2CFAB

Structure of viral flavin-dependant thymidylate synthase thyx
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
Knots found
sequence length
215
structure length
178
Chain Sequence
b'MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQINNKTASGLLKYIRHKHWSIFETAFMTLELKTSRGIAAQVIRHRSFHFQEFSPWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFSIAKALDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE SYNTHASE
publication title Catalytic Mechanism and Structure of Viral Flavin-Dependent Thymidylate Synthase Thyx.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 51
structure length 178
sequence length 215
other databases KnotProt 2.0: S -31
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2cfaB01
4GTBA 4P5AA 4P5BA 3G4CA 4KARA 3N0CA 5IORA 4GTLA 1O28A 3N0BA 5JFEA 1KQ4A 4KASA 3N3YA 1O29A 5CHPA 5IOQA 3AH5A 4GTCA 1O26A 4GTFA 1O25A 3G4AA 1O24A 5IOTA 4KATA 4GTAA 5IOSA 1O2BA 1O2AA 2CFAB 4GTDA 1O27A 2CFAA 4FZBA 4GTEA 4GT9A
chains in the Genus database with same CATH superfamily
4GZYA 4A3GC 1PJ5A 4G7HA 3G4CA 3HOUK 4BY7C 3S1RK 4WJ4A 2YU9C 4KASA 1Y1VC 1XZQA 3IPJA 3HOWK 4C45A 4GTCA 5M5WK 4MEYA 1WIHA 3H3VL 1WQGA 1IQ0A 4LQYA 4FM9A 1WOPA 4A3LC 4A3CC 4Q4ZA 4LK0A 5IYCC 1XZPB 1EK8A 1WORA 1EI6A 3LAPA 4ILDA 4C3HK 1WQHA 5IP7K 5EGHA 1TWHC 3H0GA 3HOVK 4O2DA 5IOQA 4GTFA 4C2MC 3GTJC 2PPBA 4KN7A 2V6UA 5D4DA 1J6VA 3S1MK 3M4OK 3H0GC 1DCOA 2CFAB 2VUMA 2V6SA 1L0WA 4WILA 5C4JK 4GTBA 3T02A 2GAGC 2PHCB 2Y0SD 1VH2A 3GTMC 2ZFZA 3I4MC 4A3DK 4Y52C 5C3EC 4Q5SA 3QX3A 1JQWA 2B63C 3S16C 3S15K 4QJVA 3AD9C 1O2AA 3TFHA 2XCQA 1R9TK 3SZZA 4P5AA 3I4NK 5FLMC 1WOOA 1XXBA 2O5JA 1IE0A 1F7VA 3N0BA 3GTKA 3HKZL 1BJTA 5TMFA 2A69A 3HKZD 1IBAA 5TMCA 1O25A 1I3QA 3HOUC 3K7AK 2FQTA 3S1RC 4A3FK 4XLPA 3CQZK 5IOSA 3S0XA 1XXCA 1O2BA 3HOWC 2RGRA 2VUMK 2Y3PA 4YFXA 4OIRA 1BGWA 1ISEA 1HI9A 4KB4A 1TWAA 4M1XA 2R7ZK 3N3YA 4QIWL 3L4KA 3M3YK 3RZOK 3LAJA 2PA8L 4P9SA 3EQLA 4QIWD 4C3HC 5IP7C 2PMZL 1VJEA 2PA8D 3OEPA 5L46A 5E68A 1O27A 3JSTA 3HOVC 4RMFA 1F9NA 1ZQ1C 3FHZA 3GEIA 3S14K 3PO2K 2A6EA 1YX2A 4AYBD 3N0CA 3V4GA 2R93K 4PABA 3GTKK 1ZYRA 3GTQK 3M4OC 3S1MC 1ZVUA 4A3EK 3FKIA 3T00A 3Q3QA 1VRQC 1WCMA 1TWCA 5C4JC 1EH1A 3AD7C 1I3QK 5IP9K 5M5XK 4Y7NK 4BKWA 4A3BK 3S1QK 3GTPA 3GSIA 1TWGK 3FOFA 4KM8A 1R9TA 3ADAC 3GDZA 1WSVA 4LOWA 2W7VA 3NUHA 4KAWX 4A3DC 3FOEA 3GEHA 3T01A 1I6HK 1TWAK 1XPPA 1O28A 4XLNA 1KQ4A 2NVYA 1XZQB 4NOIA 1F93A 2E2HA 3GTLA 3S15C 1J6WA 2WAQL 3AH5A 4MEXA 2JA5A 1R9TC 4BXXK 3I4NC 2WAQD 5JVOA 4GFQA 2BE5A 3S2HK 1HQMA 3CQZA 2GSOA 3BP8C 2Y0SL 2E2IK 4KC6A 2NVTK 4KARA 3K7AC 1EFWA 2CW0A 4XSZA 4A3FC 1DD5A 3PO3K 4A3KK 1K83A 2R7ZA 3CQZC 3HOXK 3FKIK 1B4BA 1O26A 4LR2A 4J3NA 2VUMC 2RH6A 1F7UA 1WCMK 1TWCK 3A8IA 4YFKA 1BDFA 3GTPK 3A8KA 4KATA 1JVIA 2R7ZC 1I50A 4G7ZA 3GEEA 4G0WA 3M3YC 4BLBA 3RZOC 5IORA 4X6AK 3L4JA 2R93A 5M3MK 4BBSC 1Y1WA 2NVYK 2E2HK 3GTQA 3GTLK 1GE9A 4PAAA 3BUEA 2JA5K 2A68A 3S14C 3PO2C 1YNJA 2R93C 3GTKC 4QJVB 3GTQC 1TWGA 4GT9A 5CJ9A 4BLAA 4A3EC 4A3IK 4KMDA 4Y7NC 5IP9C 1I3QC 4A3BC 3S1QC 2JA8C 1K83K 1TWGC 1WOSA 3HOYK 4KMHA 3G4AA 1I6HC 5IYDK 2GAHC 1O24A 1TWAC 5IOTA 1JOEA 4C3IK 4BBSK 2JA6A 4BY1K 4GTAA 5TJ3A 2ZUFA 1I50K 4AYBL 4MQ9A 2WB1L 1DCHA 1J98A 3GTOK 4P5BA 4BXXC 2E2IA 2JA7A 4KM9A 1G51A 2NVXA 1SMYA 2NVQK 3S2HC 2WB1D 1AB4A 1SFOA 3GTGA 1TWFA 5JFEA 1Y1WK 3LPXA 4A93K 2KWAA 4LLGA 1ZBSA 1B4AA 3MMLB 5C4XK 2E2IC 3TFJA 2XCRB 1PJ7A 2NVTC 3TFIA 3S17K 2YU9A 1RU0A 2R92A 4DDQA 1TWFC 4YG2A 2JA8K 3PO3C 4A3KC 5C44K 4LK1A 3HOZK 3HOXC 1XZPA 3FKIC 4LJZA 1WCMC 1TWCC 2A6HA 1INNA 1I6VA 4OIPA 1VLOA 3VA7A 2R92C 3GTPC 1BS2A 4C3JK 2FQOA 4OIQA 4OIOA 5M5YK 1IS1A 3OREA 2O5IA 3S2DK 1TWHA 2GSUA 3SZYA 4X6AC 3H3VD 4A3MK 2JA6K 2P8TA 2NVYC 4BBRK 3OPFA 4GTDA 2E2JK 2E2HC 2CFAA 3GTLC 4GTEA 5FJ8K 3S1NK 3GTJA 4KN4A 2JA5C 2P5MA 4A3JK 2JA7K 1V5VA 2NVXK 1SFOK 4GTLA 5IYBK 3GTGK 1TWFK 3RZDK 1EQRA 4A3GK 4A3IC 1O2FB 4BY7K 4G7OA 1J6XA 2YU9K 2R92K 1Y1VK 1K83C 1UV7A 4KMUA 3GTMA 4G0UA 4AH6A 3GTOA 3HOYC 5IYDC 4A3LK 2B63A 1XXAA 4A3CK 1C0AA 1YNNA 4G0VA 4C3IC 1ZXOA 3AD8C 5M3FK 2JH3A 5HL8A 5IYCK 1O29A 4BY1C 1I50C 5EGEA 3GIRA 3GTOC 1TWHK 2EBBA 3HXAA 2NVQC 4XCHA 1USOA 4JK1A 1Y1WC 4A93C 3CAGA 1VGXA 2ZUEA 4C2MK 3GTJK 4XSXA 5C4XC 4KDDA 1PJ6A 3S17C 3H0GK 5C44C 5CHPA 3HOZC 1IL2A 3ERED 4WJ3M 4ZH4A 2V6TA 3WODA 3TTGA 3A8JA 3DXJA 1YCLA 4C3JC 3GTMK 3AQPA 4FZBA 4OINA 3I4MK 4Y52K 5C3EK 3S2DC 3BP3A 2B63K 3S16K 4A3MC 1WQFA 2JA6C 1X31C 1USMA 2XCOA 4KB2A 4BBRC 4YFNA 2E2JC 2GSNA 3S1NC 1DCPA 5FLMK 4A3JC 2JA7C 2NVXC 1SFOC 1IW7A 5IYBC 3GTGC 1Y1VA 2PMZD 4KMAA 1WSRA 3RZDC 3AQOA 2D6FC
chains in the Genus database with same CATH topology
1BGWA 1ISEA 4KB4A 3G4CA 1TWAA 5IORA 4M1XA 3L4JA 4GTLA 2R93A 1Y1WA 4KASA 3N3YA 3GTQA 1GE9A 4GTCA 3BUEA 3L4KA 3LAJA 1WIHA 4C3HC 1WQGA 4LQYA 4FM9A 3GTMA 3OEPA 4G0UA 1O27A 1TWGA 4GT9A 5CJ9A 4BLAA 1EK8A 1F9NA 3FHZA 4KMDA 3GTOA 3LAPA 4ILDA 1WQHA 5EGHA 3N0CA 3V4GA 2B63A 1XXAA 4G0VA 4C3IC 1ZXOA 3H0GA 2JH3A 1ZVUA 1O29A 5IOQA 3FKIA 5EGEA 3Q3QA 4GTFA 4C2MC 1WCMA 1TWCA 4KMHA 3G4AA 1EH1A 1O24A 4BKWA 3GTPA 5IOTA 2JA6A 4GTAA 5TJ3A 3CAGA 2CFAB 3FOFA 2VUMA 4KM8A 1R9TA 3NUHA 4GTBA 4KAWX 4P5BA 3FOEA 2E2IA 2JA7A 4KDDA 4KM9A 2NVXA 2PHCB 1SFOA 1AB4A 1O28A 3GTGA 1TWFA 1KQ4A 2NVYA 3LPXA 5JFEA 2KWAA 2E2HA 3GTLA 1ZBSA 1B4AA 3AH5A 2ZFZA 5CHPA 2JA5A 3MMLB 3ERED 5JVOA 4GFQA 2XCRB 3QX3A 2YU9A 2R92A 4DDQA 4C3JC 1O2AA 3AQPA 2XCQA 2GSOA 3CQZA 4FZBA 4KC6A 4P5AA 4KARA 1XXBA 3VA7A 1DD5A 3N0BA 1WQFA 3GTKA 1K83A 2R7ZA 1BJTA 2XCOA 4KB2A 1IS1A 2GSNA 1B4BA 1O26A 3OREA 4LR2A 4J3NA 2RH6A 1O25A 1I3QA 1TWHA 2GSUA 4KATA 5IOSA 3OPFA 1Y1VA 1XXCA 4GTDA 1O2BA 4KMAA 1I50A 2CFAA 3S0XA 4GTEA 2RGRA 4G0WA 2Y3PA 3AQOA 3GTJA 2P5MA 4BLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTB A;  4P5A A;  4P5B A;  3G4C A;  4KAR A;  3N0C A;  5IOR A;  4GTL A;  1O28 A;  3N0B A;  5JFE A;  1KQ4 A;  4KAS A;  3N3Y A;  1O29 A;  5CHP A;  5IOQ A;  3AH5 A;  4GTC A;  1O26 A;  4GTF A;  1O25 A;  3G4A A;  1O24 A;  5IOT A;  4KAT A;  4GTA A;  5IOS A;  1O2B A;  1O2A A;  2CFA B;  4GTD A;  1O27 A;  2CFA A;  4FZB A;  4GTE A;  4GT9 A; 
#chains in the Genus database with same CATH topology
 4GZY A;  4A3G C;  1PJ5 A;  4G7H A;  3G4C A;  3HOU K;  4BY7 C;  3S1R K;  4WJ4 A;  2YU9 C;  4KAS A;  1Y1V C;  1XZQ A;  3IPJ A;  3HOW K;  4C45 A;  4GTC A;  5M5W K;  4MEY A;  1WIH A;  3H3V L;  1WQG A;  1IQ0 A;  4LQY A;  4FM9 A;  1WOP A;  4A3L C;  4A3C C;  4Q4Z A;  4LK0 A;  5IYC C;  1XZP B;  1EK8 A;  1WOR A;  1EI6 A;  3LAP A;  4ILD A;  4C3H K;  1WQH A;  5IP7 K;  5EGH A;  1TWH C;  3H0G A;  3HOV K;  4O2D A;  5IOQ A;  4GTF A;  4C2M C;  3GTJ C;  2PPB A;  4KN7 A;  2V6U A;  5D4D A;  1J6V A;  3S1M K;  3M4O K;  3H0G C;  1DCO A;  2CFA B;  2VUM A;  2V6S A;  1L0W A;  4WIL A;  5C4J K;  4GTB A;  3T02 A;  2GAG C;  2PHC B;  2Y0S D;  1VH2 A;  3GTM C;  2ZFZ A;  3I4M C;  4A3D K;  4Y52 C;  5C3E C;  4Q5S A;  3QX3 A;  1JQW A;  2B63 C;  3S16 C;  3S15 K;  4QJV A;  3AD9 C;  1O2A A;  3TFH A;  2XCQ A;  1R9T K;  3SZZ A;  4P5A A;  3I4N K;  5FLM C;  1WOO A;  1XXB A;  2O5J A;  1IE0 A;  1F7V A;  3N0B A;  3GTK A;  3HKZ L;  1BJT A;  5TMF A;  2A69 A;  3HKZ D;  1IBA A;  5TMC A;  1O25 A;  1I3Q A;  3HOU C;  3K7A K;  2FQT A;  3S1R C;  4A3F K;  4XLP A;  3CQZ K;  5IOS A;  3S0X A;  1XXC A;  1O2B A;  3HOW C;  2RGR A;  2VUM K;  2Y3P A;  4YFX A;  4OIR A;  1BGW A;  1ISE A;  1HI9 A;  4KB4 A;  1TWA A;  4M1X A;  2R7Z K;  3N3Y A;  4QIW L;  3L4K A;  3M3Y K;  3RZO K;  3LAJ A;  2PA8 L;  4P9S A;  3EQL A;  4QIW D;  4C3H C;  5IP7 C;  2PMZ L;  1VJE A;  2PA8 D;  3OEP A;  5L46 A;  5E68 A;  1O27 A;  3JST A;  3HOV C;  4RMF A;  1F9N A;  1ZQ1 C;  3FHZ A;  3GEI A;  3S14 K;  3PO2 K;  2A6E A;  1YX2 A;  4AYB D;  3N0C A;  3V4G A;  2R93 K;  4PAB A;  3GTK K;  1ZYR A;  3GTQ K;  3M4O C;  3S1M C;  1ZVU A;  4A3E K;  3FKI A;  3T00 A;  3Q3Q A;  1VRQ C;  1WCM A;  1TWC A;  5C4J C;  1EH1 A;  3AD7 C;  1I3Q K;  5IP9 K;  5M5X K;  4Y7N K;  4BKW A;  4A3B K;  3S1Q K;  3GTP A;  3GSI A;  1TWG K;  3FOF A;  4KM8 A;  1R9T A;  3ADA C;  3GDZ A;  1WSV A;  4LOW A;  2W7V A;  3NUH A;  4KAW X;  4A3D C;  3FOE A;  3GEH A;  3T01 A;  1I6H K;  1TWA K;  1XPP A;  1O28 A;  4XLN A;  1KQ4 A;  2NVY A;  1XZQ B;  4NOI A;  1F93 A;  2E2H A;  3GTL A;  3S15 C;  1J6W A;  2WAQ L;  3AH5 A;  4MEX A;  2JA5 A;  1R9T C;  4BXX K;  3I4N C;  2WAQ D;  5JVO A;  4GFQ A;  2BE5 A;  3S2H K;  1HQM A;  3CQZ A;  2GSO A;  3BP8 C;  2Y0S L;  2E2I K;  4KC6 A;  2NVT K;  4KAR A;  3K7A C;  1EFW A;  2CW0 A;  4XSZ A;  4A3F C;  1DD5 A;  3PO3 K;  4A3K K;  1K83 A;  2R7Z A;  3CQZ C;  3HOX K;  3FKI K;  1B4B A;  1O26 A;  4LR2 A;  4J3N A;  2VUM C;  2RH6 A;  1F7U A;  1WCM K;  1TWC K;  3A8I A;  4YFK A;  1BDF A;  3GTP K;  3A8K A;  4KAT A;  1JVI A;  2R7Z C;  1I50 A;  4G7Z A;  3GEE A;  4G0W A;  3M3Y C;  4BLB A;  3RZO C;  5IOR A;  4X6A K;  3L4J A;  2R93 A;  5M3M K;  4BBS C;  1Y1W A;  2NVY K;  2E2H K;  3GTQ A;  3GTL K;  1GE9 A;  4PAA A;  3BUE A;  2JA5 K;  2A68 A;  3S14 C;  3PO2 C;  1YNJ A;  2R93 C;  3GTK C;  4QJV B;  3GTQ C;  1TWG A;  4GT9 A;  5CJ9 A;  4BLA A;  4A3E C;  4A3I K;  4KMD A;  4Y7N C;  5IP9 C;  1I3Q C;  4A3B C;  3S1Q C;  2JA8 C;  1K83 K;  1TWG C;  1WOS A;  3HOY K;  4KMH A;  3G4A A;  1I6H C;  5IYD K;  2GAH C;  1O24 A;  1TWA C;  5IOT A;  1JOE A;  4C3I K;  4BBS K;  2JA6 A;  4BY1 K;  4GTA A;  5TJ3 A;  2ZUF A;  1I50 K;  4AYB L;  4MQ9 A;  2WB1 L;  1DCH A;  1J98 A;  3GTO K;  4P5B A;  4BXX C;  2E2I A;  2JA7 A;  4KM9 A;  1G51 A;  2NVX A;  1SMY A;  2NVQ K;  3S2H C;  2WB1 D;  1AB4 A;  1SFO A;  3GTG A;  1TWF A;  5JFE A;  1Y1W K;  3LPX A;  4A93 K;  2KWA A;  4LLG A;  1ZBS A;  1B4A A;  3MML B;  5C4X K;  2E2I C;  3TFJ A;  2XCR B;  1PJ7 A;  2NVT C;  3TFI A;  3S17 K;  2YU9 A;  1RU0 A;  2R92 A;  4DDQ A;  1TWF C;  4YG2 A;  2JA8 K;  3PO3 C;  4A3K C;  5C44 K;  4LK1 A;  3HOZ K;  3HOX C;  1XZP A;  3FKI C;  4LJZ A;  1WCM C;  1TWC C;  2A6H A;  1INN A;  1I6V A;  4OIP A;  1VLO A;  3VA7 A;  2R92 C;  3GTP C;  1BS2 A;  4C3J K;  2FQO A;  4OIQ A;  4OIO A;  5M5Y K;  1IS1 A;  3ORE A;  2O5I A;  3S2D K;  1TWH A;  2GSU A;  3SZY A;  4X6A C;  3H3V D;  4A3M K;  2JA6 K;  2P8T A;  2NVY C;  4BBR K;  3OPF A;  4GTD A;  2E2J K;  2E2H C;  2CFA A;  3GTL C;  4GTE A;  5FJ8 K;  3S1N K;  3GTJ A;  4KN4 A;  2JA5 C;  2P5M A;  4A3J K;  2JA7 K;  1V5V A;  2NVX K;  1SFO K;  4GTL A;  5IYB K;  3GTG K;  1TWF K;  3RZD K;  1EQR A;  4A3G K;  4A3I C;  1O2F B;  4BY7 K;  4G7O A;  1J6X A;  2YU9 K;  2R92 K;  1Y1V K;  1K83 C;  1UV7 A;  4KMU A;  3GTM A;  4G0U A;  4AH6 A;  3GTO A;  3HOY C;  5IYD C;  4A3L K;  2B63 A;  1XXA A;  4A3C K;  1C0A A;  1YNN A;  4G0V A;  4C3I C;  1ZXO A;  3AD8 C;  5M3F K;  2JH3 A;  5HL8 A;  5IYC K;  1O29 A;  4BY1 C;  1I50 C;  5EGE A;  3GIR A;  3GTO C;  1TWH K;  2EBB A;  3HXA A;  2NVQ C;  4XCH A;  1USO A;  4JK1 A;  1Y1W C;  4A93 C;  3CAG A;  1VGX A;  2ZUE A;  4C2M K;  3GTJ K;  4XSX A;  5C4X C;  4KDD A;  1PJ6 A;  3S17 C;  3H0G K;  5C44 C;  5CHP A;  3HOZ C;  1IL2 A;  3ERE D;  4WJ3 M;  4ZH4 A;  2V6T A;  3WOD A;  3TTG A;  3A8J A;  3DXJ A;  1YCL A;  4C3J C;  3GTM K;  3AQP A;  4FZB A;  4OIN A;  3I4M K;  4Y52 K;  5C3E K;  3S2D C;  3BP3 A;  2B63 K;  3S16 K;  4A3M C;  1WQF A;  2JA6 C;  1X31 C;  1USM A;  2XCO A;  4KB2 A;  4BBR C;  4YFN A;  2E2J C;  2GSN A;  3S1N C;  1DCP A;  5FLM K;  4A3J C;  2JA7 C;  2NVX C;  1SFO C;  1IW7 A;  5IYB C;  3GTG C;  1Y1V A;  2PMZ D;  4KMA A;  1WSR A;  3RZD C;  3AQO A;  2D6F C; 
#chains in the Genus database with same CATH homology
 1BGW A;  1ISE A;  4KB4 A;  3G4C A;  1TWA A;  5IOR A;  4M1X A;  3L4J A;  4GTL A;  2R93 A;  1Y1W A;  4KAS A;  3N3Y A;  3GTQ A;  1GE9 A;  4GTC A;  3BUE A;  3L4K A;  3LAJ A;  1WIH A;  4C3H C;  1WQG A;  4LQY A;  4FM9 A;  3GTM A;  3OEP A;  4G0U A;  1O27 A;  1TWG A;  4GT9 A;  5CJ9 A;  4BLA A;  1EK8 A;  1F9N A;  3FHZ A;  4KMD A;  3GTO A;  3LAP A;  4ILD A;  1WQH A;  5EGH A;  3N0C A;  3V4G A;  2B63 A;  1XXA A;  4G0V A;  4C3I C;  1ZXO A;  3H0G A;  2JH3 A;  1ZVU A;  1O29 A;  5IOQ A;  3FKI A;  5EGE A;  3Q3Q A;  4GTF A;  4C2M C;  1WCM A;  1TWC A;  4KMH A;  3G4A A;  1EH1 A;  1O24 A;  4BKW A;  3GTP A;  5IOT A;  2JA6 A;  4GTA A;  5TJ3 A;  3CAG A;  2CFA B;  3FOF A;  2VUM A;  4KM8 A;  1R9T A;  3NUH A;  4GTB A;  4KAW X;  4P5B A;  3FOE A;  2E2I A;  2JA7 A;  4KDD A;  4KM9 A;  2NVX A;  2PHC B;  1SFO A;  1AB4 A;  1O28 A;  3GTG A;  1TWF A;  1KQ4 A;  2NVY A;  3LPX A;  5JFE A;  2KWA A;  2E2H A;  3GTL A;  1ZBS A;  1B4A A;  3AH5 A;  2ZFZ A;  5CHP A;  2JA5 A;  3MML B;  3ERE D;  5JVO A;  4GFQ A;  2XCR B;  3QX3 A;  2YU9 A;  2R92 A;  4DDQ A;  4C3J C;  1O2A A;  3AQP A;  2XCQ A;  2GSO A;  3CQZ A;  4FZB A;  4KC6 A;  4P5A A;  4KAR A;  1XXB A;  3VA7 A;  1DD5 A;  3N0B A;  1WQF A;  3GTK A;  1K83 A;  2R7Z A;  1BJT A;  2XCO A;  4KB2 A;  1IS1 A;  2GSN A;  1B4B A;  1O26 A;  3ORE A;  4LR2 A;  4J3N A;  2RH6 A;  1O25 A;  1I3Q A;  1TWH A;  2GSU A;  4KAT A;  5IOS A;  3OPF A;  1Y1V A;  1XXC A;  4GTD A;  1O2B A;  4KMA A;  1I50 A;  2CFA A;  3S0X A;  4GTE A;  2RGR A;  4G0W A;  2Y3P A;  3AQO A;  3GTJ A;  2P5M A;  4BLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...