2CFAB

Structure of viral flavin-dependant thymidylate synthase thyx
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
Knots found
sequence length
215
structure length
178
Chain Sequence
MSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQINNKTASGLLKYIRHKHWSIFETAFMTLELKTSRGIAAQVIRHRSFHFQEFSPWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFSIAKALDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE SYNTHASE
publication title Catalytic Mechanism and Structure of Viral Flavin-Dependent Thymidylate Synthase Thyx.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase
total genus 51
structure length 178
sequence length 215
other databases KnotProt 2.0: S -31
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2cfaB01
4KASA 4GTBA 4GTCA 4GTDA 5IOTA 4GT9A 3AH5A 1O27A 4KARA 4KATA 1O25A 4FZBA 4GTFA 4P5AA 5IOSA 5IORA 3G4CA 5IOQA 1KQ4A 4GTEA 3N0BA 3G4AA 1O28A 1O24A 2CFAA 1O26A 3N0CA 2CFAB 4GTAA 5JFEA 1O2AA 1O2BA 1O29A 3N3YA 4P5BA 5CHPA 4GTLA
chains in the Genus database with same CATH superfamily
3AQOA 4GTDA 2EBBA 4C3JK 2PHCB 1K83K 4PAAA 3TFHA 1BDFA 2W7VA 3CQZC 4WILA 5IOQA 3S1QC 1ZXOA 5IYDC 1IW7A 3AD8C 3HOUC 3GTPA 2FQOA 1WSVA 2VUMA 2B63K 1WIHA 3TTGA 3GTMA 4A93K 1INNA 1TWAA 2JA8C 3RZDK 2NVQC 2RGRA 1GE9A 1O2FB 4KASA 1VGXA 3GTOA 4NOIA 2E2HC 4GT9A 4Q4ZA 1I6VA 5IP7C 4Y7NK 1TWFA 5C3EK 3RZOK 1WSRA 2JA7K 4XLNA 3TFJA 2E2JC 3S15C 1I50A 1R9TC 1Y1VC 1BJTA 1O24A 1O26A 3I4MK 1WCMK 2YU9K 3GTQA 1XPPA 1IE0A 2FQTA 2RH6A 1XZPA 1WOOA 1ZYRA 3HOXC 1SFOK 1J98A 4A3LK 1O25A 3QX3A 4GTFA 4A3IC 3HKZL 3Q3QA 3GTGK 4A3FC 3GTJA 3OPFA 1KQ4A 4ZH4A 1I3QK 2R7ZA 3EQLA 4YFNA 2P5MA 2ZUFA 3BP3A 4AYBL 5TJ3A 1V5VA 5M5WK 3A8KA 1Y1WA 2KWAA 3CQZK 2O5JA 1VRQC 3S1QK 2XCRB 5CHPA 5IYDK 3HOUK 4A3MC 4PABA 4A3JC 3LAPA 1AB4A 1TWGA 4KMDA 3NUHA 4P5AA 2JA8K 2NVQK 2Y0SL 5IYCC 4G0VA 1DD5A 1TWCA 2E2HK 2BE5A 1F7UA 3CAGA 5M3MK 1IL2A 1VJEA 4YG2A 3GTLC 2E2JK 3DXJA 3S15K 1YNNA 1R9TK 1Y1VK 3GSIA 3GTKA 3FKIA 5IOSA 5EGEA 5JVOA 3S14C 4G0WA 4Y52C 1EI6A 1EH1A 3HOXK 2R92C 2A6EA 4LQYA 3ERED 2YU9A 3PO2C 2ZFZA 4A3IK 5JFEA 1O2AA 3LAJA 3I4NC 1O29A 3FOEA 4A3FK 1F93A 4LOWA 3N3YA 4GTLA 4KATA 4Q5SA 1BS2A 2NVYA 2P8TA 4LK0A 5D4DA 4KN7A 4P9SA 5E68A 1G51A 5M3FK 4A3MK 4A3JK 2R93A 2NVTC 4ILDA 3AQPA 2CFAB 3H0GA 3SZZA 2JA6A 2NVXA 5IYCK 3T01A 4A3KC 4GFQA 3GTPC 4BY7C 2VUMC 4MEXA 3AH5A 1O27A 3OEPA 2A6HA 3GTMC 1TWAC 1EFWA 1UV7A 1IS1A 2WAQL 4MQ9A 4OINA 2E2HA 3GTLK 3WODA 1IBAA 1DCOA 1VLOA 2CW0A 3AD7C 3G4AA 3FHZA 3S1NC 1JVIA 4XCHA 3S16C 5EGHA 1EQRA 1BGWA 3S14K 1TWHA 4Y52K 4KM9A 5M5XK 1I6HC 2R92K 4KARA 2GSUA 3L4JA 1I50C 5IYBC 3HKZD 3PO2K 3I4NK 3S2HK 2GAHC 4DDQA 3GTQC 2O5IA 1YX2A 4KMHA 4AYBD 5C4JC 4OIQA 1PJ5A 3S1MC 4G7OA 1WOPA 1C0AA 2E2IC 3GTJC 3HOWC 4G0UA 1YNJA 4BBSC 1K83A 2NVTK 3HOVC 3PO3C 5C4XC 1DCHA 1J6VA 2XCOA 2Y0SD 3GEHA 3V4GA 3HOYC 1Y1WC 4M1XA 4AH6A 2B63A 4C3IC 4A3KK 1EK8A 1XXAA 3GTPK 1ZVUA 4BY7K 2VUMK 3TFIA 1F7VA 4BXXC 5L46A 4J3NA 2V6SA 1TWGC 3GTMK 2PPBA 1TWAK 2CFAA 4JK1A 4X6AC 1O2BA 4KB2A 3IPJA 1DCPA 3S17C 1XXCA 2Y3PA 2V6UA 4FM9A 1WORA 1TWCC 4FZBA 4LLGA 3T02A 3HOZC 3SZYA 2PMZL 3S1NK 1J6XA 3S16K 4BBRC 4KM8A 4C2MC 2GAGC 2JA7A 4BY1C 1ISEA 2WB1L 1IQ0A 2JA5C 4A3BC 4A3GC 1I6HK 4LK1A 1I50K 1WCMA 5IYBK 3GTKC 2V6TA 3FKIC 3S2HC 3M3YC 3GTQK 4KC6A 2PA8D 1SFOA 3BUEA 2PA8L 3ADAC 1RU0A 4KAWX 5C4JK 4A3CC 3S1MK 4QIWL 5IP9C 3GTGA 1PJ7A 2E2IK 1HI9A 1I3QA 4A3EC 3GTJK 4G7ZA 3HOWK 5C44C 4LR2A 4BBSK 3HOVK 2JH3A 3PO3K 1WQHA 5C4XK 5FJ8K 2NVYC 1ZQ1C 3CQZA 4KB4A 3HOYK 4GZYA 1WQGA 1Y1WK 1F9NA 4C3IK 4MEYA 4RMFA 4BXXK 2R93C 1TWGK 3K7AC 1HQMA 2WAQD 4X6AK 3L4KA 3A8JA 1USOA 3H0GC 3H3VD 2JA6C 2NVXC 4GTEA 5FLMC 3H3VL 3S17K 1USMA 3S1RC 2D6FC 4QJVB 1XZQB 5HL8A 3HXAA 5TMFA 1TWCK 3S2DC 3HOZK 3BP8C 3VA7A 3GTOC 1SMYA 1X31C 3JSTA 4BLBA 4BBRK 4KN4A 4XSXA 2ZUEA 4C2MK 3MMLB 1TWFC 4BY1K 3M4OC 1J6WA 1JQWA 2JA5K 4A3BK 4A3GK 1R9TA 1Y1VA 3AD9C 4OIPA 4KMAA 4YFXA 3GTKK 1PJ6A 3FKIK 3M3YK 2XCQA 3GDZA 1TWHC 2GSNA 4A3CK 3N0CA 5IP9K 1WOSA 4A3EK 3GEEA 1JOEA 5M5YK 4C3HC 2A69A 4OIRA 5C44K 4BKWA 2R7ZC 2E2IA 5IORA 2NVYK 3G4CA 1B4BA 3S0XA 4A3DC 3GEIA 4C3JC 2R93K 1K83C 5TMCA 3K7AK 1B4AA 4GTAA 4XLPA 3T00A 3H0GK 2JA6K 2NVXK 5FLMK 4GTCA 2B63C 3S1RK 4LJZA 3GIRA 4A93C 1XXBA 3S2DK 2PMZD 3GTOK 4O2DA 3RZDC 1ZBSA 2A68A 3GTLA 1TWFK 3M4OK 2WB1D 3A8IA 4QJVA 1XZQA 1L0WA 4C45A 5IP7K 1YCLA 4Y7NC 5C3EC 3RZOC 4WJ4A 4P5BA 4YFKA 2JA5A 4WJ3M 1XZPB 2JA7C 4GTBA 5IOTA 4XSZA 2R92A 1TWHK 5CJ9A 1VH2A 4QIWD 3I4MC 4KDDA 1WCMC 2YU9C 4G7HA 4C3HK 3N0BA 1SFOC 3OREA 2R7ZK 4A3LC 1O28A 4KMUA 4OIOA 3LPXA 4BLAA 2GSOA 3GTGC 3FOFA 1WQFA 4A3DK 1I3QC
chains in the Genus database with same CATH topology
3AQOA 4GTDA 4G0UA 1R9TA 1Y1VA 2PHCB 1K83A 3GTKA 4KMAA 3FKIA 5IOSA 2XCOA 5EGEA 5JVOA 3V4GA 5IOQA 1ZXOA 4M1XA 2B63A 3GTPA 4C3IC 1EK8A 2XCQA 4G0WA 2VUMA 1XXAA 1EH1A 1ZVUA 1WIHA 2GSNA 3GTMA 4J3NA 1TWAA 4LQYA 3ERED 2YU9A 2CFAA 2ZFZA 3N0CA 5JFEA 1O2AA 1O2BA 3LAJA 4KB2A 1O29A 2RGRA 3FOEA 3N3YA 1GE9A 4GTLA 4C3HC 4KASA 1XXCA 2Y3PA 4BKWA 3GTOA 4GT9A 4KATA 4FM9A 4FZBA 2NVYA 2E2IA 5IORA 3G4CA 1TWFA 1B4BA 3S0XA 4KM8A 4C2MC 2JA7A 1ISEA 2R93A 4C3JC 1I50A 4ILDA 3AQPA 1WCMA 1B4AA 1BJTA 1O24A 1O26A 4GTAA 2CFAB 3H0GA 2JA6A 3GTQA 2NVXA 2RH6A 4KC6A 1SFOA 4GFQA 4GTCA 3BUEA 3AH5A 1O27A 3OEPA 1XXBA 1O25A 4KAWX 3QX3A 4GTFA 3GTGA 1IS1A 1ZBSA 3Q3QA 3GTJA 1I3QA 3OPFA 1KQ4A 3GTLA 2R7ZA 2E2HA 4LR2A 2P5MA 3G4AA 2JH3A 1WQHA 5TJ3A 3FHZA 3CQZA 5EGHA 1Y1WA 4KB4A 2KWAA 1WQGA 4P5BA 1BGWA 5CHPA 2XCRB 1F9NA 2JA5A 1TWHA 4GTBA 4KM9A 5IOTA 3LAPA 2R92A 1AB4A 1TWGA 4KARA 2GSUA 5CJ9A 3L4JA 4KMDA 3NUHA 4KDDA 4P5AA 3L4KA 4DDQA 4GTEA 4G0VA 3N0BA 4KMHA 1DD5A 3OREA 1TWCA 3CAGA 1O28A 3LPXA 3VA7A 4BLAA 4BLBA 2GSOA 3FOFA 1WQFA 3MMLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAS A;  4GTB A;  4GTC A;  4GTD A;  5IOT A;  4GT9 A;  3AH5 A;  1O27 A;  4KAR A;  4KAT A;  1O25 A;  4FZB A;  4GTF A;  4P5A A;  5IOS A;  5IOR A;  3G4C A;  5IOQ A;  1KQ4 A;  4GTE A;  3N0B A;  3G4A A;  1O28 A;  1O24 A;  2CFA A;  1O26 A;  3N0C A;  2CFA B;  4GTA A;  5JFE A;  1O2A A;  1O2B A;  1O29 A;  3N3Y A;  4P5B A;  5CHP A;  4GTL A; 
#chains in the Genus database with same CATH topology
 3AQO A;  4GTD A;  2EBB A;  4C3J K;  2PHC B;  1K83 K;  4PAA A;  3TFH A;  1BDF A;  2W7V A;  3CQZ C;  4WIL A;  5IOQ A;  3S1Q C;  1ZXO A;  5IYD C;  1IW7 A;  3AD8 C;  3HOU C;  3GTP A;  2FQO A;  1WSV A;  2VUM A;  2B63 K;  1WIH A;  3TTG A;  3GTM A;  4A93 K;  1INN A;  1TWA A;  2JA8 C;  3RZD K;  2NVQ C;  2RGR A;  1GE9 A;  1O2F B;  4KAS A;  1VGX A;  3GTO A;  4NOI A;  2E2H C;  4GT9 A;  4Q4Z A;  1I6V A;  5IP7 C;  4Y7N K;  1TWF A;  5C3E K;  3RZO K;  1WSR A;  2JA7 K;  4XLN A;  3TFJ A;  2E2J C;  3S15 C;  1I50 A;  1R9T C;  1Y1V C;  1BJT A;  1O24 A;  1O26 A;  3I4M K;  1WCM K;  2YU9 K;  3GTQ A;  1XPP A;  1IE0 A;  2FQT A;  2RH6 A;  1XZP A;  1WOO A;  1ZYR A;  3HOX C;  1SFO K;  1J98 A;  4A3L K;  1O25 A;  3QX3 A;  4GTF A;  4A3I C;  3HKZ L;  3Q3Q A;  3GTG K;  4A3F C;  3GTJ A;  3OPF A;  1KQ4 A;  4ZH4 A;  1I3Q K;  2R7Z A;  3EQL A;  4YFN A;  2P5M A;  2ZUF A;  3BP3 A;  4AYB L;  5TJ3 A;  1V5V A;  5M5W K;  3A8K A;  1Y1W A;  2KWA A;  3CQZ K;  2O5J A;  1VRQ C;  3S1Q K;  2XCR B;  5CHP A;  5IYD K;  3HOU K;  4A3M C;  4PAB A;  4A3J C;  3LAP A;  1AB4 A;  1TWG A;  4KMD A;  3NUH A;  4P5A A;  2JA8 K;  2NVQ K;  2Y0S L;  5IYC C;  4G0V A;  1DD5 A;  1TWC A;  2E2H K;  2BE5 A;  1F7U A;  3CAG A;  5M3M K;  1IL2 A;  1VJE A;  4YG2 A;  3GTL C;  2E2J K;  3DXJ A;  3S15 K;  1YNN A;  1R9T K;  1Y1V K;  3GSI A;  3GTK A;  3FKI A;  5IOS A;  5EGE A;  5JVO A;  3S14 C;  4G0W A;  4Y52 C;  1EI6 A;  1EH1 A;  3HOX K;  2R92 C;  2A6E A;  4LQY A;  3ERE D;  2YU9 A;  3PO2 C;  2ZFZ A;  4A3I K;  5JFE A;  1O2A A;  3LAJ A;  3I4N C;  1O29 A;  3FOE A;  4A3F K;  1F93 A;  4LOW A;  3N3Y A;  4GTL A;  4KAT A;  4Q5S A;  1BS2 A;  2NVY A;  2P8T A;  4LK0 A;  5D4D A;  4KN7 A;  4P9S A;  5E68 A;  1G51 A;  5M3F K;  4A3M K;  4A3J K;  2R93 A;  2NVT C;  4ILD A;  3AQP A;  2CFA B;  3H0G A;  3SZZ A;  2JA6 A;  2NVX A;  5IYC K;  3T01 A;  4A3K C;  4GFQ A;  3GTP C;  4BY7 C;  2VUM C;  4MEX A;  3AH5 A;  1O27 A;  3OEP A;  2A6H A;  3GTM C;  1TWA C;  1EFW A;  1UV7 A;  1IS1 A;  2WAQ L;  4MQ9 A;  4OIN A;  2E2H A;  3GTL K;  3WOD A;  1IBA A;  1DCO A;  1VLO A;  2CW0 A;  3AD7 C;  3G4A A;  3FHZ A;  3S1N C;  1JVI A;  4XCH A;  3S16 C;  5EGH A;  1EQR A;  1BGW A;  3S14 K;  1TWH A;  4Y52 K;  4KM9 A;  5M5X K;  1I6H C;  2R92 K;  4KAR A;  2GSU A;  3L4J A;  1I50 C;  5IYB C;  3HKZ D;  3PO2 K;  3I4N K;  3S2H K;  2GAH C;  4DDQ A;  3GTQ C;  2O5I A;  1YX2 A;  4KMH A;  4AYB D;  5C4J C;  4OIQ A;  1PJ5 A;  3S1M C;  4G7O A;  1WOP A;  1C0A A;  2E2I C;  3GTJ C;  3HOW C;  4G0U A;  1YNJ A;  4BBS C;  1K83 A;  2NVT K;  3HOV C;  3PO3 C;  5C4X C;  1DCH A;  1J6V A;  2XCO A;  2Y0S D;  3GEH A;  3V4G A;  3HOY C;  1Y1W C;  4M1X A;  4AH6 A;  2B63 A;  4C3I C;  4A3K K;  1EK8 A;  1XXA A;  3GTP K;  1ZVU A;  4BY7 K;  2VUM K;  3TFI A;  1F7V A;  4BXX C;  5L46 A;  4J3N A;  2V6S A;  1TWG C;  3GTM K;  2PPB A;  1TWA K;  2CFA A;  4JK1 A;  4X6A C;  1O2B A;  4KB2 A;  3IPJ A;  1DCP A;  3S17 C;  1XXC A;  2Y3P A;  2V6U A;  4FM9 A;  1WOR A;  1TWC C;  4FZB A;  4LLG A;  3T02 A;  3HOZ C;  3SZY A;  2PMZ L;  3S1N K;  1J6X A;  3S16 K;  4BBR C;  4KM8 A;  4C2M C;  2GAG C;  2JA7 A;  4BY1 C;  1ISE A;  2WB1 L;  1IQ0 A;  2JA5 C;  4A3B C;  4A3G C;  1I6H K;  4LK1 A;  1I50 K;  1WCM A;  5IYB K;  3GTK C;  2V6T A;  3FKI C;  3S2H C;  3M3Y C;  3GTQ K;  4KC6 A;  2PA8 D;  1SFO A;  3BUE A;  2PA8 L;  3ADA C;  1RU0 A;  4KAW X;  5C4J K;  4A3C C;  3S1M K;  4QIW L;  5IP9 C;  3GTG A;  1PJ7 A;  2E2I K;  1HI9 A;  1I3Q A;  4A3E C;  3GTJ K;  4G7Z A;  3HOW K;  5C44 C;  4LR2 A;  4BBS K;  3HOV K;  2JH3 A;  3PO3 K;  1WQH A;  5C4X K;  5FJ8 K;  2NVY C;  1ZQ1 C;  3CQZ A;  4KB4 A;  3HOY K;  4GZY A;  1WQG A;  1Y1W K;  1F9N A;  4C3I K;  4MEY A;  4RMF A;  4BXX K;  2R93 C;  1TWG K;  3K7A C;  1HQM A;  2WAQ D;  4X6A K;  3L4K A;  3A8J A;  1USO A;  3H0G C;  3H3V D;  2JA6 C;  2NVX C;  4GTE A;  5FLM C;  3H3V L;  3S17 K;  1USM A;  3S1R C;  2D6F C;  4QJV B;  1XZQ B;  5HL8 A;  3HXA A;  5TMF A;  1TWC K;  3S2D C;  3HOZ K;  3BP8 C;  3VA7 A;  3GTO C;  1SMY A;  1X31 C;  3JST A;  4BLB A;  4BBR K;  4KN4 A;  4XSX A;  2ZUE A;  4C2M K;  3MML B;  1TWF C;  4BY1 K;  3M4O C;  1J6W A;  1JQW A;  2JA5 K;  4A3B K;  4A3G K;  1R9T A;  1Y1V A;  3AD9 C;  4OIP A;  4KMA A;  4YFX A;  3GTK K;  1PJ6 A;  3FKI K;  3M3Y K;  2XCQ A;  3GDZ A;  1TWH C;  2GSN A;  4A3C K;  3N0C A;  5IP9 K;  1WOS A;  4A3E K;  3GEE A;  1JOE A;  5M5Y K;  4C3H C;  2A69 A;  4OIR A;  5C44 K;  4BKW A;  2R7Z C;  2E2I A;  5IOR A;  2NVY K;  3G4C A;  1B4B A;  3S0X A;  4A3D C;  3GEI A;  4C3J C;  2R93 K;  1K83 C;  5TMC A;  3K7A K;  1B4A A;  4GTA A;  4XLP A;  3T00 A;  3H0G K;  2JA6 K;  2NVX K;  5FLM K;  4GTC A;  2B63 C;  3S1R K;  4LJZ A;  3GIR A;  4A93 C;  1XXB A;  3S2D K;  2PMZ D;  3GTO K;  4O2D A;  3RZD C;  1ZBS A;  2A68 A;  3GTL A;  1TWF K;  3M4O K;  2WB1 D;  3A8I A;  4QJV A;  1XZQ A;  1L0W A;  4C45 A;  5IP7 K;  1YCL A;  4Y7N C;  5C3E C;  3RZO C;  4WJ4 A;  4P5B A;  4YFK A;  2JA5 A;  4WJ3 M;  1XZP B;  2JA7 C;  4GTB A;  5IOT A;  4XSZ A;  2R92 A;  1TWH K;  5CJ9 A;  1VH2 A;  4QIW D;  3I4M C;  4KDD A;  1WCM C;  2YU9 C;  4G7H A;  4C3H K;  3N0B A;  1SFO C;  3ORE A;  2R7Z K;  4A3L C;  1O28 A;  4KMU A;  4OIO A;  3LPX A;  4BLA A;  2GSO A;  3GTG C;  3FOF A;  1WQF A;  4A3D K;  1I3Q C; 
#chains in the Genus database with same CATH homology
 3AQO A;  4GTD A;  4G0U A;  1R9T A;  1Y1V A;  2PHC B;  1K83 A;  3GTK A;  4KMA A;  3FKI A;  5IOS A;  2XCO A;  5EGE A;  5JVO A;  3V4G A;  5IOQ A;  1ZXO A;  4M1X A;  2B63 A;  3GTP A;  4C3I C;  1EK8 A;  2XCQ A;  4G0W A;  2VUM A;  1XXA A;  1EH1 A;  1ZVU A;  1WIH A;  2GSN A;  3GTM A;  4J3N A;  1TWA A;  4LQY A;  3ERE D;  2YU9 A;  2CFA A;  2ZFZ A;  3N0C A;  5JFE A;  1O2A A;  1O2B A;  3LAJ A;  4KB2 A;  1O29 A;  2RGR A;  3FOE A;  3N3Y A;  1GE9 A;  4GTL A;  4C3H C;  4KAS A;  1XXC A;  2Y3P A;  4BKW A;  3GTO A;  4GT9 A;  4KAT A;  4FM9 A;  4FZB A;  2NVY A;  2E2I A;  5IOR A;  3G4C A;  1TWF A;  1B4B A;  3S0X A;  4KM8 A;  4C2M C;  2JA7 A;  1ISE A;  2R93 A;  4C3J C;  1I50 A;  4ILD A;  3AQP A;  1WCM A;  1B4A A;  1BJT A;  1O24 A;  1O26 A;  4GTA A;  2CFA B;  3H0G A;  2JA6 A;  3GTQ A;  2NVX A;  2RH6 A;  4KC6 A;  1SFO A;  4GFQ A;  4GTC A;  3BUE A;  3AH5 A;  1O27 A;  3OEP A;  1XXB A;  1O25 A;  4KAW X;  3QX3 A;  4GTF A;  3GTG A;  1IS1 A;  1ZBS A;  3Q3Q A;  3GTJ A;  1I3Q A;  3OPF A;  1KQ4 A;  3GTL A;  2R7Z A;  2E2H A;  4LR2 A;  2P5M A;  3G4A A;  2JH3 A;  1WQH A;  5TJ3 A;  3FHZ A;  3CQZ A;  5EGH A;  1Y1W A;  4KB4 A;  2KWA A;  1WQG A;  4P5B A;  1BGW A;  5CHP A;  2XCR B;  1F9N A;  2JA5 A;  1TWH A;  4GTB A;  4KM9 A;  5IOT A;  3LAP A;  2R92 A;  1AB4 A;  1TWG A;  4KAR A;  2GSU A;  5CJ9 A;  3L4J A;  4KMD A;  3NUH A;  4KDD A;  4P5A A;  3L4K A;  4DDQ A;  4GTE A;  4G0V A;  3N0B A;  4KMH A;  1DD5 A;  3ORE A;  1TWC A;  3CAG A;  1O28 A;  3LPX A;  3VA7 A;  4BLA A;  4BLB A;  2GSO A;  3FOF A;  1WQF A;  3MML B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...