3GTQK

Backtracked rna polymerase ii complex induced by damage
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtqK00
3GTKC 2E2HK 3FKIK 2R93K 5M3MK 4A3JK 3GTLC 4OIRA 2R7ZC 3HOVC 3HOUC 2NVQC 3S1NK 1I50C 4QIWL 4ZH4A 3RZDC 4A3KK 1SFOC 3GTGC 3EQLA 2YU9K 1TWGC 2Y0SD 3CQZK 3HOWC 3S14K 3HOXC 3S15C 4A3LK 5M5XK 1I6HC 4X6AC 3HKZD 3GTQC 1BDFA 2E2HC 4Y52K 3S17C 1K83K 4OIPA 5C3EC 4A3FK 1R9TK 3GTMC 3S2DK 4XSZA 3WODA 1Y1VK 2JA5C 2R92K 4KMUA 5M5WK 3M3YC 4BY7K 2O5JA 5M5YK 3GTOK 4NOIA 3S1NC 2VUMK 4QJVB 1TWFK 1I6VA 3GTKK 3K7AK 4BBSK 2A69A 4C3JK 1YNJA 2WAQL 1TWAC 3I4NC 1TWCC 1WCMK 4OIOA 3FKIC 4LJZA 4A3JC 4A3IC 5C3EK 4G7HA 5FLMK 4BY1C 3H0GC 3GTJC 4A3LC 3CQZC 3HOWK 2JA8C 2O5IA 3S15K 3PO2K 4A3CK 4AYBD 2B63C 3I4MK 2NVXC 3GTMK 1SFOK 3GTGK 4OIQA 3HOZK 4A93C 5IYDK 5C44C 4Y52C 2PA8L 3S1QC 2PMZD 1I50K 3RZDK 3M4OK 1IW7A 4JK1A 4Q4ZA 2E2JC 5C4JK 3K7AC 2WB1D 2NVQK 2PMZL 4KN4A 4LK0A 3S2HK 5IYBC 1YNNA 2WAQD 4Q5SA 4A3GC 2NVXK 4BBRC 4A3MC 5M3FK 5IP7K 5C44K 4LK1A 4A3EC 3DXJA 2B63K 3I4MC 4BY1K 5IP9C 1TWHK 5C4XK 2JA6K 4C3HK 1I3QK 4KN7A 4QIWD 5TMCA 2JA8K 4A3CC 3S16C 2JA7C 5IYCK 4A3IK 3GTJK 3HOYK 5FJ8K 5FLMC 2A68A 4BBRK 4A3MK 1Y1WC 4A3BC 2A6EA 4YFKA 3RZOK 3M4OC 4G7OA 1TWCK 1WCMC 1ZYRA 5TMFA 2E2JK 3PO3K 4XLPA 3H3VD 3GTLK 2WB1L 5C4JC 3S1MK 4XSXA 3S1QK 4YFXA 4G7ZA 2R93C 3GTPC 2E2IK 3HOZC 2NVYC 2BE5A 2PA8D 4LLGA 5IP7C 4YFNA 4Y7NC 4A3EK 1I3QC 3H3VL 3HKZL 4BXXK 3HOXK 2NVTK 2JA7K 4AYBL 5IP9K 3S2HC 2CW0A 4A3FC 4A3DC 4YG2A 5D4DA 2Y0SL 4MEYA 1TWHC 2JA6C 3HOUK 5C4XC 1HQMA 1I6HK 3HOVK 4X6AK 4MQ9A 2A6HA 4C2MK 2YU9C 4OINA 3GTPK 3PO3C 2R7ZK 3S1MC 4BBSC 5IYBK 4A3GK 4A3BK 2PPBA 3HOYC 3S1RC 3PO2C 5IYCC 3M3YK 1XPPA 1TWAK 3I4NK 1TWFC 3S2DC 4C3IK 3RZOC 4A3DK 1SMYA 4GZYA 1Y1WK 1K83C 3S16K 3GTQK 2NVTC 1Y1VC 2JA5K 4QJVA 4A93K 1R9TC 1TWGK 2VUMC 4Y7NK 2R92C 3H0GK 4A3KC 3GTOC 2E2IC 3S17K 4XLNA 5IYDC 4BXXC 4MEXA 3S1RK 3S14C 4BY7C 2NVYK
chains in the Genus database with same CATH superfamily
2E2HK 1EH1A 1WCMA 1WSRA 1ISEA 2R7ZC 3HOVC 1YX2A 3N3YA 2ZUFA 3RZDC 4C2MC 2XCOA 3Q3QA 4A3KK 3S1NK 1PJ7A 3HOXC 4X6AC 1BGWA 2ZUEA 1K83K 1ZQ1C 3GTMC 3S2DK 1Y1VK 5M5YK 1B4AA 1J6WA 3GTOK 5JVOA 3IPJA 2R7ZA 1BS2A 4OIOA 3FKIA 1J98A 1F7UA 2JA7A 3GTOA 4A3CK 1O2BA 2O5IA 5IYDK 2B63C 2NVXC 1O26A 1Y1VA 1XZPB 4A93C 2P5MA 5C44C 1ZVUA 4Y52C 3BP8C 1IW7A 1RU0A 3A8JA 2WB1D 3CAGA 2ZFZA 2PMZL 3S2HK 5M3FK 5IP7K 4A3EC 5CHPA 3I4MC 4BY1K 2B63A 2JA6K 5TMCA 1XXCA 4A3CC 3H0GA 4BLAA 4A3IK 4GFQA 3GDZA 5FLMC 2A68A 1INNA 4A3MK 3GEIA 2A6EA 3RZOK 1TWAA 1IQ0A 1UV7A 1VH2A 3A8IA 4KDDA 4XLPA 1L0WA 2WB1L 3GEEA 3S1QK 4GTBA 5EGHA 4G7ZA 4AH6A 1G51A 1ZXOA 4LLGA 4BXXK 4YFNA 1C0AA 3AQPA 1I3QA 2NVTK 3S0XA 1B4BA 4A3FC 4YG2A 4A3DC 2FQTA 2Y0SL 3HOUK 4GTFA 3OPFA 1HQMA 4X6AK 4MQ9A 2A6HA 4KM8A 3GTPK 1EQRA 4BBSC 5IYBK 4A3GK 3PO2C 5IYCC 2VUMA 1XPPA 1TWFC 3RZOC 1I50A 4GZYA 2JA5K 1O28A 2VUMC 4A3KC 2GSNA 3AH5A 4C3JC 2JH3A 3S1RK 3AD7C 2NVYK 1JQWA 5M3MK 4BKWA 3G4CA 2NVQC 1I50C 4ZH4A 2NVYA 1TWFA 3SZYA 3EQLA 4KMAA 3HOWC 3S14K 1I6HC 3LAPA 1BDFA 4PABA 2E2HC 3S17C 2R92A 1R9TK 2JA5A 4P9SA 4XSZA 3TFHA 3M3YC 4KMUA 2KWAA 1TWCA 2VUMK 1F9NA 3GTKK 1O2AA 4GTEA 1YNJA 2WAQL 1TWCC 5IOSA 3FKIC 4KARA 3ADAC 1EFWA 4A3JC 1WORA 4A3IC 3GIRA 1IL2A 4KMDA 3FHZA 3S15K 2JA8C 4AYBD 3I4MK 1TWGA 3HOZK 2PA8L 2PMZD 3ERED 1WSVA 3SZZA 4JK1A 5TJ3A 3K7AC 1DCPA 2NVQK 4P5BA 4G0UA 5IOTA 2GSOA 4Q5SA 4A3MC 5C44K 4LK1A 2R93A 4BLBA 3DXJA 3LPXA 2JA6A 2XCRB 3V4GA 2B63K 5C4XK 4QIWD 3BP3A 4KB2A 3GTJK 1WQGA 4A3BC 3M4OC 3AQOA 1WCMC 4KMHA 2E2JK 3H3VD 4FM9A 3GTLK 1VGXA 1YCLA 2RH6A 4XSXA 2R93C 4M1XA 3GTPC 3N0CA 3BUEA 2FQOA 1VJEA 1VRQC 4GT9A 1I3QC 2V6SA 1JOEA 4Y7NC 2JA7K 1DD5A 4KB4A 5C4XC 1WOPA 4KAWX 4C2MK 4OINA 4WJ4A 4ILDA 2R7ZK 1AB4A 1DCHA 5IORA 4A3BK 2PPBA 3S1RC 3FOEA 4GTCA 4LQYA 3S2DC 1VLOA 1K83C 3GTQA 1TWGK 5HL8A 3AD8C 3QX3A 3GTOC 2E2IC 3S17K 5IOQA 4XLNA 4BY7C 3PO2K 3S14C 1WOOA 3GTLC 1PJ5A 3A8KA 1WIHA 1XZQA 2E2HA 3HOUC 3GTKA 1F7VA 1SFOC 1JVIA 2YU9K 3CQZK 4A3LK 5M5XK 4Y52K 4A93K 3GTMA 2R92K 3T00A 2Y3PA 1XXBA 4WJ3M 1IE0A 4NOIA 4QJVB 1TWFK 1I6VA 3G4AA 2A69A 2XCQA 1XZQB 2D6FC 1TWAC 5EGEA 4LJZA 1XZPA 5C3EK 4P5AA 4G7HA 4BY1C 3H0GC 4A3LC 4GTDA 3CQZC 3LAJA 3OEPA 3GTMK 3GTGK 1IBAA 1EI6A 1I50K 4Q4ZA 1F93A 4G0WA 5IYBC 4A3GC 4J3NA 4BBRC 2V6TA 1TWHA 4LOWA 5IP9C 3L4JA 4WILA 1I3QK 4KN7A 3S16C 2P8TA 2JA7C 1J6XA 3HOYK 4FZBA 3TTGA 4YFKA 4C3IC 2RGRA 1J6VA 5TMFA 4O2DA 4YFXA 4KASA 1SFOA 3HOZC 4C45A 2BE5A 3NUHA 5IP7C 4A3EK 2GAGC 3HKZL 3HXAA 2YU9A 1IS1A 5IP9K 5D4DA 2JA6C 1DCOA 2YU9C 3PO3C 1KQ4A 3S1MC 3MMLB 3HOYC 3GTLA 3TFIA 3I4NK 1V5VA 4C3IK 1SMYA 1Y1WK 3GTQK 1EK8A 1HI9A 4QJVA 1R9TC 3GEHA 4GTLA 2PHCB 4KATA 1GE9A 4BXXC 3L4KA 3GTKC 3FKIK 2R93K 4A3JK 4OIRA 1XXAA 4QIWL 3GTGC 5L46A 1TWGC 2Y0SD 3S15C 3HKZD 3GTQC 4OIPA 3N0BA 5C3EC 4A3FK 3WODA 1X31C 2JA5C 1K83A 4BY7K 5M5WK 2W7VA 2O5JA 1Y1WA 3S1NC 3OREA 3K7AK 4BBSK 4C3JK 2EBBA 3GTJA 3I4NC 2V6UA 1WCMK 1O25A 3FOFA 5FLMK 3GTJC 4RMFA 4C3HC 3HOWK 1SFOK 4OIQA 1R9TA 3JSTA 4XCHA 3S1QC 3RZDK 3M4OK 1PJ6A 2CFAB 2E2JC 5C4JK 2CFAA 4KN4A 4LK0A 1YNNA 2WAQD 1O27A 2NVXK 4LR2A 3T02A 1O2FB 3GSIA 1TWHK 4C3HK 2JA8K 4GTAA 1USMA 5IYCK 5FJ8K 2E2IA 4BBRK 1Y1WC 4KM9A 5E68A 4G7OA 1TWCK 1ZYRA 3PO3K 1O24A 5C4JC 3S1MK 3VA7A 2GSUA 5CJ9A 2E2IK 3GTGA 3GTPA 2NVYC 4DDQA 2PA8D 1BJTA 3H3VL 1O29A 2GAHC 3HOXK 3AD9C 4AYBL 3S2HC 2CW0A 4MEYA 1TWHC 3T01A 1I6HK 3HOVK 1USOA 2NVXA 4KC6A 4G0VA 1WQFA 5JFEA 3M3YK 1TWAK 4A3DK 3S16K 1ZBSA 2NVTC 1Y1VC 4PAAA 4Y7NK 2R92C 3H0GK 3TFJA 3CQZA 5IYDC 1WQHA 4MEXA 1WOSA
chains in the Genus database with same CATH topology
3GTKC 2E2HK 3FKIK 2R93K 5M3MK 4A3JK 3GTLC 4OIRA 2R7ZC 3HOVC 3HOUC 2NVQC 3S1NK 1I50C 4QIWL 4ZH4A 3RZDC 4A3KK 1SFOC 3GTGC 3EQLA 2YU9K 1TWGC 2Y0SD 3CQZK 3HOWC 3S14K 3HOXC 3S15C 4A3LK 5M5XK 1I6HC 4X6AC 3HKZD 3GTQC 1BDFA 2E2HC 4Y52K 3S17C 1K83K 4OIPA 5C3EC 4A3FK 1R9TK 3GTMC 3S2DK 4XSZA 3WODA 1Y1VK 2JA5C 2R92K 4KMUA 5M5WK 3M3YC 4BY7K 2O5JA 5M5YK 3GTOK 4NOIA 3S1NC 2VUMK 4QJVB 1TWFK 1I6VA 3GTKK 3K7AK 4BBSK 2A69A 4C3JK 1YNJA 2WAQL 1TWAC 3I4NC 1TWCC 1WCMK 4OIOA 3FKIC 4LJZA 4A3JC 4A3IC 5C3EK 4G7HA 5FLMK 4BY1C 3H0GC 3GTJC 4A3LC 3CQZC 3HOWK 2JA8C 2O5IA 3S15K 3PO2K 4A3CK 4AYBD 2B63C 3I4MK 2NVXC 3GTMK 1SFOK 3GTGK 4OIQA 3HOZK 4A93C 5IYDK 5C44C 4Y52C 2PA8L 3S1QC 2PMZD 1I50K 3RZDK 3M4OK 1IW7A 4JK1A 4Q4ZA 2E2JC 5C4JK 3K7AC 2WB1D 2NVQK 2PMZL 4KN4A 4LK0A 3S2HK 5IYBC 1YNNA 2WAQD 4Q5SA 4A3GC 2NVXK 4BBRC 4A3MC 5M3FK 5IP7K 5C44K 4LK1A 4A3EC 3DXJA 2B63K 3I4MC 4BY1K 5IP9C 1TWHK 5C4XK 2JA6K 4C3HK 1I3QK 4KN7A 4QIWD 5TMCA 2JA8K 4A3CC 3S16C 2JA7C 5IYCK 4A3IK 3GTJK 3HOYK 5FJ8K 5FLMC 2A68A 4BBRK 4A3MK 1Y1WC 4A3BC 2A6EA 4YFKA 3RZOK 3M4OC 4G7OA 1TWCK 1WCMC 1ZYRA 5TMFA 2E2JK 3PO3K 4XLPA 3H3VD 3GTLK 2WB1L 5C4JC 3S1MK 4XSXA 3S1QK 4YFXA 4G7ZA 2R93C 3GTPC 2E2IK 3HOZC 2NVYC 2BE5A 2PA8D 4LLGA 5IP7C 4YFNA 4Y7NC 4A3EK 1I3QC 3H3VL 3HKZL 4BXXK 3HOXK 2NVTK 2JA7K 4AYBL 5IP9K 3S2HC 2CW0A 4A3FC 4A3DC 4YG2A 5D4DA 2Y0SL 4MEYA 1TWHC 2JA6C 3HOUK 5C4XC 1HQMA 1I6HK 3HOVK 4X6AK 4MQ9A 2A6HA 4C2MK 2YU9C 4OINA 3GTPK 3PO3C 2R7ZK 3S1MC 4BBSC 5IYBK 4A3GK 4A3BK 2PPBA 3HOYC 3S1RC 3PO2C 5IYCC 3M3YK 1XPPA 1TWAK 3I4NK 1TWFC 3S2DC 4C3IK 3RZOC 4A3DK 1SMYA 4GZYA 1Y1WK 1K83C 3S16K 3GTQK 2NVTC 1Y1VC 2JA5K 4QJVA 4A93K 1R9TC 1TWGK 2VUMC 4Y7NK 2R92C 3H0GK 4A3KC 3GTOC 2E2IC 3S17K 4XLNA 5IYDC 4BXXC 4MEXA 3S1RK 3S14C 4BY7C 2NVYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTK C;  2E2H K;  3FKI K;  2R93 K;  5M3M K;  4A3J K;  3GTL C;  4OIR A;  2R7Z C;  3HOV C;  3HOU C;  2NVQ C;  3S1N K;  1I50 C;  4QIW L;  4ZH4 A;  3RZD C;  4A3K K;  1SFO C;  3GTG C;  3EQL A;  2YU9 K;  1TWG C;  2Y0S D;  3CQZ K;  3HOW C;  3S14 K;  3HOX C;  3S15 C;  4A3L K;  5M5X K;  1I6H C;  4X6A C;  3HKZ D;  3GTQ C;  1BDF A;  2E2H C;  4Y52 K;  3S17 C;  1K83 K;  4OIP A;  5C3E C;  4A3F K;  1R9T K;  3GTM C;  3S2D K;  4XSZ A;  3WOD A;  1Y1V K;  2JA5 C;  2R92 K;  4KMU A;  5M5W K;  3M3Y C;  4BY7 K;  2O5J A;  5M5Y K;  3GTO K;  4NOI A;  3S1N C;  2VUM K;  4QJV B;  1TWF K;  1I6V A;  3GTK K;  3K7A K;  4BBS K;  2A69 A;  4C3J K;  1YNJ A;  2WAQ L;  1TWA C;  3I4N C;  1TWC C;  1WCM K;  4OIO A;  3FKI C;  4LJZ A;  4A3J C;  4A3I C;  5C3E K;  4G7H A;  5FLM K;  4BY1 C;  3H0G C;  3GTJ C;  4A3L C;  3CQZ C;  3HOW K;  2JA8 C;  2O5I A;  3S15 K;  3PO2 K;  4A3C K;  4AYB D;  2B63 C;  3I4M K;  2NVX C;  3GTM K;  1SFO K;  3GTG K;  4OIQ A;  3HOZ K;  4A93 C;  5IYD K;  5C44 C;  4Y52 C;  2PA8 L;  3S1Q C;  2PMZ D;  1I50 K;  3RZD K;  3M4O K;  1IW7 A;  4JK1 A;  4Q4Z A;  2E2J C;  5C4J K;  3K7A C;  2WB1 D;  2NVQ K;  2PMZ L;  4KN4 A;  4LK0 A;  3S2H K;  5IYB C;  1YNN A;  2WAQ D;  4Q5S A;  4A3G C;  2NVX K;  4BBR C;  4A3M C;  5M3F K;  5IP7 K;  5C44 K;  4LK1 A;  4A3E C;  3DXJ A;  2B63 K;  3I4M C;  4BY1 K;  5IP9 C;  1TWH K;  5C4X K;  2JA6 K;  4C3H K;  1I3Q K;  4KN7 A;  4QIW D;  5TMC A;  2JA8 K;  4A3C C;  3S16 C;  2JA7 C;  5IYC K;  4A3I K;  3GTJ K;  3HOY K;  5FJ8 K;  5FLM C;  2A68 A;  4BBR K;  4A3M K;  1Y1W C;  4A3B C;  2A6E A;  4YFK A;  3RZO K;  3M4O C;  4G7O A;  1TWC K;  1WCM C;  1ZYR A;  5TMF A;  2E2J K;  3PO3 K;  4XLP A;  3H3V D;  3GTL K;  2WB1 L;  5C4J C;  3S1M K;  4XSX A;  3S1Q K;  4YFX A;  4G7Z A;  2R93 C;  3GTP C;  2E2I K;  3HOZ C;  2NVY C;  2BE5 A;  2PA8 D;  4LLG A;  5IP7 C;  4YFN A;  4Y7N C;  4A3E K;  1I3Q C;  3H3V L;  3HKZ L;  4BXX K;  3HOX K;  2NVT K;  2JA7 K;  4AYB L;  5IP9 K;  3S2H C;  2CW0 A;  4A3F C;  4A3D C;  4YG2 A;  5D4D A;  2Y0S L;  4MEY A;  1TWH C;  2JA6 C;  3HOU K;  5C4X C;  1HQM A;  1I6H K;  3HOV K;  4X6A K;  4MQ9 A;  2A6H A;  4C2M K;  2YU9 C;  4OIN A;  3GTP K;  3PO3 C;  2R7Z K;  3S1M C;  4BBS C;  5IYB K;  4A3G K;  4A3B K;  2PPB A;  3HOY C;  3S1R C;  3PO2 C;  5IYC C;  3M3Y K;  1XPP A;  1TWA K;  3I4N K;  1TWF C;  3S2D C;  4C3I K;  3RZO C;  4A3D K;  1SMY A;  4GZY A;  1Y1W K;  1K83 C;  3S16 K;  3GTQ K;  2NVT C;  1Y1V C;  2JA5 K;  4QJV A;  4A93 K;  1R9T C;  1TWG K;  2VUM C;  4Y7N K;  2R92 C;  3H0G K;  4A3K C;  3GTO C;  2E2I C;  3S17 K;  4XLN A;  5IYD C;  4BXX C;  4MEX A;  3S1R K;  3S14 C;  4BY7 C;  2NVY K; 
#chains in the Genus database with same CATH topology
 2E2H K;  1EH1 A;  1WCM A;  1WSR A;  1ISE A;  2R7Z C;  3HOV C;  1YX2 A;  3N3Y A;  2ZUF A;  3RZD C;  4C2M C;  2XCO A;  3Q3Q A;  4A3K K;  3S1N K;  1PJ7 A;  3HOX C;  4X6A C;  1BGW A;  2ZUE A;  1K83 K;  1ZQ1 C;  3GTM C;  3S2D K;  1Y1V K;  5M5Y K;  1B4A A;  1J6W A;  3GTO K;  5JVO A;  3IPJ A;  2R7Z A;  1BS2 A;  4OIO A;  3FKI A;  1J98 A;  1F7U A;  2JA7 A;  3GTO A;  4A3C K;  1O2B A;  2O5I A;  5IYD K;  2B63 C;  2NVX C;  1O26 A;  1Y1V A;  1XZP B;  4A93 C;  2P5M A;  5C44 C;  1ZVU A;  4Y52 C;  3BP8 C;  1IW7 A;  1RU0 A;  3A8J A;  2WB1 D;  3CAG A;  2ZFZ A;  2PMZ L;  3S2H K;  5M3F K;  5IP7 K;  4A3E C;  5CHP A;  3I4M C;  4BY1 K;  2B63 A;  2JA6 K;  5TMC A;  1XXC A;  4A3C C;  3H0G A;  4BLA A;  4A3I K;  4GFQ A;  3GDZ A;  5FLM C;  2A68 A;  1INN A;  4A3M K;  3GEI A;  2A6E A;  3RZO K;  1TWA A;  1IQ0 A;  1UV7 A;  1VH2 A;  3A8I A;  4KDD A;  4XLP A;  1L0W A;  2WB1 L;  3GEE A;  3S1Q K;  4GTB A;  5EGH A;  4G7Z A;  4AH6 A;  1G51 A;  1ZXO A;  4LLG A;  4BXX K;  4YFN A;  1C0A A;  3AQP A;  1I3Q A;  2NVT K;  3S0X A;  1B4B A;  4A3F C;  4YG2 A;  4A3D C;  2FQT A;  2Y0S L;  3HOU K;  4GTF A;  3OPF A;  1HQM A;  4X6A K;  4MQ9 A;  2A6H A;  4KM8 A;  3GTP K;  1EQR A;  4BBS C;  5IYB K;  4A3G K;  3PO2 C;  5IYC C;  2VUM A;  1XPP A;  1TWF C;  3RZO C;  1I50 A;  4GZY A;  2JA5 K;  1O28 A;  2VUM C;  4A3K C;  2GSN A;  3AH5 A;  4C3J C;  2JH3 A;  3S1R K;  3AD7 C;  2NVY K;  1JQW A;  5M3M K;  4BKW A;  3G4C A;  2NVQ C;  1I50 C;  4ZH4 A;  2NVY A;  1TWF A;  3SZY A;  3EQL A;  4KMA A;  3HOW C;  3S14 K;  1I6H C;  3LAP A;  1BDF A;  4PAB A;  2E2H C;  3S17 C;  2R92 A;  1R9T K;  2JA5 A;  4P9S A;  4XSZ A;  3TFH A;  3M3Y C;  4KMU A;  2KWA A;  1TWC A;  2VUM K;  1F9N A;  3GTK K;  1O2A A;  4GTE A;  1YNJ A;  2WAQ L;  1TWC C;  5IOS A;  3FKI C;  4KAR A;  3ADA C;  1EFW A;  4A3J C;  1WOR A;  4A3I C;  3GIR A;  1IL2 A;  4KMD A;  3FHZ A;  3S15 K;  2JA8 C;  4AYB D;  3I4M K;  1TWG A;  3HOZ K;  2PA8 L;  2PMZ D;  3ERE D;  1WSV A;  3SZZ A;  4JK1 A;  5TJ3 A;  3K7A C;  1DCP A;  2NVQ K;  4P5B A;  4G0U A;  5IOT A;  2GSO A;  4Q5S A;  4A3M C;  5C44 K;  4LK1 A;  2R93 A;  4BLB A;  3DXJ A;  3LPX A;  2JA6 A;  2XCR B;  3V4G A;  2B63 K;  5C4X K;  4QIW D;  3BP3 A;  4KB2 A;  3GTJ K;  1WQG A;  4A3B C;  3M4O C;  3AQO A;  1WCM C;  4KMH A;  2E2J K;  3H3V D;  4FM9 A;  3GTL K;  1VGX A;  1YCL A;  2RH6 A;  4XSX A;  2R93 C;  4M1X A;  3GTP C;  3N0C A;  3BUE A;  2FQO A;  1VJE A;  1VRQ C;  4GT9 A;  1I3Q C;  2V6S A;  1JOE A;  4Y7N C;  2JA7 K;  1DD5 A;  4KB4 A;  5C4X C;  1WOP A;  4KAW X;  4C2M K;  4OIN A;  4WJ4 A;  4ILD A;  2R7Z K;  1AB4 A;  1DCH A;  5IOR A;  4A3B K;  2PPB A;  3S1R C;  3FOE A;  4GTC A;  4LQY A;  3S2D C;  1VLO A;  1K83 C;  3GTQ A;  1TWG K;  5HL8 A;  3AD8 C;  3QX3 A;  3GTO C;  2E2I C;  3S17 K;  5IOQ A;  4XLN A;  4BY7 C;  3PO2 K;  3S14 C;  1WOO A;  3GTL C;  1PJ5 A;  3A8K A;  1WIH A;  1XZQ A;  2E2H A;  3HOU C;  3GTK A;  1F7V A;  1SFO C;  1JVI A;  2YU9 K;  3CQZ K;  4A3L K;  5M5X K;  4Y52 K;  4A93 K;  3GTM A;  2R92 K;  3T00 A;  2Y3P A;  1XXB A;  4WJ3 M;  1IE0 A;  4NOI A;  4QJV B;  1TWF K;  1I6V A;  3G4A A;  2A69 A;  2XCQ A;  1XZQ B;  2D6F C;  1TWA C;  5EGE A;  4LJZ A;  1XZP A;  5C3E K;  4P5A A;  4G7H A;  4BY1 C;  3H0G C;  4A3L C;  4GTD A;  3CQZ C;  3LAJ A;  3OEP A;  3GTM K;  3GTG K;  1IBA A;  1EI6 A;  1I50 K;  4Q4Z A;  1F93 A;  4G0W A;  5IYB C;  4A3G C;  4J3N A;  4BBR C;  2V6T A;  1TWH A;  4LOW A;  5IP9 C;  3L4J A;  4WIL A;  1I3Q K;  4KN7 A;  3S16 C;  2P8T A;  2JA7 C;  1J6X A;  3HOY K;  4FZB A;  3TTG A;  4YFK A;  4C3I C;  2RGR A;  1J6V A;  5TMF A;  4O2D A;  4YFX A;  4KAS A;  1SFO A;  3HOZ C;  4C45 A;  2BE5 A;  3NUH A;  5IP7 C;  4A3E K;  2GAG C;  3HKZ L;  3HXA A;  2YU9 A;  1IS1 A;  5IP9 K;  5D4D A;  2JA6 C;  1DCO A;  2YU9 C;  3PO3 C;  1KQ4 A;  3S1M C;  3MML B;  3HOY C;  3GTL A;  3TFI A;  3I4N K;  1V5V A;  4C3I K;  1SMY A;  1Y1W K;  3GTQ K;  1EK8 A;  1HI9 A;  4QJV A;  1R9T C;  3GEH A;  4GTL A;  2PHC B;  4KAT A;  1GE9 A;  4BXX C;  3L4K A;  3GTK C;  3FKI K;  2R93 K;  4A3J K;  4OIR A;  1XXA A;  4QIW L;  3GTG C;  5L46 A;  1TWG C;  2Y0S D;  3S15 C;  3HKZ D;  3GTQ C;  4OIP A;  3N0B A;  5C3E C;  4A3F K;  3WOD A;  1X31 C;  2JA5 C;  1K83 A;  4BY7 K;  5M5W K;  2W7V A;  2O5J A;  1Y1W A;  3S1N C;  3ORE A;  3K7A K;  4BBS K;  4C3J K;  2EBB A;  3GTJ A;  3I4N C;  2V6U A;  1WCM K;  1O25 A;  3FOF A;  5FLM K;  3GTJ C;  4RMF A;  4C3H C;  3HOW K;  1SFO K;  4OIQ A;  1R9T A;  3JST A;  4XCH A;  3S1Q C;  3RZD K;  3M4O K;  1PJ6 A;  2CFA B;  2E2J C;  5C4J K;  2CFA A;  4KN4 A;  4LK0 A;  1YNN A;  2WAQ D;  1O27 A;  2NVX K;  4LR2 A;  3T02 A;  1O2F B;  3GSI A;  1TWH K;  4C3H K;  2JA8 K;  4GTA A;  1USM A;  5IYC K;  5FJ8 K;  2E2I A;  4BBR K;  1Y1W C;  4KM9 A;  5E68 A;  4G7O A;  1TWC K;  1ZYR A;  3PO3 K;  1O24 A;  5C4J C;  3S1M K;  3VA7 A;  2GSU A;  5CJ9 A;  2E2I K;  3GTG A;  3GTP A;  2NVY C;  4DDQ A;  2PA8 D;  1BJT A;  3H3V L;  1O29 A;  2GAH C;  3HOX K;  3AD9 C;  4AYB L;  3S2H C;  2CW0 A;  4MEY A;  1TWH C;  3T01 A;  1I6H K;  3HOV K;  1USO A;  2NVX A;  4KC6 A;  4G0V A;  1WQF A;  5JFE A;  3M3Y K;  1TWA K;  4A3D K;  3S16 K;  1ZBS A;  2NVT C;  1Y1V C;  4PAA A;  4Y7N K;  2R92 C;  3H0G K;  3TFJ A;  3CQZ A;  5IYD C;  1WQH A;  4MEX A;  1WOS A; 
#chains in the Genus database with same CATH homology
 3GTK C;  2E2H K;  3FKI K;  2R93 K;  5M3M K;  4A3J K;  3GTL C;  4OIR A;  2R7Z C;  3HOV C;  3HOU C;  2NVQ C;  3S1N K;  1I50 C;  4QIW L;  4ZH4 A;  3RZD C;  4A3K K;  1SFO C;  3GTG C;  3EQL A;  2YU9 K;  1TWG C;  2Y0S D;  3CQZ K;  3HOW C;  3S14 K;  3HOX C;  3S15 C;  4A3L K;  5M5X K;  1I6H C;  4X6A C;  3HKZ D;  3GTQ C;  1BDF A;  2E2H C;  4Y52 K;  3S17 C;  1K83 K;  4OIP A;  5C3E C;  4A3F K;  1R9T K;  3GTM C;  3S2D K;  4XSZ A;  3WOD A;  1Y1V K;  2JA5 C;  2R92 K;  4KMU A;  5M5W K;  3M3Y C;  4BY7 K;  2O5J A;  5M5Y K;  3GTO K;  4NOI A;  3S1N C;  2VUM K;  4QJV B;  1TWF K;  1I6V A;  3GTK K;  3K7A K;  4BBS K;  2A69 A;  4C3J K;  1YNJ A;  2WAQ L;  1TWA C;  3I4N C;  1TWC C;  1WCM K;  4OIO A;  3FKI C;  4LJZ A;  4A3J C;  4A3I C;  5C3E K;  4G7H A;  5FLM K;  4BY1 C;  3H0G C;  3GTJ C;  4A3L C;  3CQZ C;  3HOW K;  2JA8 C;  2O5I A;  3S15 K;  3PO2 K;  4A3C K;  4AYB D;  2B63 C;  3I4M K;  2NVX C;  3GTM K;  1SFO K;  3GTG K;  4OIQ A;  3HOZ K;  4A93 C;  5IYD K;  5C44 C;  4Y52 C;  2PA8 L;  3S1Q C;  2PMZ D;  1I50 K;  3RZD K;  3M4O K;  1IW7 A;  4JK1 A;  4Q4Z A;  2E2J C;  5C4J K;  3K7A C;  2WB1 D;  2NVQ K;  2PMZ L;  4KN4 A;  4LK0 A;  3S2H K;  5IYB C;  1YNN A;  2WAQ D;  4Q5S A;  4A3G C;  2NVX K;  4BBR C;  4A3M C;  5M3F K;  5IP7 K;  5C44 K;  4LK1 A;  4A3E C;  3DXJ A;  2B63 K;  3I4M C;  4BY1 K;  5IP9 C;  1TWH K;  5C4X K;  2JA6 K;  4C3H K;  1I3Q K;  4KN7 A;  4QIW D;  5TMC A;  2JA8 K;  4A3C C;  3S16 C;  2JA7 C;  5IYC K;  4A3I K;  3GTJ K;  3HOY K;  5FJ8 K;  5FLM C;  2A68 A;  4BBR K;  4A3M K;  1Y1W C;  4A3B C;  2A6E A;  4YFK A;  3RZO K;  3M4O C;  4G7O A;  1TWC K;  1WCM C;  1ZYR A;  5TMF A;  2E2J K;  3PO3 K;  4XLP A;  3H3V D;  3GTL K;  2WB1 L;  5C4J C;  3S1M K;  4XSX A;  3S1Q K;  4YFX A;  4G7Z A;  2R93 C;  3GTP C;  2E2I K;  3HOZ C;  2NVY C;  2BE5 A;  2PA8 D;  4LLG A;  5IP7 C;  4YFN A;  4Y7N C;  4A3E K;  1I3Q C;  3H3V L;  3HKZ L;  4BXX K;  3HOX K;  2NVT K;  2JA7 K;  4AYB L;  5IP9 K;  3S2H C;  2CW0 A;  4A3F C;  4A3D C;  4YG2 A;  5D4D A;  2Y0S L;  4MEY A;  1TWH C;  2JA6 C;  3HOU K;  5C4X C;  1HQM A;  1I6H K;  3HOV K;  4X6A K;  4MQ9 A;  2A6H A;  4C2M K;  2YU9 C;  4OIN A;  3GTP K;  3PO3 C;  2R7Z K;  3S1M C;  4BBS C;  5IYB K;  4A3G K;  4A3B K;  2PPB A;  3HOY C;  3S1R C;  3PO2 C;  5IYC C;  3M3Y K;  1XPP A;  1TWA K;  3I4N K;  1TWF C;  3S2D C;  4C3I K;  3RZO C;  4A3D K;  1SMY A;  4GZY A;  1Y1W K;  1K83 C;  3S16 K;  3GTQ K;  2NVT C;  1Y1V C;  2JA5 K;  4QJV A;  4A93 K;  1R9T C;  1TWG K;  2VUM C;  4Y7N K;  2R92 C;  3H0G K;  4A3K C;  3GTO C;  2E2I C;  3S17 K;  4XLN A;  5IYD C;  4BXX C;  4MEX A;  3S1R K;  3S14 C;  4BY7 C;  2NVY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...