2E2JK

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2jK00
3DXJA 4QJVA 1Y1VC 4A3GC 3GTQK 4BBRC 1TWCC 3S1RC 2JA8K 3S2DK 3CQZK 3HKZL 4A3DC 1Y1WC 2PA8L 2E2IK 5C4JK 5C44C 5IYDC 3HOYK 1I6HK 1R9TK 3S1QC 4QIWD 5IP7C 4A3IK 4Q5SA 3HOUC 2NVTK 3GTPK 3GTLK 1SFOK 4Y52K 5M5XK 5FLMK 4A3FC 1IW7A 2E2JK 2NVQC 3I4MK 4KN7A 1I50K 4OIPA 2R7ZC 3GTGC 3S17K 4A3CK 4G7OA 4X6AK 4YG2A 3GTQC 2JA8C 5IYBK 4MEXA 3CQZC 3S2DC 4Q4ZA 2E2IC 1I6HC 5C4JC 3HOYC 1R9TC 2R93K 4MEYA 1TWFK 2VUMK 2BE5A 4BY1K 3GTKC 2NVXK 2YU9K 3GTPC 3GTLC 4YFXA 1SFOC 3EQLA 5C3EK 5FLMC 2E2JC 3I4MC 5IYCK 2JA5K 4A3CC 1I50C 4X6AC 1YNJA 3S17C 3S1MK 5TMFA 1HQMA 1WCMK 1TWHK 2PMZL 4KMUA 4C3JK 3FKIK 4A3EK 2Y0SL 2JA7K 5IYBC 4LK1A 3S2HK 3GTMK 3HOWC 5M5YK 2A69A 4QJVB 2A6HA 2R93C 1TWAK 4YFNA 3PO3K 1TWFC 2VUMC 2B63C 4BY1C 2NVYK 2NVXC 4XSXA 4AYBL 2YU9C 4A93K 2JA6K 3HKZD 5C3EC 2PA8D 3M3YK 2PMZD 2O5JA 2JA5C 1YNNA 1ZYRA 4A3MK 3HOXK 3S1MC 5TMCA 2O5IA 1WCMC 1TWHC 1I3QK 3FKIC 4A3EC 2JA7C 3H3VL 4G7ZA 3GTMC 4A3IC 3GTJK 2WAQL 1BDFA 2NVTC 3S1NK 4A3KK 1TWAC 3PO3C 4Y52C 4GZYA 2NVYC 3HOZK 3HOVK 4A93C 4MQ9A 4OIOA 1K83K 2JA6C 3RZOC 3M3YC 4A3MC 1TWGK 3HOXC 2R92K 4BXXK 1I3QC 4A3JK 3I4NK 4A3LK 2WAQD 4C3HK 3S15K 4BY7K 3GTJC 5C4XK 5IP7K 4Y7NK 2PPBA 3S1NC 4A3KC 3M4OK 2A6EA 2CW0A 4NOIA 4QIWL 5IYCC 2E2HK 3HOVC 3GTOK 1K83C 2Y0SD 3S16C 5M5WK 4OIQA 2A68A 2WB1L 4JK1A 1TWGC 2R92C 3S2HC 4ZH4A 5IP9K 3H0GK 5M3FK 4BXXC 4XSZA 4A3JC 3I4NC 4A3LC 4AYBD 3S15C 3S14K 3PO2K 4A3BK 4LLGA 4BY7C 5C4XC 4Y7NC 1I6VA 4BBSK 3K7AK 3RZDK 5M3MK 3GTKK 3M4OC 5D4DA 1XPPA 4XLNA 2E2HC 3RZOK 3S16K 4G7HA 3GTOC 1Y1VK 4C3IK 2WB1D 3H3VD 4A3GK 4BBRK 1TWCK 3S1RK 4A3DK 1Y1WK 4OINA 5C44K 5IYDK 4LK0A 4OIRA 4C2MK 5IP9C 3S1QK 3H0GC 5FJ8K 3HOWK 1SMYA 3HOUK 3PO2C 4XLPA 3S14C 4A3BC 4KN4A 4LJZA 3WODA 3HOZC 4YFKA 4A3FK 2B63K 3K7AC 3RZDC 2NVQK 4BBSC 3GTGK 2R7ZK
chains in the Genus database with same CATH superfamily
4QJVA 2R92A 5IOQA 4A3GC 3HKZL 1BJTA 2PA8L 2E2IK 1IL2A 4BLAA 3OPFA 4G0VA 4QIWD 1XXCA 1DCPA 4A3IK 4Q5SA 4KAWX 1EFWA 4GTCA 3GTPK 5L46A 1V5VA 4Y52K 2E2JK 2NVQC 2EBBA 4KN7A 2R7ZC 3GDZA 4XCHA 3S17K 1G51A 1WOSA 4Q4ZA 3HOYC 3QX3A 2ZUFA 3LPXA 3LAJA 2YU9K 5FLMC 3TFIA 3I4MC 5IYCK 3AQPA 4RMFA 1Y1WA 5TMFA 2JA7K 5IYBC 3AH5A 4KMDA 2VUMC 2B63C 4BY1C 3AD8C 1F7VA 2ZFZA 2NVXC 3BUEA 3N0CA 2JA6K 5C3EC 2E2IA 3HOXK 1WCMC 4A3EC 4GTAA 3GTKA 3GEHA 3GTPA 2NVTC 3PO3C 2NVYC 4A93C 4J3NA 1TWGK 1I3QC 4GTLA 2YU9A 3GTJC 5IP7K 3T00A 2A6EA 2CW0A 4QIWL 2GSOA 1J98A 3GTOK 1K83C 3A8KA 1VH2A 2JA7A 2A68A 1L0WA 4KC6A 2R92C 5IP9K 5M3FK 4XSZA 3SZYA 4A3LC 3S14K 4A3BK 4BY7C 2JA6A 1F93A 3GSIA 5D4DA 1XPPA 3HXAA 4XLNA 2XCRB 3V4GA 1Y1VK 3H3VD 1O29A 4BBRK 1TWCK 4LK0A 1DD5A 3FOEA 1ZQ1C 1F7UA 1SMYA 4GTBA 2P5MA 2GAGC 3HOZC 4YFKA 5IOTA 3K7AC 3GTGK 1TWGA 3DXJA 4A3DC 3S2DK 3CQZK 1Y1WC 4C3HC 5C4JK 5C44C 4WILA 1O2AA 4GTFA 1JQWA 3GTLK 4KMHA 3OREA 5M5XK 1IW7A 1J6XA 4G7OA 4X6AK 5IOSA 4YG2A 1WOPA 2E2IC 3TFJA 2R93K 4WJ3M 4MEYA 4PABA 2RH6A 1IQ0A 3GTKC 3GTPC 1Y1VA 1ZBSA 4YFXA 3EQLA 2E2JC 1TWCA 2JA5K 1VJEA 1YNJA 4LOWA 3S17C 1C0AA 3FKIK 1WQFA 3VA7A 3CAGA 5M5YK 4KM9A 3MMLB 4QJVB 1UV7A 3GTGA 2YU9C 1USMA 3M3YK 2RGRA 2PMZD 1XZPA 3CQZA 1YNNA 3FHZA 2O5IA 2JA7C 3H3VL 5JFEA 1GE9A 1EQRA 3S1NK 1WSRA 1B4BA 4GZYA 1EH1A 3HOVK 2JA6C 4WJ4A 3HOXC 1XZQA 1WIHA 2D6FC 2R93A 3G4CA 4ILDA 3I4NK 2WAQD 3S15K 1O24A 2V6TA 2XCQA 4KB4A 4KDDA 4KM8A 1INNA 1AB4A 2JA5A 1ZVUA 1XZQB 2Y0SD 2P8TA 3FKIA 2WB1L 4JK1A 1TWGC 3S2HC 4LQYA 3AD9C 4AYBD 4LLGA 1I6VA 1WQHA 4BBSK 3RZDK 4PAAA 3RZOK 2ZUEA 4G7HA 3GTOC 1YX2A 4C3IK 2PHCB 3S1RK 3SZZA 1O27A 4C45A 5IYDK 1HI9A 4C2MK 4P9SA 1WORA 5IP9C 3S1QK 3S14C 3HOUK 3N0BA 4XLPA 4A3BC 4LJZA 3WODA 2B63K 4A3FK 1XXBA 3FOFA 1B4AA 1Y1VC 5CHPA 3GTQK 4BBRC 1TWCC 2JA8K 1I6HK 1R9TK 5TJ3A 2NVTK 1SFOK 4KARA 4A3CK 1I50K 3ADAC 3GTGC 4BKWA 3LAPA 4DDQA 4LR2A 3CQZC 3S2DC 3Q3QA 5C4JC 3BP3A 1TWFK 3N3YA 2BE5A 3GTLC 1VRQC 2FQTA 1DCHA 4X6AC 1J6VA 3S1MK 1HQMA 4KMUA 1TWHK 4C3JK 1O28A 3L4JA 2Y0SL 4LK1A 5IORA 3GTMK 3HOWC 2A69A 2R93C 2A6HA 1TWAK 3GTOA 1ZXOA 1O2BA 4AYBL 1WOOA 5HL8A 3GTQA 4GTDA 2JA5C 3OEPA 1ZYRA 2O5JA 4A3MK 2GSNA 5TMCA 1R9TA 1WSVA 3FKIC 3T02A 4M1XA 3AQOA 4A3IC 1IE0A 1BDFA 1SFOA 4A3KK 2GSUA 4FM9A 1X31C 4Y52C 2JH3A 1I50A 3HOZK 1F9NA 4MQ9A 4OIOA 3M3YC 3T01A 1XXAA 4BXXK 4A3JK 4C3HK 1TWFA 1VGXA 5C4XK 4G0WA 4Y7NK 3G4AA 3S1NC 3M4OK 2E2HK 5IYCC 3HOVC 2KWAA 1TWHA 2CFAA 1BGWA 5M5WK 4OIQA 3GTMA 3ERED 3H0GK 3GTLA 1TWAA 3I4NC 3S15C 1XZPB 3PO2K 2V6UA 1O26A 2CFAB 5JVOA 2Y3PA 1IS1A 5M3MK 3GTKK 3TTGA 3S16K 3L4KA 3S0XA 4A3GK 1RU0A 4OINA 2FQOA 4KN4A 4BBSC 2NVQK 3RZDC 3RZOC 2R7ZK 1ISEA 3AD7C 4C3IC 4AH6A 3A8IA 3S1RC 2V6SA 3HOYK 5IYDC 4C2MC 3S1QC 5IP7C 4GTEA 2E2HA 3HOUC 1KQ4A 4KATA 1DCOA 5FLMK 4A3FC 3I4MK 4OIPA 3JSTA 3H0GA 4GT9A 3GTQC 2JA8C 5IYBK 4MEXA 5CJ9A 1I6HC 1R9TC 1WQGA 2VUMK 4BY1K 1BS2A 2NVXK 1O25A 1SFOC 1O2FB 5C3EK 3BP8C 5EGEA 4A3CC 1I50C 1IBAA 1WCMK 2PMZL 1JOEA 4A3EK 3S2HK 4YFNA 3PO3K 1TWFC 2NVYK 2R7ZA 1JVIA 4XSXA 4A93K 3HKZD 1PJ5A 2XCOA 2PA8D 1J6WA 1EK8A 3S1MC 1VLOA 1YCLA 3GIRA 1TWHC 4C3JC 3GEIA 1I3QK 4G7ZA 3GTMC 3GTJK 2WAQL 1TWAC 3TFHA 1K83K 4KMAA 2GAHC 4A3MC 1USOA 4KASA 2R92K 5EGHA 4A3LK 2VUMA 2B63A 2NVXA 4BY7K 2PPBA 4A3KC 4O2DA 4NOIA 3NUHA 4P5AA 1WCMA 4GFQA 4BLBA 3A8JA 1EI6A 4ZH4A 4BXXC 4A3JC 2NVYA 4FZBA 4P5BA 5C4XC 3IPJA 4Y7NC 1PJ7A 3K7AK 3M4OC 2E2HC 1PJ6A 2WB1D 4KB2A 1I3QA 2W7VA 4A3DK 1Y1WK 5C44K 3GTJA 4OIRA 5E68A 3H0GC 5FJ8K 3HOWK 3PO2C 1K83A 4G0UA 3S16C 3GEEA
chains in the Genus database with same CATH topology
3DXJA 4QJVA 1Y1VC 4A3GC 3GTQK 4BBRC 1TWCC 3S1RC 2JA8K 3S2DK 3CQZK 3HKZL 4A3DC 1Y1WC 2PA8L 2E2IK 5C4JK 5C44C 5IYDC 3HOYK 1I6HK 1R9TK 3S1QC 4QIWD 5IP7C 4A3IK 4Q5SA 3HOUC 2NVTK 3GTPK 3GTLK 1SFOK 4Y52K 5M5XK 5FLMK 4A3FC 1IW7A 2E2JK 2NVQC 3I4MK 4KN7A 1I50K 4OIPA 2R7ZC 3GTGC 3S17K 4A3CK 4G7OA 4X6AK 4YG2A 3GTQC 2JA8C 5IYBK 4MEXA 3CQZC 3S2DC 4Q4ZA 2E2IC 1I6HC 5C4JC 3HOYC 1R9TC 2R93K 4MEYA 1TWFK 2VUMK 2BE5A 4BY1K 3GTKC 2NVXK 2YU9K 3GTPC 3GTLC 4YFXA 1SFOC 3EQLA 5C3EK 5FLMC 2E2JC 3I4MC 5IYCK 2JA5K 4A3CC 1I50C 4X6AC 1YNJA 3S17C 3S1MK 5TMFA 1HQMA 1WCMK 1TWHK 2PMZL 4KMUA 4C3JK 3FKIK 4A3EK 2Y0SL 2JA7K 5IYBC 4LK1A 3S2HK 3GTMK 3HOWC 5M5YK 2A69A 4QJVB 2A6HA 2R93C 1TWAK 4YFNA 3PO3K 1TWFC 2VUMC 2B63C 4BY1C 2NVYK 2NVXC 4XSXA 4AYBL 2YU9C 4A93K 2JA6K 3HKZD 5C3EC 2PA8D 3M3YK 2PMZD 2O5JA 2JA5C 1YNNA 1ZYRA 4A3MK 3HOXK 3S1MC 5TMCA 2O5IA 1WCMC 1TWHC 1I3QK 3FKIC 4A3EC 2JA7C 3H3VL 4G7ZA 3GTMC 4A3IC 3GTJK 2WAQL 1BDFA 2NVTC 3S1NK 4A3KK 1TWAC 3PO3C 4Y52C 4GZYA 2NVYC 3HOZK 3HOVK 4A93C 4MQ9A 4OIOA 1K83K 2JA6C 3RZOC 3M3YC 4A3MC 1TWGK 3HOXC 2R92K 4BXXK 1I3QC 4A3JK 3I4NK 4A3LK 2WAQD 4C3HK 3S15K 4BY7K 3GTJC 5C4XK 5IP7K 4Y7NK 2PPBA 3S1NC 4A3KC 3M4OK 2A6EA 2CW0A 4NOIA 4QIWL 5IYCC 2E2HK 3HOVC 3GTOK 1K83C 2Y0SD 3S16C 5M5WK 4OIQA 2A68A 2WB1L 4JK1A 1TWGC 2R92C 3S2HC 4ZH4A 5IP9K 3H0GK 5M3FK 4BXXC 4XSZA 4A3JC 3I4NC 4A3LC 4AYBD 3S15C 3S14K 3PO2K 4A3BK 4LLGA 4BY7C 5C4XC 4Y7NC 1I6VA 4BBSK 3K7AK 3RZDK 5M3MK 3GTKK 3M4OC 5D4DA 1XPPA 4XLNA 2E2HC 3RZOK 3S16K 4G7HA 3GTOC 1Y1VK 4C3IK 2WB1D 3H3VD 4A3GK 4BBRK 1TWCK 3S1RK 4A3DK 1Y1WK 4OINA 5C44K 5IYDK 4LK0A 4OIRA 4C2MK 5IP9C 3S1QK 3H0GC 5FJ8K 3HOWK 1SMYA 3HOUK 3PO2C 4XLPA 3S14C 4A3BC 4KN4A 4LJZA 3WODA 3HOZC 4YFKA 4A3FK 2B63K 3K7AC 3RZDC 2NVQK 4BBSC 3GTGK 2R7ZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXJ A;  4QJV A;  1Y1V C;  4A3G C;  3GTQ K;  4BBR C;  1TWC C;  3S1R C;  2JA8 K;  3S2D K;  3CQZ K;  3HKZ L;  4A3D C;  1Y1W C;  2PA8 L;  2E2I K;  5C4J K;  5C44 C;  5IYD C;  3HOY K;  1I6H K;  1R9T K;  3S1Q C;  4QIW D;  5IP7 C;  4A3I K;  4Q5S A;  3HOU C;  2NVT K;  3GTP K;  3GTL K;  1SFO K;  4Y52 K;  5M5X K;  5FLM K;  4A3F C;  1IW7 A;  2E2J K;  2NVQ C;  3I4M K;  4KN7 A;  1I50 K;  4OIP A;  2R7Z C;  3GTG C;  3S17 K;  4A3C K;  4G7O A;  4X6A K;  4YG2 A;  3GTQ C;  2JA8 C;  5IYB K;  4MEX A;  3CQZ C;  3S2D C;  4Q4Z A;  2E2I C;  1I6H C;  5C4J C;  3HOY C;  1R9T C;  2R93 K;  4MEY A;  1TWF K;  2VUM K;  2BE5 A;  4BY1 K;  3GTK C;  2NVX K;  2YU9 K;  3GTP C;  3GTL C;  4YFX A;  1SFO C;  3EQL A;  5C3E K;  5FLM C;  2E2J C;  3I4M C;  5IYC K;  2JA5 K;  4A3C C;  1I50 C;  4X6A C;  1YNJ A;  3S17 C;  3S1M K;  5TMF A;  1HQM A;  1WCM K;  1TWH K;  2PMZ L;  4KMU A;  4C3J K;  3FKI K;  4A3E K;  2Y0S L;  2JA7 K;  5IYB C;  4LK1 A;  3S2H K;  3GTM K;  3HOW C;  5M5Y K;  2A69 A;  4QJV B;  2A6H A;  2R93 C;  1TWA K;  4YFN A;  3PO3 K;  1TWF C;  2VUM C;  2B63 C;  4BY1 C;  2NVY K;  2NVX C;  4XSX A;  4AYB L;  2YU9 C;  4A93 K;  2JA6 K;  3HKZ D;  5C3E C;  2PA8 D;  3M3Y K;  2PMZ D;  2O5J A;  2JA5 C;  1YNN A;  1ZYR A;  4A3M K;  3HOX K;  3S1M C;  5TMC A;  2O5I A;  1WCM C;  1TWH C;  1I3Q K;  3FKI C;  4A3E C;  2JA7 C;  3H3V L;  4G7Z A;  3GTM C;  4A3I C;  3GTJ K;  2WAQ L;  1BDF A;  2NVT C;  3S1N K;  4A3K K;  1TWA C;  3PO3 C;  4Y52 C;  4GZY A;  2NVY C;  3HOZ K;  3HOV K;  4A93 C;  4MQ9 A;  4OIO A;  1K83 K;  2JA6 C;  3RZO C;  3M3Y C;  4A3M C;  1TWG K;  3HOX C;  2R92 K;  4BXX K;  1I3Q C;  4A3J K;  3I4N K;  4A3L K;  2WAQ D;  4C3H K;  3S15 K;  4BY7 K;  3GTJ C;  5C4X K;  5IP7 K;  4Y7N K;  2PPB A;  3S1N C;  4A3K C;  3M4O K;  2A6E A;  2CW0 A;  4NOI A;  4QIW L;  5IYC C;  2E2H K;  3HOV C;  3GTO K;  1K83 C;  2Y0S D;  3S16 C;  5M5W K;  4OIQ A;  2A68 A;  2WB1 L;  4JK1 A;  1TWG C;  2R92 C;  3S2H C;  4ZH4 A;  5IP9 K;  3H0G K;  5M3F K;  4BXX C;  4XSZ A;  4A3J C;  3I4N C;  4A3L C;  4AYB D;  3S15 C;  3S14 K;  3PO2 K;  4A3B K;  4LLG A;  4BY7 C;  5C4X C;  4Y7N C;  1I6V A;  4BBS K;  3K7A K;  3RZD K;  5M3M K;  3GTK K;  3M4O C;  5D4D A;  1XPP A;  4XLN A;  2E2H C;  3RZO K;  3S16 K;  4G7H A;  3GTO C;  1Y1V K;  4C3I K;  2WB1 D;  3H3V D;  4A3G K;  4BBR K;  1TWC K;  3S1R K;  4A3D K;  1Y1W K;  4OIN A;  5C44 K;  5IYD K;  4LK0 A;  4OIR A;  4C2M K;  5IP9 C;  3S1Q K;  3H0G C;  5FJ8 K;  3HOW K;  1SMY A;  3HOU K;  3PO2 C;  4XLP A;  3S14 C;  4A3B C;  4KN4 A;  4LJZ A;  3WOD A;  3HOZ C;  4YFK A;  4A3F K;  2B63 K;  3K7A C;  3RZD C;  2NVQ K;  4BBS C;  3GTG K;  2R7Z K; 
#chains in the Genus database with same CATH topology
 4QJV A;  2R92 A;  5IOQ A;  4A3G C;  3HKZ L;  1BJT A;  2PA8 L;  2E2I K;  1IL2 A;  4BLA A;  3OPF A;  4G0V A;  4QIW D;  1XXC A;  1DCP A;  4A3I K;  4Q5S A;  4KAW X;  1EFW A;  4GTC A;  3GTP K;  5L46 A;  1V5V A;  4Y52 K;  2E2J K;  2NVQ C;  2EBB A;  4KN7 A;  2R7Z C;  3GDZ A;  4XCH A;  3S17 K;  1G51 A;  1WOS A;  4Q4Z A;  3HOY C;  3QX3 A;  2ZUF A;  3LPX A;  3LAJ A;  2YU9 K;  5FLM C;  3TFI A;  3I4M C;  5IYC K;  3AQP A;  4RMF A;  1Y1W A;  5TMF A;  2JA7 K;  5IYB C;  3AH5 A;  4KMD A;  2VUM C;  2B63 C;  4BY1 C;  3AD8 C;  1F7V A;  2ZFZ A;  2NVX C;  3BUE A;  3N0C A;  2JA6 K;  5C3E C;  2E2I A;  3HOX K;  1WCM C;  4A3E C;  4GTA A;  3GTK A;  3GEH A;  3GTP A;  2NVT C;  3PO3 C;  2NVY C;  4A93 C;  4J3N A;  1TWG K;  1I3Q C;  4GTL A;  2YU9 A;  3GTJ C;  5IP7 K;  3T00 A;  2A6E A;  2CW0 A;  4QIW L;  2GSO A;  1J98 A;  3GTO K;  1K83 C;  3A8K A;  1VH2 A;  2JA7 A;  2A68 A;  1L0W A;  4KC6 A;  2R92 C;  5IP9 K;  5M3F K;  4XSZ A;  3SZY A;  4A3L C;  3S14 K;  4A3B K;  4BY7 C;  2JA6 A;  1F93 A;  3GSI A;  5D4D A;  1XPP A;  3HXA A;  4XLN A;  2XCR B;  3V4G A;  1Y1V K;  3H3V D;  1O29 A;  4BBR K;  1TWC K;  4LK0 A;  1DD5 A;  3FOE A;  1ZQ1 C;  1F7U A;  1SMY A;  4GTB A;  2P5M A;  2GAG C;  3HOZ C;  4YFK A;  5IOT A;  3K7A C;  3GTG K;  1TWG A;  3DXJ A;  4A3D C;  3S2D K;  3CQZ K;  1Y1W C;  4C3H C;  5C4J K;  5C44 C;  4WIL A;  1O2A A;  4GTF A;  1JQW A;  3GTL K;  4KMH A;  3ORE A;  5M5X K;  1IW7 A;  1J6X A;  4G7O A;  4X6A K;  5IOS A;  4YG2 A;  1WOP A;  2E2I C;  3TFJ A;  2R93 K;  4WJ3 M;  4MEY A;  4PAB A;  2RH6 A;  1IQ0 A;  3GTK C;  3GTP C;  1Y1V A;  1ZBS A;  4YFX A;  3EQL A;  2E2J C;  1TWC A;  2JA5 K;  1VJE A;  1YNJ A;  4LOW A;  3S17 C;  1C0A A;  3FKI K;  1WQF A;  3VA7 A;  3CAG A;  5M5Y K;  4KM9 A;  3MML B;  4QJV B;  1UV7 A;  3GTG A;  2YU9 C;  1USM A;  3M3Y K;  2RGR A;  2PMZ D;  1XZP A;  3CQZ A;  1YNN A;  3FHZ A;  2O5I A;  2JA7 C;  3H3V L;  5JFE A;  1GE9 A;  1EQR A;  3S1N K;  1WSR A;  1B4B A;  4GZY A;  1EH1 A;  3HOV K;  2JA6 C;  4WJ4 A;  3HOX C;  1XZQ A;  1WIH A;  2D6F C;  2R93 A;  3G4C A;  4ILD A;  3I4N K;  2WAQ D;  3S15 K;  1O24 A;  2V6T A;  2XCQ A;  4KB4 A;  4KDD A;  4KM8 A;  1INN A;  1AB4 A;  2JA5 A;  1ZVU A;  1XZQ B;  2Y0S D;  2P8T A;  3FKI A;  2WB1 L;  4JK1 A;  1TWG C;  3S2H C;  4LQY A;  3AD9 C;  4AYB D;  4LLG A;  1I6V A;  1WQH A;  4BBS K;  3RZD K;  4PAA A;  3RZO K;  2ZUE A;  4G7H A;  3GTO C;  1YX2 A;  4C3I K;  2PHC B;  3S1R K;  3SZZ A;  1O27 A;  4C45 A;  5IYD K;  1HI9 A;  4C2M K;  4P9S A;  1WOR A;  5IP9 C;  3S1Q K;  3S14 C;  3HOU K;  3N0B A;  4XLP A;  4A3B C;  4LJZ A;  3WOD A;  2B63 K;  4A3F K;  1XXB A;  3FOF A;  1B4A A;  1Y1V C;  5CHP A;  3GTQ K;  4BBR C;  1TWC C;  2JA8 K;  1I6H K;  1R9T K;  5TJ3 A;  2NVT K;  1SFO K;  4KAR A;  4A3C K;  1I50 K;  3ADA C;  3GTG C;  4BKW A;  3LAP A;  4DDQ A;  4LR2 A;  3CQZ C;  3S2D C;  3Q3Q A;  5C4J C;  3BP3 A;  1TWF K;  3N3Y A;  2BE5 A;  3GTL C;  1VRQ C;  2FQT A;  1DCH A;  4X6A C;  1J6V A;  3S1M K;  1HQM A;  4KMU A;  1TWH K;  4C3J K;  1O28 A;  3L4J A;  2Y0S L;  4LK1 A;  5IOR A;  3GTM K;  3HOW C;  2A69 A;  2R93 C;  2A6H A;  1TWA K;  3GTO A;  1ZXO A;  1O2B A;  4AYB L;  1WOO A;  5HL8 A;  3GTQ A;  4GTD A;  2JA5 C;  3OEP A;  1ZYR A;  2O5J A;  4A3M K;  2GSN A;  5TMC A;  1R9T A;  1WSV A;  3FKI C;  3T02 A;  4M1X A;  3AQO A;  4A3I C;  1IE0 A;  1BDF A;  1SFO A;  4A3K K;  2GSU A;  4FM9 A;  1X31 C;  4Y52 C;  2JH3 A;  1I50 A;  3HOZ K;  1F9N A;  4MQ9 A;  4OIO A;  3M3Y C;  3T01 A;  1XXA A;  4BXX K;  4A3J K;  4C3H K;  1TWF A;  1VGX A;  5C4X K;  4G0W A;  4Y7N K;  3G4A A;  3S1N C;  3M4O K;  2E2H K;  5IYC C;  3HOV C;  2KWA A;  1TWH A;  2CFA A;  1BGW A;  5M5W K;  4OIQ A;  3GTM A;  3ERE D;  3H0G K;  3GTL A;  1TWA A;  3I4N C;  3S15 C;  1XZP B;  3PO2 K;  2V6U A;  1O26 A;  2CFA B;  5JVO A;  2Y3P A;  1IS1 A;  5M3M K;  3GTK K;  3TTG A;  3S16 K;  3L4K A;  3S0X A;  4A3G K;  1RU0 A;  4OIN A;  2FQO A;  4KN4 A;  4BBS C;  2NVQ K;  3RZD C;  3RZO C;  2R7Z K;  1ISE A;  3AD7 C;  4C3I C;  4AH6 A;  3A8I A;  3S1R C;  2V6S A;  3HOY K;  5IYD C;  4C2M C;  3S1Q C;  5IP7 C;  4GTE A;  2E2H A;  3HOU C;  1KQ4 A;  4KAT A;  1DCO A;  5FLM K;  4A3F C;  3I4M K;  4OIP A;  3JST A;  3H0G A;  4GT9 A;  3GTQ C;  2JA8 C;  5IYB K;  4MEX A;  5CJ9 A;  1I6H C;  1R9T C;  1WQG A;  2VUM K;  4BY1 K;  1BS2 A;  2NVX K;  1O25 A;  1SFO C;  1O2F B;  5C3E K;  3BP8 C;  5EGE A;  4A3C C;  1I50 C;  1IBA A;  1WCM K;  2PMZ L;  1JOE A;  4A3E K;  3S2H K;  4YFN A;  3PO3 K;  1TWF C;  2NVY K;  2R7Z A;  1JVI A;  4XSX A;  4A93 K;  3HKZ D;  1PJ5 A;  2XCO A;  2PA8 D;  1J6W A;  1EK8 A;  3S1M C;  1VLO A;  1YCL A;  3GIR A;  1TWH C;  4C3J C;  3GEI A;  1I3Q K;  4G7Z A;  3GTM C;  3GTJ K;  2WAQ L;  1TWA C;  3TFH A;  1K83 K;  4KMA A;  2GAH C;  4A3M C;  1USO A;  4KAS A;  2R92 K;  5EGH A;  4A3L K;  2VUM A;  2B63 A;  2NVX A;  4BY7 K;  2PPB A;  4A3K C;  4O2D A;  4NOI A;  3NUH A;  4P5A A;  1WCM A;  4GFQ A;  4BLB A;  3A8J A;  1EI6 A;  4ZH4 A;  4BXX C;  4A3J C;  2NVY A;  4FZB A;  4P5B A;  5C4X C;  3IPJ A;  4Y7N C;  1PJ7 A;  3K7A K;  3M4O C;  2E2H C;  1PJ6 A;  2WB1 D;  4KB2 A;  1I3Q A;  2W7V A;  4A3D K;  1Y1W K;  5C44 K;  3GTJ A;  4OIR A;  5E68 A;  3H0G C;  5FJ8 K;  3HOW K;  3PO2 C;  1K83 A;  4G0U A;  3S16 C;  3GEE A; 
#chains in the Genus database with same CATH homology
 3DXJ A;  4QJV A;  1Y1V C;  4A3G C;  3GTQ K;  4BBR C;  1TWC C;  3S1R C;  2JA8 K;  3S2D K;  3CQZ K;  3HKZ L;  4A3D C;  1Y1W C;  2PA8 L;  2E2I K;  5C4J K;  5C44 C;  5IYD C;  3HOY K;  1I6H K;  1R9T K;  3S1Q C;  4QIW D;  5IP7 C;  4A3I K;  4Q5S A;  3HOU C;  2NVT K;  3GTP K;  3GTL K;  1SFO K;  4Y52 K;  5M5X K;  5FLM K;  4A3F C;  1IW7 A;  2E2J K;  2NVQ C;  3I4M K;  4KN7 A;  1I50 K;  4OIP A;  2R7Z C;  3GTG C;  3S17 K;  4A3C K;  4G7O A;  4X6A K;  4YG2 A;  3GTQ C;  2JA8 C;  5IYB K;  4MEX A;  3CQZ C;  3S2D C;  4Q4Z A;  2E2I C;  1I6H C;  5C4J C;  3HOY C;  1R9T C;  2R93 K;  4MEY A;  1TWF K;  2VUM K;  2BE5 A;  4BY1 K;  3GTK C;  2NVX K;  2YU9 K;  3GTP C;  3GTL C;  4YFX A;  1SFO C;  3EQL A;  5C3E K;  5FLM C;  2E2J C;  3I4M C;  5IYC K;  2JA5 K;  4A3C C;  1I50 C;  4X6A C;  1YNJ A;  3S17 C;  3S1M K;  5TMF A;  1HQM A;  1WCM K;  1TWH K;  2PMZ L;  4KMU A;  4C3J K;  3FKI K;  4A3E K;  2Y0S L;  2JA7 K;  5IYB C;  4LK1 A;  3S2H K;  3GTM K;  3HOW C;  5M5Y K;  2A69 A;  4QJV B;  2A6H A;  2R93 C;  1TWA K;  4YFN A;  3PO3 K;  1TWF C;  2VUM C;  2B63 C;  4BY1 C;  2NVY K;  2NVX C;  4XSX A;  4AYB L;  2YU9 C;  4A93 K;  2JA6 K;  3HKZ D;  5C3E C;  2PA8 D;  3M3Y K;  2PMZ D;  2O5J A;  2JA5 C;  1YNN A;  1ZYR A;  4A3M K;  3HOX K;  3S1M C;  5TMC A;  2O5I A;  1WCM C;  1TWH C;  1I3Q K;  3FKI C;  4A3E C;  2JA7 C;  3H3V L;  4G7Z A;  3GTM C;  4A3I C;  3GTJ K;  2WAQ L;  1BDF A;  2NVT C;  3S1N K;  4A3K K;  1TWA C;  3PO3 C;  4Y52 C;  4GZY A;  2NVY C;  3HOZ K;  3HOV K;  4A93 C;  4MQ9 A;  4OIO A;  1K83 K;  2JA6 C;  3RZO C;  3M3Y C;  4A3M C;  1TWG K;  3HOX C;  2R92 K;  4BXX K;  1I3Q C;  4A3J K;  3I4N K;  4A3L K;  2WAQ D;  4C3H K;  3S15 K;  4BY7 K;  3GTJ C;  5C4X K;  5IP7 K;  4Y7N K;  2PPB A;  3S1N C;  4A3K C;  3M4O K;  2A6E A;  2CW0 A;  4NOI A;  4QIW L;  5IYC C;  2E2H K;  3HOV C;  3GTO K;  1K83 C;  2Y0S D;  3S16 C;  5M5W K;  4OIQ A;  2A68 A;  2WB1 L;  4JK1 A;  1TWG C;  2R92 C;  3S2H C;  4ZH4 A;  5IP9 K;  3H0G K;  5M3F K;  4BXX C;  4XSZ A;  4A3J C;  3I4N C;  4A3L C;  4AYB D;  3S15 C;  3S14 K;  3PO2 K;  4A3B K;  4LLG A;  4BY7 C;  5C4X C;  4Y7N C;  1I6V A;  4BBS K;  3K7A K;  3RZD K;  5M3M K;  3GTK K;  3M4O C;  5D4D A;  1XPP A;  4XLN A;  2E2H C;  3RZO K;  3S16 K;  4G7H A;  3GTO C;  1Y1V K;  4C3I K;  2WB1 D;  3H3V D;  4A3G K;  4BBR K;  1TWC K;  3S1R K;  4A3D K;  1Y1W K;  4OIN A;  5C44 K;  5IYD K;  4LK0 A;  4OIR A;  4C2M K;  5IP9 C;  3S1Q K;  3H0G C;  5FJ8 K;  3HOW K;  1SMY A;  3HOU K;  3PO2 C;  4XLP A;  3S14 C;  4A3B C;  4KN4 A;  4LJZ A;  3WOD A;  3HOZ C;  4YFK A;  4A3F K;  2B63 K;  3K7A C;  3RZD C;  2NVQ K;  4BBS C;  3GTG K;  2R7Z K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...