3GTQK

Backtracked rna polymerase ii complex induced by damage
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtqK00
1WCMC 2Y0SL 3PO3K 3WODA 4C3HK 4G7HA 3GTKK 1TWFC 3RZDC 3HOVC 1SFOC 3HOZK 2O5IA 5IP7K 2B63C 3FKIK 4C3JK 3S15K 2E2JC 4BBSK 1WCMK 4A93K 4KMUA 2R93K 5IYBK 1I50K 5IYCC 4A3EK 3GTKC 1TWFK 4LJZA 5FJ8K 3RZDK 3HOVK 4QIWD 2PMZD 3HOYK 4A3GK 4OIQA 4YFKA 2B63K 3S15C 1I3QC 4BBSC 3GTGC 5IYDK 3GTPK 1TWGC 1K83C 2CW0A 4JK1A 3H3VL 1YNJA 5M5XK 3CQZC 4BBRK 3HOYC 2NVTC 2PMZL 4QIWL 1HQMA 3GTQC 5IYDC 3GTGK 2A68A 2R92C 3S16K 5FLMK 2JA6C 2JA8C 3K7AC 1K83K 2JA7C 3I4MK 4A3CC 2NVXK 2E2HK 4C2MK 4A3IK 4XLPA 4Y52C 3S1RK 4A3FK 4BBRC 3S2HK 1TWHK 3EQLA 4MEXA 4OIOA 4KN7A 4G7OA 4YFNA 1XPPA 3HKZL 2R92K 3PO3C 2WB1D 2JA8K 5M5YK 4A3BK 3I4MC 2NVYK 4A3KC 4MQ9A 4A3CK 1I6VA 4A3FC 3FKIC 4A93C 1YNNA 4XSXA 5IYBC 3HKZD 2WAQD 1I50C 5TMCA 4A3EC 4A3LC 4A3GC 4KN4A 5IP9K 3M4OC 4BY1C 2PA8L 1I6HK 4A3MK 1I3QK 5C4XC 3GTPC 4Y7NC 5C4JK 3M3YK 3I4NK 2VUMC 3S1QK 3H0GC 3CQZK 1IW7A 4QJVA 3S14C 3M4OK 1SMYA 2A6EA 1R9TC 2PA8D 4A3MC 5M3FK 3GTQK 2O5JA 4Y7NK 4MEYA 5FLMC 3I4NC 5M5WK 3K7AK 3S1NC 4BY7K 3S2DC 2JA7K 2NVXC 3S1MC 1BDFA 3S1QC 3S2HC 4A3JC 4Y52K 5C44C 4LK1A 4ZH4A 4YG2A 3GTMK 3RZOC 4X6AC 4A3DK 3S1NK 4A3BC 4Q5SA 2NVYC 4A3KK 3S1MK 1ZYRA 4AYBD 4A3JK 2E2IC 5C3EK 5C44K 4OINA 2WAQL 2BE5A 2PPBA 3HOWK 4C3IK 4OIRA 3H3VD 3GTOK 4X6AK 3PO2C 3S17C 5IP9C 2YU9K 2NVQC 3HOZC 4BY1K 4OIPA 2E2IK 5IP7C 4BXXK 1I6HC 5C3EC 2JA5K 5C4XK 2R7ZK 4LLGA 1TWAC 5C4JC 3GTJC 3M3YC 1TWCC 3HOWC 4NOIA 4G7ZA 2VUMK 3GTOC 4LK0A 2WB1L 5IYCK 2A6HA 3PO2K 3S17K 1Y1WC 3H0GK 3HOUC 2YU9C 2NVQK 3S14K 4BXXC 4GZYA 1R9TK 2R93C 2JA5C 3GTLC 2R7ZC 1TWAK 2A69A 4YFXA 3GTJK 1TWCK 1TWGK 3DXJA 3S2DK 4BY7C 5M3MK 1Y1WK 5D4DA 1Y1VC 3HOUK 3HOXC 4A3LK 2NVTK 2Y0SD 3S16C 3GTMC 3RZOK 4Q4ZA 5TMFA 4XSZA 3GTLK 2JA6K 4A3DC 4XLNA 4QJVB 4AYBL 2E2HC 1SFOK 4A3IC 3S1RC 1Y1VK 3HOXK 1TWHC 2E2JK
chains in the Genus database with same CATH superfamily
3N0BA 1XZPB 4C3HK 1F93A 3RZDC 4LOWA 1O2FB 3HOVC 2O5IA 5IP7K 4KDDA 4KMUA 2XCQA 5IYCC 1INNA 4GTBA 3RZDK 5FJ8K 2PMZD 3HOYK 1I3QC 2JA6A 1K83C 3GTPA 3GTKA 1O2BA 2NVTC 1BGWA 2JA8C 3I4MK 4A3CC 4WILA 4C2MK 3FKIA 1TWHK 2VUMA 4G7OA 3GIRA 4YFNA 1XPPA 3HKZL 3GTQA 2ZFZA 2JA8K 1TWGA 1L0WA 1EQRA 2EBBA 2NVYA 5IYBC 3HKZD 2GSNA 4KN4A 5IP9K 3M4OC 1EI6A 1PJ6A 4LQYA 3GTPC 3M3YK 4G0UA 1XXBA 3GEIA 1ZBSA 2V6SA 4RMFA 1USOA 3M4OK 4QJVA 3IPJA 1I3QA 1SMYA 2A6EA 3S14C 2PA8D 4GT9A 3GTQK 5FLMC 3I4NC 5M5WK 3QX3A 2R7ZA 4LK1A 4FZBA 4YG2A 1O27A 4A3DK 3S1NK 4A3BC 2NVYC 5EGEA 1PJ5A 4BLBA 4KC6A 4KM9A 1O24A 3PO2C 3S17C 4KB2A 3GSIA 5JVOA 4LLGA 2R93C 1TWCC 4NOIA 1J98A 5IYCK 1IQ0A 3PO2K 3S17K 1Y1WC 2NVQK 4BXXC 3ERED 3T00A 3GTLC 2R7ZC 4BY7C 3GTJA 1TWCK 1TWGK 3S2DK 1DCOA 3BUEA 5M3MK 1Y1WK 1IL2A 4P5AA 4A3LK 4PAAA 2NVTK 3S16C 4BKWA 3GTMC 3RZOK 4BLAA 1WQFA 4ILDA 4XLNA 1B4BA 1SFOK 3T01A 3S1RC 1TWHC 1WCMC 3WODA 3GTKK 1SFOC 1XZQA 3HOZK 1X31C 2P8TA 2E2JC 1WCMK 4A93K 1Y1WA 1K83A 5IYBK 3L4JA 4A3EK 1IS1A 3GTKC 4LJZA 1F9NA 4OIQA 2B63K 3G4CA 1VLOA 3OREA 5JFEA 1YNJA 3SZZA 5HL8A 2PMZL 2Y3PA 1HQMA 3GTQC 1DD5A 1XXCA 2R92C 3GTGA 3BP3A 5CJ9A 1ZVUA 2NVXK 4WJ4A 1HI9A 4A3IK 1USMA 3EQLA 4KN7A 3S0XA 2R92K 3LPXA 5M5YK 1WOSA 1UV7A 5IOQA 2FQTA 4XSXA 1V5VA 1WORA 1I50C 3TFJA 1I3QK 2GSOA 5EGHA 1AB4A 3OEPA 3AH5A 3H0GC 3CQZK 1GE9A 1C0AA 3LAJA 2O5JA 2GAGC 4Y7NK 3S2DC 2JA7K 4M1XA 1BDFA 1VH2A 5C44C 1J6WA 1EK8A 3GTMK 3RZOC 3G4AA 3TFHA 1WOPA 3TFIA 1IE0A 4GFQA 4Q5SA 4A3KK 4AYBD 4KMAA 1WSVA 4OIRA 1BJTA 3GTOK 1ISEA 5IP9C 2YU9K 3GDZA 5L46A 2KWAA 5C3EC 3N0CA 4KMHA 2ZUFA 1TWAC 3M3YC 3CAGA 3GTOC 1O26A 2WB1L 4LK0A 2A6HA 2YU9C 3S14K 1R9TK 3CQZA 1XZPA 5IOSA 2E2IA 2V6UA 3VA7A 1R9TA 5D4DA 4LR2A 4A3IC 4KASA 1Y1VK 5E68A 2V6TA 2W7VA 2Y0SL 3PO3K 4G7HA 1TWFC 4C3JK 3S15K 4BBSK 2R93K 3LAPA 4C3HC 1I50K 3GTMA 1EFWA 1TWFK 1WSRA 1EH1A 3HOVK 4YFKA 1G51A 3N3YA 3S15C 4BBSC 3V4GA 1TWGC 2CW0A 5TJ3A 4JK1A 3MMLB 5M5XK 3CQZC 3HOYC 4WJ3M 4QIWL 3S16K 3NUHA 1JVIA 1K83K 4AH6A 2JA7C 1PJ7A 3A8IA 1WCMA 2E2HK 3S1RK 4XLPA 4MEXA 4KARA 4GTAA 1O2AA 2WB1D 1IBAA 3AD7C 3I4MC 4A3KC 4A3CK 3A8KA 1RU0A 3FKIC 1XXAA 2XCOA 2XCRB 4A93C 3TTGA 3Q3QA 2WAQD 4A3EC 1XZQB 4J3NA 4A3GC 5C4XC 5C4JK 1VJEA 3I4NK 2VUMC 2P5MA 3JSTA 1IW7A 1R9TC 4PABA 5M3FK 2JA7A 3K7AK 3S1NC 2ZUEA 2NVXC 3S1MC 1WQGA 3S2HC 4A3JC 4Y52K 3ADAC 3AD8C 4C3IC 3AQOA 4X6AC 3S1MK 1YX2A 1ZYRA 4A3JK 3GTLA 2PPBA 3HOWK 4C3IK 4X6AK 3T02A 2YU9A 2NVQC 4BY1K 4BXXK 1I6HC 5IP7C 2JA5K 1YCLA 2R7ZK 3GTJC 3H0GA 3HOWC 4G7ZA 4KM8A 3GEHA 3H0GK 3AQPA 2JA5C 4P9SA 2RH6A 2A69A 4YFXA 3GTJK 1JQWA 2PHCB 1KQ4A 3HXAA 2CFAB 4P5BA 1VGXA 2Y0SD 3GTLK 5TMFA 1WOOA 2D6FC 4QJVB 2E2HC 4G0VA 4C2MC 3L4KA 4A3LC 2E2JK 1WIHA 2FQOA 1B4AA 1J6XA 2B63C 3FKIK 1DCPA 4DDQA 4GTDA 4A3GK 4QIWD 4C45A 1SFOA 1VRQC 4KMDA 4GTCA 3GTGC 3GTPK 2R92A 3OPFA 5IYDK 3A8JA 1BS2A 3H3VL 2NVXA 4BBRK 2JA5A 2GAHC 5IYDC 3GTGK 2A68A 5FLMK 2JA6C 3K7AC 4Y52C 3S2HK 4KATA 4BBRC 4A3FK 4O2DA 4OIOA 4KAWX 1ZXOA 2JH3A 3PO3C 2E2HA 2B63A 4A3BK 1JOEA 2NVYK 4MQ9A 1O28A 1I6VA 4A3FC 4C3JC 1O25A 1YNNA 5TMCA 3GEEA 2PA8L 4BY1C 1I6HK 3SZYA 4A3MK 3FOFA 4Y7NC 4XCHA 1I50A 4FM9A 3S1QK 2R93A 4GTEA 4A3MC 4MEYA 4BY7K 1DCHA 1F7VA 1WQHA 3S1QC 2GSUA 1TWCA 4ZH4A 1Y1VA 3BP8C 3FHZA 3FOEA 2E2IC 2RGRA 4OINA 5C3EK 5C44K 1O29A 2WAQL 5CHPA 2BE5A 4KB4A 3H3VD 3HOZC 4OIPA 2E2IK 5C4XK 1F7UA 5C4JC 2VUMK 5IORA 3AD9C 1TWHA 3HOUC 4GZYA 4GTLA 1TWFA 1TWAK 1TWAA 3DXJA 3GTOA 4G0WA 1Y1VC 3HOUK 3HOXC 4GTFA 1ZQ1C 4Q4ZA 4XSZA 2JA6K 4A3DC 1J6VA 2CFAA 4AYBL 3HOXK 5IOTA
chains in the Genus database with same CATH topology
1WCMC 2Y0SL 3PO3K 3WODA 4C3HK 4G7HA 3GTKK 1TWFC 3RZDC 3HOVC 1SFOC 3HOZK 2O5IA 5IP7K 2B63C 3FKIK 4C3JK 3S15K 2E2JC 4BBSK 1WCMK 4A93K 4KMUA 2R93K 5IYBK 1I50K 5IYCC 4A3EK 3GTKC 1TWFK 4LJZA 5FJ8K 3RZDK 3HOVK 4QIWD 2PMZD 3HOYK 4A3GK 4OIQA 4YFKA 2B63K 3S15C 1I3QC 4BBSC 3GTGC 5IYDK 3GTPK 1TWGC 1K83C 2CW0A 4JK1A 3H3VL 1YNJA 5M5XK 3CQZC 4BBRK 3HOYC 2NVTC 2PMZL 4QIWL 1HQMA 3GTQC 5IYDC 3GTGK 2A68A 2R92C 3S16K 5FLMK 2JA6C 2JA8C 3K7AC 1K83K 2JA7C 3I4MK 4A3CC 2NVXK 2E2HK 4C2MK 4A3IK 4XLPA 4Y52C 3S1RK 4A3FK 4BBRC 3S2HK 1TWHK 3EQLA 4MEXA 4OIOA 4KN7A 4G7OA 4YFNA 1XPPA 3HKZL 2R92K 3PO3C 2WB1D 2JA8K 5M5YK 4A3BK 3I4MC 2NVYK 4A3KC 4MQ9A 4A3CK 1I6VA 4A3FC 3FKIC 4A93C 1YNNA 4XSXA 5IYBC 3HKZD 2WAQD 1I50C 5TMCA 4A3EC 4A3LC 4A3GC 4KN4A 5IP9K 3M4OC 4BY1C 2PA8L 1I6HK 4A3MK 1I3QK 5C4XC 3GTPC 4Y7NC 5C4JK 3M3YK 3I4NK 2VUMC 3S1QK 3H0GC 3CQZK 1IW7A 4QJVA 3S14C 3M4OK 1SMYA 2A6EA 1R9TC 2PA8D 4A3MC 5M3FK 3GTQK 2O5JA 4Y7NK 4MEYA 5FLMC 3I4NC 5M5WK 3K7AK 3S1NC 4BY7K 3S2DC 2JA7K 2NVXC 3S1MC 1BDFA 3S1QC 3S2HC 4A3JC 4Y52K 5C44C 4LK1A 4ZH4A 4YG2A 3GTMK 3RZOC 4X6AC 4A3DK 3S1NK 4A3BC 4Q5SA 2NVYC 4A3KK 3S1MK 1ZYRA 4AYBD 4A3JK 2E2IC 5C3EK 5C44K 4OINA 2WAQL 2BE5A 2PPBA 3HOWK 4C3IK 4OIRA 3H3VD 3GTOK 4X6AK 3PO2C 3S17C 5IP9C 2YU9K 2NVQC 3HOZC 4BY1K 4OIPA 2E2IK 5IP7C 4BXXK 1I6HC 5C3EC 2JA5K 5C4XK 2R7ZK 4LLGA 1TWAC 5C4JC 3GTJC 3M3YC 1TWCC 3HOWC 4NOIA 4G7ZA 2VUMK 3GTOC 4LK0A 2WB1L 5IYCK 2A6HA 3PO2K 3S17K 1Y1WC 3H0GK 3HOUC 2YU9C 2NVQK 3S14K 4BXXC 4GZYA 1R9TK 2R93C 2JA5C 3GTLC 2R7ZC 1TWAK 2A69A 4YFXA 3GTJK 1TWCK 1TWGK 3DXJA 3S2DK 4BY7C 5M3MK 1Y1WK 5D4DA 1Y1VC 3HOUK 3HOXC 4A3LK 2NVTK 2Y0SD 3S16C 3GTMC 3RZOK 4Q4ZA 5TMFA 4XSZA 3GTLK 2JA6K 4A3DC 4XLNA 4QJVB 4AYBL 2E2HC 1SFOK 4A3IC 3S1RC 1Y1VK 3HOXK 1TWHC 2E2JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM C;  2Y0S L;  3PO3 K;  3WOD A;  4C3H K;  4G7H A;  3GTK K;  1TWF C;  3RZD C;  3HOV C;  1SFO C;  3HOZ K;  2O5I A;  5IP7 K;  2B63 C;  3FKI K;  4C3J K;  3S15 K;  2E2J C;  4BBS K;  1WCM K;  4A93 K;  4KMU A;  2R93 K;  5IYB K;  1I50 K;  5IYC C;  4A3E K;  3GTK C;  1TWF K;  4LJZ A;  5FJ8 K;  3RZD K;  3HOV K;  4QIW D;  2PMZ D;  3HOY K;  4A3G K;  4OIQ A;  4YFK A;  2B63 K;  3S15 C;  1I3Q C;  4BBS C;  3GTG C;  5IYD K;  3GTP K;  1TWG C;  1K83 C;  2CW0 A;  4JK1 A;  3H3V L;  1YNJ A;  5M5X K;  3CQZ C;  4BBR K;  3HOY C;  2NVT C;  2PMZ L;  4QIW L;  1HQM A;  3GTQ C;  5IYD C;  3GTG K;  2A68 A;  2R92 C;  3S16 K;  5FLM K;  2JA6 C;  2JA8 C;  3K7A C;  1K83 K;  2JA7 C;  3I4M K;  4A3C C;  2NVX K;  2E2H K;  4C2M K;  4A3I K;  4XLP A;  4Y52 C;  3S1R K;  4A3F K;  4BBR C;  3S2H K;  1TWH K;  3EQL A;  4MEX A;  4OIO A;  4KN7 A;  4G7O A;  4YFN A;  1XPP A;  3HKZ L;  2R92 K;  3PO3 C;  2WB1 D;  2JA8 K;  5M5Y K;  4A3B K;  3I4M C;  2NVY K;  4A3K C;  4MQ9 A;  4A3C K;  1I6V A;  4A3F C;  3FKI C;  4A93 C;  1YNN A;  4XSX A;  5IYB C;  3HKZ D;  2WAQ D;  1I50 C;  5TMC A;  4A3E C;  4A3L C;  4A3G C;  4KN4 A;  5IP9 K;  3M4O C;  4BY1 C;  2PA8 L;  1I6H K;  4A3M K;  1I3Q K;  5C4X C;  3GTP C;  4Y7N C;  5C4J K;  3M3Y K;  3I4N K;  2VUM C;  3S1Q K;  3H0G C;  3CQZ K;  1IW7 A;  4QJV A;  3S14 C;  3M4O K;  1SMY A;  2A6E A;  1R9T C;  2PA8 D;  4A3M C;  5M3F K;  3GTQ K;  2O5J A;  4Y7N K;  4MEY A;  5FLM C;  3I4N C;  5M5W K;  3K7A K;  3S1N C;  4BY7 K;  3S2D C;  2JA7 K;  2NVX C;  3S1M C;  1BDF A;  3S1Q C;  3S2H C;  4A3J C;  4Y52 K;  5C44 C;  4LK1 A;  4ZH4 A;  4YG2 A;  3GTM K;  3RZO C;  4X6A C;  4A3D K;  3S1N K;  4A3B C;  4Q5S A;  2NVY C;  4A3K K;  3S1M K;  1ZYR A;  4AYB D;  4A3J K;  2E2I C;  5C3E K;  5C44 K;  4OIN A;  2WAQ L;  2BE5 A;  2PPB A;  3HOW K;  4C3I K;  4OIR A;  3H3V D;  3GTO K;  4X6A K;  3PO2 C;  3S17 C;  5IP9 C;  2YU9 K;  2NVQ C;  3HOZ C;  4BY1 K;  4OIP A;  2E2I K;  5IP7 C;  4BXX K;  1I6H C;  5C3E C;  2JA5 K;  5C4X K;  2R7Z K;  4LLG A;  1TWA C;  5C4J C;  3GTJ C;  3M3Y C;  1TWC C;  3HOW C;  4NOI A;  4G7Z A;  2VUM K;  3GTO C;  4LK0 A;  2WB1 L;  5IYC K;  2A6H A;  3PO2 K;  3S17 K;  1Y1W C;  3H0G K;  3HOU C;  2YU9 C;  2NVQ K;  3S14 K;  4BXX C;  4GZY A;  1R9T K;  2R93 C;  2JA5 C;  3GTL C;  2R7Z C;  1TWA K;  2A69 A;  4YFX A;  3GTJ K;  1TWC K;  1TWG K;  3DXJ A;  3S2D K;  4BY7 C;  5M3M K;  1Y1W K;  5D4D A;  1Y1V C;  3HOU K;  3HOX C;  4A3L K;  2NVT K;  2Y0S D;  3S16 C;  3GTM C;  3RZO K;  4Q4Z A;  5TMF A;  4XSZ A;  3GTL K;  2JA6 K;  4A3D C;  4XLN A;  4QJV B;  4AYB L;  2E2H C;  1SFO K;  4A3I C;  3S1R C;  1Y1V K;  3HOX K;  1TWH C;  2E2J K; 
#chains in the Genus database with same CATH topology
 3N0B A;  1XZP B;  4C3H K;  1F93 A;  3RZD C;  4LOW A;  1O2F B;  3HOV C;  2O5I A;  5IP7 K;  4KDD A;  4KMU A;  2XCQ A;  5IYC C;  1INN A;  4GTB A;  3RZD K;  5FJ8 K;  2PMZ D;  3HOY K;  1I3Q C;  2JA6 A;  1K83 C;  3GTP A;  3GTK A;  1O2B A;  2NVT C;  1BGW A;  2JA8 C;  3I4M K;  4A3C C;  4WIL A;  4C2M K;  3FKI A;  1TWH K;  2VUM A;  4G7O A;  3GIR A;  4YFN A;  1XPP A;  3HKZ L;  3GTQ A;  2ZFZ A;  2JA8 K;  1TWG A;  1L0W A;  1EQR A;  2EBB A;  2NVY A;  5IYB C;  3HKZ D;  2GSN A;  4KN4 A;  5IP9 K;  3M4O C;  1EI6 A;  1PJ6 A;  4LQY A;  3GTP C;  3M3Y K;  4G0U A;  1XXB A;  3GEI A;  1ZBS A;  2V6S A;  4RMF A;  1USO A;  3M4O K;  4QJV A;  3IPJ A;  1I3Q A;  1SMY A;  2A6E A;  3S14 C;  2PA8 D;  4GT9 A;  3GTQ K;  5FLM C;  3I4N C;  5M5W K;  3QX3 A;  2R7Z A;  4LK1 A;  4FZB A;  4YG2 A;  1O27 A;  4A3D K;  3S1N K;  4A3B C;  2NVY C;  5EGE A;  1PJ5 A;  4BLB A;  4KC6 A;  4KM9 A;  1O24 A;  3PO2 C;  3S17 C;  4KB2 A;  3GSI A;  5JVO A;  4LLG A;  2R93 C;  1TWC C;  4NOI A;  1J98 A;  5IYC K;  1IQ0 A;  3PO2 K;  3S17 K;  1Y1W C;  2NVQ K;  4BXX C;  3ERE D;  3T00 A;  3GTL C;  2R7Z C;  4BY7 C;  3GTJ A;  1TWC K;  1TWG K;  3S2D K;  1DCO A;  3BUE A;  5M3M K;  1Y1W K;  1IL2 A;  4P5A A;  4A3L K;  4PAA A;  2NVT K;  3S16 C;  4BKW A;  3GTM C;  3RZO K;  4BLA A;  1WQF A;  4ILD A;  4XLN A;  1B4B A;  1SFO K;  3T01 A;  3S1R C;  1TWH C;  1WCM C;  3WOD A;  3GTK K;  1SFO C;  1XZQ A;  3HOZ K;  1X31 C;  2P8T A;  2E2J C;  1WCM K;  4A93 K;  1Y1W A;  1K83 A;  5IYB K;  3L4J A;  4A3E K;  1IS1 A;  3GTK C;  4LJZ A;  1F9N A;  4OIQ A;  2B63 K;  3G4C A;  1VLO A;  3ORE A;  5JFE A;  1YNJ A;  3SZZ A;  5HL8 A;  2PMZ L;  2Y3P A;  1HQM A;  3GTQ C;  1DD5 A;  1XXC A;  2R92 C;  3GTG A;  3BP3 A;  5CJ9 A;  1ZVU A;  2NVX K;  4WJ4 A;  1HI9 A;  4A3I K;  1USM A;  3EQL A;  4KN7 A;  3S0X A;  2R92 K;  3LPX A;  5M5Y K;  1WOS A;  1UV7 A;  5IOQ A;  2FQT A;  4XSX A;  1V5V A;  1WOR A;  1I50 C;  3TFJ A;  1I3Q K;  2GSO A;  5EGH A;  1AB4 A;  3OEP A;  3AH5 A;  3H0G C;  3CQZ K;  1GE9 A;  1C0A A;  3LAJ A;  2O5J A;  2GAG C;  4Y7N K;  3S2D C;  2JA7 K;  4M1X A;  1BDF A;  1VH2 A;  5C44 C;  1J6W A;  1EK8 A;  3GTM K;  3RZO C;  3G4A A;  3TFH A;  1WOP A;  3TFI A;  1IE0 A;  4GFQ A;  4Q5S A;  4A3K K;  4AYB D;  4KMA A;  1WSV A;  4OIR A;  1BJT A;  3GTO K;  1ISE A;  5IP9 C;  2YU9 K;  3GDZ A;  5L46 A;  2KWA A;  5C3E C;  3N0C A;  4KMH A;  2ZUF A;  1TWA C;  3M3Y C;  3CAG A;  3GTO C;  1O26 A;  2WB1 L;  4LK0 A;  2A6H A;  2YU9 C;  3S14 K;  1R9T K;  3CQZ A;  1XZP A;  5IOS A;  2E2I A;  2V6U A;  3VA7 A;  1R9T A;  5D4D A;  4LR2 A;  4A3I C;  4KAS A;  1Y1V K;  5E68 A;  2V6T A;  2W7V A;  2Y0S L;  3PO3 K;  4G7H A;  1TWF C;  4C3J K;  3S15 K;  4BBS K;  2R93 K;  3LAP A;  4C3H C;  1I50 K;  3GTM A;  1EFW A;  1TWF K;  1WSR A;  1EH1 A;  3HOV K;  4YFK A;  1G51 A;  3N3Y A;  3S15 C;  4BBS C;  3V4G A;  1TWG C;  2CW0 A;  5TJ3 A;  4JK1 A;  3MML B;  5M5X K;  3CQZ C;  3HOY C;  4WJ3 M;  4QIW L;  3S16 K;  3NUH A;  1JVI A;  1K83 K;  4AH6 A;  2JA7 C;  1PJ7 A;  3A8I A;  1WCM A;  2E2H K;  3S1R K;  4XLP A;  4MEX A;  4KAR A;  4GTA A;  1O2A A;  2WB1 D;  1IBA A;  3AD7 C;  3I4M C;  4A3K C;  4A3C K;  3A8K A;  1RU0 A;  3FKI C;  1XXA A;  2XCO A;  2XCR B;  4A93 C;  3TTG A;  3Q3Q A;  2WAQ D;  4A3E C;  1XZQ B;  4J3N A;  4A3G C;  5C4X C;  5C4J K;  1VJE A;  3I4N K;  2VUM C;  2P5M A;  3JST A;  1IW7 A;  1R9T C;  4PAB A;  5M3F K;  2JA7 A;  3K7A K;  3S1N C;  2ZUE A;  2NVX C;  3S1M C;  1WQG A;  3S2H C;  4A3J C;  4Y52 K;  3ADA C;  3AD8 C;  4C3I C;  3AQO A;  4X6A C;  3S1M K;  1YX2 A;  1ZYR A;  4A3J K;  3GTL A;  2PPB A;  3HOW K;  4C3I K;  4X6A K;  3T02 A;  2YU9 A;  2NVQ C;  4BY1 K;  4BXX K;  1I6H C;  5IP7 C;  2JA5 K;  1YCL A;  2R7Z K;  3GTJ C;  3H0G A;  3HOW C;  4G7Z A;  4KM8 A;  3GEH A;  3H0G K;  3AQP A;  2JA5 C;  4P9S A;  2RH6 A;  2A69 A;  4YFX A;  3GTJ K;  1JQW A;  2PHC B;  1KQ4 A;  3HXA A;  2CFA B;  4P5B A;  1VGX A;  2Y0S D;  3GTL K;  5TMF A;  1WOO A;  2D6F C;  4QJV B;  2E2H C;  4G0V A;  4C2M C;  3L4K A;  4A3L C;  2E2J K;  1WIH A;  2FQO A;  1B4A A;  1J6X A;  2B63 C;  3FKI K;  1DCP A;  4DDQ A;  4GTD A;  4A3G K;  4QIW D;  4C45 A;  1SFO A;  1VRQ C;  4KMD A;  4GTC A;  3GTG C;  3GTP K;  2R92 A;  3OPF A;  5IYD K;  3A8J A;  1BS2 A;  3H3V L;  2NVX A;  4BBR K;  2JA5 A;  2GAH C;  5IYD C;  3GTG K;  2A68 A;  5FLM K;  2JA6 C;  3K7A C;  4Y52 C;  3S2H K;  4KAT A;  4BBR C;  4A3F K;  4O2D A;  4OIO A;  4KAW X;  1ZXO A;  2JH3 A;  3PO3 C;  2E2H A;  2B63 A;  4A3B K;  1JOE A;  2NVY K;  4MQ9 A;  1O28 A;  1I6V A;  4A3F C;  4C3J C;  1O25 A;  1YNN A;  5TMC A;  3GEE A;  2PA8 L;  4BY1 C;  1I6H K;  3SZY A;  4A3M K;  3FOF A;  4Y7N C;  4XCH A;  1I50 A;  4FM9 A;  3S1Q K;  2R93 A;  4GTE A;  4A3M C;  4MEY A;  4BY7 K;  1DCH A;  1F7V A;  1WQH A;  3S1Q C;  2GSU A;  1TWC A;  4ZH4 A;  1Y1V A;  3BP8 C;  3FHZ A;  3FOE A;  2E2I C;  2RGR A;  4OIN A;  5C3E K;  5C44 K;  1O29 A;  2WAQ L;  5CHP A;  2BE5 A;  4KB4 A;  3H3V D;  3HOZ C;  4OIP A;  2E2I K;  5C4X K;  1F7U A;  5C4J C;  2VUM K;  5IOR A;  3AD9 C;  1TWH A;  3HOU C;  4GZY A;  4GTL A;  1TWF A;  1TWA K;  1TWA A;  3DXJ A;  3GTO A;  4G0W A;  1Y1V C;  3HOU K;  3HOX C;  4GTF A;  1ZQ1 C;  4Q4Z A;  4XSZ A;  2JA6 K;  4A3D C;  1J6V A;  2CFA A;  4AYB L;  3HOX K;  5IOT A; 
#chains in the Genus database with same CATH homology
 1WCM C;  2Y0S L;  3PO3 K;  3WOD A;  4C3H K;  4G7H A;  3GTK K;  1TWF C;  3RZD C;  3HOV C;  1SFO C;  3HOZ K;  2O5I A;  5IP7 K;  2B63 C;  3FKI K;  4C3J K;  3S15 K;  2E2J C;  4BBS K;  1WCM K;  4A93 K;  4KMU A;  2R93 K;  5IYB K;  1I50 K;  5IYC C;  4A3E K;  3GTK C;  1TWF K;  4LJZ A;  5FJ8 K;  3RZD K;  3HOV K;  4QIW D;  2PMZ D;  3HOY K;  4A3G K;  4OIQ A;  4YFK A;  2B63 K;  3S15 C;  1I3Q C;  4BBS C;  3GTG C;  5IYD K;  3GTP K;  1TWG C;  1K83 C;  2CW0 A;  4JK1 A;  3H3V L;  1YNJ A;  5M5X K;  3CQZ C;  4BBR K;  3HOY C;  2NVT C;  2PMZ L;  4QIW L;  1HQM A;  3GTQ C;  5IYD C;  3GTG K;  2A68 A;  2R92 C;  3S16 K;  5FLM K;  2JA6 C;  2JA8 C;  3K7A C;  1K83 K;  2JA7 C;  3I4M K;  4A3C C;  2NVX K;  2E2H K;  4C2M K;  4A3I K;  4XLP A;  4Y52 C;  3S1R K;  4A3F K;  4BBR C;  3S2H K;  1TWH K;  3EQL A;  4MEX A;  4OIO A;  4KN7 A;  4G7O A;  4YFN A;  1XPP A;  3HKZ L;  2R92 K;  3PO3 C;  2WB1 D;  2JA8 K;  5M5Y K;  4A3B K;  3I4M C;  2NVY K;  4A3K C;  4MQ9 A;  4A3C K;  1I6V A;  4A3F C;  3FKI C;  4A93 C;  1YNN A;  4XSX A;  5IYB C;  3HKZ D;  2WAQ D;  1I50 C;  5TMC A;  4A3E C;  4A3L C;  4A3G C;  4KN4 A;  5IP9 K;  3M4O C;  4BY1 C;  2PA8 L;  1I6H K;  4A3M K;  1I3Q K;  5C4X C;  3GTP C;  4Y7N C;  5C4J K;  3M3Y K;  3I4N K;  2VUM C;  3S1Q K;  3H0G C;  3CQZ K;  1IW7 A;  4QJV A;  3S14 C;  3M4O K;  1SMY A;  2A6E A;  1R9T C;  2PA8 D;  4A3M C;  5M3F K;  3GTQ K;  2O5J A;  4Y7N K;  4MEY A;  5FLM C;  3I4N C;  5M5W K;  3K7A K;  3S1N C;  4BY7 K;  3S2D C;  2JA7 K;  2NVX C;  3S1M C;  1BDF A;  3S1Q C;  3S2H C;  4A3J C;  4Y52 K;  5C44 C;  4LK1 A;  4ZH4 A;  4YG2 A;  3GTM K;  3RZO C;  4X6A C;  4A3D K;  3S1N K;  4A3B C;  4Q5S A;  2NVY C;  4A3K K;  3S1M K;  1ZYR A;  4AYB D;  4A3J K;  2E2I C;  5C3E K;  5C44 K;  4OIN A;  2WAQ L;  2BE5 A;  2PPB A;  3HOW K;  4C3I K;  4OIR A;  3H3V D;  3GTO K;  4X6A K;  3PO2 C;  3S17 C;  5IP9 C;  2YU9 K;  2NVQ C;  3HOZ C;  4BY1 K;  4OIP A;  2E2I K;  5IP7 C;  4BXX K;  1I6H C;  5C3E C;  2JA5 K;  5C4X K;  2R7Z K;  4LLG A;  1TWA C;  5C4J C;  3GTJ C;  3M3Y C;  1TWC C;  3HOW C;  4NOI A;  4G7Z A;  2VUM K;  3GTO C;  4LK0 A;  2WB1 L;  5IYC K;  2A6H A;  3PO2 K;  3S17 K;  1Y1W C;  3H0G K;  3HOU C;  2YU9 C;  2NVQ K;  3S14 K;  4BXX C;  4GZY A;  1R9T K;  2R93 C;  2JA5 C;  3GTL C;  2R7Z C;  1TWA K;  2A69 A;  4YFX A;  3GTJ K;  1TWC K;  1TWG K;  3DXJ A;  3S2D K;  4BY7 C;  5M3M K;  1Y1W K;  5D4D A;  1Y1V C;  3HOU K;  3HOX C;  4A3L K;  2NVT K;  2Y0S D;  3S16 C;  3GTM C;  3RZO K;  4Q4Z A;  5TMF A;  4XSZ A;  3GTL K;  2JA6 K;  4A3D C;  4XLN A;  4QJV B;  4AYB L;  2E2H C;  1SFO K;  4A3I C;  3S1R C;  1Y1V K;  3HOX K;  1TWH C;  2E2J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...