3GTQK

Backtracked rna polymerase ii complex induced by damage
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 24
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3gtqK00
4A3JC 4Y52K 1TWAC 3S16K 4A3GC 4A3DK 5IYCK 4LJZA 3GTKC 2NVYK 1TWCK 4XSZA 4KMUA 4QJVA 3HKZL 3I4MC 5M5WK 2WAQD 1Y1VC 4C3JK 1YNJA 4A3KK 3S1MK 4MEYA 4Y7NC 3H0GC 4BXXK 4OIPA 1I50K 4YFKA 4A3JK 1TWHK 3K7AC 2JA7C 4A3GK 4OINA 2E2IC 3S16C 2VUMC 3S17C 3GTKK 3S14C 1SFOC 3GTPC 3S2DK 2PMZD 2NVYC 4A93C 1Y1VK 3FKIC 4AYBL 1TWGC 2A69A 4XLPA 4Y7NK 5M3MK 1BDFA 3RZDK 1I50C 2JA6C 3K7AK 4BY7C 5M5XK 2JA7K 2PPBA 1SMYA 4OIQA 3M4OK 5C4XC 1TWHC 2E2IK 2JA5C 4Q4ZA 2VUMK 3S17K 3S14K 1SFOK 3GTPK 1I6VA 3S2HC 3I4NC 4LLGA 5C4JK 4ZH4A 1IW7A 3PO3C 4A93K 3S2DC 4GZYA 3GTOC 2R93C 3FKIK 1TWGK 2E2JC 2B63K 3EQLA 4A3MC 1Y1WC 2R92K 4OIOA 5C3EK 4A3LC 1K83C 2JA6K 4BY7K 3S1NC 3HOVC 3S1QC 5IP7C 5C4XK 3RZDC 2JA5K 2PMZL 3I4NK 3M4OC 3S2HK 2Y0SL 4KN4A 2CW0A 3PO3K 5IYDC 1R9TK 4G7ZA 5C4JC 4YFXA 3GTOK 2R93K 3PO2C 4BBRC 2E2JK 4BBSC 4C2MK 4A3MK 1Y1WK 2B63C 4A3LK 2WB1D 1K83K 2NVTK 2O5IA 4KN7A 2R92C 5C3EC 4Q5SA 3S1NK 3HOVK 4LK1A 4QJVB 5IP7K 3H3VD 3S1QK 3GTMC 2YU9C 3CQZC 5IP9C 4X6AK 2WAQL 5D4DA 4XLNA 5IYDK 1I3QC 3M3YC 2BE5A 3HOXC 4A3IK 2A6EA 1R9TC 3PO2K 1YNNA 4BBRK 3S1RK 3GTLK 3HOUC 4YFNA 4BBSK 4OIRA 2NVQC 4C3HK 1WCMC 4XSXA 2NVTC 4C3IK 5M5YK 5FJ8K 2R7ZK 2E2HK 3GTMK 2YU9K 3CQZK 3HOWK 4A3BC 3GTQC 5IP9K 3RZOC 4MQ9A 5IYBC 1I3QK 4G7HA 3M3YK 3HOXK 3GTJC 2NVXC 4G7OA 4X6AC 2WB1L 4A3IC 3HOUK 3GTLC 3S1RC 2NVQK 4YG2A 4NOIA 3H3VL 4JK1A 4QIWD 1WCMK 2PA8D 4BY1C 4A3CC 1TWFC 4A3EC 1XPPA 4MEXA 4A3BK 5TMFA 2R7ZC 5C44K 2E2HC 3GTQK 3HOWC 3S15K 4A3FC 3RZOK 5TMCA 5IYBK 2O5JA 3GTJK 2NVXK 3GTGC 1HQMA 5FLMK 3HKZD 3I4MK 2JA8C 3HOZC 1I6HC 4A3CK 3WODA 3HOYC 3DXJA 4BY1K 1TWAK 1TWFK 4Y52C 4A3EK 3HOYK 4A3DC 5IYCC 1TWCC 1ZYRA 5C44C 4A3FK 3S15C 2Y0SD 3GTGK 4LK0A 3H0GK 2A68A 4QIWL 5M3FK 2PA8L 4A3KC 2JA8K 3HOZK 3S1MC 5FLMC 1I6HK 4BXXC 4AYBD 2A6HA
chains in the Genus database with same CATH superfamily
4A3JC 2XCRB 4A3GC 1TWFA 4LJZA 4XSZA 3AQOA 1Y1VC 1JVIA 5IOSA 1YNJA 4A3KK 4MEYA 1I3QA 4BXXK 1TWHK 4GFQA 4OINA 2XCOA 2E2IC 1DCHA 3S2DK 3S14C 1XZPB 4A93C 5HL8A 1TWCA 4M1XA 4XLPA 4Y7NK 1EK8A 2JA6C 4OIQA 3IPJA 3N0CA 5C4XC 1TWHC 1O29A 4Q4ZA 1BJTA 1SFOK 3GTPK 1I6VA 3S2DC 1IW7A 4GZYA 4KB4A 3V4GA 2E2JC 5JVOA 3GTGA 1IE0A 3S1NC 3S1QC 3TFJA 2PMZL 3I4NK 4P9SA 4G7ZA 5EGHA 1J6XA 5TJ3A 4BBRC 4BBSC 4A3MK 3ERED 1O2AA 4FZBA 4KN7A 3Q3QA 3GSIA 4LK1A 4QJVB 3LAJA 3GTMC 2YU9C 3CQZC 1TWHA 5IP9C 1VLOA 1GE9A 1ZBSA 3SZZA 4DDQA 3GTLK 3PO2K 5CHPA 4BLBA 4C3HK 5FJ8K 2R7ZK 4XCHA 3GTQC 1PJ5A 4G7HA 3M3YK 2NVXC 2WB1L 3GTLC 2NVQK 4BY1C 4WJ3M 4A3EC 1XZQB 4MEXA 2R7ZC 5C44K 3GTMA 2CFAA 1XXAA 2Y3PA 4A3FC 2O5JA 3MMLB 3I4MK 1WOSA 4A3CK 3HOYC 1TWFK 4Y52C 1DD5A 4KMHA 4J3NA 1BS2A 1VJEA 5C44C 2Y0SD 3GTQA 4GTEA 1C0AA 4LK0A 2GSUA 1O25A 2PA8L 1VRQC 4QIWL 2JA8K 2NVXA 3I4MC 1EI6A 4RMFA 3GTLA 3S16K 1USOA 5IOQA 4A3DK 2FQTA 3JSTA 1ZQ1C 3GTKC 1TWCK 2R7ZA 3A8IA 5M5WK 2WAQD 3FHZA 3CAGA 4OIPA 4YFKA 4A3JK 1WOPA 2RGRA 2JA7C 4A3GK 3S16C 2VUMC 5EGEA 2PMZD 1F7VA 4P5AA 1Y1VK 3FKIC 5E68A 3BUEA 2A69A 4KASA 4KC6A 3RZDK 4BY7C 1WIHA 3M4OK 2E2IK 2FQOA 2JA5C 3S14K 4KMDA 4ZH4A 4A93K 3GTKA 3GTOC 1VH2A 2R93C 2B63K 4C2MC 1Y1WC 4OIOA 5C3EK 4BLAA 2JA6K 2W7VA 4GT9A 3HOVC 4GTBA 3RZDC 5C4XK 3M4OC 2EBBA 3GEEA 2JA7A 2Y0SL 3AD8C 3GDZA 2VUMA 2E2JK 3AD7C 3FKIA 2B63C 2WB1D 4G0UA 2O5IA 5C3EC 3S1NK 4C3IC 3S1QK 1VGXA 2JA5A 2WAQL 4XLNA 3QX3A 3HOXC 4A3IK 2A6EA 1YNNA 4BBRK 3S1RK 3HOUC 4BBSK 1Y1VA 3GTMK 3HOWK 2YU9K 3CQZK 2V6TA 5IP9K 1EFWA 5IYBC 2E2IA 4GTLA 4A3IC 3S1RC 4NOIA 4QIWD 2PA8D 1O27A 4O2DA 2B63A 3LPXA 1X31C 5TMFA 3GTQK 3HOWC 2JA6A 2ZFZA 5TMCA 2NVXK 5FLMK 1I6HC 3DXJA 4BY1K 3HXAA 4A3EK 3NUHA 5IYCC 1YX2A 1AB4A 4A3FK 1WSVA 4KB2A 3A8JA 4KM9A 1ISEA 5M3FK 1INNA 3OPFA 3S1MC 5FLMC 2A6HA 3HOYK 4Y52K 2V6SA 3L4JA 3OEPA 1B4BA 1L0WA 4LR2A 2YU9A 3CQZA 4C3JK 2KWAA 4KAWX 1I50K 3K7AC 3LAPA 1WOOA 3S17C 3GTKK 1O28A 2ZUFA 1TWGC 4WILA 3SZYA 4C3JC 1EH1A 2V6UA 3AD9C 5IORA 1I50C 3GIRA 2JA7K 2PPBA 3ADAC 1KQ4A 2VUMK 3S2HC 1IBAA 4KARA 1JQWA 5C4JK 4KM8A 3PO3C 1IQ0A 1PJ6A 4BKWA 3FKIK 5CJ9A 2R92K 4A3LC 1K83C 4BY7K 3A8KA 5IP7C 5L46A 2JA5K 4KN4A 3T00A 5IYDC 1R9TK 3GTOK 5C4JC 4YFXA 2R93K 4C2MK 1Y1WK 1TWGA 4FM9A 2R92C 1PJ7A 4G0WA 3HOVK 3GEIA 1I50A 2GSOA 3VA7A 3N3YA 1I3QC 1R9TC 4WJ4A 2JH3A 4YFNA 1G51A 3S0XA 1WSRA 4OIRA 1J98A 1WCMC 4C3IK 5M5YK 1K83A 2E2HK 4A3BC 1WORA 4LOWA 3RZOC 3FOFA 3HOXK 3GTJC 5JFEA 3HOUK 2PHCB 1XXCA 1XZPA 3H3VL 4JK1A 1ZXOA 4LQYA 1B4AA 1WQFA 1XPPA 1JOEA 5IOTA 2R92A 3AQPA 2E2HC 3S15K 4GTFA 5IYBK 3TFHA 3GTGC 2D6FC 1HQMA 3HOZC 1F7UA 1R9TA 3GTOA 2R93A 1V5VA 1TWAK 1O2FB 3BP8C 1WCMA 1Y1WA 3BP3A 3S15C 2P5MA 3H0GK 4A3KC 1DCPA 3GTJA 2GSNA 3FOEA 4BXXC 4C45A 1I6HK 2GAGC 1F93A 3AH5A 1IL2A 4GTDA 1TWAC 3N0BA 5IYCK 1BGWA 2NVYK 4KMUA 4QJVA 3HKZL 2E2HA 1UV7A 3S1MK 4Y7NC 3H0GC 1O24A 4ILDA 1J6WA 1SFOC 3GTPC 4PAAA 2NVYC 2RH6A 4AYBL 5M3MK 1BDFA 3K7AK 5M5XK 1SMYA 1EQRA 2GAHC 3I4NC 3S17K 1TWAA 4LLGA 1F9NA 4KATA 1XZQA 1TWGK 2XCQA 3EQLA 4A3MC 3H0GA 3GEHA 2ZUEA 3S2HK 2CW0A 3PO3K 3OREA 1SFOA 3GTPA 1XXBA 3PO2C 2NVYA 3TFIA 1YCLA 4C3HC 1K83K 2NVTK 1J6VA 1HI9A 4A3LK 4Q5SA 2CFAB 5IP7K 3H3VD 1WQHA 2P8TA 3G4CA 4X6AK 5IYDK 5D4DA 3M3YC 2BE5A 3L4KA 1RU0A 4KDDA 1WQGA 4KMAA 2NVQC 4XSXA 4PABA 2NVTC 1ZVUA 4GTCA 3G4AA 4MQ9A 1I3QK 4G7OA 4X6AC 4YG2A 4A3CC 1WCMK 1TWFC 1USMA 4A3BK 3RZOK 4G0VA 4P5BA 3GTJK 3HKZD 2JA8C 3T02A 4AH6A 3T01A 3WODA 4GTAA 4A3DC 1DCOA 1TWCC 1ZYRA 1O2BA 3GTGK 2A68A 3HOZK 1IS1A 4AYBD 3TTGA 1O26A
chains in the Genus database with same CATH topology
4A3JC 4Y52K 1TWAC 3S16K 4A3GC 4A3DK 5IYCK 4LJZA 3GTKC 2NVYK 1TWCK 4XSZA 4KMUA 4QJVA 3HKZL 3I4MC 5M5WK 2WAQD 1Y1VC 4C3JK 1YNJA 4A3KK 3S1MK 4MEYA 4Y7NC 3H0GC 4BXXK 4OIPA 1I50K 4YFKA 4A3JK 1TWHK 3K7AC 2JA7C 4A3GK 4OINA 2E2IC 3S16C 2VUMC 3S17C 3GTKK 3S14C 1SFOC 3GTPC 3S2DK 2PMZD 2NVYC 4A93C 1Y1VK 3FKIC 4AYBL 1TWGC 2A69A 4XLPA 4Y7NK 5M3MK 1BDFA 3RZDK 1I50C 2JA6C 3K7AK 4BY7C 5M5XK 2JA7K 2PPBA 1SMYA 4OIQA 3M4OK 5C4XC 1TWHC 2E2IK 2JA5C 4Q4ZA 2VUMK 3S17K 3S14K 1SFOK 3GTPK 1I6VA 3S2HC 3I4NC 4LLGA 5C4JK 4ZH4A 1IW7A 3PO3C 4A93K 3S2DC 4GZYA 3GTOC 2R93C 3FKIK 1TWGK 2E2JC 2B63K 3EQLA 4A3MC 1Y1WC 2R92K 4OIOA 5C3EK 4A3LC 1K83C 2JA6K 4BY7K 3S1NC 3HOVC 3S1QC 5IP7C 5C4XK 3RZDC 2JA5K 2PMZL 3I4NK 3M4OC 3S2HK 2Y0SL 4KN4A 2CW0A 3PO3K 5IYDC 1R9TK 4G7ZA 5C4JC 4YFXA 3GTOK 2R93K 3PO2C 4BBRC 2E2JK 4BBSC 4C2MK 4A3MK 1Y1WK 2B63C 4A3LK 2WB1D 1K83K 2NVTK 2O5IA 4KN7A 2R92C 5C3EC 4Q5SA 3S1NK 3HOVK 4LK1A 4QJVB 5IP7K 3H3VD 3S1QK 3GTMC 2YU9C 3CQZC 5IP9C 4X6AK 2WAQL 5D4DA 4XLNA 5IYDK 1I3QC 3M3YC 2BE5A 3HOXC 4A3IK 2A6EA 1R9TC 3PO2K 1YNNA 4BBRK 3S1RK 3GTLK 3HOUC 4YFNA 4BBSK 4OIRA 2NVQC 4C3HK 1WCMC 4XSXA 2NVTC 4C3IK 5M5YK 5FJ8K 2R7ZK 2E2HK 3GTMK 2YU9K 3CQZK 3HOWK 4A3BC 3GTQC 5IP9K 3RZOC 4MQ9A 5IYBC 1I3QK 4G7HA 3M3YK 3HOXK 3GTJC 2NVXC 4G7OA 4X6AC 2WB1L 4A3IC 3HOUK 3GTLC 3S1RC 2NVQK 4YG2A 4NOIA 3H3VL 4JK1A 4QIWD 1WCMK 2PA8D 4BY1C 4A3CC 1TWFC 4A3EC 1XPPA 4MEXA 4A3BK 5TMFA 2R7ZC 5C44K 2E2HC 3GTQK 3HOWC 3S15K 4A3FC 3RZOK 5TMCA 5IYBK 2O5JA 3GTJK 2NVXK 3GTGC 1HQMA 5FLMK 3HKZD 3I4MK 2JA8C 3HOZC 1I6HC 4A3CK 3WODA 3HOYC 3DXJA 4BY1K 1TWAK 1TWFK 4Y52C 4A3EK 3HOYK 4A3DC 5IYCC 1TWCC 1ZYRA 5C44C 4A3FK 3S15C 2Y0SD 3GTGK 4LK0A 3H0GK 2A68A 4QIWL 5M3FK 2PA8L 4A3KC 2JA8K 3HOZK 3S1MC 5FLMC 1I6HK 4BXXC 4AYBD 2A6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J C;  4Y52 K;  1TWA C;  3S16 K;  4A3G C;  4A3D K;  5IYC K;  4LJZ A;  3GTK C;  2NVY K;  1TWC K;  4XSZ A;  4KMU A;  4QJV A;  3HKZ L;  3I4M C;  5M5W K;  2WAQ D;  1Y1V C;  4C3J K;  1YNJ A;  4A3K K;  3S1M K;  4MEY A;  4Y7N C;  3H0G C;  4BXX K;  4OIP A;  1I50 K;  4YFK A;  4A3J K;  1TWH K;  3K7A C;  2JA7 C;  4A3G K;  4OIN A;  2E2I C;  3S16 C;  2VUM C;  3S17 C;  3GTK K;  3S14 C;  1SFO C;  3GTP C;  3S2D K;  2PMZ D;  2NVY C;  4A93 C;  1Y1V K;  3FKI C;  4AYB L;  1TWG C;  2A69 A;  4XLP A;  4Y7N K;  5M3M K;  1BDF A;  3RZD K;  1I50 C;  2JA6 C;  3K7A K;  4BY7 C;  5M5X K;  2JA7 K;  2PPB A;  1SMY A;  4OIQ A;  3M4O K;  5C4X C;  1TWH C;  2E2I K;  2JA5 C;  4Q4Z A;  2VUM K;  3S17 K;  3S14 K;  1SFO K;  3GTP K;  1I6V A;  3S2H C;  3I4N C;  4LLG A;  5C4J K;  4ZH4 A;  1IW7 A;  3PO3 C;  4A93 K;  3S2D C;  4GZY A;  3GTO C;  2R93 C;  3FKI K;  1TWG K;  2E2J C;  2B63 K;  3EQL A;  4A3M C;  1Y1W C;  2R92 K;  4OIO A;  5C3E K;  4A3L C;  1K83 C;  2JA6 K;  4BY7 K;  3S1N C;  3HOV C;  3S1Q C;  5IP7 C;  5C4X K;  3RZD C;  2JA5 K;  2PMZ L;  3I4N K;  3M4O C;  3S2H K;  2Y0S L;  4KN4 A;  2CW0 A;  3PO3 K;  5IYD C;  1R9T K;  4G7Z A;  5C4J C;  4YFX A;  3GTO K;  2R93 K;  3PO2 C;  4BBR C;  2E2J K;  4BBS C;  4C2M K;  4A3M K;  1Y1W K;  2B63 C;  4A3L K;  2WB1 D;  1K83 K;  2NVT K;  2O5I A;  4KN7 A;  2R92 C;  5C3E C;  4Q5S A;  3S1N K;  3HOV K;  4LK1 A;  4QJV B;  5IP7 K;  3H3V D;  3S1Q K;  3GTM C;  2YU9 C;  3CQZ C;  5IP9 C;  4X6A K;  2WAQ L;  5D4D A;  4XLN A;  5IYD K;  1I3Q C;  3M3Y C;  2BE5 A;  3HOX C;  4A3I K;  2A6E A;  1R9T C;  3PO2 K;  1YNN A;  4BBR K;  3S1R K;  3GTL K;  3HOU C;  4YFN A;  4BBS K;  4OIR A;  2NVQ C;  4C3H K;  1WCM C;  4XSX A;  2NVT C;  4C3I K;  5M5Y K;  5FJ8 K;  2R7Z K;  2E2H K;  3GTM K;  2YU9 K;  3CQZ K;  3HOW K;  4A3B C;  3GTQ C;  5IP9 K;  3RZO C;  4MQ9 A;  5IYB C;  1I3Q K;  4G7H A;  3M3Y K;  3HOX K;  3GTJ C;  2NVX C;  4G7O A;  4X6A C;  2WB1 L;  4A3I C;  3HOU K;  3GTL C;  3S1R C;  2NVQ K;  4YG2 A;  4NOI A;  3H3V L;  4JK1 A;  4QIW D;  1WCM K;  2PA8 D;  4BY1 C;  4A3C C;  1TWF C;  4A3E C;  1XPP A;  4MEX A;  4A3B K;  5TMF A;  2R7Z C;  5C44 K;  2E2H C;  3GTQ K;  3HOW C;  3S15 K;  4A3F C;  3RZO K;  5TMC A;  5IYB K;  2O5J A;  3GTJ K;  2NVX K;  3GTG C;  1HQM A;  5FLM K;  3HKZ D;  3I4M K;  2JA8 C;  3HOZ C;  1I6H C;  4A3C K;  3WOD A;  3HOY C;  3DXJ A;  4BY1 K;  1TWA K;  1TWF K;  4Y52 C;  4A3E K;  3HOY K;  4A3D C;  5IYC C;  1TWC C;  1ZYR A;  5C44 C;  4A3F K;  3S15 C;  2Y0S D;  3GTG K;  4LK0 A;  3H0G K;  2A68 A;  4QIW L;  5M3F K;  2PA8 L;  4A3K C;  2JA8 K;  3HOZ K;  3S1M C;  5FLM C;  1I6H K;  4BXX C;  4AYB D;  2A6H A; 
#chains in the Genus database with same CATH topology
 4A3J C;  2XCR B;  4A3G C;  1TWF A;  4LJZ A;  4XSZ A;  3AQO A;  1Y1V C;  1JVI A;  5IOS A;  1YNJ A;  4A3K K;  4MEY A;  1I3Q A;  4BXX K;  1TWH K;  4GFQ A;  4OIN A;  2XCO A;  2E2I C;  1DCH A;  3S2D K;  3S14 C;  1XZP B;  4A93 C;  5HL8 A;  1TWC A;  4M1X A;  4XLP A;  4Y7N K;  1EK8 A;  2JA6 C;  4OIQ A;  3IPJ A;  3N0C A;  5C4X C;  1TWH C;  1O29 A;  4Q4Z A;  1BJT A;  1SFO K;  3GTP K;  1I6V A;  3S2D C;  1IW7 A;  4GZY A;  4KB4 A;  3V4G A;  2E2J C;  5JVO A;  3GTG A;  1IE0 A;  3S1N C;  3S1Q C;  3TFJ A;  2PMZ L;  3I4N K;  4P9S A;  4G7Z A;  5EGH A;  1J6X A;  5TJ3 A;  4BBR C;  4BBS C;  4A3M K;  3ERE D;  1O2A A;  4FZB A;  4KN7 A;  3Q3Q A;  3GSI A;  4LK1 A;  4QJV B;  3LAJ A;  3GTM C;  2YU9 C;  3CQZ C;  1TWH A;  5IP9 C;  1VLO A;  1GE9 A;  1ZBS A;  3SZZ A;  4DDQ A;  3GTL K;  3PO2 K;  5CHP A;  4BLB A;  4C3H K;  5FJ8 K;  2R7Z K;  4XCH A;  3GTQ C;  1PJ5 A;  4G7H A;  3M3Y K;  2NVX C;  2WB1 L;  3GTL C;  2NVQ K;  4BY1 C;  4WJ3 M;  4A3E C;  1XZQ B;  4MEX A;  2R7Z C;  5C44 K;  3GTM A;  2CFA A;  1XXA A;  2Y3P A;  4A3F C;  2O5J A;  3MML B;  3I4M K;  1WOS A;  4A3C K;  3HOY C;  1TWF K;  4Y52 C;  1DD5 A;  4KMH A;  4J3N A;  1BS2 A;  1VJE A;  5C44 C;  2Y0S D;  3GTQ A;  4GTE A;  1C0A A;  4LK0 A;  2GSU A;  1O25 A;  2PA8 L;  1VRQ C;  4QIW L;  2JA8 K;  2NVX A;  3I4M C;  1EI6 A;  4RMF A;  3GTL A;  3S16 K;  1USO A;  5IOQ A;  4A3D K;  2FQT A;  3JST A;  1ZQ1 C;  3GTK C;  1TWC K;  2R7Z A;  3A8I A;  5M5W K;  2WAQ D;  3FHZ A;  3CAG A;  4OIP A;  4YFK A;  4A3J K;  1WOP A;  2RGR A;  2JA7 C;  4A3G K;  3S16 C;  2VUM C;  5EGE A;  2PMZ D;  1F7V A;  4P5A A;  1Y1V K;  3FKI C;  5E68 A;  3BUE A;  2A69 A;  4KAS A;  4KC6 A;  3RZD K;  4BY7 C;  1WIH A;  3M4O K;  2E2I K;  2FQO A;  2JA5 C;  3S14 K;  4KMD A;  4ZH4 A;  4A93 K;  3GTK A;  3GTO C;  1VH2 A;  2R93 C;  2B63 K;  4C2M C;  1Y1W C;  4OIO A;  5C3E K;  4BLA A;  2JA6 K;  2W7V A;  4GT9 A;  3HOV C;  4GTB A;  3RZD C;  5C4X K;  3M4O C;  2EBB A;  3GEE A;  2JA7 A;  2Y0S L;  3AD8 C;  3GDZ A;  2VUM A;  2E2J K;  3AD7 C;  3FKI A;  2B63 C;  2WB1 D;  4G0U A;  2O5I A;  5C3E C;  3S1N K;  4C3I C;  3S1Q K;  1VGX A;  2JA5 A;  2WAQ L;  4XLN A;  3QX3 A;  3HOX C;  4A3I K;  2A6E A;  1YNN A;  4BBR K;  3S1R K;  3HOU C;  4BBS K;  1Y1V A;  3GTM K;  3HOW K;  2YU9 K;  3CQZ K;  2V6T A;  5IP9 K;  1EFW A;  5IYB C;  2E2I A;  4GTL A;  4A3I C;  3S1R C;  4NOI A;  4QIW D;  2PA8 D;  1O27 A;  4O2D A;  2B63 A;  3LPX A;  1X31 C;  5TMF A;  3GTQ K;  3HOW C;  2JA6 A;  2ZFZ A;  5TMC A;  2NVX K;  5FLM K;  1I6H C;  3DXJ A;  4BY1 K;  3HXA A;  4A3E K;  3NUH A;  5IYC C;  1YX2 A;  1AB4 A;  4A3F K;  1WSV A;  4KB2 A;  3A8J A;  4KM9 A;  1ISE A;  5M3F K;  1INN A;  3OPF A;  3S1M C;  5FLM C;  2A6H A;  3HOY K;  4Y52 K;  2V6S A;  3L4J A;  3OEP A;  1B4B A;  1L0W A;  4LR2 A;  2YU9 A;  3CQZ A;  4C3J K;  2KWA A;  4KAW X;  1I50 K;  3K7A C;  3LAP A;  1WOO A;  3S17 C;  3GTK K;  1O28 A;  2ZUF A;  1TWG C;  4WIL A;  3SZY A;  4C3J C;  1EH1 A;  2V6U A;  3AD9 C;  5IOR A;  1I50 C;  3GIR A;  2JA7 K;  2PPB A;  3ADA C;  1KQ4 A;  2VUM K;  3S2H C;  1IBA A;  4KAR A;  1JQW A;  5C4J K;  4KM8 A;  3PO3 C;  1IQ0 A;  1PJ6 A;  4BKW A;  3FKI K;  5CJ9 A;  2R92 K;  4A3L C;  1K83 C;  4BY7 K;  3A8K A;  5IP7 C;  5L46 A;  2JA5 K;  4KN4 A;  3T00 A;  5IYD C;  1R9T K;  3GTO K;  5C4J C;  4YFX A;  2R93 K;  4C2M K;  1Y1W K;  1TWG A;  4FM9 A;  2R92 C;  1PJ7 A;  4G0W A;  3HOV K;  3GEI A;  1I50 A;  2GSO A;  3VA7 A;  3N3Y A;  1I3Q C;  1R9T C;  4WJ4 A;  2JH3 A;  4YFN A;  1G51 A;  3S0X A;  1WSR A;  4OIR A;  1J98 A;  1WCM C;  4C3I K;  5M5Y K;  1K83 A;  2E2H K;  4A3B C;  1WOR A;  4LOW A;  3RZO C;  3FOF A;  3HOX K;  3GTJ C;  5JFE A;  3HOU K;  2PHC B;  1XXC A;  1XZP A;  3H3V L;  4JK1 A;  1ZXO A;  4LQY A;  1B4A A;  1WQF A;  1XPP A;  1JOE A;  5IOT A;  2R92 A;  3AQP A;  2E2H C;  3S15 K;  4GTF A;  5IYB K;  3TFH A;  3GTG C;  2D6F C;  1HQM A;  3HOZ C;  1F7U A;  1R9T A;  3GTO A;  2R93 A;  1V5V A;  1TWA K;  1O2F B;  3BP8 C;  1WCM A;  1Y1W A;  3BP3 A;  3S15 C;  2P5M A;  3H0G K;  4A3K C;  1DCP A;  3GTJ A;  2GSN A;  3FOE A;  4BXX C;  4C45 A;  1I6H K;  2GAG C;  1F93 A;  3AH5 A;  1IL2 A;  4GTD A;  1TWA C;  3N0B A;  5IYC K;  1BGW A;  2NVY K;  4KMU A;  4QJV A;  3HKZ L;  2E2H A;  1UV7 A;  3S1M K;  4Y7N C;  3H0G C;  1O24 A;  4ILD A;  1J6W A;  1SFO C;  3GTP C;  4PAA A;  2NVY C;  2RH6 A;  4AYB L;  5M3M K;  1BDF A;  3K7A K;  5M5X K;  1SMY A;  1EQR A;  2GAH C;  3I4N C;  3S17 K;  1TWA A;  4LLG A;  1F9N A;  4KAT A;  1XZQ A;  1TWG K;  2XCQ A;  3EQL A;  4A3M C;  3H0G A;  3GEH A;  2ZUE A;  3S2H K;  2CW0 A;  3PO3 K;  3ORE A;  1SFO A;  3GTP A;  1XXB A;  3PO2 C;  2NVY A;  3TFI A;  1YCL A;  4C3H C;  1K83 K;  2NVT K;  1J6V A;  1HI9 A;  4A3L K;  4Q5S A;  2CFA B;  5IP7 K;  3H3V D;  1WQH A;  2P8T A;  3G4C A;  4X6A K;  5IYD K;  5D4D A;  3M3Y C;  2BE5 A;  3L4K A;  1RU0 A;  4KDD A;  1WQG A;  4KMA A;  2NVQ C;  4XSX A;  4PAB A;  2NVT C;  1ZVU A;  4GTC A;  3G4A A;  4MQ9 A;  1I3Q K;  4G7O A;  4X6A C;  4YG2 A;  4A3C C;  1WCM K;  1TWF C;  1USM A;  4A3B K;  3RZO K;  4G0V A;  4P5B A;  3GTJ K;  3HKZ D;  2JA8 C;  3T02 A;  4AH6 A;  3T01 A;  3WOD A;  4GTA A;  4A3D C;  1DCO A;  1TWC C;  1ZYR A;  1O2B A;  3GTG K;  2A68 A;  3HOZ K;  1IS1 A;  4AYB D;  3TTG A;  1O26 A; 
#chains in the Genus database with same CATH homology
 4A3J C;  4Y52 K;  1TWA C;  3S16 K;  4A3G C;  4A3D K;  5IYC K;  4LJZ A;  3GTK C;  2NVY K;  1TWC K;  4XSZ A;  4KMU A;  4QJV A;  3HKZ L;  3I4M C;  5M5W K;  2WAQ D;  1Y1V C;  4C3J K;  1YNJ A;  4A3K K;  3S1M K;  4MEY A;  4Y7N C;  3H0G C;  4BXX K;  4OIP A;  1I50 K;  4YFK A;  4A3J K;  1TWH K;  3K7A C;  2JA7 C;  4A3G K;  4OIN A;  2E2I C;  3S16 C;  2VUM C;  3S17 C;  3GTK K;  3S14 C;  1SFO C;  3GTP C;  3S2D K;  2PMZ D;  2NVY C;  4A93 C;  1Y1V K;  3FKI C;  4AYB L;  1TWG C;  2A69 A;  4XLP A;  4Y7N K;  5M3M K;  1BDF A;  3RZD K;  1I50 C;  2JA6 C;  3K7A K;  4BY7 C;  5M5X K;  2JA7 K;  2PPB A;  1SMY A;  4OIQ A;  3M4O K;  5C4X C;  1TWH C;  2E2I K;  2JA5 C;  4Q4Z A;  2VUM K;  3S17 K;  3S14 K;  1SFO K;  3GTP K;  1I6V A;  3S2H C;  3I4N C;  4LLG A;  5C4J K;  4ZH4 A;  1IW7 A;  3PO3 C;  4A93 K;  3S2D C;  4GZY A;  3GTO C;  2R93 C;  3FKI K;  1TWG K;  2E2J C;  2B63 K;  3EQL A;  4A3M C;  1Y1W C;  2R92 K;  4OIO A;  5C3E K;  4A3L C;  1K83 C;  2JA6 K;  4BY7 K;  3S1N C;  3HOV C;  3S1Q C;  5IP7 C;  5C4X K;  3RZD C;  2JA5 K;  2PMZ L;  3I4N K;  3M4O C;  3S2H K;  2Y0S L;  4KN4 A;  2CW0 A;  3PO3 K;  5IYD C;  1R9T K;  4G7Z A;  5C4J C;  4YFX A;  3GTO K;  2R93 K;  3PO2 C;  4BBR C;  2E2J K;  4BBS C;  4C2M K;  4A3M K;  1Y1W K;  2B63 C;  4A3L K;  2WB1 D;  1K83 K;  2NVT K;  2O5I A;  4KN7 A;  2R92 C;  5C3E C;  4Q5S A;  3S1N K;  3HOV K;  4LK1 A;  4QJV B;  5IP7 K;  3H3V D;  3S1Q K;  3GTM C;  2YU9 C;  3CQZ C;  5IP9 C;  4X6A K;  2WAQ L;  5D4D A;  4XLN A;  5IYD K;  1I3Q C;  3M3Y C;  2BE5 A;  3HOX C;  4A3I K;  2A6E A;  1R9T C;  3PO2 K;  1YNN A;  4BBR K;  3S1R K;  3GTL K;  3HOU C;  4YFN A;  4BBS K;  4OIR A;  2NVQ C;  4C3H K;  1WCM C;  4XSX A;  2NVT C;  4C3I K;  5M5Y K;  5FJ8 K;  2R7Z K;  2E2H K;  3GTM K;  2YU9 K;  3CQZ K;  3HOW K;  4A3B C;  3GTQ C;  5IP9 K;  3RZO C;  4MQ9 A;  5IYB C;  1I3Q K;  4G7H A;  3M3Y K;  3HOX K;  3GTJ C;  2NVX C;  4G7O A;  4X6A C;  2WB1 L;  4A3I C;  3HOU K;  3GTL C;  3S1R C;  2NVQ K;  4YG2 A;  4NOI A;  3H3V L;  4JK1 A;  4QIW D;  1WCM K;  2PA8 D;  4BY1 C;  4A3C C;  1TWF C;  4A3E C;  1XPP A;  4MEX A;  4A3B K;  5TMF A;  2R7Z C;  5C44 K;  2E2H C;  3GTQ K;  3HOW C;  3S15 K;  4A3F C;  3RZO K;  5TMC A;  5IYB K;  2O5J A;  3GTJ K;  2NVX K;  3GTG C;  1HQM A;  5FLM K;  3HKZ D;  3I4M K;  2JA8 C;  3HOZ C;  1I6H C;  4A3C K;  3WOD A;  3HOY C;  3DXJ A;  4BY1 K;  1TWA K;  1TWF K;  4Y52 C;  4A3E K;  3HOY K;  4A3D C;  5IYC C;  1TWC C;  1ZYR A;  5C44 C;  4A3F K;  3S15 C;  2Y0S D;  3GTG K;  4LK0 A;  3H0G K;  2A68 A;  4QIW L;  5M3F K;  2PA8 L;  4A3K C;  2JA8 K;  3HOZ K;  3S1M C;  5FLM C;  1I6H K;  4BXX C;  4AYB D;  2A6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...