  4BBR K;  4A3F C;  1R9T A;  3GEI A;  1K83 C;  4KDD A;  5M3M K;  1TWG A;  3HOX C;  1VH2 A;  3HOU K;  3IPJ A;  1HI9 A;  1WSV A;  2WB1 D;  1EK8 A;  4BXX C;  4Y7N C;  3S14 C;  3M4O C;  3H3V D;  1TWG C;  4Y52 K;  3S15 K;  3GTK A;  1TWA K;  4KN7 A;  2ZUF A;  1IQ0 A;  4QJV B;  1TWC A;  2PPB A;  1BS2 A;  3BUE A;  2Y0S D;  1SFO A;  3N0C A;  2NVY A;  3GTG C;  2A69 A;  1XZQ A;  5L46 A;  3HOZ K;  2E2H A;  3G4A A;  4LK0 A;  3ERE D;  3S1M C;  1XZP A;  4GZY A;  1F9N A;  5IYC C;  3OPF A;  2PMZ D;  1YX2 A;  3GTJ C;  1Y1W C;  4KAT A;  5C4X C;  3N0B A;  3DXJ A;  5C3E K;  3BP8 C;  4KAS A;  2JA6 A;  1SFO C;  4GT9 A;  4PAB A;  3M4O K;  3S1N C;  1WOS A;  5C44 K;  4GTF A;  5IYD C;  3ORE A;  2RH6 A;  2B63 C;  2E2J K;  2R7Z K;  2KWA A;  5D4D A;  2B63 K;  1TWA C;  4BLA A;  4BY7 C;  2E2I A;  1GE9 A;  1I50 A;  1J6W A;  4A3M K;  3AD9 C;  3JST A;  4RMF A;  5FLM K;  1I3Q A;  3GTO K;  3S17 K;  3CQZ C;  1V5V A;  1J98 A;  3QX3 A;  3S17 C;  4C2M C;  4A3G C;  3HKZ D;  3GTQ K;  4GTA A;  1B4A A;  1WQF A;  4A3C K;  3HOZ C;  2NVX A;  1O26 A;  1I50 C;  4GTB A;  1EQR A;  5EGH A;  5IYB K;  2EBB A;  1WOP A;  3GEH A;  2E2I K;  3T01 A;  2B63 A;  1I3Q C;  4OIR A;  2R7Z C;  3S15 C;  1I6H K;  3TFI A;  1PJ7 A;  3S2H K;  3TFH A;  3GTL C;  1XZQ B;  4KMD A;  4A3B C;  1JVI A;  4A3M C;  2ZFZ A;  2A6E A;  4G7H A;  1ZVU A;  3S2D K;  5IOQ A;  4QIW L;  3NUH A;  2R93 C;  4BLB A;  4GTE A;  2GSO A;  1Y1V C;  1TWF A;  2NVY C;  1TWH A;  2JA5 A;  2RGR A;  2BE5 A;  2E2I C;  3BP3 A;  4A3K C;  1INN A;  3H0G A;  1YNN A;  1C0A A;  1TWC K;  3GTM C;  2PA8 D;  2PA8 L;  3GTK K;  3GTM K;  2JA5 K;  1Y1V A;  4A3L K;  4A3F K;  3AH5 A;  1K83 K;  1X31 C;  4XCH A;  5IP7 K;  1DCH A;  1Y1W A;  3A8I A;  4A3D C;  4LK1 A;  2NVX C;  3HOV K;  4A3E K;  1TWF K;  4BXX K;  2YU9 K;  2V6U A;  4GFQ A;  1TWF C;  1XXC A;  5M5W K;  1ZYR A;  3GEE A;  1J6V A;  1J6X A;  4YFK A;  3S2D C;  1JOE A;  4BBR C;  1O2A A;  3S1N K;  1SMY A;  1WCM A;  2JA6 C;  3S1M K;  1F7V A;  3I4N C;  4QJV A;  1F7U A;  1HQM A;  4BY7 K;  2VUM A;  3V4G A;  3ADA C;  1WQG A;  4OIP A;  1R9T C;  2Y0S L;  4ZH4 A;  3GTG K;  4LJZ A;  3K7A K;  3SZY A;  3L4J A;  4MEX A;  3S2H C;  3FKI A;  4A3G K;  2GSN A;  3H3V L;  2V6S A;  4Y52 C;  2P5M A;  1ISE A;  4G0V A;  4A93 C;  1EI6 A;  4KMH A;  5TMC A;  3AQP A;  1O27 A;  1EFW A;  1I50 K;  2O5I A;  4GTC A;  4A93 K;  2JA7 K;  4A3I K;  3MML B;  3GDZ A;  3G4C A;  4KMA A;  3FHZ A;  4C45 A;  1ZXO A;  4PAA A;  4KM9 A;  4AYB D;  4C3I K;  4ILD A;  5IYD K;  4G0W A;  4OIQ A;  1TWG K;  2JA7 C;  2JA8 C;  2R92 A;  5C4J K;  1YCL A;  4G7Z A;  3A8J A;  4A3E C;  4BBS C;  2A6H A;  4X6A K;  2JA7 A;  1VLO A;  3Q3Q A;  1WQH A;  3GTJ A;  3H0G K;  1I6V A;  2D6F C;  1IW7 A;  3WOD A;  4XLN A;  4KB2 A;  1PJ6 A;  4BBS K;  1USO A;  5M5X K;  2R93 A;  1KQ4 A;  3HOW C;  4XLP A;  5M5Y K;  5M3F K;  3CAG A;  4YFX A;  2NVX K;  3GTG A;  5C3E C;  2NVQ K;  5HL8 A;  4LR2 A;  3HOY C;  2FQO A;  3CQZ A;  1K83 A;  3N3Y A;  1ZQ1 C;  4NOI A;  3GTK C;  1Y1V K;  1I6H C;  3GTM A;  4BKW A;  2JA8 K;  5JFE A;  4C3J C;  2NVT K;  2Y3P A;  4Q4Z A;  2W7V A;  1XXB A;  2GAH C;  3AD8 C;  3H0G C;  1YNJ A;  3T02 A;  3I4N K;  2GSU A;  1RU0 A;  4OIO A;  3FOE A;  3S1Q K;  1B4B A;  4P5B A;  1PJ5 A;  3RZD K;  3HOW K;  4LLG A;  4C2M K;  2WAQ L;  1L0W A;  5E68 A;  4MEY A;  3HOU C;  3S1R C;  3T00 A;  2NVQ C;  4A3I C;  3FKI C;  5IYB C;  2R92 K;  4BY1 C;  2YU9 C;  3S16 K; 
#chains in the Genus database with same CATH homology
 3BP8 C;  3IPJ A;  1IBA A;  1O2F B;  3BP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...