2CFAB

Structure of viral flavin-dependant thymidylate synthase thyx
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
Knots found
sequence length
215
structure length
178
Chain Sequence
MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQINNKTASGLLKYIRHKHWSIFETAFMTLELKTSRGIAAQVIRHRSFHFQEFSPWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFSIAKALDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE SYNTHASE
publication title Catalytic Mechanism and Structure of Viral Flavin-Dependent Thymidylate Synthase Thyx.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
total genus 51
structure length 178
sequence length 215
other databases KnotProt 2.0: S -31
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2cfaB01
2CFAA 1O25A 4P5BA 3N0CA 4KARA 4GT9A 4P5AA 1O27A 4GTAA 4GTLA 1O2BA 1O28A 2CFAB 1O26A 4GTDA 3N3YA 3AH5A 4GTBA 5IORA 3G4AA 3N0BA 4KASA 5CHPA 5JFEA 5IOSA 1O29A 4GTFA 1O2AA 4FZBA 1O24A 4GTEA 3G4CA 1KQ4A 5IOTA 4KATA 4GTCA 5IOQA
chains in the Genus database with same CATH superfamily
2EBBA 3GTJK 3ERED 1JQWA 4YFNA 3N0CA 4A3MK 2E2HK 4A3EK 2NVTC 4LQYA 1ZYRA 3S17C 2PMZL 5M5YK 4A3CC 2VUMC 1WQHA 3RZOC 3S14C 4A3DC 4C3JC 4XLPA 2CW0A 3CQZK 1I3QC 4X6AC 2GAHC 4FM9A 2XCRB 3H3VD 1F7UA 3GEEA 5EGEA 3GTMC 1WQGA 3RZOK 1INNA 1TWGK 2B63C 3M3YC 4X6AK 3A8JA 3BP8C 2GSUA 2A69A 3HOXC 4C2MC 3TFJA 5M3MK 1Y1VA 3T01A 1X31C 5FLMC 1PJ6A 4LOWA 1ZXOA 3FOEA 1DCHA 4A3JK 1IW7A 5IP7C 4A3KC 1SFOK 4PAAA 4OIOA 4KMHA 2FQTA 3S16K 2GSNA 1IE0A 3HXAA 4A3IK 1TWFA 3JSTA 5C3EC 3PO3C 2KWAA 4KDDA 1O25A 1WCMC 3GTQC 4DDQA 2Y3PA 2ZUFA 4A3GK 4KN4A 3FKIA 5IYCC 2V6TA 1YCLA 4OIRA 5JFEA 5IOSA 4WILA 4C3IK 4G0UA 1O29A 2PA8D 2JH3A 1I6HC 2PHCB 3G4CA 3I4NK 4NOIA 5IOTA 2R7ZA 3NUHA 2V6UA 1R9TK 1TWFC 1USMA 5IYBC 2A6HA 1Y1VK 1GE9A 3DXJA 1EFWA 1IBAA 1USOA 3N0BA 3OEPA 1VRQC 1WOSA 4KMDA 3FKIC 5C44C 2E2IK 1O2AA 3GTLC 1VH2A 2R92A 3L4KA 3CAGA 4C3HC 1VLOA 5D4DA 4Y7NC 1TWAK 3S0XA 3GTPK 2VUMA 3L4JA 3EQLA 1I3QA 3TFHA 4A3FC 2R7ZC 1O26A 3HOVC 3FKIK 1VGXA 3N3YA 2JA6C 5FJ8K 4AYBL 3S1MC 1I6VA 4A3LC 3AD7C 4Y52C 4G7HA 5C4XC 2V6SA 3HOUK 4MEYA 1G51A 4BY7C 1C0AA 3S1NK 4MQ9A 3HOVK 2R7ZK 3HOWC 1WSRA 5M5XK 4KC6A 5C4JK 4P5BA 5M3FK 2R93K 3S1QK 3RZDC 2R92C 2JA8C 4BY1K 1EK8A 3I4MK 3AH5A 1IS1A 5TJ3A 3GTKC 1HQMA 1DCOA 3HOWK 1DD5A 1XZPA 4A93C 1ZVUA 5IP9C 1WCMA 3GEIA 5TMFA 4O2DA 3GTQA 2NVTK 2A6EA 4KATA 3S17K 4GTCA 4A3CK 2VUMK 3S14K 4A3DK 5TMCA 4C3JK 3TFIA 3S2DC 1L0WA 3LAPA 1I3QK 1ISEA 1J6XA 1EH1A 3BUEA 1TWCC 1SMYA 4XSZA 2JA5C 1WORA 2YU9A 4ZH4A 3GTMK 4J3NA 4BLBA 2P5MA 1YNJA 4GTFA 5IYDC 2E2JC 3S2DK 2B63K 3M3YK 3HOXK 2JA7A 4C2MK 2CFAA 3H3VL 2O5IA 5FLMK 4G0WA 3M4OC 1O2BA 2ZFZA 2WAQD 5IP7K 4A3KK 4LR2A 4KM8A 3SZZA 1Y1WC 3GTLA 3HOYC 5JVOA 2WB1D 5C3EK 4OIQA 3PO3K 3SZYA 2YU9C 1J6WA 3H0GA 3HKZD 4FZBA 3GIRA 1XZPB 3QX3A 1WCMK 1BDFA 4YFKA 3GTQK 1PJ7A 4JK1A 5IYCK 2JA6A 1I50C 1WIHA 2GAGC 4BBRC 1XXCA 2XCQA 3HOZC 2JA7C 4QJVA 4A3BC 4G0VA 3GTOC 4Q4ZA 1I6HK 2XCOA 4KASA 5CHPA 1TWHC 2NVXA 2WAQL 1RU0A 4KMUA 4PABA 4LK0A 4KB2A 4BBSC 4BBRK 1PJ5A 3AD9C 2Y0SD 2O5JA 1WSVA 1K83C 1TWFK 2JA7K 3V4GA 2NVQC 4XLNA 5IYBK 1YNNA 3S2HC 2RH6A 2PA8L 3HKZL 4M1XA 3H0GC 3GTKA 2CFAB 1IQ0A 4KAWX 3LAJA 5C44K 3K7AC 3GTLK 4XSXA 3CQZA 4BXXC 3PO2C 4C3HK 2NVYC 4Y7NK 4Q5SA 3H0GK 4GTEA 1XXAA 4G7ZA 2NVXC 4A3FK 3S15C 1TWCA 2JA5A 2JA6K 2P8TA 1J6VA 5E68A 4WJ4A 5M5WK 3TTGA 3S1MK 2Y0SL 2A68A 1O27A 4GTAA 4A3LK 4Y52K 5C4XK 2FQOA 3GTJC 2GSOA 1BJTA 4BY7K 3MMLB 1O2FB 4QJVB 4A3MC 2E2HC 4A3EC 2D6FC 4QIWD 3CQZC 3OREA 3RZDK 2R92K 2JA8K 3GSIA 1WQFA 1YX2A 5HL8A 3GTKK 1Y1WA 3GTGA 4P5AA 4WJ3M 4A93K 3GDZA 1JVIA 1B4BA 1BS2A 4KM9A 1TWGC 4GTBA 5IP9K 4GFQA 4OINA 1I50A 3T02A 1XXBA 2ZUEA 1V5VA 4RMFA 2PPBA 5EGHA 3WODA 4A3JC 1TWCK 2JA5K 1SFOC 3A8KA 3GTOA 4QIWL 1R9TA 3FHZA 3S16C 4A3IC 3OPFA 1TWHA 3AQOA 1WOOA 5IYDK 2E2JK 3GTGC 1K83A 1DCPA 4A3GC 4KMAA 2E2IA 1VJEA 4LK1A 4KN7A 4YFXA 1UV7A 3M4OK 3IPJA 1EQRA 5CJ9A 1TWAA 3LPXA 4C3IC 3GTPA 1IL2A 4GZYA 1HI9A 1JOEA 1Y1WK 3GTGK 4KARA 3HOYK 3I4NC 3S1RC 2NVYA 4GTDA 1EI6A 2YU9K 1XZQA 4LJZA 1R9TC 3G4AA 1ZBSA 4KB4A 4P9SA 1Y1VC 4AH6A 1I50K 1F93A 1B4AA 3S1RK 3HOZK 4ILDA 2WB1L 3BP3A 4A3BK 2E2IC 4AYBD 3GTOK 1J98A 3GTJA 2R93A 1BGWA 3ADAC 4GTLA 1TWHK 2E2HA 3GEHA 1TWAC 3GTPC 4BBSK 1ZQ1C 1F7VA 4C45A 3AQPA 4BLAA 2W7VA 2NVQK 1K83K 3S2HK 3T00A 1KQ4A 5L46A 2PMZD 1WOPA 3HOUC 1TWGA 2BE5A 3K7AK 4GT9A 1XPPA 2RGRA 1O28A 3S1NC 3PO2K 4BXXK 2NVYK 3VA7A 1F9NA 4LLGA 5C4JC 5IORA 3GTMA 2R93C 3S1QC 4MEXA 4YG2A 4BY1C 2NVXK 4XCHA 3I4MC 3AD8C 3S15K 4OIPA 1XZQB 1SFOA 3Q3QA 1O24A 3A8IA 2B63A 4BKWA 3FOFA 4G7OA 1AB4A 5IOQA
chains in the Genus database with same CATH topology
3S0XA 2JA6A 3GTOA 3ERED 2VUMA 1WIHA 1R9TA 3FHZA 3N0CA 1XXCA 3L4JA 2XCQA 3OPFA 4LQYA 1TWHA 1I3QA 1O26A 3N3YA 4G0VA 3AQOA 1WQHA 4C3JC 2XCOA 4KASA 5CHPA 2NVXA 1K83A 4FM9A 4KMAA 2XCRB 2E2IA 4KB2A 5EGEA 3V4GA 5CJ9A 1TWAA 3LPXA 4C3IC 3GTPA 1WQGA 4KC6A 2RH6A 4M1XA 4P5BA 4KARA 3GTKA 2GSUA 2CFAB 4C2MC 1EK8A 2NVYA 4GTDA 4KAWX 3LAJA 1Y1VA 3AH5A 1IS1A 5TJ3A 3CQZA 3G4AA 1ZBSA 1ZXOA 4KB4A 3FOEA 1DD5A 1ZVUA 4GTEA 1B4AA 4KMHA 1XXAA 1WCMA 2GSNA 3GTQA 1TWFA 4ILDA 4KATA 4GTCA 1TWCA 2KWAA 2JA5A 4KDDA 3GTJA 1O25A 2R93A 1BGWA 1O27A 4GTAA 4DDQA 2Y3PA 4GTLA 3LAPA 1ISEA 1EH1A 2E2HA 3BUEA 3FKIA 2YU9A 2GSOA 1BJTA 3MMLB 3AQPA 4J3NA 4BLAA 4BLBA 5JFEA 2P5MA 5IOSA 4G0UA 1O29A 4GTFA 2JH3A 2PHCB 3G4CA 3OREA 1KQ4A 5IOTA 2JA7A 2R7ZA 2CFAA 1TWGA 1WQFA 1Y1WA 3GTGA 4G0WA 3NUHA 4GT9A 4P5AA 2RGRA 1O28A 1O2BA 2ZFZA 1B4BA 4KM9A 3VA7A 4LR2A 4KM8A 4GTBA 1F9NA 1GE9A 3GTLA 5IORA 3GTMA 5JVOA 3OEPA 3N0BA 4KMDA 4GFQA 1O2AA 1SFOA 3H0GA 3Q3QA 1I50A 4FZBA 1O24A 1XXBA 3QX3A 2B63A 2R92A 3L4KA 3CAGA 4BKWA 4C3HC 3FOFA 5EGHA 1AB4A 5IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA A;  1O25 A;  4P5B A;  3N0C A;  4KAR A;  4GT9 A;  4P5A A;  1O27 A;  4GTA A;  4GTL A;  1O2B A;  1O28 A;  2CFA B;  1O26 A;  4GTD A;  3N3Y A;  3AH5 A;  4GTB A;  5IOR A;  3G4A A;  3N0B A;  4KAS A;  5CHP A;  5JFE A;  5IOS A;  1O29 A;  4GTF A;  1O2A A;  4FZB A;  1O24 A;  4GTE A;  3G4C A;  1KQ4 A;  5IOT A;  4KAT A;  4GTC A;  5IOQ A; 
#chains in the Genus database with same CATH topology
 2EBB A;  3GTJ K;  3ERE D;  1JQW A;  4YFN A;  3N0C A;  4A3M K;  2E2H K;  4A3E K;  2NVT C;  4LQY A;  1ZYR A;  3S17 C;  2PMZ L;  5M5Y K;  4A3C C;  2VUM C;  1WQH A;  3RZO C;  3S14 C;  4A3D C;  4C3J C;  4XLP A;  2CW0 A;  3CQZ K;  1I3Q C;  4X6A C;  2GAH C;  4FM9 A;  2XCR B;  3H3V D;  1F7U A;  3GEE A;  5EGE A;  3GTM C;  1WQG A;  3RZO K;  1INN A;  1TWG K;  2B63 C;  3M3Y C;  4X6A K;  3A8J A;  3BP8 C;  2GSU A;  2A69 A;  3HOX C;  4C2M C;  3TFJ A;  5M3M K;  1Y1V A;  3T01 A;  1X31 C;  5FLM C;  1PJ6 A;  4LOW A;  1ZXO A;  3FOE A;  1DCH A;  4A3J K;  1IW7 A;  5IP7 C;  4A3K C;  1SFO K;  4PAA A;  4OIO A;  4KMH A;  2FQT A;  3S16 K;  2GSN A;  1IE0 A;  3HXA A;  4A3I K;  1TWF A;  3JST A;  5C3E C;  3PO3 C;  2KWA A;  4KDD A;  1O25 A;  1WCM C;  3GTQ C;  4DDQ A;  2Y3P A;  2ZUF A;  4A3G K;  4KN4 A;  3FKI A;  5IYC C;  2V6T A;  1YCL A;  4OIR A;  5JFE A;  5IOS A;  4WIL A;  4C3I K;  4G0U A;  1O29 A;  2PA8 D;  2JH3 A;  1I6H C;  2PHC B;  3G4C A;  3I4N K;  4NOI A;  5IOT A;  2R7Z A;  3NUH A;  2V6U A;  1R9T K;  1TWF C;  1USM A;  5IYB C;  2A6H A;  1Y1V K;  1GE9 A;  3DXJ A;  1EFW A;  1IBA A;  1USO A;  3N0B A;  3OEP A;  1VRQ C;  1WOS A;  4KMD A;  3FKI C;  5C44 C;  2E2I K;  1O2A A;  3GTL C;  1VH2 A;  2R92 A;  3L4K A;  3CAG A;  4C3H C;  1VLO A;  5D4D A;  4Y7N C;  1TWA K;  3S0X A;  3GTP K;  2VUM A;  3L4J A;  3EQL A;  1I3Q A;  3TFH A;  4A3F C;  2R7Z C;  1O26 A;  3HOV C;  3FKI K;  1VGX A;  3N3Y A;  2JA6 C;  5FJ8 K;  4AYB L;  3S1M C;  1I6V A;  4A3L C;  3AD7 C;  4Y52 C;  4G7H A;  5C4X C;  2V6S A;  3HOU K;  4MEY A;  1G51 A;  4BY7 C;  1C0A A;  3S1N K;  4MQ9 A;  3HOV K;  2R7Z K;  3HOW C;  1WSR A;  5M5X K;  4KC6 A;  5C4J K;  4P5B A;  5M3F K;  2R93 K;  3S1Q K;  3RZD C;  2R92 C;  2JA8 C;  4BY1 K;  1EK8 A;  3I4M K;  3AH5 A;  1IS1 A;  5TJ3 A;  3GTK C;  1HQM A;  1DCO A;  3HOW K;  1DD5 A;  1XZP A;  4A93 C;  1ZVU A;  5IP9 C;  1WCM A;  3GEI A;  5TMF A;  4O2D A;  3GTQ A;  2NVT K;  2A6E A;  4KAT A;  3S17 K;  4GTC A;  4A3C K;  2VUM K;  3S14 K;  4A3D K;  5TMC A;  4C3J K;  3TFI A;  3S2D C;  1L0W A;  3LAP A;  1I3Q K;  1ISE A;  1J6X A;  1EH1 A;  3BUE A;  1TWC C;  1SMY A;  4XSZ A;  2JA5 C;  1WOR A;  2YU9 A;  4ZH4 A;  3GTM K;  4J3N A;  4BLB A;  2P5M A;  1YNJ A;  4GTF A;  5IYD C;  2E2J C;  3S2D K;  2B63 K;  3M3Y K;  3HOX K;  2JA7 A;  4C2M K;  2CFA A;  3H3V L;  2O5I A;  5FLM K;  4G0W A;  3M4O C;  1O2B A;  2ZFZ A;  2WAQ D;  5IP7 K;  4A3K K;  4LR2 A;  4KM8 A;  3SZZ A;  1Y1W C;  3GTL A;  3HOY C;  5JVO A;  2WB1 D;  5C3E K;  4OIQ A;  3PO3 K;  3SZY A;  2YU9 C;  1J6W A;  3H0G A;  3HKZ D;  4FZB A;  3GIR A;  1XZP B;  3QX3 A;  1WCM K;  1BDF A;  4YFK A;  3GTQ K;  1PJ7 A;  4JK1 A;  5IYC K;  2JA6 A;  1I50 C;  1WIH A;  2GAG C;  4BBR C;  1XXC A;  2XCQ A;  3HOZ C;  2JA7 C;  4QJV A;  4A3B C;  4G0V A;  3GTO C;  4Q4Z A;  1I6H K;  2XCO A;  4KAS A;  5CHP A;  1TWH C;  2NVX A;  2WAQ L;  1RU0 A;  4KMU A;  4PAB A;  4LK0 A;  4KB2 A;  4BBS C;  4BBR K;  1PJ5 A;  3AD9 C;  2Y0S D;  2O5J A;  1WSV A;  1K83 C;  1TWF K;  2JA7 K;  3V4G A;  2NVQ C;  4XLN A;  5IYB K;  1YNN A;  3S2H C;  2RH6 A;  2PA8 L;  3HKZ L;  4M1X A;  3H0G C;  3GTK A;  2CFA B;  1IQ0 A;  4KAW X;  3LAJ A;  5C44 K;  3K7A C;  3GTL K;  4XSX A;  3CQZ A;  4BXX C;  3PO2 C;  4C3H K;  2NVY C;  4Y7N K;  4Q5S A;  3H0G K;  4GTE A;  1XXA A;  4G7Z A;  2NVX C;  4A3F K;  3S15 C;  1TWC A;  2JA5 A;  2JA6 K;  2P8T A;  1J6V A;  5E68 A;  4WJ4 A;  5M5W K;  3TTG A;  3S1M K;  2Y0S L;  2A68 A;  1O27 A;  4GTA A;  4A3L K;  4Y52 K;  5C4X K;  2FQO A;  3GTJ C;  2GSO A;  1BJT A;  4BY7 K;  3MML B;  1O2F B;  4QJV B;  4A3M C;  2E2H C;  4A3E C;  2D6F C;  4QIW D;  3CQZ C;  3ORE A;  3RZD K;  2R92 K;  2JA8 K;  3GSI A;  1WQF A;  1YX2 A;  5HL8 A;  3GTK K;  1Y1W A;  3GTG A;  4P5A A;  4WJ3 M;  4A93 K;  3GDZ A;  1JVI A;  1B4B A;  1BS2 A;  4KM9 A;  1TWG C;  4GTB A;  5IP9 K;  4GFQ A;  4OIN A;  1I50 A;  3T02 A;  1XXB A;  2ZUE A;  1V5V A;  4RMF A;  2PPB A;  5EGH A;  3WOD A;  4A3J C;  1TWC K;  2JA5 K;  1SFO C;  3A8K A;  3GTO A;  4QIW L;  1R9T A;  3FHZ A;  3S16 C;  4A3I C;  3OPF A;  1TWH A;  3AQO A;  1WOO A;  5IYD K;  2E2J K;  3GTG C;  1K83 A;  1DCP A;  4A3G C;  4KMA A;  2E2I A;  1VJE A;  4LK1 A;  4KN7 A;  4YFX A;  1UV7 A;  3M4O K;  3IPJ A;  1EQR A;  5CJ9 A;  1TWA A;  3LPX A;  4C3I C;  3GTP A;  1IL2 A;  4GZY A;  1HI9 A;  1JOE A;  1Y1W K;  3GTG K;  4KAR A;  3HOY K;  3I4N C;  3S1R C;  2NVY A;  4GTD A;  1EI6 A;  2YU9 K;  1XZQ A;  4LJZ A;  1R9T C;  3G4A A;  1ZBS A;  4KB4 A;  4P9S A;  1Y1V C;  4AH6 A;  1I50 K;  1F93 A;  1B4A A;  3S1R K;  3HOZ K;  4ILD A;  2WB1 L;  3BP3 A;  4A3B K;  2E2I C;  4AYB D;  3GTO K;  1J98 A;  3GTJ A;  2R93 A;  1BGW A;  3ADA C;  4GTL A;  1TWH K;  2E2H A;  3GEH A;  1TWA C;  3GTP C;  4BBS K;  1ZQ1 C;  1F7V A;  4C45 A;  3AQP A;  4BLA A;  2W7V A;  2NVQ K;  1K83 K;  3S2H K;  3T00 A;  1KQ4 A;  5L46 A;  2PMZ D;  1WOP A;  3HOU C;  1TWG A;  2BE5 A;  3K7A K;  4GT9 A;  1XPP A;  2RGR A;  1O28 A;  3S1N C;  3PO2 K;  4BXX K;  2NVY K;  3VA7 A;  1F9N A;  4LLG A;  5C4J C;  5IOR A;  3GTM A;  2R93 C;  3S1Q C;  4MEX A;  4YG2 A;  4BY1 C;  2NVX K;  4XCH A;  3I4M C;  3AD8 C;  3S15 K;  4OIP A;  1XZQ B;  1SFO A;  3Q3Q A;  1O24 A;  3A8I A;  2B63 A;  4BKW A;  3FOF A;  4G7O A;  1AB4 A;  5IOQ A; 
#chains in the Genus database with same CATH homology
 3S0X A;  2JA6 A;  3GTO A;  3ERE D;  2VUM A;  1WIH A;  1R9T A;  3FHZ A;  3N0C A;  1XXC A;  3L4J A;  2XCQ A;  3OPF A;  4LQY A;  1TWH A;  1I3Q A;  1O26 A;  3N3Y A;  4G0V A;  3AQO A;  1WQH A;  4C3J C;  2XCO A;  4KAS A;  5CHP A;  2NVX A;  1K83 A;  4FM9 A;  4KMA A;  2XCR B;  2E2I A;  4KB2 A;  5EGE A;  3V4G A;  5CJ9 A;  1TWA A;  3LPX A;  4C3I C;  3GTP A;  1WQG A;  4KC6 A;  2RH6 A;  4M1X A;  4P5B A;  4KAR A;  3GTK A;  2GSU A;  2CFA B;  4C2M C;  1EK8 A;  2NVY A;  4GTD A;  4KAW X;  3LAJ A;  1Y1V A;  3AH5 A;  1IS1 A;  5TJ3 A;  3CQZ A;  3G4A A;  1ZBS A;  1ZXO A;  4KB4 A;  3FOE A;  1DD5 A;  1ZVU A;  4GTE A;  1B4A A;  4KMH A;  1XXA A;  1WCM A;  2GSN A;  3GTQ A;  1TWF A;  4ILD A;  4KAT A;  4GTC A;  1TWC A;  2KWA A;  2JA5 A;  4KDD A;  3GTJ A;  1O25 A;  2R93 A;  1BGW A;  1O27 A;  4GTA A;  4DDQ A;  2Y3P A;  4GTL A;  3LAP A;  1ISE A;  1EH1 A;  2E2H A;  3BUE A;  3FKI A;  2YU9 A;  2GSO A;  1BJT A;  3MML B;  3AQP A;  4J3N A;  4BLA A;  4BLB A;  5JFE A;  2P5M A;  5IOS A;  4G0U A;  1O29 A;  4GTF A;  2JH3 A;  2PHC B;  3G4C A;  3ORE A;  1KQ4 A;  5IOT A;  2JA7 A;  2R7Z A;  2CFA A;  1TWG A;  1WQF A;  1Y1W A;  3GTG A;  4G0W A;  3NUH A;  4GT9 A;  4P5A A;  2RGR A;  1O28 A;  1O2B A;  2ZFZ A;  1B4B A;  4KM9 A;  3VA7 A;  4LR2 A;  4KM8 A;  4GTB A;  1F9N A;  1GE9 A;  3GTL A;  5IOR A;  3GTM A;  5JVO A;  3OEP A;  3N0B A;  4KMD A;  4GFQ A;  1O2A A;  1SFO A;  3H0G A;  3Q3Q A;  1I50 A;  4FZB A;  1O24 A;  1XXB A;  3QX3 A;  2B63 A;  2R92 A;  3L4K A;  3CAG A;  4BKW A;  4C3H C;  3FOF A;  5EGH A;  1AB4 A;  5IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...