3GTQK

Backtracked rna polymerase ii complex induced by damage
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtqK00
4A3EK 2E2HK 3PO2K 2O5JA 1YNJA 3H3VL 4BXXC 5IYCK 5C3EC 3HOXC 1TWHC 1HQMA 3RZDK 3S2DK 1XPPA 5IP7C 3HOYC 3GTLK 3S17K 1SMYA 2B63K 5C44C 2JA8C 2JA5C 3HKZL 3K7AK 4QJVA 3GTJC 3HOVC 2VUMC 2A6EA 1I6VA 1WCMC 4A3JK 1TWFC 3HOWC 3I4MC 3S1QK 1Y1WC 3S14C 3PO2C 2PPBA 4LJZA 3GTGC 1IW7A 2NVYC 5FJ8K 2NVXC 1TWCK 4C2MK 2A6HA 5C4JC 2R7ZC 4A93K 4BY7C 1TWGC 5M5WK 5IP9C 3FKIK 4KN4A 1I50C 1SFOK 2E2JC 2R92K 2A68A 3HOUC 3M3YC 4A3CC 3H0GC 3GTQC 2O5IA 5TMCA 2PA8D 4NOIA 4A3LC 4KMUA 3GTOC 4MEXA 3I4NK 2WB1D 1I6HC 5M3MK 4MEYA 4GZYA 2PMZL 4X6AC 3S1RC 4Y52C 3CQZK 4BY1K 3M4OK 4QIWL 3S1QC 4OIOA 4AYBD 3S15C 4XSZA 4LLGA 2WAQD 4A3GC 1TWCC 4G7HA 1TWAK 2A69A 3S16K 3S2HC 4A3BK 1R9TK 4KN7A 5IYDK 5M5YK 5C4XK 3S1MK 1Y1VC 4BBRC 4A3FC 4A3IK 2NVTC 4OIPA 4A3EC 1BDFA 2E2HC 4YFNA 3GTMK 3WODA 5IYCC 5IYBK 2NVQK 5TMFA 3M4OC 3S1NK 3RZDC 3GTPK 2JA6K 3S2DC 3RZOK 3GTLC 3S17C 4A3MK 1K83K 1YNNA 2B63C 4XLPA 5FLMK 1R9TC 3K7AC 4Y7NK 4OIRA 2JA7K 3HOZK 3GTKK 4XSXA 2E2IK 4Q5SA 2PA8L 4A3JC 2WB1L 4A93C 5C3EK 3HOXK 2R92C 1TWHK 3FKIC 4BBSC 1I3QK 1SFOC 2Y0SD 2CW0A 4QJVB 5IP7K 4AYBL 4A3DK 1ZYRA 4C3JK 4G7ZA 1K83C 2WAQL 4A3MC 4LK1A 4C3IK 4YG2A 5C44K 4XLNA 2JA5K 4OINA 4Q4ZA 2JA8K 3I4NC 3GTJK 5M3FK 2YU9K 4G7OA 3H3VD 3HOVK 2VUMK 3HOZC 1WCMK 4A3KK 3CQZC 4BY1C 3HOWK 3I4MK 1Y1WK 3S14K 3GTGK 4LK0A 2NVYK 4YFKA 2BE5A 2NVXK 4OIQA 5C4JK 2R7ZK 4BY7K 1TWAC 1TWGK 5IP9K 3M3YK 3HKZD 1I50K 1I3QC 2E2JK 3S16C 3HOUK 3PO3K 5IYDC 4A3BC 3H0GK 3GTQK 4A3CK 4A3DC 5C4XC 4C3HK 3S1MC 2R93K 4A3LK 3GTOK 4A3IC 4A3GK 1I6HK 2YU9C 4X6AK 3GTMC 5D4DA 4BXXK 3S1RK 4A3KC 4BBSK 4Y52K 4JK1A 5IYBC 2NVQC 3S1NC 3S15K 3GTPC 2JA6C 3HOYK 3RZOC 4YFXA 3EQLA 3DXJA 3S2HK 3PO3C 5FLMC 2PMZD 2Y0SL 4Y7NC 2JA7C 3GTKC 1Y1VK 4BBRK 2E2IC 4A3FK 2R93C 4QIWD 4MQ9A 2NVTK 1TWFK 5M5XK 4ZH4A
chains in the Genus database with same CATH superfamily
3PO2K 2W7VA 4FM9A 4KMDA 1YNJA 2EBBA 5CHPA 3RZDK 3S2DK 1TWGA 1XPPA 1I50A 1C0AA 5IOQA 2JA8C 2P8TA 3AD8C 3GTOA 2A6EA 1I6VA 1WCMC 4A3JK 1TWFC 3I4MC 4AH6A 1IW7A 2R7ZC 2A6HA 1ISEA 5M5WK 4BBSK 3GEIA 1SFOK 3HOUC 4A3CC 1DCHA 3H0GC 3GTQC 3Q3QA 3T00A 4A3LC 2ZUEA 4GFQA 1Y1VA 2E2HA 4Y52C 3CQZK 3N3YA 4DDQA 4BY1K 3S1QC 3V4GA 3S15C 1XZPA 1O28A 1INNA 1R9TK 1IS1A 1RU0A 1R9TA 2NVTC 3A8KA 5EGEA 1DCOA 1L0WA 2NVQK 1EK8A 3RZDC 3GEHA 3S2DC 2R92A 2GSUA 1YNNA 4XLPA 3HOZK 4Q5SA 4A3JC 5HL8A 2WB1L 3GDZA 3BP8C 4G0VA 5IOTA 4BBSC 1SFOC 3G4AA 4C45A 4A3DK 5IP7K 1ZYRA 2JA5K 4G0UA 3GTJK 4G7OA 3HOVK 1XXBA 3CQZC 3LPXA 4BY1C 3HOWK 3GTMA 1J6VA 3TFJA 3GTGK 2NVXK 2ZUFA 3GTPA 2JA6A 1O2FB 5IP9K 2D6FC 1B4AA 3AH5A 1I6HK 2GAGC 2E2IA 4KB2A 3S1RK 4A3KC 3HXAA 2NVQC 4KM9A 3PO3C 1XZQA 1J98A 4KAWX 1PJ6A 1TWFK 1WCMA 3OREA 1WQGA 3N0CA 1TWFA 2O5JA 4BXXC 1EI6A 3BUEA 2R7ZA 5IP7C 3IPJA 3H0GA 3GTQA 4WILA 2JA5C 3HKZL 4LQYA 4QJVA 1J6WA 3GTJC 3HOVC 2KWAA 1VRQC 1EH1A 1JQWA 1WSVA 3HOWC 3S1QK 3LAPA 1WOSA 3GTGC 1VH2A 4GZYA 2NVXC 4A93K 1X31C 4GTBA 5IP9C 4P5AA 2O5IA 2WB1D 1I6HC 4GTFA 4LOWA 1EQRA 4MEYA 2PMZL 3LAJA 3SZYA 3S1RC 1J6XA 1USMA 4XSZA 1TWCC 2JH3A 2A69A 3S1MK 4A3IK 1VGXA 1BDFA 5JFEA 4YFNA 3WODA 1O29A 3AD9C 3AD7C 3M4OC 2XCQA 1F93A 5L46A 1SFOA 3N0BA 4M1XA 2XCRB 3GTKK 2XCOA 2RH6A 3FOEA 3CQZA 4A93C 1BJTA 5C3EK 3QX3A 2CW0A 1K83C 5E68A 4LK1A 5C44K 4XLNA 1WOPA 4OINA 5M3FK 2VUMA 4A3KK 4P5BA 1Y1WK 4LK0A 2NVYK 4OIQA 2BE5A 2V6UA 4BY7K 4P9SA 3FHZA 4XCHA 3HKZD 2E2JK 3PO3K 3T02A 4C3JC 3S1MC 4A3IC 3TTGA 2YU9C 1DCPA 2V6SA 4X6AK 1XZPB 4BXXK 2GSOA 4KMHA 4YFXA 3EQLA 3S2HK 2GSNA 1JOEA 2PMZD 2JA5A 4GT9A 1UV7A 3GTJA 3GTKC 4A3FK 5IYCK 5C3EC 3OPFA 4BLBA 3GTGA 2NVXA 1HQMA 2P5MA 3GTLK 1SMYA 2B63K 3G4CA 5C44C 1IL2A 3K7AK 1Y1WC 2PPBA 2NVYC 5FJ8K 4BY7C 1TWCK 3FKIK 1TWCA 2E2JC 2A68A 3GSIA 5TMCA 4NOIA 4KMUA 4MEXA 1BGWA 1EFWA 3I4NK 5M3MK 3AQOA 4X6AC 5IORA 3M4OK 2ZFZA 4OIOA 2RGRA 1ZVUA 4LLGA 4A3GC 4PAAA 1WOOA 4KMAA 1TWAK 3S2HC 4KASA 4A3BK 2CFAA 1USOA 4KARA 5C4XK 1O24A 4A3FC 5IYCC 1XXAA 5IYBK 5TMFA 1XZQB 3RZOK 1PJ5A 3GTLC 1O27A 1K83K 4WJ4A 2B63C 4GTCA 1O26A 3VA7A 3K7AC 2JA7K 4XSXA 2PA8L 5TJ3A 3AQPA 1V5VA 1VLOA 3HOXK 1TWHK 3FKIC 4QJVB 4AYBL 4GTAA 4C3JK 4G7ZA 1WQHA 2WAQL 4A3MC 4C3IK 3I4NC 2YU9K 2VUMK 1ZBSA 4FZBA 2YU9A 4ILDA 3S14K 4RMFA 3ERED 4YFKA 5C4JK 1TWAC 1TWGK 3M3YK 4A3BC 1I50K 1I3QC 4J3NA 5C4XC 3GTOK 1BS2A 3GTKA 1B4BA 3NUHA 5D4DA 4JK1A 5IYBC 3S0XA 1ZQ1C 3RZOC 3GEEA 1WSRA 2Y0SL 2JA7C 4KATA 4C3HC 4BLAA 5CJ9A 1Y1VK 4BBRK 2R93C 4MQ9A 4ZH4A 4A3EK 1IE0A 2E2HK 1WQFA 2FQTA 3H3VL 1Y1WA 2NVYA 3HOXC 1TWHC 4LR2A 3HOYC 3S17K 5IOSA 3CAGA 4C3IC 2GAHC 5JVOA 2PHCB 2VUMC 1DD5A 4PABA 3S14C 3PO2C 4LJZA 4A3GK 3TFIA 4C2MK 5C4JC 1WIHA 1TWGC 2R92K 1O2AA 4KN4A 3M3YC 1I50C 3L4JA 2PA8D 4KDDA 4KC6A 3GTOC 4GTLA 2Y3PA 3FOFA 4G0WA 1VJEA 1JVIA 3A8IA 4BKWA 2FQOA 4QIWL 4AYBD 2WAQD 3SZZA 4G7HA 1O2BA 3A8JA 3S16K 3GTLA 3MMLB 4KN7A 5IYDK 2B63A 5M5YK 1Y1VC 4BBRC 1G51A 4OIPA 4A3EC 2E2HC 3JSTA 1YCLA 3GTMK 1GE9A 3S1NK 3GTPK 2JA6K 1YX2A 3FKIA 1KQ4A 3S17C 4A3MK 3ADAC 5EGHA 1ZXOA 5FLMK 1R9TC 4Y7NK 4OIRA 2E2IK 1HI9A 3TFHA 4C2MC 4KB4A 4KM8A 2R92C 1AB4A 1I3QK 3OEPA 2Y0SD 1IQ0A 1IBAA 1TWAA 3GIRA 1I3QA 1XXCA 4YG2A 2JA8K 4Q4ZA 3H3VD 3HOZC 1WCMK 1F7VA 3I4MK 2R7ZK 3S16C 1K83A 3HOUK 4A3CK 5IYDC 3H0GK 1WORA 3GTQK 4A3DC 4C3HK 4WJ3M 4O2DA 2R93K 4A3LK 2V6TA 2JA7A 2R93A 3GTMC 3T01A 4Y52K 1PJ7A 2CFAB 3S1NC 3S15K 3GTPC 2JA6C 4GTDA 1TWHA 3L4KA 3HOYK 1O25A 3DXJA 4GTEA 5FLMC 3BP3A 1F7UA 4Y7NC 2E2IC 1F9NA 4QIWD 2NVTK 5M5XK
chains in the Genus database with same CATH topology
4A3EK 2E2HK 3PO2K 2O5JA 1YNJA 3H3VL 4BXXC 5IYCK 5C3EC 3HOXC 1TWHC 1HQMA 3RZDK 3S2DK 1XPPA 5IP7C 3HOYC 3GTLK 3S17K 1SMYA 2B63K 5C44C 2JA8C 2JA5C 3HKZL 3K7AK 4QJVA 3GTJC 3HOVC 2VUMC 2A6EA 1I6VA 1WCMC 4A3JK 1TWFC 3HOWC 3I4MC 3S1QK 1Y1WC 3S14C 3PO2C 2PPBA 4LJZA 3GTGC 1IW7A 2NVYC 5FJ8K 2NVXC 1TWCK 4C2MK 2A6HA 5C4JC 2R7ZC 4A93K 4BY7C 1TWGC 5M5WK 5IP9C 3FKIK 4KN4A 1I50C 1SFOK 2E2JC 2R92K 2A68A 3HOUC 3M3YC 4A3CC 3H0GC 3GTQC 2O5IA 5TMCA 2PA8D 4NOIA 4A3LC 4KMUA 3GTOC 4MEXA 3I4NK 2WB1D 1I6HC 5M3MK 4MEYA 4GZYA 2PMZL 4X6AC 3S1RC 4Y52C 3CQZK 4BY1K 3M4OK 4QIWL 3S1QC 4OIOA 4AYBD 3S15C 4XSZA 4LLGA 2WAQD 4A3GC 1TWCC 4G7HA 1TWAK 2A69A 3S16K 3S2HC 4A3BK 1R9TK 4KN7A 5IYDK 5M5YK 5C4XK 3S1MK 1Y1VC 4BBRC 4A3FC 4A3IK 2NVTC 4OIPA 4A3EC 1BDFA 2E2HC 4YFNA 3GTMK 3WODA 5IYCC 5IYBK 2NVQK 5TMFA 3M4OC 3S1NK 3RZDC 3GTPK 2JA6K 3S2DC 3RZOK 3GTLC 3S17C 4A3MK 1K83K 1YNNA 2B63C 4XLPA 5FLMK 1R9TC 3K7AC 4Y7NK 4OIRA 2JA7K 3HOZK 3GTKK 4XSXA 2E2IK 4Q5SA 2PA8L 4A3JC 2WB1L 4A93C 5C3EK 3HOXK 2R92C 1TWHK 3FKIC 4BBSC 1I3QK 1SFOC 2Y0SD 2CW0A 4QJVB 5IP7K 4AYBL 4A3DK 1ZYRA 4C3JK 4G7ZA 1K83C 2WAQL 4A3MC 4LK1A 4C3IK 4YG2A 5C44K 4XLNA 2JA5K 4OINA 4Q4ZA 2JA8K 3I4NC 3GTJK 5M3FK 2YU9K 4G7OA 3H3VD 3HOVK 2VUMK 3HOZC 1WCMK 4A3KK 3CQZC 4BY1C 3HOWK 3I4MK 1Y1WK 3S14K 3GTGK 4LK0A 2NVYK 4YFKA 2BE5A 2NVXK 4OIQA 5C4JK 2R7ZK 4BY7K 1TWAC 1TWGK 5IP9K 3M3YK 3HKZD 1I50K 1I3QC 2E2JK 3S16C 3HOUK 3PO3K 5IYDC 4A3BC 3H0GK 3GTQK 4A3CK 4A3DC 5C4XC 4C3HK 3S1MC 2R93K 4A3LK 3GTOK 4A3IC 4A3GK 1I6HK 2YU9C 4X6AK 3GTMC 5D4DA 4BXXK 3S1RK 4A3KC 4BBSK 4Y52K 4JK1A 5IYBC 2NVQC 3S1NC 3S15K 3GTPC 2JA6C 3HOYK 3RZOC 4YFXA 3EQLA 3DXJA 3S2HK 3PO3C 5FLMC 2PMZD 2Y0SL 4Y7NC 2JA7C 3GTKC 1Y1VK 4BBRK 2E2IC 4A3FK 2R93C 4QIWD 4MQ9A 2NVTK 1TWFK 5M5XK 4ZH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E K;  2E2H K;  3PO2 K;  2O5J A;  1YNJ A;  3H3V L;  4BXX C;  5IYC K;  5C3E C;  3HOX C;  1TWH C;  1HQM A;  3RZD K;  3S2D K;  1XPP A;  5IP7 C;  3HOY C;  3GTL K;  3S17 K;  1SMY A;  2B63 K;  5C44 C;  2JA8 C;  2JA5 C;  3HKZ L;  3K7A K;  4QJV A;  3GTJ C;  3HOV C;  2VUM C;  2A6E A;  1I6V A;  1WCM C;  4A3J K;  1TWF C;  3HOW C;  3I4M C;  3S1Q K;  1Y1W C;  3S14 C;  3PO2 C;  2PPB A;  4LJZ A;  3GTG C;  1IW7 A;  2NVY C;  5FJ8 K;  2NVX C;  1TWC K;  4C2M K;  2A6H A;  5C4J C;  2R7Z C;  4A93 K;  4BY7 C;  1TWG C;  5M5W K;  5IP9 C;  3FKI K;  4KN4 A;  1I50 C;  1SFO K;  2E2J C;  2R92 K;  2A68 A;  3HOU C;  3M3Y C;  4A3C C;  3H0G C;  3GTQ C;  2O5I A;  5TMC A;  2PA8 D;  4NOI A;  4A3L C;  4KMU A;  3GTO C;  4MEX A;  3I4N K;  2WB1 D;  1I6H C;  5M3M K;  4MEY A;  4GZY A;  2PMZ L;  4X6A C;  3S1R C;  4Y52 C;  3CQZ K;  4BY1 K;  3M4O K;  4QIW L;  3S1Q C;  4OIO A;  4AYB D;  3S15 C;  4XSZ A;  4LLG A;  2WAQ D;  4A3G C;  1TWC C;  4G7H A;  1TWA K;  2A69 A;  3S16 K;  3S2H C;  4A3B K;  1R9T K;  4KN7 A;  5IYD K;  5M5Y K;  5C4X K;  3S1M K;  1Y1V C;  4BBR C;  4A3F C;  4A3I K;  2NVT C;  4OIP A;  4A3E C;  1BDF A;  2E2H C;  4YFN A;  3GTM K;  3WOD A;  5IYC C;  5IYB K;  2NVQ K;  5TMF A;  3M4O C;  3S1N K;  3RZD C;  3GTP K;  2JA6 K;  3S2D C;  3RZO K;  3GTL C;  3S17 C;  4A3M K;  1K83 K;  1YNN A;  2B63 C;  4XLP A;  5FLM K;  1R9T C;  3K7A C;  4Y7N K;  4OIR A;  2JA7 K;  3HOZ K;  3GTK K;  4XSX A;  2E2I K;  4Q5S A;  2PA8 L;  4A3J C;  2WB1 L;  4A93 C;  5C3E K;  3HOX K;  2R92 C;  1TWH K;  3FKI C;  4BBS C;  1I3Q K;  1SFO C;  2Y0S D;  2CW0 A;  4QJV B;  5IP7 K;  4AYB L;  4A3D K;  1ZYR A;  4C3J K;  4G7Z A;  1K83 C;  2WAQ L;  4A3M C;  4LK1 A;  4C3I K;  4YG2 A;  5C44 K;  4XLN A;  2JA5 K;  4OIN A;  4Q4Z A;  2JA8 K;  3I4N C;  3GTJ K;  5M3F K;  2YU9 K;  4G7O A;  3H3V D;  3HOV K;  2VUM K;  3HOZ C;  1WCM K;  4A3K K;  3CQZ C;  4BY1 C;  3HOW K;  3I4M K;  1Y1W K;  3S14 K;  3GTG K;  4LK0 A;  2NVY K;  4YFK A;  2BE5 A;  2NVX K;  4OIQ A;  5C4J K;  2R7Z K;  4BY7 K;  1TWA C;  1TWG K;  5IP9 K;  3M3Y K;  3HKZ D;  1I50 K;  1I3Q C;  2E2J K;  3S16 C;  3HOU K;  3PO3 K;  5IYD C;  4A3B C;  3H0G K;  3GTQ K;  4A3C K;  4A3D C;  5C4X C;  4C3H K;  3S1M C;  2R93 K;  4A3L K;  3GTO K;  4A3I C;  4A3G K;  1I6H K;  2YU9 C;  4X6A K;  3GTM C;  5D4D A;  4BXX K;  3S1R K;  4A3K C;  4BBS K;  4Y52 K;  4JK1 A;  5IYB C;  2NVQ C;  3S1N C;  3S15 K;  3GTP C;  2JA6 C;  3HOY K;  3RZO C;  4YFX A;  3EQL A;  3DXJ A;  3S2H K;  3PO3 C;  5FLM C;  2PMZ D;  2Y0S L;  4Y7N C;  2JA7 C;  3GTK C;  1Y1V K;  4BBR K;  2E2I C;  4A3F K;  2R93 C;  4QIW D;  4MQ9 A;  2NVT K;  1TWF K;  5M5X K;  4ZH4 A; 
#chains in the Genus database with same CATH topology
 3PO2 K;  2W7V A;  4FM9 A;  4KMD A;  1YNJ A;  2EBB A;  5CHP A;  3RZD K;  3S2D K;  1TWG A;  1XPP A;  1I50 A;  1C0A A;  5IOQ A;  2JA8 C;  2P8T A;  3AD8 C;  3GTO A;  2A6E A;  1I6V A;  1WCM C;  4A3J K;  1TWF C;  3I4M C;  4AH6 A;  1IW7 A;  2R7Z C;  2A6H A;  1ISE A;  5M5W K;  4BBS K;  3GEI A;  1SFO K;  3HOU C;  4A3C C;  1DCH A;  3H0G C;  3GTQ C;  3Q3Q A;  3T00 A;  4A3L C;  2ZUE A;  4GFQ A;  1Y1V A;  2E2H A;  4Y52 C;  3CQZ K;  3N3Y A;  4DDQ A;  4BY1 K;  3S1Q C;  3V4G A;  3S15 C;  1XZP A;  1O28 A;  1INN A;  1R9T K;  1IS1 A;  1RU0 A;  1R9T A;  2NVT C;  3A8K A;  5EGE A;  1DCO A;  1L0W A;  2NVQ K;  1EK8 A;  3RZD C;  3GEH A;  3S2D C;  2R92 A;  2GSU A;  1YNN A;  4XLP A;  3HOZ K;  4Q5S A;  4A3J C;  5HL8 A;  2WB1 L;  3GDZ A;  3BP8 C;  4G0V A;  5IOT A;  4BBS C;  1SFO C;  3G4A A;  4C45 A;  4A3D K;  5IP7 K;  1ZYR A;  2JA5 K;  4G0U A;  3GTJ K;  4G7O A;  3HOV K;  1XXB A;  3CQZ C;  3LPX A;  4BY1 C;  3HOW K;  3GTM A;  1J6V A;  3TFJ A;  3GTG K;  2NVX K;  2ZUF A;  3GTP A;  2JA6 A;  1O2F B;  5IP9 K;  2D6F C;  1B4A A;  3AH5 A;  1I6H K;  2GAG C;  2E2I A;  4KB2 A;  3S1R K;  4A3K C;  3HXA A;  2NVQ C;  4KM9 A;  3PO3 C;  1XZQ A;  1J98 A;  4KAW X;  1PJ6 A;  1TWF K;  1WCM A;  3ORE A;  1WQG A;  3N0C A;  1TWF A;  2O5J A;  4BXX C;  1EI6 A;  3BUE A;  2R7Z A;  5IP7 C;  3IPJ A;  3H0G A;  3GTQ A;  4WIL A;  2JA5 C;  3HKZ L;  4LQY A;  4QJV A;  1J6W A;  3GTJ C;  3HOV C;  2KWA A;  1VRQ C;  1EH1 A;  1JQW A;  1WSV A;  3HOW C;  3S1Q K;  3LAP A;  1WOS A;  3GTG C;  1VH2 A;  4GZY A;  2NVX C;  4A93 K;  1X31 C;  4GTB A;  5IP9 C;  4P5A A;  2O5I A;  2WB1 D;  1I6H C;  4GTF A;  4LOW A;  1EQR A;  4MEY A;  2PMZ L;  3LAJ A;  3SZY A;  3S1R C;  1J6X A;  1USM A;  4XSZ A;  1TWC C;  2JH3 A;  2A69 A;  3S1M K;  4A3I K;  1VGX A;  1BDF A;  5JFE A;  4YFN A;  3WOD A;  1O29 A;  3AD9 C;  3AD7 C;  3M4O C;  2XCQ A;  1F93 A;  5L46 A;  1SFO A;  3N0B A;  4M1X A;  2XCR B;  3GTK K;  2XCO A;  2RH6 A;  3FOE A;  3CQZ A;  4A93 C;  1BJT A;  5C3E K;  3QX3 A;  2CW0 A;  1K83 C;  5E68 A;  4LK1 A;  5C44 K;  4XLN A;  1WOP A;  4OIN A;  5M3F K;  2VUM A;  4A3K K;  4P5B A;  1Y1W K;  4LK0 A;  2NVY K;  4OIQ A;  2BE5 A;  2V6U A;  4BY7 K;  4P9S A;  3FHZ A;  4XCH A;  3HKZ D;  2E2J K;  3PO3 K;  3T02 A;  4C3J C;  3S1M C;  4A3I C;  3TTG A;  2YU9 C;  1DCP A;  2V6S A;  4X6A K;  1XZP B;  4BXX K;  2GSO A;  4KMH A;  4YFX A;  3EQL A;  3S2H K;  2GSN A;  1JOE A;  2PMZ D;  2JA5 A;  4GT9 A;  1UV7 A;  3GTJ A;  3GTK C;  4A3F K;  5IYC K;  5C3E C;  3OPF A;  4BLB A;  3GTG A;  2NVX A;  1HQM A;  2P5M A;  3GTL K;  1SMY A;  2B63 K;  3G4C A;  5C44 C;  1IL2 A;  3K7A K;  1Y1W C;  2PPB A;  2NVY C;  5FJ8 K;  4BY7 C;  1TWC K;  3FKI K;  1TWC A;  2E2J C;  2A68 A;  3GSI A;  5TMC A;  4NOI A;  4KMU A;  4MEX A;  1BGW A;  1EFW A;  3I4N K;  5M3M K;  3AQO A;  4X6A C;  5IOR A;  3M4O K;  2ZFZ A;  4OIO A;  2RGR A;  1ZVU A;  4LLG A;  4A3G C;  4PAA A;  1WOO A;  4KMA A;  1TWA K;  3S2H C;  4KAS A;  4A3B K;  2CFA A;  1USO A;  4KAR A;  5C4X K;  1O24 A;  4A3F C;  5IYC C;  1XXA A;  5IYB K;  5TMF A;  1XZQ B;  3RZO K;  1PJ5 A;  3GTL C;  1O27 A;  1K83 K;  4WJ4 A;  2B63 C;  4GTC A;  1O26 A;  3VA7 A;  3K7A C;  2JA7 K;  4XSX A;  2PA8 L;  5TJ3 A;  3AQP A;  1V5V A;  1VLO A;  3HOX K;  1TWH K;  3FKI C;  4QJV B;  4AYB L;  4GTA A;  4C3J K;  4G7Z A;  1WQH A;  2WAQ L;  4A3M C;  4C3I K;  3I4N C;  2YU9 K;  2VUM K;  1ZBS A;  4FZB A;  2YU9 A;  4ILD A;  3S14 K;  4RMF A;  3ERE D;  4YFK A;  5C4J K;  1TWA C;  1TWG K;  3M3Y K;  4A3B C;  1I50 K;  1I3Q C;  4J3N A;  5C4X C;  3GTO K;  1BS2 A;  3GTK A;  1B4B A;  3NUH A;  5D4D A;  4JK1 A;  5IYB C;  3S0X A;  1ZQ1 C;  3RZO C;  3GEE A;  1WSR A;  2Y0S L;  2JA7 C;  4KAT A;  4C3H C;  4BLA A;  5CJ9 A;  1Y1V K;  4BBR K;  2R93 C;  4MQ9 A;  4ZH4 A;  4A3E K;  1IE0 A;  2E2H K;  1WQF A;  2FQT A;  3H3V L;  1Y1W A;  2NVY A;  3HOX C;  1TWH C;  4LR2 A;  3HOY C;  3S17 K;  5IOS A;  3CAG A;  4C3I C;  2GAH C;  5JVO A;  2PHC B;  2VUM C;  1DD5 A;  4PAB A;  3S14 C;  3PO2 C;  4LJZ A;  4A3G K;  3TFI A;  4C2M K;  5C4J C;  1WIH A;  1TWG C;  2R92 K;  1O2A A;  4KN4 A;  3M3Y C;  1I50 C;  3L4J A;  2PA8 D;  4KDD A;  4KC6 A;  3GTO C;  4GTL A;  2Y3P A;  3FOF A;  4G0W A;  1VJE A;  1JVI A;  3A8I A;  4BKW A;  2FQO A;  4QIW L;  4AYB D;  2WAQ D;  3SZZ A;  4G7H A;  1O2B A;  3A8J A;  3S16 K;  3GTL A;  3MML B;  4KN7 A;  5IYD K;  2B63 A;  5M5Y K;  1Y1V C;  4BBR C;  1G51 A;  4OIP A;  4A3E C;  2E2H C;  3JST A;  1YCL A;  3GTM K;  1GE9 A;  3S1N K;  3GTP K;  2JA6 K;  1YX2 A;  3FKI A;  1KQ4 A;  3S17 C;  4A3M K;  3ADA C;  5EGH A;  1ZXO A;  5FLM K;  1R9T C;  4Y7N K;  4OIR A;  2E2I K;  1HI9 A;  3TFH A;  4C2M C;  4KB4 A;  4KM8 A;  2R92 C;  1AB4 A;  1I3Q K;  3OEP A;  2Y0S D;  1IQ0 A;  1IBA A;  1TWA A;  3GIR A;  1I3Q A;  1XXC A;  4YG2 A;  2JA8 K;  4Q4Z A;  3H3V D;  3HOZ C;  1WCM K;  1F7V A;  3I4M K;  2R7Z K;  3S16 C;  1K83 A;  3HOU K;  4A3C K;  5IYD C;  3H0G K;  1WOR A;  3GTQ K;  4A3D C;  4C3H K;  4WJ3 M;  4O2D A;  2R93 K;  4A3L K;  2V6T A;  2JA7 A;  2R93 A;  3GTM C;  3T01 A;  4Y52 K;  1PJ7 A;  2CFA B;  3S1N C;  3S15 K;  3GTP C;  2JA6 C;  4GTD A;  1TWH A;  3L4K A;  3HOY K;  1O25 A;  3DXJ A;  4GTE A;  5FLM C;  3BP3 A;  1F7U A;  4Y7N C;  2E2I C;  1F9N A;  4QIW D;  2NVT K;  5M5X K; 
#chains in the Genus database with same CATH homology
 4A3E K;  2E2H K;  3PO2 K;  2O5J A;  1YNJ A;  3H3V L;  4BXX C;  5IYC K;  5C3E C;  3HOX C;  1TWH C;  1HQM A;  3RZD K;  3S2D K;  1XPP A;  5IP7 C;  3HOY C;  3GTL K;  3S17 K;  1SMY A;  2B63 K;  5C44 C;  2JA8 C;  2JA5 C;  3HKZ L;  3K7A K;  4QJV A;  3GTJ C;  3HOV C;  2VUM C;  2A6E A;  1I6V A;  1WCM C;  4A3J K;  1TWF C;  3HOW C;  3I4M C;  3S1Q K;  1Y1W C;  3S14 C;  3PO2 C;  2PPB A;  4LJZ A;  3GTG C;  1IW7 A;  2NVY C;  5FJ8 K;  2NVX C;  1TWC K;  4C2M K;  2A6H A;  5C4J C;  2R7Z C;  4A93 K;  4BY7 C;  1TWG C;  5M5W K;  5IP9 C;  3FKI K;  4KN4 A;  1I50 C;  1SFO K;  2E2J C;  2R92 K;  2A68 A;  3HOU C;  3M3Y C;  4A3C C;  3H0G C;  3GTQ C;  2O5I A;  5TMC A;  2PA8 D;  4NOI A;  4A3L C;  4KMU A;  3GTO C;  4MEX A;  3I4N K;  2WB1 D;  1I6H C;  5M3M K;  4MEY A;  4GZY A;  2PMZ L;  4X6A C;  3S1R C;  4Y52 C;  3CQZ K;  4BY1 K;  3M4O K;  4QIW L;  3S1Q C;  4OIO A;  4AYB D;  3S15 C;  4XSZ A;  4LLG A;  2WAQ D;  4A3G C;  1TWC C;  4G7H A;  1TWA K;  2A69 A;  3S16 K;  3S2H C;  4A3B K;  1R9T K;  4KN7 A;  5IYD K;  5M5Y K;  5C4X K;  3S1M K;  1Y1V C;  4BBR C;  4A3F C;  4A3I K;  2NVT C;  4OIP A;  4A3E C;  1BDF A;  2E2H C;  4YFN A;  3GTM K;  3WOD A;  5IYC C;  5IYB K;  2NVQ K;  5TMF A;  3M4O C;  3S1N K;  3RZD C;  3GTP K;  2JA6 K;  3S2D C;  3RZO K;  3GTL C;  3S17 C;  4A3M K;  1K83 K;  1YNN A;  2B63 C;  4XLP A;  5FLM K;  1R9T C;  3K7A C;  4Y7N K;  4OIR A;  2JA7 K;  3HOZ K;  3GTK K;  4XSX A;  2E2I K;  4Q5S A;  2PA8 L;  4A3J C;  2WB1 L;  4A93 C;  5C3E K;  3HOX K;  2R92 C;  1TWH K;  3FKI C;  4BBS C;  1I3Q K;  1SFO C;  2Y0S D;  2CW0 A;  4QJV B;  5IP7 K;  4AYB L;  4A3D K;  1ZYR A;  4C3J K;  4G7Z A;  1K83 C;  2WAQ L;  4A3M C;  4LK1 A;  4C3I K;  4YG2 A;  5C44 K;  4XLN A;  2JA5 K;  4OIN A;  4Q4Z A;  2JA8 K;  3I4N C;  3GTJ K;  5M3F K;  2YU9 K;  4G7O A;  3H3V D;  3HOV K;  2VUM K;  3HOZ C;  1WCM K;  4A3K K;  3CQZ C;  4BY1 C;  3HOW K;  3I4M K;  1Y1W K;  3S14 K;  3GTG K;  4LK0 A;  2NVY K;  4YFK A;  2BE5 A;  2NVX K;  4OIQ A;  5C4J K;  2R7Z K;  4BY7 K;  1TWA C;  1TWG K;  5IP9 K;  3M3Y K;  3HKZ D;  1I50 K;  1I3Q C;  2E2J K;  3S16 C;  3HOU K;  3PO3 K;  5IYD C;  4A3B C;  3H0G K;  3GTQ K;  4A3C K;  4A3D C;  5C4X C;  4C3H K;  3S1M C;  2R93 K;  4A3L K;  3GTO K;  4A3I C;  4A3G K;  1I6H K;  2YU9 C;  4X6A K;  3GTM C;  5D4D A;  4BXX K;  3S1R K;  4A3K C;  4BBS K;  4Y52 K;  4JK1 A;  5IYB C;  2NVQ C;  3S1N C;  3S15 K;  3GTP C;  2JA6 C;  3HOY K;  3RZO C;  4YFX A;  3EQL A;  3DXJ A;  3S2H K;  3PO3 C;  5FLM C;  2PMZ D;  2Y0S L;  4Y7N C;  2JA7 C;  3GTK C;  1Y1V K;  4BBR K;  2E2I C;  4A3F K;  2R93 C;  4QIW D;  4MQ9 A;  2NVT K;  1TWF K;  5M5X K;  4ZH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...