2E2JK

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2jK00
1K83K 2NVYK 3FKIC 5IYDC 4LK0A 1SMYA 2CW0A 1I50C 3HOXK 2NVTC 4A3JC 4YFKA 3GTPC 3S15K 2Y0SL 5M3MK 4G7ZA 3HOWC 3S17K 2O5IA 4A3DC 4A3MK 2VUMK 1I50K 3HOXC 2NVTK 4KMUA 5IYDK 4OINA 3H3VL 3S1QC 3S1QK 4A3FC 2PMZL 3S1RC 5TMCA 3S1RK 5C4JC 3FKIK 1IW7A 3GTLK 1K83C 4BBRK 2YU9K 4A3MC 4BY1K 3H0GC 4G7HA 2WAQL 2B63K 4OIOA 3GTOK 3HOWK 3S17C 3S2HC 1ZYRA 2E2JK 2JA6C 2E2HK 4A3IK 5IYCC 4OIQA 4C3IK 2B63C 3CQZC 1Y1WK 4A3KK 3GTQK 3S16C 4A3BC 2A6HA 3DXJA 2E2IC 4XSXA 4LLGA 4AYBL 2E2IK 3GTLC 5C4JK 4G7OA 2R93C 2JA5K 2E2HC 5C3EC 3WODA 3S2HK 3HOYK 3GTOC 4BY7K 4C3JK 3I4MK 3HOVK 3S1NC 2JA7C 1TWGC 4A93K 1TWFC 2YU9C 3GTGK 4C3HK 4QJVA 3HOUK 4GZYA 1I6HK 3M3YC 4X6AC 4A3FK 5FJ8K 3GTJK 4BBSK 4A3GK 4QIWL 4BXXK 2VUMC 4A3CK 4XLNA 5C4XK 2NVXK 2WB1D 4KN7A 3GTKC 2JA8C 4YFNA 4YG2A 5C44K 5IP7C 1BDFA 5FLMK 3GTMK 3I4NK 4XLPA 2NVYC 4MEYA 4YFXA 3PO3K 5IP9C 4ZH4A 4Y52C 1I6VA 2O5JA 3HOZC 1YNNA 3PO2C 2R92K 3S14K 3S14C 4Y7NC 1SFOK 3M4OC 1Y1VK 3H3VD 4A3LK 4BXXC 2PMZD 3PO3C 2A68A 4C2MK 4A3EC 1TWAK 4LJZA 1TWCK 3S2DC 3HKZL 2R7ZC 1I3QC 3I4NC 5C44C 3GTMC 3GTGC 2WAQD 3RZDK 3RZDC 3S1MK 1TWHC 3S1MC 4MEXA 4A3EK 3K7AK 4LK1A 2PA8L 2R7ZK 3HOYC 1TWAC 3S2DK 4Y7NK 1WCMK 1Y1VC 3RZOC 2A6EA 2Y0SD 3EQLA 3K7AC 5IP9K 1I3QK 2PPBA 4A3KC 3GTQC 3S16K 5M3FK 3HOVC 1YNJA 4JK1A 1WCMC 4A3GC 4BY1C 4BBRC 4X6AK 5D4DA 5IYCK 4Q4ZA 3GTKK 3M3YK 2E2JC 5FLMC 2JA7K 2JA8K 2WB1L 4OIPA 3RZOK 2A69A 4AYBD 2NVXC 5C4XC 3H0GK 4A3CC 5TMFA 5M5WK 4A3JK 4BY7C 4QJVB 2JA5C 4NOIA 3GTJC 1HQMA 4BBSC 5C3EK 2R92C 3HOUC 1I6HC 1TWHK 1TWFK 2BE5A 4OIRA 4A93C 4Y52K 3CQZK 1Y1WC 5IYBK 3I4MC 2NVQK 4KN4A 1TWCC 1TWGK 4XSZA 3S1NK 3S15C 4A3DK 5IP7K 3GTPK 4MQ9A 4A3IC 5M5XK 3HKZD 2JA6K 1SFOC 3M4OK 1XPPA 4A3LC 4Q5SA 4QIWD 5M5YK 2R93K 2NVQC 3HOZK 5IYBC 3PO2K 4A3BK 1R9TK 1R9TC 2PA8D
chains in the Genus database with same CATH superfamily
5CHPA 1EFWA 4KMHA 5IYDC 4LK0A 5IOTA 3GTPA 2GSOA 2Y0SL 4G7ZA 2O5IA 3Q3QA 4KMUA 4OINA 1EH1A 2PMZL 4GTLA 3GTLK 4BBRK 3H0GC 3V4GA 4G7HA 3S2HC 3FOFA 4A3IK 5IYCC 2B63C 1XZPB 4A3KK 3S16C 2E2IC 3GTLC 2P8TA 4BY7K 1JVIA 4C3JK 1O2FB 2YU9C 4A3FK 4KMAA 3LPXA 4BBSK 2P5MA 5C4XK 2NVXK 1UV7A 4YFNA 1HI9A 5JVOA 2GAHC 2NVYC 4MEYA 3N0CA 4YFXA 3PO3K 4FZBA 4Y52C 1I6VA 1EK8A 2XCQA 3M4OC 5L46A 2ZUFA 4G0UA 3PO3C 4C2MK 1TWAK 4LJZA 3S2DC 1I3QA 3GTMA 2EBBA 3GTGC 3RZDK 3RZDC 1TWHC 4A3EK 3K7AK 4LK1A 1TWAC 3S2DK 1XZQA 3GSIA 2A6EA 4GTEA 3EQLA 5IP9K 4BLAA 1I3QK 3GTQC 1IBAA 3T01A 3AD8C 4KATA 4BLBA 4BY1C 1O25A 4KB4A 3N0BA 4C3IC 1WOSA 3N3YA 5IYCK 1XXAA 1ZVUA 4WJ4A 2W7VA 2JA7K 4GT9A 2JA8K 2WB1L 4OIPA 3RZOK 4AYBD 1BGWA 4A3JK 4NOIA 2RGRA 3GTJA 2R92C 1TWHK 4A93C 1Y1WC 4C3HC 4P5AA 1IE0A 4KN4A 4XSZA 1SFOA 1XPPA 4QIWD 1XZPA 1F7VA 1O27A 1R9TK 1SMYA 1I50A 4YFKA 4KM8A 2GSNA 2VUMK 3AD7C 1I50K 4KB2A 3HOXC 3H3VL 3S1QC 3S1QK 1EI6A 5TMCA 5C4JC 4KMDA 3FKIK 3FHZA 1K83C 2Y3PA 3H0GA 3NUHA 3A8IA 2E2JK 3CQZC 3GTQK 2JH3A 2E2IA 4XSXA 4AYBL 3GTLA 2E2HC 1WSRA 3WODA 3HOYK 5TJ3A 3GTOA 3I4MK 2JA7A 1TWFC 2V6TA 2YU9A 2D6FC 4QJVA 3A8KA 4X6AC 3T02A 1WIHA 5FJ8K 1X31C 4LQYA 2ZUEA 1JQWA 1DD5A 1ZQ1C 2JA8C 1VLOA 3AQOA 3I4NK 1IL2A 2NVYA 3BUEA 4ZH4A 2O5JA 3HOZC 1YNNA 3QX3A 3PO2C 2R92K 1J98A 3T00A 4A3LK 1Y1VK 1F7UA 2PMZD 3TFHA 2A68A 4KDDA 3I4NC 1I3QC 5C44C 3GTMC 3GTGA 1DCHA 2PA8L 2R7ZK 2CFAA 1O2BA 4P9SA 4O2DA 1J6XA 5M3FK 4RMFA 1YNJA 1IQ0A 1WQFA 1WCMA 3SZZA 2GSUA 3GTKK 5IOQA 2E2JC 5IOSA 3M3YK 5FLMC 1C0AA 5TMFA 3GDZA 4OIRA 5IYBK 2NVQK 1TWCA 1XXBA 3FOEA 2JA6K 1SFOC 5M5YK 2R93K 2NVQC 1USOA 4XCHA 3HOZK 3PO2K 4A3BK 1XZQB 1K83K 5HL8A 3FKIC 4P5BA 1F93A 2PHCB 1I50C 5JFEA 3HOXK 3LAJA 1J6WA 3TFIA 4KAWX 4A3MK 3GEEA 2NVTK 3L4KA 3S0XA 1IW7A 1K83A 3TTGA 4A3MC 1BJTA 1B4BA 2B63K 1ZBSA 4GTBA 2JA6A 2E2HK 4WILA 4C3IK 2V6SA 1VRQC 3CQZA 4ILDA 1Y1WK 4A3BC 4LLGA 4C45A 2R93C 2E2HA 5C3EC 3GTOC 2JA7C 1TWGC 1XXCA 1WOPA 1TWFA 3HOUK 1I6HK 3BP3A 3TFJA 3GTJK 4A3GK 4QIWL 1PJ7A 1WSVA 1VJEA 2VUMC 1BS2A 1DCPA 1WOOA 4KN7A 3GTKC 4YG2A 5FLMK 5IP7C 1BDFA 4XLPA 4C2MC 4GFQA 5IP9C 2V6UA 3L4JA 1KQ4A 3S14K 3S14C 4Y7NC 4BXXC 3H3VD 3G4AA 4A3EC 1TWCK 2R7ZA 1O29A 4J3NA 4MEXA 4M1XA 1B4AA 1ZXOA 3HOYC 1WQHA 4Y7NK 1Y1VA 1ISEA 3RZOC 2Y0SD 1GE9A 4WJ3M 2PPBA 2FQOA 2KWAA 4C3JC 4JK1A 4LR2A 1USMA 1WCMC 4BKWA 4A3GC 3AD9C 3LAPA 5D4DA 1WQGA 1YCLA 1RU0A 1VGXA 2A69A 1JOEA 4GTCA 3H0GK 2NVXA 4A3CC 4BY7C 4QJVB 4GTDA 2JA5A 1HQMA 2XCOA 5C3EK 3BP8C 1TWFK 2BE5A 1PJ5A 3I4MC 1TWCC 3S1NK 1INNA 4A3IC 2CFAB 5M5XK 3SZYA 4GTFA 3M4OK 3MMLB 2GAGC 1IS1A 1R9TA 4LOWA 2PA8D 2NVYK 3FKIA 3OREA 2CW0A 1O26A 2NVTC 3ERED 5E68A 3HXAA 4A3JC 3GTPC 3S15K 3GEIA 5M3MK 4A3DC 3HOWC 3S17K 5IYDK 4A3FC 3S1RC 3S1RK 1DCOA 3JSTA 2YU9K 4BY1K 2WAQL 3GEHA 4OIOA 1EQRA 3GTOK 3HOWK 3S17C 1ZYRA 2JA6C 1WORA 3CAGA 4OIQA 2B63A 2A6HA 3DXJA 2E2IK 2R93A 5C4JK 1F9NA 4G7OA 2JA5K 4FM9A 3OEPA 3VA7A 3AH5A 3S2HK 3OPFA 3HOVK 3S1NC 4DDQA 1TWGA 1O2AA 4A93K 3GTGK 4C3HK 4GZYA 1VH2A 3M3YC 3IPJA 4BXXK 4KC6A 2VUMA 4A3CK 4XLNA 2WB1D 3GIRA 3GTKA 5IORA 5C44K 3GTMK 2FQTA 4PABA 4AH6A 1SFOK 3AQPA 3HKZL 2R7ZC 5EGEA 3A8JA 2WAQD 3S1MC 3S1MK 1TWHA 3G4CA 1TWAA 4KASA 1WCMK 2ZFZA 1Y1VC 5CJ9A 3K7AC 4PAAA 1O28A 4A3KC 3S16K 3GTQA 3HOVC 1G51A 1PJ6A 1O24A 4GTAA 2RH6A 4BBRC 2XCRB 4X6AK 4Q4ZA 5EGHA 4G0WA 1V5VA 2NVXC 5C4XC 1AB4A 5M5WK 2JA5C 4BBSC 3GTJC 4G0VA 2R92A 3HOUC 1I6HC 4Y52K 4KARA 1J6VA 3CQZK 4KM9A 1Y1WA 1TWGK 3S15C 4A3DK 5IP7K 3GTPK 4MQ9A 1YX2A 3HKZD 4A3LC 4Q5SA 5IYBC 3ADAC 1R9TC 1L0WA
chains in the Genus database with same CATH topology
1K83K 2NVYK 3FKIC 5IYDC 4LK0A 1SMYA 2CW0A 1I50C 3HOXK 2NVTC 4A3JC 4YFKA 3GTPC 3S15K 2Y0SL 5M3MK 4G7ZA 3HOWC 3S17K 2O5IA 4A3DC 4A3MK 2VUMK 1I50K 3HOXC 2NVTK 4KMUA 5IYDK 4OINA 3H3VL 3S1QC 3S1QK 4A3FC 2PMZL 3S1RC 5TMCA 3S1RK 5C4JC 3FKIK 1IW7A 3GTLK 1K83C 4BBRK 2YU9K 4A3MC 4BY1K 3H0GC 4G7HA 2WAQL 2B63K 4OIOA 3GTOK 3HOWK 3S17C 3S2HC 1ZYRA 2E2JK 2JA6C 2E2HK 4A3IK 5IYCC 4OIQA 4C3IK 2B63C 3CQZC 1Y1WK 4A3KK 3GTQK 3S16C 4A3BC 2A6HA 3DXJA 2E2IC 4XSXA 4LLGA 4AYBL 2E2IK 3GTLC 5C4JK 4G7OA 2R93C 2JA5K 2E2HC 5C3EC 3WODA 3S2HK 3HOYK 3GTOC 4BY7K 4C3JK 3I4MK 3HOVK 3S1NC 2JA7C 1TWGC 4A93K 1TWFC 2YU9C 3GTGK 4C3HK 4QJVA 3HOUK 4GZYA 1I6HK 3M3YC 4X6AC 4A3FK 5FJ8K 3GTJK 4BBSK 4A3GK 4QIWL 4BXXK 2VUMC 4A3CK 4XLNA 5C4XK 2NVXK 2WB1D 4KN7A 3GTKC 2JA8C 4YFNA 4YG2A 5C44K 5IP7C 1BDFA 5FLMK 3GTMK 3I4NK 4XLPA 2NVYC 4MEYA 4YFXA 3PO3K 5IP9C 4ZH4A 4Y52C 1I6VA 2O5JA 3HOZC 1YNNA 3PO2C 2R92K 3S14K 3S14C 4Y7NC 1SFOK 3M4OC 1Y1VK 3H3VD 4A3LK 4BXXC 2PMZD 3PO3C 2A68A 4C2MK 4A3EC 1TWAK 4LJZA 1TWCK 3S2DC 3HKZL 2R7ZC 1I3QC 3I4NC 5C44C 3GTMC 3GTGC 2WAQD 3RZDK 3RZDC 3S1MK 1TWHC 3S1MC 4MEXA 4A3EK 3K7AK 4LK1A 2PA8L 2R7ZK 3HOYC 1TWAC 3S2DK 4Y7NK 1WCMK 1Y1VC 3RZOC 2A6EA 2Y0SD 3EQLA 3K7AC 5IP9K 1I3QK 2PPBA 4A3KC 3GTQC 3S16K 5M3FK 3HOVC 1YNJA 4JK1A 1WCMC 4A3GC 4BY1C 4BBRC 4X6AK 5D4DA 5IYCK 4Q4ZA 3GTKK 3M3YK 2E2JC 5FLMC 2JA7K 2JA8K 2WB1L 4OIPA 3RZOK 2A69A 4AYBD 2NVXC 5C4XC 3H0GK 4A3CC 5TMFA 5M5WK 4A3JK 4BY7C 4QJVB 2JA5C 4NOIA 3GTJC 1HQMA 4BBSC 5C3EK 2R92C 3HOUC 1I6HC 1TWHK 1TWFK 2BE5A 4OIRA 4A93C 4Y52K 3CQZK 1Y1WC 5IYBK 3I4MC 2NVQK 4KN4A 1TWCC 1TWGK 4XSZA 3S1NK 3S15C 4A3DK 5IP7K 3GTPK 4MQ9A 4A3IC 5M5XK 3HKZD 2JA6K 1SFOC 3M4OK 1XPPA 4A3LC 4Q5SA 4QIWD 5M5YK 2R93K 2NVQC 3HOZK 5IYBC 3PO2K 4A3BK 1R9TK 1R9TC 2PA8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 K;  2NVY K;  3FKI C;  5IYD C;  4LK0 A;  1SMY A;  2CW0 A;  1I50 C;  3HOX K;  2NVT C;  4A3J C;  4YFK A;  3GTP C;  3S15 K;  2Y0S L;  5M3M K;  4G7Z A;  3HOW C;  3S17 K;  2O5I A;  4A3D C;  4A3M K;  2VUM K;  1I50 K;  3HOX C;  2NVT K;  4KMU A;  5IYD K;  4OIN A;  3H3V L;  3S1Q C;  3S1Q K;  4A3F C;  2PMZ L;  3S1R C;  5TMC A;  3S1R K;  5C4J C;  3FKI K;  1IW7 A;  3GTL K;  1K83 C;  4BBR K;  2YU9 K;  4A3M C;  4BY1 K;  3H0G C;  4G7H A;  2WAQ L;  2B63 K;  4OIO A;  3GTO K;  3HOW K;  3S17 C;  3S2H C;  1ZYR A;  2E2J K;  2JA6 C;  2E2H K;  4A3I K;  5IYC C;  4OIQ A;  4C3I K;  2B63 C;  3CQZ C;  1Y1W K;  4A3K K;  3GTQ K;  3S16 C;  4A3B C;  2A6H A;  3DXJ A;  2E2I C;  4XSX A;  4LLG A;  4AYB L;  2E2I K;  3GTL C;  5C4J K;  4G7O A;  2R93 C;  2JA5 K;  2E2H C;  5C3E C;  3WOD A;  3S2H K;  3HOY K;  3GTO C;  4BY7 K;  4C3J K;  3I4M K;  3HOV K;  3S1N C;  2JA7 C;  1TWG C;  4A93 K;  1TWF C;  2YU9 C;  3GTG K;  4C3H K;  4QJV A;  3HOU K;  4GZY A;  1I6H K;  3M3Y C;  4X6A C;  4A3F K;  5FJ8 K;  3GTJ K;  4BBS K;  4A3G K;  4QIW L;  4BXX K;  2VUM C;  4A3C K;  4XLN A;  5C4X K;  2NVX K;  2WB1 D;  4KN7 A;  3GTK C;  2JA8 C;  4YFN A;  4YG2 A;  5C44 K;  5IP7 C;  1BDF A;  5FLM K;  3GTM K;  3I4N K;  4XLP A;  2NVY C;  4MEY A;  4YFX A;  3PO3 K;  5IP9 C;  4ZH4 A;  4Y52 C;  1I6V A;  2O5J A;  3HOZ C;  1YNN A;  3PO2 C;  2R92 K;  3S14 K;  3S14 C;  4Y7N C;  1SFO K;  3M4O C;  1Y1V K;  3H3V D;  4A3L K;  4BXX C;  2PMZ D;  3PO3 C;  2A68 A;  4C2M K;  4A3E C;  1TWA K;  4LJZ A;  1TWC K;  3S2D C;  3HKZ L;  2R7Z C;  1I3Q C;  3I4N C;  5C44 C;  3GTM C;  3GTG C;  2WAQ D;  3RZD K;  3RZD C;  3S1M K;  1TWH C;  3S1M C;  4MEX A;  4A3E K;  3K7A K;  4LK1 A;  2PA8 L;  2R7Z K;  3HOY C;  1TWA C;  3S2D K;  4Y7N K;  1WCM K;  1Y1V C;  3RZO C;  2A6E A;  2Y0S D;  3EQL A;  3K7A C;  5IP9 K;  1I3Q K;  2PPB A;  4A3K C;  3GTQ C;  3S16 K;  5M3F K;  3HOV C;  1YNJ A;  4JK1 A;  1WCM C;  4A3G C;  4BY1 C;  4BBR C;  4X6A K;  5D4D A;  5IYC K;  4Q4Z A;  3GTK K;  3M3Y K;  2E2J C;  5FLM C;  2JA7 K;  2JA8 K;  2WB1 L;  4OIP A;  3RZO K;  2A69 A;  4AYB D;  2NVX C;  5C4X C;  3H0G K;  4A3C C;  5TMF A;  5M5W K;  4A3J K;  4BY7 C;  4QJV B;  2JA5 C;  4NOI A;  3GTJ C;  1HQM A;  4BBS C;  5C3E K;  2R92 C;  3HOU C;  1I6H C;  1TWH K;  1TWF K;  2BE5 A;  4OIR A;  4A93 C;  4Y52 K;  3CQZ K;  1Y1W C;  5IYB K;  3I4M C;  2NVQ K;  4KN4 A;  1TWC C;  1TWG K;  4XSZ A;  3S1N K;  3S15 C;  4A3D K;  5IP7 K;  3GTP K;  4MQ9 A;  4A3I C;  5M5X K;  3HKZ D;  2JA6 K;  1SFO C;  3M4O K;  1XPP A;  4A3L C;  4Q5S A;  4QIW D;  5M5Y K;  2R93 K;  2NVQ C;  3HOZ K;  5IYB C;  3PO2 K;  4A3B K;  1R9T K;  1R9T C;  2PA8 D; 
#chains in the Genus database with same CATH topology
 5CHP A;  1EFW A;  4KMH A;  5IYD C;  4LK0 A;  5IOT A;  3GTP A;  2GSO A;  2Y0S L;  4G7Z A;  2O5I A;  3Q3Q A;  4KMU A;  4OIN A;  1EH1 A;  2PMZ L;  4GTL A;  3GTL K;  4BBR K;  3H0G C;  3V4G A;  4G7H A;  3S2H C;  3FOF A;  4A3I K;  5IYC C;  2B63 C;  1XZP B;  4A3K K;  3S16 C;  2E2I C;  3GTL C;  2P8T A;  4BY7 K;  1JVI A;  4C3J K;  1O2F B;  2YU9 C;  4A3F K;  4KMA A;  3LPX A;  4BBS K;  2P5M A;  5C4X K;  2NVX K;  1UV7 A;  4YFN A;  1HI9 A;  5JVO A;  2GAH C;  2NVY C;  4MEY A;  3N0C A;  4YFX A;  3PO3 K;  4FZB A;  4Y52 C;  1I6V A;  1EK8 A;  2XCQ A;  3M4O C;  5L46 A;  2ZUF A;  4G0U A;  3PO3 C;  4C2M K;  1TWA K;  4LJZ A;  3S2D C;  1I3Q A;  3GTM A;  2EBB A;  3GTG C;  3RZD K;  3RZD C;  1TWH C;  4A3E K;  3K7A K;  4LK1 A;  1TWA C;  3S2D K;  1XZQ A;  3GSI A;  2A6E A;  4GTE A;  3EQL A;  5IP9 K;  4BLA A;  1I3Q K;  3GTQ C;  1IBA A;  3T01 A;  3AD8 C;  4KAT A;  4BLB A;  4BY1 C;  1O25 A;  4KB4 A;  3N0B A;  4C3I C;  1WOS A;  3N3Y A;  5IYC K;  1XXA A;  1ZVU A;  4WJ4 A;  2W7V A;  2JA7 K;  4GT9 A;  2JA8 K;  2WB1 L;  4OIP A;  3RZO K;  4AYB D;  1BGW A;  4A3J K;  4NOI A;  2RGR A;  3GTJ A;  2R92 C;  1TWH K;  4A93 C;  1Y1W C;  4C3H C;  4P5A A;  1IE0 A;  4KN4 A;  4XSZ A;  1SFO A;  1XPP A;  4QIW D;  1XZP A;  1F7V A;  1O27 A;  1R9T K;  1SMY A;  1I50 A;  4YFK A;  4KM8 A;  2GSN A;  2VUM K;  3AD7 C;  1I50 K;  4KB2 A;  3HOX C;  3H3V L;  3S1Q C;  3S1Q K;  1EI6 A;  5TMC A;  5C4J C;  4KMD A;  3FKI K;  3FHZ A;  1K83 C;  2Y3P A;  3H0G A;  3NUH A;  3A8I A;  2E2J K;  3CQZ C;  3GTQ K;  2JH3 A;  2E2I A;  4XSX A;  4AYB L;  3GTL A;  2E2H C;  1WSR A;  3WOD A;  3HOY K;  5TJ3 A;  3GTO A;  3I4M K;  2JA7 A;  1TWF C;  2V6T A;  2YU9 A;  2D6F C;  4QJV A;  3A8K A;  4X6A C;  3T02 A;  1WIH A;  5FJ8 K;  1X31 C;  4LQY A;  2ZUE A;  1JQW A;  1DD5 A;  1ZQ1 C;  2JA8 C;  1VLO A;  3AQO A;  3I4N K;  1IL2 A;  2NVY A;  3BUE A;  4ZH4 A;  2O5J A;  3HOZ C;  1YNN A;  3QX3 A;  3PO2 C;  2R92 K;  1J98 A;  3T00 A;  4A3L K;  1Y1V K;  1F7U A;  2PMZ D;  3TFH A;  2A68 A;  4KDD A;  3I4N C;  1I3Q C;  5C44 C;  3GTM C;  3GTG A;  1DCH A;  2PA8 L;  2R7Z K;  2CFA A;  1O2B A;  4P9S A;  4O2D A;  1J6X A;  5M3F K;  4RMF A;  1YNJ A;  1IQ0 A;  1WQF A;  1WCM A;  3SZZ A;  2GSU A;  3GTK K;  5IOQ A;  2E2J C;  5IOS A;  3M3Y K;  5FLM C;  1C0A A;  5TMF A;  3GDZ A;  4OIR A;  5IYB K;  2NVQ K;  1TWC A;  1XXB A;  3FOE A;  2JA6 K;  1SFO C;  5M5Y K;  2R93 K;  2NVQ C;  1USO A;  4XCH A;  3HOZ K;  3PO2 K;  4A3B K;  1XZQ B;  1K83 K;  5HL8 A;  3FKI C;  4P5B A;  1F93 A;  2PHC B;  1I50 C;  5JFE A;  3HOX K;  3LAJ A;  1J6W A;  3TFI A;  4KAW X;  4A3M K;  3GEE A;  2NVT K;  3L4K A;  3S0X A;  1IW7 A;  1K83 A;  3TTG A;  4A3M C;  1BJT A;  1B4B A;  2B63 K;  1ZBS A;  4GTB A;  2JA6 A;  2E2H K;  4WIL A;  4C3I K;  2V6S A;  1VRQ C;  3CQZ A;  4ILD A;  1Y1W K;  4A3B C;  4LLG A;  4C45 A;  2R93 C;  2E2H A;  5C3E C;  3GTO C;  2JA7 C;  1TWG C;  1XXC A;  1WOP A;  1TWF A;  3HOU K;  1I6H K;  3BP3 A;  3TFJ A;  3GTJ K;  4A3G K;  4QIW L;  1PJ7 A;  1WSV A;  1VJE A;  2VUM C;  1BS2 A;  1DCP A;  1WOO A;  4KN7 A;  3GTK C;  4YG2 A;  5FLM K;  5IP7 C;  1BDF A;  4XLP A;  4C2M C;  4GFQ A;  5IP9 C;  2V6U A;  3L4J A;  1KQ4 A;  3S14 K;  3S14 C;  4Y7N C;  4BXX C;  3H3V D;  3G4A A;  4A3E C;  1TWC K;  2R7Z A;  1O29 A;  4J3N A;  4MEX A;  4M1X A;  1B4A A;  1ZXO A;  3HOY C;  1WQH A;  4Y7N K;  1Y1V A;  1ISE A;  3RZO C;  2Y0S D;  1GE9 A;  4WJ3 M;  2PPB A;  2FQO A;  2KWA A;  4C3J C;  4JK1 A;  4LR2 A;  1USM A;  1WCM C;  4BKW A;  4A3G C;  3AD9 C;  3LAP A;  5D4D A;  1WQG A;  1YCL A;  1RU0 A;  1VGX A;  2A69 A;  1JOE A;  4GTC A;  3H0G K;  2NVX A;  4A3C C;  4BY7 C;  4QJV B;  4GTD A;  2JA5 A;  1HQM A;  2XCO A;  5C3E K;  3BP8 C;  1TWF K;  2BE5 A;  1PJ5 A;  3I4M C;  1TWC C;  3S1N K;  1INN A;  4A3I C;  2CFA B;  5M5X K;  3SZY A;  4GTF A;  3M4O K;  3MML B;  2GAG C;  1IS1 A;  1R9T A;  4LOW A;  2PA8 D;  2NVY K;  3FKI A;  3ORE A;  2CW0 A;  1O26 A;  2NVT C;  3ERE D;  5E68 A;  3HXA A;  4A3J C;  3GTP C;  3S15 K;  3GEI A;  5M3M K;  4A3D C;  3HOW C;  3S17 K;  5IYD K;  4A3F C;  3S1R C;  3S1R K;  1DCO A;  3JST A;  2YU9 K;  4BY1 K;  2WAQ L;  3GEH A;  4OIO A;  1EQR A;  3GTO K;  3HOW K;  3S17 C;  1ZYR A;  2JA6 C;  1WOR A;  3CAG A;  4OIQ A;  2B63 A;  2A6H A;  3DXJ A;  2E2I K;  2R93 A;  5C4J K;  1F9N A;  4G7O A;  2JA5 K;  4FM9 A;  3OEP A;  3VA7 A;  3AH5 A;  3S2H K;  3OPF A;  3HOV K;  3S1N C;  4DDQ A;  1TWG A;  1O2A A;  4A93 K;  3GTG K;  4C3H K;  4GZY A;  1VH2 A;  3M3Y C;  3IPJ A;  4BXX K;  4KC6 A;  2VUM A;  4A3C K;  4XLN A;  2WB1 D;  3GIR A;  3GTK A;  5IOR A;  5C44 K;  3GTM K;  2FQT A;  4PAB A;  4AH6 A;  1SFO K;  3AQP A;  3HKZ L;  2R7Z C;  5EGE A;  3A8J A;  2WAQ D;  3S1M C;  3S1M K;  1TWH A;  3G4C A;  1TWA A;  4KAS A;  1WCM K;  2ZFZ A;  1Y1V C;  5CJ9 A;  3K7A C;  4PAA A;  1O28 A;  4A3K C;  3S16 K;  3GTQ A;  3HOV C;  1G51 A;  1PJ6 A;  1O24 A;  4GTA A;  2RH6 A;  4BBR C;  2XCR B;  4X6A K;  4Q4Z A;  5EGH A;  4G0W A;  1V5V A;  2NVX C;  5C4X C;  1AB4 A;  5M5W K;  2JA5 C;  4BBS C;  3GTJ C;  4G0V A;  2R92 A;  3HOU C;  1I6H C;  4Y52 K;  4KAR A;  1J6V A;  3CQZ K;  4KM9 A;  1Y1W A;  1TWG K;  3S15 C;  4A3D K;  5IP7 K;  3GTP K;  4MQ9 A;  1YX2 A;  3HKZ D;  4A3L C;  4Q5S A;  5IYB C;  3ADA C;  1R9T C;  1L0W A; 
#chains in the Genus database with same CATH homology
 1K83 K;  2NVY K;  3FKI C;  5IYD C;  4LK0 A;  1SMY A;  2CW0 A;  1I50 C;  3HOX K;  2NVT C;  4A3J C;  4YFK A;  3GTP C;  3S15 K;  2Y0S L;  5M3M K;  4G7Z A;  3HOW C;  3S17 K;  2O5I A;  4A3D C;  4A3M K;  2VUM K;  1I50 K;  3HOX C;  2NVT K;  4KMU A;  5IYD K;  4OIN A;  3H3V L;  3S1Q C;  3S1Q K;  4A3F C;  2PMZ L;  3S1R C;  5TMC A;  3S1R K;  5C4J C;  3FKI K;  1IW7 A;  3GTL K;  1K83 C;  4BBR K;  2YU9 K;  4A3M C;  4BY1 K;  3H0G C;  4G7H A;  2WAQ L;  2B63 K;  4OIO A;  3GTO K;  3HOW K;  3S17 C;  3S2H C;  1ZYR A;  2E2J K;  2JA6 C;  2E2H K;  4A3I K;  5IYC C;  4OIQ A;  4C3I K;  2B63 C;  3CQZ C;  1Y1W K;  4A3K K;  3GTQ K;  3S16 C;  4A3B C;  2A6H A;  3DXJ A;  2E2I C;  4XSX A;  4LLG A;  4AYB L;  2E2I K;  3GTL C;  5C4J K;  4G7O A;  2R93 C;  2JA5 K;  2E2H C;  5C3E C;  3WOD A;  3S2H K;  3HOY K;  3GTO C;  4BY7 K;  4C3J K;  3I4M K;  3HOV K;  3S1N C;  2JA7 C;  1TWG C;  4A93 K;  1TWF C;  2YU9 C;  3GTG K;  4C3H K;  4QJV A;  3HOU K;  4GZY A;  1I6H K;  3M3Y C;  4X6A C;  4A3F K;  5FJ8 K;  3GTJ K;  4BBS K;  4A3G K;  4QIW L;  4BXX K;  2VUM C;  4A3C K;  4XLN A;  5C4X K;  2NVX K;  2WB1 D;  4KN7 A;  3GTK C;  2JA8 C;  4YFN A;  4YG2 A;  5C44 K;  5IP7 C;  1BDF A;  5FLM K;  3GTM K;  3I4N K;  4XLP A;  2NVY C;  4MEY A;  4YFX A;  3PO3 K;  5IP9 C;  4ZH4 A;  4Y52 C;  1I6V A;  2O5J A;  3HOZ C;  1YNN A;  3PO2 C;  2R92 K;  3S14 K;  3S14 C;  4Y7N C;  1SFO K;  3M4O C;  1Y1V K;  3H3V D;  4A3L K;  4BXX C;  2PMZ D;  3PO3 C;  2A68 A;  4C2M K;  4A3E C;  1TWA K;  4LJZ A;  1TWC K;  3S2D C;  3HKZ L;  2R7Z C;  1I3Q C;  3I4N C;  5C44 C;  3GTM C;  3GTG C;  2WAQ D;  3RZD K;  3RZD C;  3S1M K;  1TWH C;  3S1M C;  4MEX A;  4A3E K;  3K7A K;  4LK1 A;  2PA8 L;  2R7Z K;  3HOY C;  1TWA C;  3S2D K;  4Y7N K;  1WCM K;  1Y1V C;  3RZO C;  2A6E A;  2Y0S D;  3EQL A;  3K7A C;  5IP9 K;  1I3Q K;  2PPB A;  4A3K C;  3GTQ C;  3S16 K;  5M3F K;  3HOV C;  1YNJ A;  4JK1 A;  1WCM C;  4A3G C;  4BY1 C;  4BBR C;  4X6A K;  5D4D A;  5IYC K;  4Q4Z A;  3GTK K;  3M3Y K;  2E2J C;  5FLM C;  2JA7 K;  2JA8 K;  2WB1 L;  4OIP A;  3RZO K;  2A69 A;  4AYB D;  2NVX C;  5C4X C;  3H0G K;  4A3C C;  5TMF A;  5M5W K;  4A3J K;  4BY7 C;  4QJV B;  2JA5 C;  4NOI A;  3GTJ C;  1HQM A;  4BBS C;  5C3E K;  2R92 C;  3HOU C;  1I6H C;  1TWH K;  1TWF K;  2BE5 A;  4OIR A;  4A93 C;  4Y52 K;  3CQZ K;  1Y1W C;  5IYB K;  3I4M C;  2NVQ K;  4KN4 A;  1TWC C;  1TWG K;  4XSZ A;  3S1N K;  3S15 C;  4A3D K;  5IP7 K;  3GTP K;  4MQ9 A;  4A3I C;  5M5X K;  3HKZ D;  2JA6 K;  1SFO C;  3M4O K;  1XPP A;  4A3L C;  4Q5S A;  4QIW D;  5M5Y K;  2R93 K;  2NVQ C;  3HOZ K;  5IYB C;  3PO2 K;  4A3B K;  1R9T K;  1R9T C;  2PA8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...