2E2JK

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2jK00
4XSZA 1Y1VK 3S14C 1K83K 4A3GK 2JA6K 5C44C 3PO3C 4BY7K 1TWCC 4AYBL 3RZOC 5M5YK 5IYBC 3GTQK 1TWGK 2E2HC 3GTOK 3S1MC 1I6HK 4A3CC 1SFOK 3S15K 1I6VA 4A3EC 5M5XK 4BBRC 2YU9C 3HOWC 1ZYRA 3GTMK 4Y52K 3GTJC 3H3VD 4A3KK 3S16C 3S2HC 3GTLK 4OIOA 4QIWL 4A3LK 3GTGC 5C4JK 3M3YK 1I3QC 3HOXK 2WAQD 2PA8D 3PO2K 5IYDK 2JA7C 4YG2A 3WODA 3GTKC 3HOVC 4A3BK 5C3EK 5M3FK 5IP9C 4G7ZA 2Y0SL 2NVYK 5M5WK 5TMFA 2NVQK 2CW0A 2VUMC 3HOZK 3I4MC 2JA5C 2E2IC 4KN4A 1TWAC 1SMYA 3GTPK 4A93K 4A3DC 4YFNA 3HOUK 4XSXA 4LK1A 3M4OC 4C3HK 2E2JC 1TWFC 3K7AK 3S17K 3HOYK 4LJZA 4Y7NC 5IYCK 1Y1VC 4Q4ZA 4A3IK 1Y1WK 3I4NC 3S1QC 3S1NK 4QJVB 4GZYA 4BY7C 4BY1K 2A6EA 5C4XC 2NVXC 2O5JA 1TWGC 1WCMK 4G7HA 4MQ9A 2NVTK 1I6HC 4X6AK 3H0GC 1BDFA 2WB1L 5FLMC 3S15C 2R93K 4OINA 4YFXA 1I50K 1R9TC 5M3MK 3RZDK 4Y52C 3S2DK 4MEXA 4BBSC 3CQZC 3HKZD 4XLNA 4A3KC 3FKIK 3GTLC 4OIRA 5D4DA 2R92K 1TWCK 2PPBA 2R7ZC 5C4JC 3M3YC 3RZOK 4A3FC 2PMZD 3PO2C 5IYBK 1TWHC 5IYDC 4A3MC 2E2HK 3S1MK 2Y0SD 4XLPA 4C2MK 5FJ8K 4A3EK 3HOZC 4BBRK 2YU9K 4A3JK 2A68A 4LK0A 2B63K 3GTPC 3HOWK 3HOUC 4A93C 3GTJK 5TMCA 2A6HA 1K83C 3H3VL 4A3GC 2JA6C 3HOYC 3S17C 4AYBD 4QJVA 5IYCC 4A3IC 3S1RK 4JK1A 3DXJA 1I3QK 1IW7A 4ZH4A 2WAQL 2PA8L 5IP7K 1HQMA 3GTOC 3GTQC 2JA8K 3HOVK 1SFOC 5IP9K 4OIQA 1WCMC 3I4MK 4X6AC 2JA5K 3GTMC 3M4OK 4BXXK 4NOIA 3S14K 2R93C 4LLGA 2E2JK 1I50C 1TWFK 4QIWD 5C44K 4Y7NK 3PO3K 4A3LC 4OIPA 3FKIC 3HOXC 3I4NK 3S1QK 4A3BC 4KMUA 2R92C 5C3EC 4A3CK 2BE5A 5C4XK 2NVYC 2NVXK 2NVQC 4BXXC 4C3IK 3H0GK 5FLMK 3S2HK 3S16K 1XPPA 3K7AC 4C3JK 4A3JC 1R9TK 2B63C 4G7OA 1Y1WC 4BBSK 3GTGK 3CQZK 3HKZL 2A69A 3S1NC 1YNNA 2JA7K 4BY1C 3S1RC 3GTKK 2R7ZK 4Q5SA 4A3FK 4KN7A 1YNJA 5IP7C 2PMZL 1TWHK 4YFKA 3EQLA 4A3MK 2NVTC 2JA8C 2VUMK 2E2IK 2WB1D 1TWAK 4MEYA 4A3DK 2O5IA 3S2DC 3RZDC
chains in the Genus database with same CATH superfamily
3S14C 4PAAA 1K83K 4A3GK 2B63A 3TFHA 1B4BA 4O2DA 3GTOK 1I6VA 4GTFA 4KMHA 1WQGA 1EK8A 3GTJC 1L0WA 2PHCB 4QIWL 3PO2K 2XCOA 2JA7C 3WODA 3SZZA 5EGEA 4G7ZA 4BXXK 2JA5C 2E2IC 1ISEA 1SMYA 3GTPK 4A3DC 3M4OC 2V6TA 3K7AK 3HOYK 5IYCK 1Y1VC 4A3IK 3S1QC 4P9SA 2JH3A 3GTGA 1J6XA 2NVXC 3GTKA 3S15C 5FLMC 2R93K 4C3JC 1I50K 4YFXA 5M3MK 3A8KA 4Y52C 4BBSC 4A3KC 3Q3QA 3GTLC 4FZBA 1IBAA 1XZQB 4A3MC 2Y0SD 3MMLB 4BKWA 4A3JK 2A68A 3H0GA 3HOUC 3GTJK 4GTLA 2JA6C 4QJVA 3GTQC 4ZH4A 4KARA 2PA8L 1SFOC 4OIQA 1PJ7A 1VRQC 3G4CA 1TWHA 1IS1A 4G0WA 2JA5K 3M4OK 1DD5A 1VJEA 3GTPA 3FHZA 3FKIC 3S1QK 3T01A 4KMUA 5C3EC 3AD9C 3A8JA 2NVXK 2P5MA 2XCRB 5FLMK 1O25A 4C3HC 1IL2A 1WSRA 4C3JK 5IOSA 5E68A 4BBSK 3AD7C 2R93A 3HKZL 1I50A 3GDZA 4LQYA 4KN7A 2VUMK 3OEPA 3L4KA 4A3MK 3EQLA 4G0UA 2JA8C 2NVTC 4MEYA 2NVYA 4WJ4A 2O5IA 3S2DC 4G0VA 3TFIA 2JA6K 4BY7K 1VLOA 1Y1WA 1XZPA 5IYBC 3GTQK 3S1MC 1I6HK 1SFOK 2GAGC 4FM9A 3GSIA 3H3VD 3S16C 3M3YK 5C4JK 1I3QC 4KASA 1ZVUA 4KC6A 5IYDK 1O24A 5C3EK 5M3FK 2P8TA 2E2HA 4KM8A 1TWAC 4A93K 4XSXA 4C3HK 1TWFC 2YU9A 1BJTA 1PJ5A 4LJZA 3S17K 1YCLA 4GZYA 5C4XC 1EFWA 1TWGC 1WCMK 2CFAB 1F7UA 2NVTK 1VGXA 2ZUEA 5TJ3A 2VUMA 4M1XA 3S2DK 4MEXA 2V6UA 5D4DA 3LAPA 3TTGA 2PPBA 2R7ZC 1WOOA 2PMZD 1WIHA 5IYBK 1B4AA 3GEHA 3S1MK 4XLPA 2FQOA 5FJ8K 3HOZC 4KB2A 3GIRA 3V4GA 1JQWA 3NUHA 3G4AA 1XXBA 1R9TA 1UV7A 3GEIA 4AYBD 4KM9A 3S1RK 1AB4A 3CQZA 3AH5A 1I3QK 3N0CA 5IP7K 1HQMA 1J6WA 3VA7A 1IE0A 1BS2A 4GTEA 4LOWA 4X6AC 3GTMC 4NOIA 3S14K 5IOTA 1TWFK 3AQOA 1WSVA 2ZUFA 1K83A 3AD8C 4A3BC 2R92C 2BE5A 2RH6A 5C4XK 2NVQC 3GTOA 4WJ3M 1USMA 1WCMA 2B63C 4G7OA 3ADAC 5CHPA 3AQPA 3S1NC 2RGRA 2JA7K 2R7ZK 1XXCA 5L46A 4C45A 3LAJA 5JFEA 2E2IK 1O28A 2WB1D 1USOA 4A3DK 4J3NA 2D6FC 4DDQA 2GSOA 1Y1VK 1XXAA 4GT9A 1O2BA 5C44C 3GEEA 1TWCC 3PO3C 5M5YK 3T02A 4A3CC 4P5BA 3S15K 1JVIA 3HOWC 3GTMK 4C3IC 2GSUA 4Y52K 3S2HC 2KWAA 2FQTA 4A3KK 3GTLK 3GTGC 2Y3PA 2WAQD 1J98A 4A3BK 3HOVC 3GTKC 3A8IA 4GTDA 2NVQK 5TMFA 2CW0A 3SZYA 3HOUK 4LK1A 3GTJA 3S1NK 4QJVB 1PJ6A 4P5AA 2A6EA 2O5JA 4G7HA 4KMAA 4MQ9A 2JA7A 5IOQA 3CAGA 1G51A 3H0GC 1BDFA 4LR2A 5JVOA 2JA5A 2E2IA 3QX3A 4KB4A 1DCPA 3FKIK 4OIRA 2V6SA 1TWCK 1O2AA 1Y1VA 4A3FC 3PO2C 1TWHC 2NVXA 4GTAA 4GTBA 3HOWK 3GTPC 3ERED 2A6HA 4GTCA 3H3VL 3HOYC 3GTMA 5IYCC 4A3IC 3GTLA 1IW7A 4AH6A 3HOVK 2JA8K 1V5VA 3T00A 2R93C 4LLGA 1I50C 4QIWD 4A3LC 3HOXC 2JA6A 4KMDA 1ZBSA 1XZQA 1XZPB 2NVYC 4XCHA 3GTQA 4PABA 1SFOA 3H0GK 1JOEA 3S16K 4A3JC 1YX2A 1KQ4A 1Y1WC 2A69A 3FOFA 4RMFA 4BY1C 1J6VA 5HL8A 3FKIA 5EGHA 4A3FK 2PMZL 1INNA 1TWHK 4YFKA 1TWCA 2XCQA 1TWAK 1DCOA 1O27A 1WQFA 3RZDC 4XSZA 5IORA 1EH1A 4GFQA 4AYBL 3RZOC 1EI6A 1TWGK 2E2HC 1WQHA 4C2MC 4A3EC 5M5XK 4BBRC 1HI9A 2YU9C 1EQRA 1ZYRA 1VH2A 4OIOA 4A3LK 1ZXOA 3HOXK 2PA8D 2GAHC 4YG2A 4WILA 5IP9C 2NVYK 2Y0SL 5M5WK 2VUMC 3HOZK 3I4MC 4KN4A 2W7VA 4YFNA 1DCHA 2E2JC 3JSTA 4Y7NC 4Q4ZA 1Y1WK 1WORA 3I4NC 3N0BA 4BY7C 4BY1K 1I3QA 2EBBA 1I6HC 4X6AK 2WB1L 4OINA 1IQ0A 1R9TC 3RZDK 1TWAA 3LPXA 4KATA 3CQZC 3HKZD 4XLNA 3OREA 1TWFA 2R92K 3M3YC 5C4JC 3RZOK 4KDDA 5IYDC 2E2HK 4BLBA 1RU0A 4KAWX 4C2MK 1WOSA 4A3EK 1TWGA 4BBRK 2YU9K 4LK0A 2B63K 4A93C 1F9NA 5TMCA 1K83C 4A3GC 4ILDA 1O26A 3S17C 4BLAA 3HXAA 4JK1A 3DXJA 3S0XA 1WOPA 3BP8C 2WAQL 1GE9A 3GTOC 1X31C 1O2FB 2CFAA 2R7ZA 5IP9K 1O29A 1WCMC 3I4MK 1BGWA 1C0AA 2E2JK 3L4JA 2GSNA 2ZFZA 5C44K 4Y7NK 3PO3K 3IPJA 4OIPA 3I4NK 1ZQ1C 3BUEA 5CJ9A 1F7VA 4A3CK 1F93A 3BP3A 4BXXC 4C3IK 3S2HK 1XPPA 3TFJA 3K7AC 1R9TK 3GTGK 3CQZK 1YNNA 3FOEA 3S1RC 3GTKK 4Q5SA 1YNJA 5IP7C 2R92A 3N3YA 3OPFA
chains in the Genus database with same CATH topology
4XSZA 1Y1VK 3S14C 1K83K 4A3GK 2JA6K 5C44C 3PO3C 4BY7K 1TWCC 4AYBL 3RZOC 5M5YK 5IYBC 3GTQK 1TWGK 2E2HC 3GTOK 3S1MC 1I6HK 4A3CC 1SFOK 3S15K 1I6VA 4A3EC 5M5XK 4BBRC 2YU9C 3HOWC 1ZYRA 3GTMK 4Y52K 3GTJC 3H3VD 4A3KK 3S16C 3S2HC 3GTLK 4OIOA 4QIWL 4A3LK 3GTGC 5C4JK 3M3YK 1I3QC 3HOXK 2WAQD 2PA8D 3PO2K 5IYDK 2JA7C 4YG2A 3WODA 3GTKC 3HOVC 4A3BK 5C3EK 5M3FK 5IP9C 4G7ZA 2Y0SL 2NVYK 5M5WK 5TMFA 2NVQK 2CW0A 2VUMC 3HOZK 3I4MC 2JA5C 2E2IC 4KN4A 1TWAC 1SMYA 3GTPK 4A93K 4A3DC 4YFNA 3HOUK 4XSXA 4LK1A 3M4OC 4C3HK 2E2JC 1TWFC 3K7AK 3S17K 3HOYK 4LJZA 4Y7NC 5IYCK 1Y1VC 4Q4ZA 4A3IK 1Y1WK 3I4NC 3S1QC 3S1NK 4QJVB 4GZYA 4BY7C 4BY1K 2A6EA 5C4XC 2NVXC 2O5JA 1TWGC 1WCMK 4G7HA 4MQ9A 2NVTK 1I6HC 4X6AK 3H0GC 1BDFA 2WB1L 5FLMC 3S15C 2R93K 4OINA 4YFXA 1I50K 1R9TC 5M3MK 3RZDK 4Y52C 3S2DK 4MEXA 4BBSC 3CQZC 3HKZD 4XLNA 4A3KC 3FKIK 3GTLC 4OIRA 5D4DA 2R92K 1TWCK 2PPBA 2R7ZC 5C4JC 3M3YC 3RZOK 4A3FC 2PMZD 3PO2C 5IYBK 1TWHC 5IYDC 4A3MC 2E2HK 3S1MK 2Y0SD 4XLPA 4C2MK 5FJ8K 4A3EK 3HOZC 4BBRK 2YU9K 4A3JK 2A68A 4LK0A 2B63K 3GTPC 3HOWK 3HOUC 4A93C 3GTJK 5TMCA 2A6HA 1K83C 3H3VL 4A3GC 2JA6C 3HOYC 3S17C 4AYBD 4QJVA 5IYCC 4A3IC 3S1RK 4JK1A 3DXJA 1I3QK 1IW7A 4ZH4A 2WAQL 2PA8L 5IP7K 1HQMA 3GTOC 3GTQC 2JA8K 3HOVK 1SFOC 5IP9K 4OIQA 1WCMC 3I4MK 4X6AC 2JA5K 3GTMC 3M4OK 4BXXK 4NOIA 3S14K 2R93C 4LLGA 2E2JK 1I50C 1TWFK 4QIWD 5C44K 4Y7NK 3PO3K 4A3LC 4OIPA 3FKIC 3HOXC 3I4NK 3S1QK 4A3BC 4KMUA 2R92C 5C3EC 4A3CK 2BE5A 5C4XK 2NVYC 2NVXK 2NVQC 4BXXC 4C3IK 3H0GK 5FLMK 3S2HK 3S16K 1XPPA 3K7AC 4C3JK 4A3JC 1R9TK 2B63C 4G7OA 1Y1WC 4BBSK 3GTGK 3CQZK 3HKZL 2A69A 3S1NC 1YNNA 2JA7K 4BY1C 3S1RC 3GTKK 2R7ZK 4Q5SA 4A3FK 4KN7A 1YNJA 5IP7C 2PMZL 1TWHK 4YFKA 3EQLA 4A3MK 2NVTC 2JA8C 2VUMK 2E2IK 2WB1D 1TWAK 4MEYA 4A3DK 2O5IA 3S2DC 3RZDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSZ A;  1Y1V K;  3S14 C;  1K83 K;  4A3G K;  2JA6 K;  5C44 C;  3PO3 C;  4BY7 K;  1TWC C;  4AYB L;  3RZO C;  5M5Y K;  5IYB C;  3GTQ K;  1TWG K;  2E2H C;  3GTO K;  3S1M C;  1I6H K;  4A3C C;  1SFO K;  3S15 K;  1I6V A;  4A3E C;  5M5X K;  4BBR C;  2YU9 C;  3HOW C;  1ZYR A;  3GTM K;  4Y52 K;  3GTJ C;  3H3V D;  4A3K K;  3S16 C;  3S2H C;  3GTL K;  4OIO A;  4QIW L;  4A3L K;  3GTG C;  5C4J K;  3M3Y K;  1I3Q C;  3HOX K;  2WAQ D;  2PA8 D;  3PO2 K;  5IYD K;  2JA7 C;  4YG2 A;  3WOD A;  3GTK C;  3HOV C;  4A3B K;  5C3E K;  5M3F K;  5IP9 C;  4G7Z A;  2Y0S L;  2NVY K;  5M5W K;  5TMF A;  2NVQ K;  2CW0 A;  2VUM C;  3HOZ K;  3I4M C;  2JA5 C;  2E2I C;  4KN4 A;  1TWA C;  1SMY A;  3GTP K;  4A93 K;  4A3D C;  4YFN A;  3HOU K;  4XSX A;  4LK1 A;  3M4O C;  4C3H K;  2E2J C;  1TWF C;  3K7A K;  3S17 K;  3HOY K;  4LJZ A;  4Y7N C;  5IYC K;  1Y1V C;  4Q4Z A;  4A3I K;  1Y1W K;  3I4N C;  3S1Q C;  3S1N K;  4QJV B;  4GZY A;  4BY7 C;  4BY1 K;  2A6E A;  5C4X C;  2NVX C;  2O5J A;  1TWG C;  1WCM K;  4G7H A;  4MQ9 A;  2NVT K;  1I6H C;  4X6A K;  3H0G C;  1BDF A;  2WB1 L;  5FLM C;  3S15 C;  2R93 K;  4OIN A;  4YFX A;  1I50 K;  1R9T C;  5M3M K;  3RZD K;  4Y52 C;  3S2D K;  4MEX A;  4BBS C;  3CQZ C;  3HKZ D;  4XLN A;  4A3K C;  3FKI K;  3GTL C;  4OIR A;  5D4D A;  2R92 K;  1TWC K;  2PPB A;  2R7Z C;  5C4J C;  3M3Y C;  3RZO K;  4A3F C;  2PMZ D;  3PO2 C;  5IYB K;  1TWH C;  5IYD C;  4A3M C;  2E2H K;  3S1M K;  2Y0S D;  4XLP A;  4C2M K;  5FJ8 K;  4A3E K;  3HOZ C;  4BBR K;  2YU9 K;  4A3J K;  2A68 A;  4LK0 A;  2B63 K;  3GTP C;  3HOW K;  3HOU C;  4A93 C;  3GTJ K;  5TMC A;  2A6H A;  1K83 C;  3H3V L;  4A3G C;  2JA6 C;  3HOY C;  3S17 C;  4AYB D;  4QJV A;  5IYC C;  4A3I C;  3S1R K;  4JK1 A;  3DXJ A;  1I3Q K;  1IW7 A;  4ZH4 A;  2WAQ L;  2PA8 L;  5IP7 K;  1HQM A;  3GTO C;  3GTQ C;  2JA8 K;  3HOV K;  1SFO C;  5IP9 K;  4OIQ A;  1WCM C;  3I4M K;  4X6A C;  2JA5 K;  3GTM C;  3M4O K;  4BXX K;  4NOI A;  3S14 K;  2R93 C;  4LLG A;  2E2J K;  1I50 C;  1TWF K;  4QIW D;  5C44 K;  4Y7N K;  3PO3 K;  4A3L C;  4OIP A;  3FKI C;  3HOX C;  3I4N K;  3S1Q K;  4A3B C;  4KMU A;  2R92 C;  5C3E C;  4A3C K;  2BE5 A;  5C4X K;  2NVY C;  2NVX K;  2NVQ C;  4BXX C;  4C3I K;  3H0G K;  5FLM K;  3S2H K;  3S16 K;  1XPP A;  3K7A C;  4C3J K;  4A3J C;  1R9T K;  2B63 C;  4G7O A;  1Y1W C;  4BBS K;  3GTG K;  3CQZ K;  3HKZ L;  2A69 A;  3S1N C;  1YNN A;  2JA7 K;  4BY1 C;  3S1R C;  3GTK K;  2R7Z K;  4Q5S A;  4A3F K;  4KN7 A;  1YNJ A;  5IP7 C;  2PMZ L;  1TWH K;  4YFK A;  3EQL A;  4A3M K;  2NVT C;  2JA8 C;  2VUM K;  2E2I K;  2WB1 D;  1TWA K;  4MEY A;  4A3D K;  2O5I A;  3S2D C;  3RZD C; 
#chains in the Genus database with same CATH topology
 3S14 C;  4PAA A;  1K83 K;  4A3G K;  2B63 A;  3TFH A;  1B4B A;  4O2D A;  3GTO K;  1I6V A;  4GTF A;  4KMH A;  1WQG A;  1EK8 A;  3GTJ C;  1L0W A;  2PHC B;  4QIW L;  3PO2 K;  2XCO A;  2JA7 C;  3WOD A;  3SZZ A;  5EGE A;  4G7Z A;  4BXX K;  2JA5 C;  2E2I C;  1ISE A;  1SMY A;  3GTP K;  4A3D C;  3M4O C;  2V6T A;  3K7A K;  3HOY K;  5IYC K;  1Y1V C;  4A3I K;  3S1Q C;  4P9S A;  2JH3 A;  3GTG A;  1J6X A;  2NVX C;  3GTK A;  3S15 C;  5FLM C;  2R93 K;  4C3J C;  1I50 K;  4YFX A;  5M3M K;  3A8K A;  4Y52 C;  4BBS C;  4A3K C;  3Q3Q A;  3GTL C;  4FZB A;  1IBA A;  1XZQ B;  4A3M C;  2Y0S D;  3MML B;  4BKW A;  4A3J K;  2A68 A;  3H0G A;  3HOU C;  3GTJ K;  4GTL A;  2JA6 C;  4QJV A;  3GTQ C;  4ZH4 A;  4KAR A;  2PA8 L;  1SFO C;  4OIQ A;  1PJ7 A;  1VRQ C;  3G4C A;  1TWH A;  1IS1 A;  4G0W A;  2JA5 K;  3M4O K;  1DD5 A;  1VJE A;  3GTP A;  3FHZ A;  3FKI C;  3S1Q K;  3T01 A;  4KMU A;  5C3E C;  3AD9 C;  3A8J A;  2NVX K;  2P5M A;  2XCR B;  5FLM K;  1O25 A;  4C3H C;  1IL2 A;  1WSR A;  4C3J K;  5IOS A;  5E68 A;  4BBS K;  3AD7 C;  2R93 A;  3HKZ L;  1I50 A;  3GDZ A;  4LQY A;  4KN7 A;  2VUM K;  3OEP A;  3L4K A;  4A3M K;  3EQL A;  4G0U A;  2JA8 C;  2NVT C;  4MEY A;  2NVY A;  4WJ4 A;  2O5I A;  3S2D C;  4G0V A;  3TFI A;  2JA6 K;  4BY7 K;  1VLO A;  1Y1W A;  1XZP A;  5IYB C;  3GTQ K;  3S1M C;  1I6H K;  1SFO K;  2GAG C;  4FM9 A;  3GSI A;  3H3V D;  3S16 C;  3M3Y K;  5C4J K;  1I3Q C;  4KAS A;  1ZVU A;  4KC6 A;  5IYD K;  1O24 A;  5C3E K;  5M3F K;  2P8T A;  2E2H A;  4KM8 A;  1TWA C;  4A93 K;  4XSX A;  4C3H K;  1TWF C;  2YU9 A;  1BJT A;  1PJ5 A;  4LJZ A;  3S17 K;  1YCL A;  4GZY A;  5C4X C;  1EFW A;  1TWG C;  1WCM K;  2CFA B;  1F7U A;  2NVT K;  1VGX A;  2ZUE A;  5TJ3 A;  2VUM A;  4M1X A;  3S2D K;  4MEX A;  2V6U A;  5D4D A;  3LAP A;  3TTG A;  2PPB A;  2R7Z C;  1WOO A;  2PMZ D;  1WIH A;  5IYB K;  1B4A A;  3GEH A;  3S1M K;  4XLP A;  2FQO A;  5FJ8 K;  3HOZ C;  4KB2 A;  3GIR A;  3V4G A;  1JQW A;  3NUH A;  3G4A A;  1XXB A;  1R9T A;  1UV7 A;  3GEI A;  4AYB D;  4KM9 A;  3S1R K;  1AB4 A;  3CQZ A;  3AH5 A;  1I3Q K;  3N0C A;  5IP7 K;  1HQM A;  1J6W A;  3VA7 A;  1IE0 A;  1BS2 A;  4GTE A;  4LOW A;  4X6A C;  3GTM C;  4NOI A;  3S14 K;  5IOT A;  1TWF K;  3AQO A;  1WSV A;  2ZUF A;  1K83 A;  3AD8 C;  4A3B C;  2R92 C;  2BE5 A;  2RH6 A;  5C4X K;  2NVQ C;  3GTO A;  4WJ3 M;  1USM A;  1WCM A;  2B63 C;  4G7O A;  3ADA C;  5CHP A;  3AQP A;  3S1N C;  2RGR A;  2JA7 K;  2R7Z K;  1XXC A;  5L46 A;  4C45 A;  3LAJ A;  5JFE A;  2E2I K;  1O28 A;  2WB1 D;  1USO A;  4A3D K;  4J3N A;  2D6F C;  4DDQ A;  2GSO A;  1Y1V K;  1XXA A;  4GT9 A;  1O2B A;  5C44 C;  3GEE A;  1TWC C;  3PO3 C;  5M5Y K;  3T02 A;  4A3C C;  4P5B A;  3S15 K;  1JVI A;  3HOW C;  3GTM K;  4C3I C;  2GSU A;  4Y52 K;  3S2H C;  2KWA A;  2FQT A;  4A3K K;  3GTL K;  3GTG C;  2Y3P A;  2WAQ D;  1J98 A;  4A3B K;  3HOV C;  3GTK C;  3A8I A;  4GTD A;  2NVQ K;  5TMF A;  2CW0 A;  3SZY A;  3HOU K;  4LK1 A;  3GTJ A;  3S1N K;  4QJV B;  1PJ6 A;  4P5A A;  2A6E A;  2O5J A;  4G7H A;  4KMA A;  4MQ9 A;  2JA7 A;  5IOQ A;  3CAG A;  1G51 A;  3H0G C;  1BDF A;  4LR2 A;  5JVO A;  2JA5 A;  2E2I A;  3QX3 A;  4KB4 A;  1DCP A;  3FKI K;  4OIR A;  2V6S A;  1TWC K;  1O2A A;  1Y1V A;  4A3F C;  3PO2 C;  1TWH C;  2NVX A;  4GTA A;  4GTB A;  3HOW K;  3GTP C;  3ERE D;  2A6H A;  4GTC A;  3H3V L;  3HOY C;  3GTM A;  5IYC C;  4A3I C;  3GTL A;  1IW7 A;  4AH6 A;  3HOV K;  2JA8 K;  1V5V A;  3T00 A;  2R93 C;  4LLG A;  1I50 C;  4QIW D;  4A3L C;  3HOX C;  2JA6 A;  4KMD A;  1ZBS A;  1XZQ A;  1XZP B;  2NVY C;  4XCH A;  3GTQ A;  4PAB A;  1SFO A;  3H0G K;  1JOE A;  3S16 K;  4A3J C;  1YX2 A;  1KQ4 A;  1Y1W C;  2A69 A;  3FOF A;  4RMF A;  4BY1 C;  1J6V A;  5HL8 A;  3FKI A;  5EGH A;  4A3F K;  2PMZ L;  1INN A;  1TWH K;  4YFK A;  1TWC A;  2XCQ A;  1TWA K;  1DCO A;  1O27 A;  1WQF A;  3RZD C;  4XSZ A;  5IOR A;  1EH1 A;  4GFQ A;  4AYB L;  3RZO C;  1EI6 A;  1TWG K;  2E2H C;  1WQH A;  4C2M C;  4A3E C;  5M5X K;  4BBR C;  1HI9 A;  2YU9 C;  1EQR A;  1ZYR A;  1VH2 A;  4OIO A;  4A3L K;  1ZXO A;  3HOX K;  2PA8 D;  2GAH C;  4YG2 A;  4WIL A;  5IP9 C;  2NVY K;  2Y0S L;  5M5W K;  2VUM C;  3HOZ K;  3I4M C;  4KN4 A;  2W7V A;  4YFN A;  1DCH A;  2E2J C;  3JST A;  4Y7N C;  4Q4Z A;  1Y1W K;  1WOR A;  3I4N C;  3N0B A;  4BY7 C;  4BY1 K;  1I3Q A;  2EBB A;  1I6H C;  4X6A K;  2WB1 L;  4OIN A;  1IQ0 A;  1R9T C;  3RZD K;  1TWA A;  3LPX A;  4KAT A;  3CQZ C;  3HKZ D;  4XLN A;  3ORE A;  1TWF A;  2R92 K;  3M3Y C;  5C4J C;  3RZO K;  4KDD A;  5IYD C;  2E2H K;  4BLB A;  1RU0 A;  4KAW X;  4C2M K;  1WOS A;  4A3E K;  1TWG A;  4BBR K;  2YU9 K;  4LK0 A;  2B63 K;  4A93 C;  1F9N A;  5TMC A;  1K83 C;  4A3G C;  4ILD A;  1O26 A;  3S17 C;  4BLA A;  3HXA A;  4JK1 A;  3DXJ A;  3S0X A;  1WOP A;  3BP8 C;  2WAQ L;  1GE9 A;  3GTO C;  1X31 C;  1O2F B;  2CFA A;  2R7Z A;  5IP9 K;  1O29 A;  1WCM C;  3I4M K;  1BGW A;  1C0A A;  2E2J K;  3L4J A;  2GSN A;  2ZFZ A;  5C44 K;  4Y7N K;  3PO3 K;  3IPJ A;  4OIP A;  3I4N K;  1ZQ1 C;  3BUE A;  5CJ9 A;  1F7V A;  4A3C K;  1F93 A;  3BP3 A;  4BXX C;  4C3I K;  3S2H K;  1XPP A;  3TFJ A;  3K7A C;  1R9T K;  3GTG K;  3CQZ K;  1YNN A;  3FOE A;  3S1R C;  3GTK K;  4Q5S A;  1YNJ A;  5IP7 C;  2R92 A;  3N3Y A;  3OPF A; 
#chains in the Genus database with same CATH homology
 4XSZ A;  1Y1V K;  3S14 C;  1K83 K;  4A3G K;  2JA6 K;  5C44 C;  3PO3 C;  4BY7 K;  1TWC C;  4AYB L;  3RZO C;  5M5Y K;  5IYB C;  3GTQ K;  1TWG K;  2E2H C;  3GTO K;  3S1M C;  1I6H K;  4A3C C;  1SFO K;  3S15 K;  1I6V A;  4A3E C;  5M5X K;  4BBR C;  2YU9 C;  3HOW C;  1ZYR A;  3GTM K;  4Y52 K;  3GTJ C;  3H3V D;  4A3K K;  3S16 C;  3S2H C;  3GTL K;  4OIO A;  4QIW L;  4A3L K;  3GTG C;  5C4J K;  3M3Y K;  1I3Q C;  3HOX K;  2WAQ D;  2PA8 D;  3PO2 K;  5IYD K;  2JA7 C;  4YG2 A;  3WOD A;  3GTK C;  3HOV C;  4A3B K;  5C3E K;  5M3F K;  5IP9 C;  4G7Z A;  2Y0S L;  2NVY K;  5M5W K;  5TMF A;  2NVQ K;  2CW0 A;  2VUM C;  3HOZ K;  3I4M C;  2JA5 C;  2E2I C;  4KN4 A;  1TWA C;  1SMY A;  3GTP K;  4A93 K;  4A3D C;  4YFN A;  3HOU K;  4XSX A;  4LK1 A;  3M4O C;  4C3H K;  2E2J C;  1TWF C;  3K7A K;  3S17 K;  3HOY K;  4LJZ A;  4Y7N C;  5IYC K;  1Y1V C;  4Q4Z A;  4A3I K;  1Y1W K;  3I4N C;  3S1Q C;  3S1N K;  4QJV B;  4GZY A;  4BY7 C;  4BY1 K;  2A6E A;  5C4X C;  2NVX C;  2O5J A;  1TWG C;  1WCM K;  4G7H A;  4MQ9 A;  2NVT K;  1I6H C;  4X6A K;  3H0G C;  1BDF A;  2WB1 L;  5FLM C;  3S15 C;  2R93 K;  4OIN A;  4YFX A;  1I50 K;  1R9T C;  5M3M K;  3RZD K;  4Y52 C;  3S2D K;  4MEX A;  4BBS C;  3CQZ C;  3HKZ D;  4XLN A;  4A3K C;  3FKI K;  3GTL C;  4OIR A;  5D4D A;  2R92 K;  1TWC K;  2PPB A;  2R7Z C;  5C4J C;  3M3Y C;  3RZO K;  4A3F C;  2PMZ D;  3PO2 C;  5IYB K;  1TWH C;  5IYD C;  4A3M C;  2E2H K;  3S1M K;  2Y0S D;  4XLP A;  4C2M K;  5FJ8 K;  4A3E K;  3HOZ C;  4BBR K;  2YU9 K;  4A3J K;  2A68 A;  4LK0 A;  2B63 K;  3GTP C;  3HOW K;  3HOU C;  4A93 C;  3GTJ K;  5TMC A;  2A6H A;  1K83 C;  3H3V L;  4A3G C;  2JA6 C;  3HOY C;  3S17 C;  4AYB D;  4QJV A;  5IYC C;  4A3I C;  3S1R K;  4JK1 A;  3DXJ A;  1I3Q K;  1IW7 A;  4ZH4 A;  2WAQ L;  2PA8 L;  5IP7 K;  1HQM A;  3GTO C;  3GTQ C;  2JA8 K;  3HOV K;  1SFO C;  5IP9 K;  4OIQ A;  1WCM C;  3I4M K;  4X6A C;  2JA5 K;  3GTM C;  3M4O K;  4BXX K;  4NOI A;  3S14 K;  2R93 C;  4LLG A;  2E2J K;  1I50 C;  1TWF K;  4QIW D;  5C44 K;  4Y7N K;  3PO3 K;  4A3L C;  4OIP A;  3FKI C;  3HOX C;  3I4N K;  3S1Q K;  4A3B C;  4KMU A;  2R92 C;  5C3E C;  4A3C K;  2BE5 A;  5C4X K;  2NVY C;  2NVX K;  2NVQ C;  4BXX C;  4C3I K;  3H0G K;  5FLM K;  3S2H K;  3S16 K;  1XPP A;  3K7A C;  4C3J K;  4A3J C;  1R9T K;  2B63 C;  4G7O A;  1Y1W C;  4BBS K;  3GTG K;  3CQZ K;  3HKZ L;  2A69 A;  3S1N C;  1YNN A;  2JA7 K;  4BY1 C;  3S1R C;  3GTK K;  2R7Z K;  4Q5S A;  4A3F K;  4KN7 A;  1YNJ A;  5IP7 C;  2PMZ L;  1TWH K;  4YFK A;  3EQL A;  4A3M K;  2NVT C;  2JA8 C;  2VUM K;  2E2I K;  2WB1 D;  1TWA K;  4MEY A;  4A3D K;  2O5I A;  3S2D C;  3RZD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...