3GTQK

Backtracked rna polymerase ii complex induced by damage
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna-rna hybrid
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtqK00
1I6VA 3HOWK 3HOWC 4A3CK 4A3CC 3HOVK 3HOVC 4BBRC 4BBRK 4JK1A 3PO3C 3PO3K 4XLNA 3S17K 3S17C 4C3HK 3S2DK 3S2DC 4A3MK 4A3MC 2R7ZC 2R7ZK 1ZYRA 3GTOC 3GTOK 2BE5A 5C4JK 5C4JC 4A3KK 4A3KC 3RZDC 3RZDK 4A3DC 5IP7C 5IP7K 2JA6K 2JA6C 4A3DK 1R9TK 3FKIK 3FKIC 1R9TC 3GTKC 3GTKK 2NVQC 2NVQK 3S1MK 3S1MC 2YU9K 2YU9C 3GTMC 3GTMK 3S1RC 2WAQD 3S1RK 3RZOC 3RZOK 3S1NK 3S1NC 2O5JA 3S15K 3S15C 4YFKA 3GTGC 3S1QC 2B63C 3DXJA 4C3IK 3S1QK 4XSXA 1I6HK 1I6HC 3M3YC 3M3YK 5M5WK 4OIPA 1TWAC 1TWAK 4QIWD 2Y0SD 4MEYA 4AYBD 3WODA 5IYCK 5IYCC 2E2HC 3K7AC 3K7AK 4MEXA 2E2HK 2PMZD 3CQZK 3CQZC 4X6AK 5FLMK 5FLMC 4X6AC 4NOIA 3H3VD 1TWHK 1TWHC 3HOYK 3HOYC 4KN7A 4LLGA 2NVXC 5M5XK 2NVXK 2JA7K 2JA7C 2JA8C 4XSZA 5D4DA 2JA8K 4A93K 4A93C 3S14K 3S14C 4YG2A 4OIRA 2A68A 5C44K 1K83C 1K83K 5M3MK 5C44C 4BBSC 1YNNA 4BBSK 2R93C 2R93K 3HKZD 5IYDC 5IYDK 4A3FK 4A3FC 3HOUC 3HOUK 3GTJC 3GTJK 4QJVB 4QIWL 4KN4A 4Q4ZA 4MQ9A 4A3GK 4C3JK 4A3GC 5M5YK 1YNJA 2NVYK 2NVYC 5TMCA 3GTPK 1SMYA 2PMZL 2E2IC 2E2IK 4A3JK 4A3JC 1IW7A 1TWFC 1TWFK 3H3VL 3GTQK 3GTQC 4BXXC 4BXXK 4KMUA 4Y7NC 4Y7NK 1HQMA 5M3FK 4BY1K 4BY1C 2A6EA 2Y0SL 2WAQL 4AYBL 1TWCK 1TWCC 4OIOA 4QJVA 3HOXC 3HOXK 2VUMK 4G7ZA 2VUMC 3S2HK 3S2HC 4G7OA 4A3BC 4A3BK 4OIQA 3I4MK 3I4NK 3I4MC 3I4NC 2WB1L 1Y1VC 1Y1VK 3H0GC 3H0GK 4A3IK 4A3IC 2A6HA 2R92K 2WB1D 2R92C 3HOZC 3HOZK 4ZH4A 3GTLK 5IP9K 5IP9C 3GTLC 2PA8D 4BY7C 4BY7K 1I50K 1I50C 2JA5C 2JA5K 4G7HA 4LK0A 4LK1A 4A3EK 5C3EK 5C3EC 4A3EC 3M4OC 5TMFA 3M4OK 4LJZA 2E2JK 1XPPA 1TWGK 1TWGC 5FJ8K 1Y1WK 3HKZL 4Y52C 1Y1WC 2E2JC 3GTPC 4Y52K 3PO2C 3PO2K 5IYBK 5IYBC 1SFOK 1SFOC 2PA8L 4A3LK 4A3LC 1WCMK 1WCMC 4OINA 2CW0A 4YFNA 4XLPA 4GZYA 2O5IA 5C4XK 3S16K 3S16C 5C4XC 2NVTK 2NVTC 1BDFA 1I3QC 1I3QK 4C2MK 4YFXA 2B63K 3GTGK 4Q5SA 3EQLA 2A69A 2PPBA
chains in the Genus database with same CATH superfamily
4DDQA 3A8JA 3S2DK 1ZYRA 4A3KK 3RZDC 1IS1A 1VGXA 1ZQ1C 5IP7C 4A3DC 3FKIC 3S1MC 2NVQK 3S1RK 3RZOK 5JFEA 3T02A 1USMA 2O5JA 1BGWA 3Q3QA 3S15K 1WOSA 4LOWA 4XSXA 3M3YK 5M5WK 4OIPA 3AD8C 2GSOA 4GTDA 2V6UA 1O26A 2E2HC 5E68A 5EGEA 2PMZD 1XZQA 3CQZK 4XCHA 4X6AK 5FLMK 3FOEA 1TWHC 3HOYC 4KN7A 4LLGA 5CHPA 2NVXK 2JA7C 2JA8K 5D4DA 2D6FC 3S14C 1WSRA 4YG2A 5C44K 1K83C 4BBSK 2R93K 1O25A 5IYDC 4A3FK 3GTJK 2B63A 4KDDA 1F7UA 4QIWL 4KN4A 1PJ7A 3AQPA 1TWCA 5IORA 5M5YK 1JOEA 2NVYC 1IBAA 3GTQK 4M1XA 4BY1C 2P8TA 2WAQL 4OIOA 1IE0A 3NUHA 2XCQA 4G7ZA 3S2HC 4G7OA 4A3BK 3I4MC 1TWGA 1Y1VK 3BP8C 2P5MA 3H0GC 4A3IK 3N0CA 1TWAA 1EH1A 1O2AA 5C3EK 1ISEA 3M4OC 2GAGC 1VH2A 5TMFA 3ADAC 2E2JK 1XPPA 1Y1WK 4KMDA 3HKZL 4Y52K 2R92A 3PO2C 1DCHA 3HXAA 3IPJA 4A3LC 1GE9A 3A8IA 3V4GA 4KM8A 4BLAA 3S16K 1BDFA 1VRQC 2RH6A 1USOA 5EGHA 3GTGC 1JQWA 1R9TA 2A69A 3GTJA 4A3CK 3HOVK 4BKWA 4BBRC 4JK1A 3PO3K 1ZVUA 4KC6A 4XLNA 3S17C 4C3HC 4J3NA 4A3MC 2R7ZK 1O2BA 1I3QA 3CAGA 2BE5A 4A3KC 2E2IA 5IP7K 3GTKC 1RU0A 1VJEA 2PHCB 3GTMC 3AD9C 2WAQD 3S1NC 2XCRB 1XXBA 4KASA 3S15C 3DXJA 4C3IK 1I6HK 2JA6A 1XZPA 2XCOA 2CFAB 3M3YC 1I50A 3GIRA 1O2FB 3LAPA 4GTAA 2JA5A 4QIWD 2Y0SD 4GTEA 4C45A 5IYCC 2R93A 3K7AK 3CQZC 3TTGA 4X6AC 1J98A 1SFOA 2RGRA 3H3VD 1TWHK 1WCMA 2NVXC 2JA7K 1X31C 2W7VA 4XSZA 2JA8C 3AQOA 4A93C 3S14K 4OIRA 5C44C 4BBSC 1YNNA 1C0AA 2Y3PA 5IYDK 4QJVB 4GTCA 4C3JK 1YNJA 2NVYK 3GTOA 2E2IK 5TJ3A 4BXXC 4KMUA 4Y7NC 5M3FK 3T01A 2Y0SL 4AYBL 1TWCK 4KMAA 3HOXC 4WJ3M 3I4NC 3I4MK 2ZFZA 1Y1WA 1Y1VC 3H0GK 4A3IC 5JVOA 3GTQA 5IP9C 4BY7C 3QX3A 1I50K 1DCOA 2JA5K 3BUEA 4G7HA 4LK0A 4LK1A 4A3EC 5C3EC 1XXCA 1O27A 3OPFA 1TWGK 4Y52C 3GTLA 4A3LK 4FZBA 1WCMK 1TWHA 4OINA 4PAAA 2JA7A 1J6XA 2O5IA 3S16C 2NVTC 3GTPA 3AD7C 3TFIA 1EI6A 4C2MC 4G0UA 1O24A 1G51A 4Q5SA 3GTGK 3SZYA 2PPBA 1WIHA 4A3CC 3HOWK 3HOVC 4BBRK 3PO3C 3S17K 4C3HK 4A3MK 2GSUA 2R7ZC 1BJTA 3GTOK 5C4JC 2JA6K 1TWFA 1R9TK 3GTKK 2YU9C 3GTMK 2FQTA 2VUMA 3S1NK 2KWAA 1O28A 3S1QC 4C3IC 3H0GA 4GTBA 1I6HC 3G4AA 1V5VA 1UV7A 3FKIA 3GEIA 1WOOA 3GSIA 1TWAC 4AYBD 4KM9A 5IYCK 1K83A 3K7AC 1O29A 4KB2A 4NOIA 1WQHA 2V6TA 4A93K 2A68A 5M3MK 5HL8A 2E2HA 3HKZD 3HOUK 2ZUEA 4A3GK 4C3JC 5IOQA 2EBBA 4LR2A 5TMCA 4GTFA 4KATA 1DD5A 2E2IC 4A3JC 4P9SA 1TWFK 3BP3A 3H3VL 4BXXK 1AB4A 4Y7NK 1HQMA 2A6EA 3OEPA 1TWCC 2VUMK 4WJ4A 4LQYA 3HOXK 3TFHA 2NVYA 3I4NK 4GT9A 2WB1L 4KAWX 2R92C 2WB1D 1J6WA 3HOZK 3A8KA 4ZH4A 3GTLK 5IP9K 4BY7K 1I50C 4BLBA 3S0XA 2JA5C 4A3EK 1B4AA 4KARA 4P5AA 1TWGC 3GTPK 5L46A 1PJ5A 5IYBK 1SFOK 4GTLA 1WCMC 3JSTA 4XLPA 1F9NA 1DCPA 4GZYA 5C4XC 1WSVA 2NVTK 3FHZA 1L0WA 2CFAA 1I3QC 4C2MK 3G4CA 4YFXA 5IOSA 3OREA 2B63K 5FJ8K 2B63C 4O2DA 1I6VA 3HOWC 4GFQA 5CJ9A 1WOPA 3S2DC 3GTOC 5C4JK 1BS2A 4AH6A 3RZDK 4A3DK 3FOFA 2JA6C 1R9TC 3FKIK 3S1MK 2NVQC 2YU9K 3GDZA 3S1RC 3RZOC 3N3YA 1YCLA 4YFKA 4PABA 4ILDA 3S1QK 1Y1VA 1ZXOA 3CQZA 3GTKA 1IL2A 3GTMA 1TWAK 3L4KA 1F93A 1YX2A 4MEYA 3WODA 3ERED 3T00A 3VA7A 1XZPB 1IQ0A 2E2HK 4MEXA 3AH5A 1VLOA 5FLMC 3LPXA 4KB4A 3HOYK 3GEEA 5IOTA 5M5XK 3LAJA 1K83K 1EK8A 2R93C 3GTGA 4A3FC 3HOUC 4G0VA 3GTJC 2NVXA 4FM9A 4Q4ZA 4WILA 4MQ9A 3GEHA 4A3GC 1SMYA 2R7ZA 1J6VA 2V6SA 2JH3A 4P5BA 2PMZL 4A3JK 1TWFC 3GTQC 1WORA 3N0BA 4BY1K 1WQGA 2YU9A 3MMLB 2VUMC 4QJVA 1HI9A 1PJ6A 3S2HK 4A3BC 3SZZA 4OIQA 1EQRA 1ZBSA 2A6HA 2R92K 3TFJA 3L4JA 3HOZC 1WQFA 3GTLC 2PA8D 1XXAA 1JVIA 3M4OK 4LJZA 2E2JC 3GTPC 1Y1WC 4RMFA 2ZUFA 1XZQB 2GSNA 3PO2K 5IYBC 1SFOC 1B4BA 2PA8L 4KMHA 2CW0A 2FQOA 4YFNA 5C4XK 1INNA 1EFWA 1KQ4A 1I3QK 4G0WA 1F7VA 3EQLA 2GAHC 1IW7A
chains in the Genus database with same CATH topology
1I6VA 3HOWK 3HOWC 4A3CK 4A3CC 3HOVK 3HOVC 4BBRC 4BBRK 4JK1A 3PO3C 3PO3K 4XLNA 3S17K 3S17C 4C3HK 3S2DK 3S2DC 4A3MK 4A3MC 2R7ZC 2R7ZK 1ZYRA 3GTOC 3GTOK 2BE5A 5C4JK 5C4JC 4A3KK 4A3KC 3RZDC 3RZDK 4A3DC 5IP7C 5IP7K 2JA6K 2JA6C 4A3DK 1R9TK 3FKIK 3FKIC 1R9TC 3GTKC 3GTKK 2NVQC 2NVQK 3S1MK 3S1MC 2YU9K 2YU9C 3GTMC 3GTMK 3S1RC 2WAQD 3S1RK 3RZOC 3RZOK 3S1NK 3S1NC 2O5JA 3S15K 3S15C 4YFKA 3GTGC 3S1QC 2B63C 3DXJA 4C3IK 3S1QK 4XSXA 1I6HK 1I6HC 3M3YC 3M3YK 5M5WK 4OIPA 1TWAC 1TWAK 4QIWD 2Y0SD 4MEYA 4AYBD 3WODA 5IYCK 5IYCC 2E2HC 3K7AC 3K7AK 4MEXA 2E2HK 2PMZD 3CQZK 3CQZC 4X6AK 5FLMK 5FLMC 4X6AC 4NOIA 3H3VD 1TWHK 1TWHC 3HOYK 3HOYC 4KN7A 4LLGA 2NVXC 5M5XK 2NVXK 2JA7K 2JA7C 2JA8C 4XSZA 5D4DA 2JA8K 4A93K 4A93C 3S14K 3S14C 4YG2A 4OIRA 2A68A 5C44K 1K83C 1K83K 5M3MK 5C44C 4BBSC 1YNNA 4BBSK 2R93C 2R93K 3HKZD 5IYDC 5IYDK 4A3FK 4A3FC 3HOUC 3HOUK 3GTJC 3GTJK 4QJVB 4QIWL 4KN4A 4Q4ZA 4MQ9A 4A3GK 4C3JK 4A3GC 5M5YK 1YNJA 2NVYK 2NVYC 5TMCA 3GTPK 1SMYA 2PMZL 2E2IC 2E2IK 4A3JK 4A3JC 1IW7A 1TWFC 1TWFK 3H3VL 3GTQK 3GTQC 4BXXC 4BXXK 4KMUA 4Y7NC 4Y7NK 1HQMA 5M3FK 4BY1K 4BY1C 2A6EA 2Y0SL 2WAQL 4AYBL 1TWCK 1TWCC 4OIOA 4QJVA 3HOXC 3HOXK 2VUMK 4G7ZA 2VUMC 3S2HK 3S2HC 4G7OA 4A3BC 4A3BK 4OIQA 3I4MK 3I4NK 3I4MC 3I4NC 2WB1L 1Y1VC 1Y1VK 3H0GC 3H0GK 4A3IK 4A3IC 2A6HA 2R92K 2WB1D 2R92C 3HOZC 3HOZK 4ZH4A 3GTLK 5IP9K 5IP9C 3GTLC 2PA8D 4BY7C 4BY7K 1I50K 1I50C 2JA5C 2JA5K 4G7HA 4LK0A 4LK1A 4A3EK 5C3EK 5C3EC 4A3EC 3M4OC 5TMFA 3M4OK 4LJZA 2E2JK 1XPPA 1TWGK 1TWGC 5FJ8K 1Y1WK 3HKZL 4Y52C 1Y1WC 2E2JC 3GTPC 4Y52K 3PO2C 3PO2K 5IYBK 5IYBC 1SFOK 1SFOC 2PA8L 4A3LK 4A3LC 1WCMK 1WCMC 4OINA 2CW0A 4YFNA 4XLPA 4GZYA 2O5IA 5C4XK 3S16K 3S16C 5C4XC 2NVTK 2NVTC 1BDFA 1I3QC 1I3QK 4C2MK 4YFXA 2B63K 3GTGK 4Q5SA 3EQLA 2A69A 2PPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6V A;  3HOW K;  3HOW C;  4A3C K;  4A3C C;  3HOV K;  3HOV C;  4BBR C;  4BBR K;  4JK1 A;  3PO3 C;  3PO3 K;  4XLN A;  3S17 K;  3S17 C;  4C3H K;  3S2D K;  3S2D C;  4A3M K;  4A3M C;  2R7Z C;  2R7Z K;  1ZYR A;  3GTO C;  3GTO K;  2BE5 A;  5C4J K;  5C4J C;  4A3K K;  4A3K C;  3RZD C;  3RZD K;  4A3D C;  5IP7 C;  5IP7 K;  2JA6 K;  2JA6 C;  4A3D K;  1R9T K;  3FKI K;  3FKI C;  1R9T C;  3GTK C;  3GTK K;  2NVQ C;  2NVQ K;  3S1M K;  3S1M C;  2YU9 K;  2YU9 C;  3GTM C;  3GTM K;  3S1R C;  2WAQ D;  3S1R K;  3RZO C;  3RZO K;  3S1N K;  3S1N C;  2O5J A;  3S15 K;  3S15 C;  4YFK A;  3GTG C;  3S1Q C;  2B63 C;  3DXJ A;  4C3I K;  3S1Q K;  4XSX A;  1I6H K;  1I6H C;  3M3Y C;  3M3Y K;  5M5W K;  4OIP A;  1TWA C;  1TWA K;  4QIW D;  2Y0S D;  4MEY A;  4AYB D;  3WOD A;  5IYC K;  5IYC C;  2E2H C;  3K7A C;  3K7A K;  4MEX A;  2E2H K;  2PMZ D;  3CQZ K;  3CQZ C;  4X6A K;  5FLM K;  5FLM C;  4X6A C;  4NOI A;  3H3V D;  1TWH K;  1TWH C;  3HOY K;  3HOY C;  4KN7 A;  4LLG A;  2NVX C;  5M5X K;  2NVX K;  2JA7 K;  2JA7 C;  2JA8 C;  4XSZ A;  5D4D A;  2JA8 K;  4A93 K;  4A93 C;  3S14 K;  3S14 C;  4YG2 A;  4OIR A;  2A68 A;  5C44 K;  1K83 C;  1K83 K;  5M3M K;  5C44 C;  4BBS C;  1YNN A;  4BBS K;  2R93 C;  2R93 K;  3HKZ D;  5IYD C;  5IYD K;  4A3F K;  4A3F C;  3HOU C;  3HOU K;  3GTJ C;  3GTJ K;  4QJV B;  4QIW L;  4KN4 A;  4Q4Z A;  4MQ9 A;  4A3G K;  4C3J K;  4A3G C;  5M5Y K;  1YNJ A;  2NVY K;  2NVY C;  5TMC A;  3GTP K;  1SMY A;  2PMZ L;  2E2I C;  2E2I K;  4A3J K;  4A3J C;  1IW7 A;  1TWF C;  1TWF K;  3H3V L;  3GTQ K;  3GTQ C;  4BXX C;  4BXX K;  4KMU A;  4Y7N C;  4Y7N K;  1HQM A;  5M3F K;  4BY1 K;  4BY1 C;  2A6E A;  2Y0S L;  2WAQ L;  4AYB L;  1TWC K;  1TWC C;  4OIO A;  4QJV A;  3HOX C;  3HOX K;  2VUM K;  4G7Z A;  2VUM C;  3S2H K;  3S2H C;  4G7O A;  4A3B C;  4A3B K;  4OIQ A;  3I4M K;  3I4N K;  3I4M C;  3I4N C;  2WB1 L;  1Y1V C;  1Y1V K;  3H0G C;  3H0G K;  4A3I K;  4A3I C;  2A6H A;  2R92 K;  2WB1 D;  2R92 C;  3HOZ C;  3HOZ K;  4ZH4 A;  3GTL K;  5IP9 K;  5IP9 C;  3GTL C;  2PA8 D;  4BY7 C;  4BY7 K;  1I50 K;  1I50 C;  2JA5 C;  2JA5 K;  4G7H A;  4LK0 A;  4LK1 A;  4A3E K;  5C3E K;  5C3E C;  4A3E C;  3M4O C;  5TMF A;  3M4O K;  4LJZ A;  2E2J K;  1XPP A;  1TWG K;  1TWG C;  5FJ8 K;  1Y1W K;  3HKZ L;  4Y52 C;  1Y1W C;  2E2J C;  3GTP C;  4Y52 K;  3PO2 C;  3PO2 K;  5IYB K;  5IYB C;  1SFO K;  1SFO C;  2PA8 L;  4A3L K;  4A3L C;  1WCM K;  1WCM C;  4OIN A;  2CW0 A;  4YFN A;  4XLP A;  4GZY A;  2O5I A;  5C4X K;  3S16 K;  3S16 C;  5C4X C;  2NVT K;  2NVT C;  1BDF A;  1I3Q C;  1I3Q K;  4C2M K;  4YFX A;  2B63 K;  3GTG K;  4Q5S A;  3EQL A;  2A69 A;  2PPB A; 
#chains in the Genus database with same CATH topology
 4DDQ A;  3A8J A;  3S2D K;  1ZYR A;  4A3K K;  3RZD C;  1IS1 A;  1VGX A;  1ZQ1 C;  5IP7 C;  4A3D C;  3FKI C;  3S1M C;  2NVQ K;  3S1R K;  3RZO K;  5JFE A;  3T02 A;  1USM A;  2O5J A;  1BGW A;  3Q3Q A;  3S15 K;  1WOS A;  4LOW A;  4XSX A;  3M3Y K;  5M5W K;  4OIP A;  3AD8 C;  2GSO A;  4GTD A;  2V6U A;  1O26 A;  2E2H C;  5E68 A;  5EGE A;  2PMZ D;  1XZQ A;  3CQZ K;  4XCH A;  4X6A K;  5FLM K;  3FOE A;  1TWH C;  3HOY C;  4KN7 A;  4LLG A;  5CHP A;  2NVX K;  2JA7 C;  2JA8 K;  5D4D A;  2D6F C;  3S14 C;  1WSR A;  4YG2 A;  5C44 K;  1K83 C;  4BBS K;  2R93 K;  1O25 A;  5IYD C;  4A3F K;  3GTJ K;  2B63 A;  4KDD A;  1F7U A;  4QIW L;  4KN4 A;  1PJ7 A;  3AQP A;  1TWC A;  5IOR A;  5M5Y K;  1JOE A;  2NVY C;  1IBA A;  3GTQ K;  4M1X A;  4BY1 C;  2P8T A;  2WAQ L;  4OIO A;  1IE0 A;  3NUH A;  2XCQ A;  4G7Z A;  3S2H C;  4G7O A;  4A3B K;  3I4M C;  1TWG A;  1Y1V K;  3BP8 C;  2P5M A;  3H0G C;  4A3I K;  3N0C A;  1TWA A;  1EH1 A;  1O2A A;  5C3E K;  1ISE A;  3M4O C;  2GAG C;  1VH2 A;  5TMF A;  3ADA C;  2E2J K;  1XPP A;  1Y1W K;  4KMD A;  3HKZ L;  4Y52 K;  2R92 A;  3PO2 C;  1DCH A;  3HXA A;  3IPJ A;  4A3L C;  1GE9 A;  3A8I A;  3V4G A;  4KM8 A;  4BLA A;  3S16 K;  1BDF A;  1VRQ C;  2RH6 A;  1USO A;  5EGH A;  3GTG C;  1JQW A;  1R9T A;  2A69 A;  3GTJ A;  4A3C K;  3HOV K;  4BKW A;  4BBR C;  4JK1 A;  3PO3 K;  1ZVU A;  4KC6 A;  4XLN A;  3S17 C;  4C3H C;  4J3N A;  4A3M C;  2R7Z K;  1O2B A;  1I3Q A;  3CAG A;  2BE5 A;  4A3K C;  2E2I A;  5IP7 K;  3GTK C;  1RU0 A;  1VJE A;  2PHC B;  3GTM C;  3AD9 C;  2WAQ D;  3S1N C;  2XCR B;  1XXB A;  4KAS A;  3S15 C;  3DXJ A;  4C3I K;  1I6H K;  2JA6 A;  1XZP A;  2XCO A;  2CFA B;  3M3Y C;  1I50 A;  3GIR A;  1O2F B;  3LAP A;  4GTA A;  2JA5 A;  4QIW D;  2Y0S D;  4GTE A;  4C45 A;  5IYC C;  2R93 A;  3K7A K;  3CQZ C;  3TTG A;  4X6A C;  1J98 A;  1SFO A;  2RGR A;  3H3V D;  1TWH K;  1WCM A;  2NVX C;  2JA7 K;  1X31 C;  2W7V A;  4XSZ A;  2JA8 C;  3AQO A;  4A93 C;  3S14 K;  4OIR A;  5C44 C;  4BBS C;  1YNN A;  1C0A A;  2Y3P A;  5IYD K;  4QJV B;  4GTC A;  4C3J K;  1YNJ A;  2NVY K;  3GTO A;  2E2I K;  5TJ3 A;  4BXX C;  4KMU A;  4Y7N C;  5M3F K;  3T01 A;  2Y0S L;  4AYB L;  1TWC K;  4KMA A;  3HOX C;  4WJ3 M;  3I4N C;  3I4M K;  2ZFZ A;  1Y1W A;  1Y1V C;  3H0G K;  4A3I C;  5JVO A;  3GTQ A;  5IP9 C;  4BY7 C;  3QX3 A;  1I50 K;  1DCO A;  2JA5 K;  3BUE A;  4G7H A;  4LK0 A;  4LK1 A;  4A3E C;  5C3E C;  1XXC A;  1O27 A;  3OPF A;  1TWG K;  4Y52 C;  3GTL A;  4A3L K;  4FZB A;  1WCM K;  1TWH A;  4OIN A;  4PAA A;  2JA7 A;  1J6X A;  2O5I A;  3S16 C;  2NVT C;  3GTP A;  3AD7 C;  3TFI A;  1EI6 A;  4C2M C;  4G0U A;  1O24 A;  1G51 A;  4Q5S A;  3GTG K;  3SZY A;  2PPB A;  1WIH A;  4A3C C;  3HOW K;  3HOV C;  4BBR K;  3PO3 C;  3S17 K;  4C3H K;  4A3M K;  2GSU A;  2R7Z C;  1BJT A;  3GTO K;  5C4J C;  2JA6 K;  1TWF A;  1R9T K;  3GTK K;  2YU9 C;  3GTM K;  2FQT A;  2VUM A;  3S1N K;  2KWA A;  1O28 A;  3S1Q C;  4C3I C;  3H0G A;  4GTB A;  1I6H C;  3G4A A;  1V5V A;  1UV7 A;  3FKI A;  3GEI A;  1WOO A;  3GSI A;  1TWA C;  4AYB D;  4KM9 A;  5IYC K;  1K83 A;  3K7A C;  1O29 A;  4KB2 A;  4NOI A;  1WQH A;  2V6T A;  4A93 K;  2A68 A;  5M3M K;  5HL8 A;  2E2H A;  3HKZ D;  3HOU K;  2ZUE A;  4A3G K;  4C3J C;  5IOQ A;  2EBB A;  4LR2 A;  5TMC A;  4GTF A;  4KAT A;  1DD5 A;  2E2I C;  4A3J C;  4P9S A;  1TWF K;  3BP3 A;  3H3V L;  4BXX K;  1AB4 A;  4Y7N K;  1HQM A;  2A6E A;  3OEP A;  1TWC C;  2VUM K;  4WJ4 A;  4LQY A;  3HOX K;  3TFH A;  2NVY A;  3I4N K;  4GT9 A;  2WB1 L;  4KAW X;  2R92 C;  2WB1 D;  1J6W A;  3HOZ K;  3A8K A;  4ZH4 A;  3GTL K;  5IP9 K;  4BY7 K;  1I50 C;  4BLB A;  3S0X A;  2JA5 C;  4A3E K;  1B4A A;  4KAR A;  4P5A A;  1TWG C;  3GTP K;  5L46 A;  1PJ5 A;  5IYB K;  1SFO K;  4GTL A;  1WCM C;  3JST A;  4XLP A;  1F9N A;  1DCP A;  4GZY A;  5C4X C;  1WSV A;  2NVT K;  3FHZ A;  1L0W A;  2CFA A;  1I3Q C;  4C2M K;  3G4C A;  4YFX A;  5IOS A;  3ORE A;  2B63 K;  5FJ8 K;  2B63 C;  4O2D A;  1I6V A;  3HOW C;  4GFQ A;  5CJ9 A;  1WOP A;  3S2D C;  3GTO C;  5C4J K;  1BS2 A;  4AH6 A;  3RZD K;  4A3D K;  3FOF A;  2JA6 C;  1R9T C;  3FKI K;  3S1M K;  2NVQ C;  2YU9 K;  3GDZ A;  3S1R C;  3RZO C;  3N3Y A;  1YCL A;  4YFK A;  4PAB A;  4ILD A;  3S1Q K;  1Y1V A;  1ZXO A;  3CQZ A;  3GTK A;  1IL2 A;  3GTM A;  1TWA K;  3L4K A;  1F93 A;  1YX2 A;  4MEY A;  3WOD A;  3ERE D;  3T00 A;  3VA7 A;  1XZP B;  1IQ0 A;  2E2H K;  4MEX A;  3AH5 A;  1VLO A;  5FLM C;  3LPX A;  4KB4 A;  3HOY K;  3GEE A;  5IOT A;  5M5X K;  3LAJ A;  1K83 K;  1EK8 A;  2R93 C;  3GTG A;  4A3F C;  3HOU C;  4G0V A;  3GTJ C;  2NVX A;  4FM9 A;  4Q4Z A;  4WIL A;  4MQ9 A;  3GEH A;  4A3G C;  1SMY A;  2R7Z A;  1J6V A;  2V6S A;  2JH3 A;  4P5B A;  2PMZ L;  4A3J K;  1TWF C;  3GTQ C;  1WOR A;  3N0B A;  4BY1 K;  1WQG A;  2YU9 A;  3MML B;  2VUM C;  4QJV A;  1HI9 A;  1PJ6 A;  3S2H K;  4A3B C;  3SZZ A;  4OIQ A;  1EQR A;  1ZBS A;  2A6H A;  2R92 K;  3TFJ A;  3L4J A;  3HOZ C;  1WQF A;  3GTL C;  2PA8 D;  1XXA A;  1JVI A;  3M4O K;  4LJZ A;  2E2J C;  3GTP C;  1Y1W C;  4RMF A;  2ZUF A;  1XZQ B;  2GSN A;  3PO2 K;  5IYB C;  1SFO C;  1B4B A;  2PA8 L;  4KMH A;  2CW0 A;  2FQO A;  4YFN A;  5C4X K;  1INN A;  1EFW A;  1KQ4 A;  1I3Q K;  4G0W A;  1F7V A;  3EQL A;  2GAH C;  1IW7 A; 
#chains in the Genus database with same CATH homology
 1I6V A;  3HOW K;  3HOW C;  4A3C K;  4A3C C;  3HOV K;  3HOV C;  4BBR C;  4BBR K;  4JK1 A;  3PO3 C;  3PO3 K;  4XLN A;  3S17 K;  3S17 C;  4C3H K;  3S2D K;  3S2D C;  4A3M K;  4A3M C;  2R7Z C;  2R7Z K;  1ZYR A;  3GTO C;  3GTO K;  2BE5 A;  5C4J K;  5C4J C;  4A3K K;  4A3K C;  3RZD C;  3RZD K;  4A3D C;  5IP7 C;  5IP7 K;  2JA6 K;  2JA6 C;  4A3D K;  1R9T K;  3FKI K;  3FKI C;  1R9T C;  3GTK C;  3GTK K;  2NVQ C;  2NVQ K;  3S1M K;  3S1M C;  2YU9 K;  2YU9 C;  3GTM C;  3GTM K;  3S1R C;  2WAQ D;  3S1R K;  3RZO C;  3RZO K;  3S1N K;  3S1N C;  2O5J A;  3S15 K;  3S15 C;  4YFK A;  3GTG C;  3S1Q C;  2B63 C;  3DXJ A;  4C3I K;  3S1Q K;  4XSX A;  1I6H K;  1I6H C;  3M3Y C;  3M3Y K;  5M5W K;  4OIP A;  1TWA C;  1TWA K;  4QIW D;  2Y0S D;  4MEY A;  4AYB D;  3WOD A;  5IYC K;  5IYC C;  2E2H C;  3K7A C;  3K7A K;  4MEX A;  2E2H K;  2PMZ D;  3CQZ K;  3CQZ C;  4X6A K;  5FLM K;  5FLM C;  4X6A C;  4NOI A;  3H3V D;  1TWH K;  1TWH C;  3HOY K;  3HOY C;  4KN7 A;  4LLG A;  2NVX C;  5M5X K;  2NVX K;  2JA7 K;  2JA7 C;  2JA8 C;  4XSZ A;  5D4D A;  2JA8 K;  4A93 K;  4A93 C;  3S14 K;  3S14 C;  4YG2 A;  4OIR A;  2A68 A;  5C44 K;  1K83 C;  1K83 K;  5M3M K;  5C44 C;  4BBS C;  1YNN A;  4BBS K;  2R93 C;  2R93 K;  3HKZ D;  5IYD C;  5IYD K;  4A3F K;  4A3F C;  3HOU C;  3HOU K;  3GTJ C;  3GTJ K;  4QJV B;  4QIW L;  4KN4 A;  4Q4Z A;  4MQ9 A;  4A3G K;  4C3J K;  4A3G C;  5M5Y K;  1YNJ A;  2NVY K;  2NVY C;  5TMC A;  3GTP K;  1SMY A;  2PMZ L;  2E2I C;  2E2I K;  4A3J K;  4A3J C;  1IW7 A;  1TWF C;  1TWF K;  3H3V L;  3GTQ K;  3GTQ C;  4BXX C;  4BXX K;  4KMU A;  4Y7N C;  4Y7N K;  1HQM A;  5M3F K;  4BY1 K;  4BY1 C;  2A6E A;  2Y0S L;  2WAQ L;  4AYB L;  1TWC K;  1TWC C;  4OIO A;  4QJV A;  3HOX C;  3HOX K;  2VUM K;  4G7Z A;  2VUM C;  3S2H K;  3S2H C;  4G7O A;  4A3B C;  4A3B K;  4OIQ A;  3I4M K;  3I4N K;  3I4M C;  3I4N C;  2WB1 L;  1Y1V C;  1Y1V K;  3H0G C;  3H0G K;  4A3I K;  4A3I C;  2A6H A;  2R92 K;  2WB1 D;  2R92 C;  3HOZ C;  3HOZ K;  4ZH4 A;  3GTL K;  5IP9 K;  5IP9 C;  3GTL C;  2PA8 D;  4BY7 C;  4BY7 K;  1I50 K;  1I50 C;  2JA5 C;  2JA5 K;  4G7H A;  4LK0 A;  4LK1 A;  4A3E K;  5C3E K;  5C3E C;  4A3E C;  3M4O C;  5TMF A;  3M4O K;  4LJZ A;  2E2J K;  1XPP A;  1TWG K;  1TWG C;  5FJ8 K;  1Y1W K;  3HKZ L;  4Y52 C;  1Y1W C;  2E2J C;  3GTP C;  4Y52 K;  3PO2 C;  3PO2 K;  5IYB K;  5IYB C;  1SFO K;  1SFO C;  2PA8 L;  4A3L K;  4A3L C;  1WCM K;  1WCM C;  4OIN A;  2CW0 A;  4YFN A;  4XLP A;  4GZY A;  2O5I A;  5C4X K;  3S16 K;  3S16 C;  5C4X C;  2NVT K;  2NVT C;  1BDF A;  1I3Q C;  1I3Q K;  4C2M K;  4YFX A;  2B63 K;  3GTG K;  4Q5S A;  3EQL A;  2A69 A;  2PPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...