2E2JK

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2jK00
3M4OK 4YG2A 2R92C 3HOUK 5M3MK 2E2HC 4BBSK 1I6HC 3HKZL 4QJVB 4NOIA 5IP9C 5IP7C 1I50K 1I3QK 3GTPC 2Y0SL 3DXJA 5IYCK 5M5XK 3HOVK 4BXXK 1TWFC 4A93K 4OIQA 1I50C 3S17C 5FLMK 4Y52C 3HOVC 3GTMK 2JA5C 4G7OA 2NVYC 4BBRK 3GTLK 3S1QK 4A3MK 3CQZK 5FLMC 2JA6C 1Y1WK 2R7ZK 2O5JA 2WB1D 4LJZA 3CQZC 5IYBC 3S1RK 1SMYA 2JA7K 5D4DA 1Y1WC 2R7ZC 1BDFA 4OIPA 3K7AC 4C3JK 1HQMA 3S2DK 4A3KC 5TMFA 3GTKK 3HKZD 3PO2K 3HOXK 2R92K 2Y0SD 2E2HK 3GTKC 2PA8L 1I6HK 5IP9K 5IP7K 3PO2C 3FKIC 2B63C 3GTPK 3GTQC 2NVXC 3GTGC 1YNNA 5C4JC 1TWFK 4A3EC 2A69A 5TMCA 5M5YK 4G7ZA 3RZDK 3RZOC 3S17K 4QIWL 4Y52K 2JA5K 2NVYK 3S1NC 3RZDC 2JA6K 5IYDC 3HOYC 4XSXA 5IYBK 2A68A 3GTOC 3PO3K 4JK1A 3S16C 4A3DC 4BY1C 5C4XK 4A3CC 3EQLA 3K7AK 3PO3C 5FJ8K 1TWGC 4A3KK 2PA8D 5C4XC 2PMZL 1TWHC 2NVQC 4X6AC 4LLGA 5C3EC 3FKIK 2B63K 3HOWC 2NVTC 1TWAK 3GTQK 4Q4ZA 4QIWD 2NVXK 4OIRA 3GTGK 5C4JK 2R93C 4XLNA 3GTJC 5C44C 4A3EK 3RZOK 1TWAC 2BE5A 4A3GC 3S1NK 4A3FC 2A6HA 5M3FK 5IYDK 3HOYK 3H3VL 2PPBA 2YU9C 4KN4A 2E2JC 3GTOK 3S16K 4A3DK 1R9TC 4BY1K 4A3JK 4YFNA 4A3CK 4KMUA 1Y1VK 4Y7NK 1WCMC 3I4MC 1TWGK 2PMZD 4A3IC 2JA8C 4BY7C 4A3JC 3H0GC 4Y7NC 1Y1VC 4A3BC 4LK0A 1K83C 1TWHK 4OINA 2NVQK 3S2HK 4X6AK 2A6EA 3S15C 5C3EK 4MEXA 3M3YC 1TWCC 4G7HA 3HOZC 4C3HK 4MQ9A 3HOWK 2NVTK 4YFXA 3I4NC 1ZYRA 2WAQL 1SFOK 3S2HC 2R93K 4A3LC 3GTJK 5C44K 4OIOA 4YFKA 5M5WK 3M4OC 4AYBL 4KN7A 1SFOC 3HOUC 3S14K 4A3GK 4BBSC 3H3VD 3S1MK 4A3FK 2O5IA 4Q5SA 1YNJA 3S14C 1IW7A 1I3QC 4LK1A 2E2IK 4BXXC 5IYCC 3S1MC 2YU9K 4A93C 4XSZA 2E2JK 2E2IC 2CW0A 1R9TK 3GTMC 2VUMK 4MEYA 4BBRC 3GTLC 3S1QC 1WCMK 4A3MC 3I4MK 4A3IK 2JA8K 4BY7K 3H0GK 2VUMC 4A3BK 1XPPA 4XLPA 3WODA 1K83K 4C3IK 3S1RC 2JA7C 2WAQD 4C2MK 4GZYA 3S15K 3M3YK 1TWCK 3HOZK 2WB1L 3I4NK 4QJVA 4AYBD 3S2DC 4ZH4A 4A3LK 1I6VA 3HOXC
chains in the Genus database with same CATH superfamily
2R92C 2CFAB 3HKZL 5IP9C 4KATA 3GTPC 3DXJA 5IYCK 4A93K 4OIQA 1PJ6A 1WQGA 3S17C 1BGWA 3HOVC 4G7OA 3GTLK 2V6TA 3CQZK 3GTQA 3GTGA 4LJZA 1Y1WC 4C45A 3T01A 1JQWA 3CAGA 4OIPA 3A8KA 1O29A 3K7AC 3S2DK 1C0AA 2P8TA 3HKZD 1J6XA 2V6UA 4LOWA 3PO2C 3FKIC 1Y1VA 2B63C 1KQ4A 4G7ZA 3RZDK 3BUEA 4Y52K 2NVYK 3SZYA 3OEPA 1SFOA 2R93A 3GTJA 4FZBA 5IYBK 3S16C 5C4XK 3L4KA 4P5BA 1VJEA 1TWGC 3Q3QA 2E2IA 2ZUFA 5CHPA 3TFJA 4KMHA 5C3EC 3GTQK 3GTGK 4KAWX 5C4JK 3H0GA 4RMFA 1TWCA 3G4CA 1WSRA 4XCHA 4GT9A 5EGEA 1Y1VK 1I50A 1WQFA 1INNA 1PJ5A 4Y7NC 1V5VA 4MEXA 3GTMA 3HOZC 4G7HA 3LPXA 1ZYRA 3GIRA 1DCHA 1SFOK 3S2HC 2R93K 3GTJK 4OIOA 5IORA 4KN7A 3S1MK 2E2IK 5IYCC 4A93C 3GTKA 4XSZA 4GTDA 2E2HA 4MEYA 3GTLC 1DCOA 2P5MA 4GTLA 4A3IK 4BY7K 3H0GK 1F9NA 1TWFA 3LAPA 4GZYA 3S15K 1TWCK 2JA5A 4C3IC 2RH6A 3T00A 4QJVA 3S2DC 2JA6A 1HI9A 3FOFA 4A3LK 3HOUK 1EH1A 1I50K 2GSOA 4Y52C 3GTMK 2NVYC 4BBRK 3S1QK 2GAHC 5FLMC 2PHCB 5IYBC 1IQ0A 1SMYA 3S1RK 2R7ZC 1BDFA 1EQRA 1F7VA 4C3JK 4G0WA 3GTKK 3BP3A 3HOXK 3GTOA 2E2HK 3S0XA 5IP7K 1O26A 3GTQC 4KMAA 3GTGC 3AD8C 5C4JC 1TWFK 4BKWA 1X31C 5TMCA 5M5YK 5EGHA 2JA5K 4G0UA 3A8JA 2FQOA 1UV7A 2JA6K 3BP8C 3IPJA 2RGRA 3PO3C 1XZQA 2YU9A 1R9TA 1WCMA 4Q4ZA 4OIRA 3L4JA 2R93C 4KMDA 3GTJC 1TWAC 1XXCA 4J3NA 3S1NK 2A6HA 5M3FK 4KN4A 3GTOK 4A3DK 3TTGA 1VGXA 4BY1K 1DCPA 4GTBA 4A3JK 2EBBA 4A3IC 4BY7C 1I3QA 3H0GC 5IOSA 1VH2A 4P9SA 4PABA 1O24A 5TJ3A 2A6EA 3S15C 1TWCC 4C3HK 1ISEA 1BS2A 2WAQL 4A3LC 1Y1WA 2GSUA 4YFKA 1IS1A 1ZQ1C 3HOUC 4A3FK 3FOEA 4Q5SA 3S14C 4LK1A 1JOEA 2YU9K 1R9TK 3GTMC 4BBRC 3S1QC 1WCMK 1WQHA 2XCRB 2VUMC 4KC6A 3QX3A 1XXBA 3WODA 3S1RC 2WAQD 4C2MK 1O2BA 3M3YK 2WB1L 3I4NK 4C3JC 3HOXC 4YG2A 4BBSK 2E2HC 5IP7C 3GDZA 1XZPB 1I3QK 3HOVK 5M5XK 3JSTA 1TWFC 2XCOA 2JA5C 4BLBA 2JA6C 1Y1WK 2NVXA 3VA7A 2O5JA 3N3YA 4FM9A 2WB1D 3CQZC 4KDDA 4PAAA 1XXAA 1BJTA 1O27A 1EK8A 1EFWA 1O2FB 1HQMA 2V6SA 1O25A 1VRQC 1WSVA 3FHZA 3PO2K 4KM8A 1XZQB 3AD7C 2PA8L 1I6HK 1AB4A 1O2AA 2A69A 4QIWL 1TWHA 3NUHA 4KARA 3S1NC 3RZDC 4KASA 4XSXA 3GEHA 3GEEA 2A68A 3GTOC 4A3DC 4JK1A 3ADAC 3G4AA 4BY1C 2XCQA 4A3KK 4WILA 2PA8D 5C4XC 3HXAA 1J98A 3V4GA 4C3HC 1J6VA 2NVXK 4QIWD 4XLNA 4A3EK 3RZOK 1K83A 2BE5A 1USOA 4A3FC 1B4BA 5IYDK 3HOYK 4M1XA 2YU9C 4ILDA 1WORA 1R9TC 1F7UA 1RU0A 4WJ4A 4YFNA 4A3CK 4Y7NK 1WCMC 1VLOA 3LAJA 1IE0A 1Y1VC 1TWHK 4KB2A 4OINA 2NVQK 3S2HK 4C2MC 4X6AK 3M3YC 3HOWK 2NVTK 4LR2A 3I4NC 1DD5A 2R7ZA 5C44K 5M5WK 3OPFA 4KM9A 1SFOC 2JA7A 4A3GK 4BBSC 1YNJA 1IW7A 1I3QC 4P5AA 3S1MC 2E2JK 2E2IC 2R92A 3GSIA 2GAGC 1WOPA 4KB4A 3I4MK 2JA8K 3GTPA 4A3BK 4C3IK 1K83K 1WOSA 3OREA 4ZH4A 1WOOA 1I6VA 3A8IA 3M4OK 5M3MK 1I6HC 1ZXOA 4NOIA 4QJVB 3TFHA 2Y0SL 4BXXK 1B4AA 4GTCA 1I50C 1O28A 5FLMK 5HL8A 4A3MK 3AQOA 3MMLB 3AQPA 3FKIA 5E68A 2B63A 1TWAA 2R7ZK 2JA7K 1L0WA 5D4DA 1F93A 1ZBSA 4AH6A 2GSNA 4A3KC 5TMFA 2CFAA 2ZFZA 3T02A 5CJ9A 2R92K 2Y0SD 4O2DA 3GTKC 5IP9K 5JFEA 2ZUEA 2Y3PA 3GTPK 1TWGA 2NVXC 1YNNA 4A3EC 3RZOC 3S17K 4BLAA 3N0CA 4DDQA 3AD9C 1ZVUA 2W7VA 5IYDC 3HOYC 3PO3K 3ERED 4A3CC 2JH3A 1JVIA 3EQLA 3K7AK 5FJ8K 1G51A 2PMZL 1TWHC 2NVQC 4X6AC 4LLGA 2VUMA 3FKIK 1PJ7A 2B63K 2NVTC 1TWAK 3HOWC 1IBAA 5IOTA 5C44C 1YCLA 5L46A 2FQTA 1IL2A 4A3GC 1YX2A 1EI6A 4GTFA 1USMA 3H3VL 2PPBA 4G0VA 2KWAA 2E2JC 3S16K 1GE9A 4KMUA 3I4MC 1TWGK 2PMZD 2JA8C 4A3JC 1J6WA 4A3BC 4LK0A 1K83C 5C3EK 4MQ9A 3GTLA 4YFXA 3CQZA 3SZZA 3M4OC 4AYBL 4GTEA 4LQYA 3S14K 3H3VD 3AH5A 2O5IA 3N0BA 3GEIA 4BXXC 2CW0A 5IOQA 2VUMK 2D6FC 4A3MC 5JVOA 4WJ3M 4GFQA 1XPPA 4XLPA 2JA7C 4GTAA 3HOZK 2NVYA 1WIHA 3TFIA 4AYBD 1XZPA
chains in the Genus database with same CATH topology
3M4OK 4YG2A 2R92C 3HOUK 5M3MK 2E2HC 4BBSK 1I6HC 3HKZL 4QJVB 4NOIA 5IP9C 5IP7C 1I50K 1I3QK 3GTPC 2Y0SL 3DXJA 5IYCK 5M5XK 3HOVK 4BXXK 1TWFC 4A93K 4OIQA 1I50C 3S17C 5FLMK 4Y52C 3HOVC 3GTMK 2JA5C 4G7OA 2NVYC 4BBRK 3GTLK 3S1QK 4A3MK 3CQZK 5FLMC 2JA6C 1Y1WK 2R7ZK 2O5JA 2WB1D 4LJZA 3CQZC 5IYBC 3S1RK 1SMYA 2JA7K 5D4DA 1Y1WC 2R7ZC 1BDFA 4OIPA 3K7AC 4C3JK 1HQMA 3S2DK 4A3KC 5TMFA 3GTKK 3HKZD 3PO2K 3HOXK 2R92K 2Y0SD 2E2HK 3GTKC 2PA8L 1I6HK 5IP9K 5IP7K 3PO2C 3FKIC 2B63C 3GTPK 3GTQC 2NVXC 3GTGC 1YNNA 5C4JC 1TWFK 4A3EC 2A69A 5TMCA 5M5YK 4G7ZA 3RZDK 3RZOC 3S17K 4QIWL 4Y52K 2JA5K 2NVYK 3S1NC 3RZDC 2JA6K 5IYDC 3HOYC 4XSXA 5IYBK 2A68A 3GTOC 3PO3K 4JK1A 3S16C 4A3DC 4BY1C 5C4XK 4A3CC 3EQLA 3K7AK 3PO3C 5FJ8K 1TWGC 4A3KK 2PA8D 5C4XC 2PMZL 1TWHC 2NVQC 4X6AC 4LLGA 5C3EC 3FKIK 2B63K 3HOWC 2NVTC 1TWAK 3GTQK 4Q4ZA 4QIWD 2NVXK 4OIRA 3GTGK 5C4JK 2R93C 4XLNA 3GTJC 5C44C 4A3EK 3RZOK 1TWAC 2BE5A 4A3GC 3S1NK 4A3FC 2A6HA 5M3FK 5IYDK 3HOYK 3H3VL 2PPBA 2YU9C 4KN4A 2E2JC 3GTOK 3S16K 4A3DK 1R9TC 4BY1K 4A3JK 4YFNA 4A3CK 4KMUA 1Y1VK 4Y7NK 1WCMC 3I4MC 1TWGK 2PMZD 4A3IC 2JA8C 4BY7C 4A3JC 3H0GC 4Y7NC 1Y1VC 4A3BC 4LK0A 1K83C 1TWHK 4OINA 2NVQK 3S2HK 4X6AK 2A6EA 3S15C 5C3EK 4MEXA 3M3YC 1TWCC 4G7HA 3HOZC 4C3HK 4MQ9A 3HOWK 2NVTK 4YFXA 3I4NC 1ZYRA 2WAQL 1SFOK 3S2HC 2R93K 4A3LC 3GTJK 5C44K 4OIOA 4YFKA 5M5WK 3M4OC 4AYBL 4KN7A 1SFOC 3HOUC 3S14K 4A3GK 4BBSC 3H3VD 3S1MK 4A3FK 2O5IA 4Q5SA 1YNJA 3S14C 1IW7A 1I3QC 4LK1A 2E2IK 4BXXC 5IYCC 3S1MC 2YU9K 4A93C 4XSZA 2E2JK 2E2IC 2CW0A 1R9TK 3GTMC 2VUMK 4MEYA 4BBRC 3GTLC 3S1QC 1WCMK 4A3MC 3I4MK 4A3IK 2JA8K 4BY7K 3H0GK 2VUMC 4A3BK 1XPPA 4XLPA 3WODA 1K83K 4C3IK 3S1RC 2JA7C 2WAQD 4C2MK 4GZYA 3S15K 3M3YK 1TWCK 3HOZK 2WB1L 3I4NK 4QJVA 4AYBD 3S2DC 4ZH4A 4A3LK 1I6VA 3HOXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4O K;  4YG2 A;  2R92 C;  3HOU K;  5M3M K;  2E2H C;  4BBS K;  1I6H C;  3HKZ L;  4QJV B;  4NOI A;  5IP9 C;  5IP7 C;  1I50 K;  1I3Q K;  3GTP C;  2Y0S L;  3DXJ A;  5IYC K;  5M5X K;  3HOV K;  4BXX K;  1TWF C;  4A93 K;  4OIQ A;  1I50 C;  3S17 C;  5FLM K;  4Y52 C;  3HOV C;  3GTM K;  2JA5 C;  4G7O A;  2NVY C;  4BBR K;  3GTL K;  3S1Q K;  4A3M K;  3CQZ K;  5FLM C;  2JA6 C;  1Y1W K;  2R7Z K;  2O5J A;  2WB1 D;  4LJZ A;  3CQZ C;  5IYB C;  3S1R K;  1SMY A;  2JA7 K;  5D4D A;  1Y1W C;  2R7Z C;  1BDF A;  4OIP A;  3K7A C;  4C3J K;  1HQM A;  3S2D K;  4A3K C;  5TMF A;  3GTK K;  3HKZ D;  3PO2 K;  3HOX K;  2R92 K;  2Y0S D;  2E2H K;  3GTK C;  2PA8 L;  1I6H K;  5IP9 K;  5IP7 K;  3PO2 C;  3FKI C;  2B63 C;  3GTP K;  3GTQ C;  2NVX C;  3GTG C;  1YNN A;  5C4J C;  1TWF K;  4A3E C;  2A69 A;  5TMC A;  5M5Y K;  4G7Z A;  3RZD K;  3RZO C;  3S17 K;  4QIW L;  4Y52 K;  2JA5 K;  2NVY K;  3S1N C;  3RZD C;  2JA6 K;  5IYD C;  3HOY C;  4XSX A;  5IYB K;  2A68 A;  3GTO C;  3PO3 K;  4JK1 A;  3S16 C;  4A3D C;  4BY1 C;  5C4X K;  4A3C C;  3EQL A;  3K7A K;  3PO3 C;  5FJ8 K;  1TWG C;  4A3K K;  2PA8 D;  5C4X C;  2PMZ L;  1TWH C;  2NVQ C;  4X6A C;  4LLG A;  5C3E C;  3FKI K;  2B63 K;  3HOW C;  2NVT C;  1TWA K;  3GTQ K;  4Q4Z A;  4QIW D;  2NVX K;  4OIR A;  3GTG K;  5C4J K;  2R93 C;  4XLN A;  3GTJ C;  5C44 C;  4A3E K;  3RZO K;  1TWA C;  2BE5 A;  4A3G C;  3S1N K;  4A3F C;  2A6H A;  5M3F K;  5IYD K;  3HOY K;  3H3V L;  2PPB A;  2YU9 C;  4KN4 A;  2E2J C;  3GTO K;  3S16 K;  4A3D K;  1R9T C;  4BY1 K;  4A3J K;  4YFN A;  4A3C K;  4KMU A;  1Y1V K;  4Y7N K;  1WCM C;  3I4M C;  1TWG K;  2PMZ D;  4A3I C;  2JA8 C;  4BY7 C;  4A3J C;  3H0G C;  4Y7N C;  1Y1V C;  4A3B C;  4LK0 A;  1K83 C;  1TWH K;  4OIN A;  2NVQ K;  3S2H K;  4X6A K;  2A6E A;  3S15 C;  5C3E K;  4MEX A;  3M3Y C;  1TWC C;  4G7H A;  3HOZ C;  4C3H K;  4MQ9 A;  3HOW K;  2NVT K;  4YFX A;  3I4N C;  1ZYR A;  2WAQ L;  1SFO K;  3S2H C;  2R93 K;  4A3L C;  3GTJ K;  5C44 K;  4OIO A;  4YFK A;  5M5W K;  3M4O C;  4AYB L;  4KN7 A;  1SFO C;  3HOU C;  3S14 K;  4A3G K;  4BBS C;  3H3V D;  3S1M K;  4A3F K;  2O5I A;  4Q5S A;  1YNJ A;  3S14 C;  1IW7 A;  1I3Q C;  4LK1 A;  2E2I K;  4BXX C;  5IYC C;  3S1M C;  2YU9 K;  4A93 C;  4XSZ A;  2E2J K;  2E2I C;  2CW0 A;  1R9T K;  3GTM C;  2VUM K;  4MEY A;  4BBR C;  3GTL C;  3S1Q C;  1WCM K;  4A3M C;  3I4M K;  4A3I K;  2JA8 K;  4BY7 K;  3H0G K;  2VUM C;  4A3B K;  1XPP A;  4XLP A;  3WOD A;  1K83 K;  4C3I K;  3S1R C;  2JA7 C;  2WAQ D;  4C2M K;  4GZY A;  3S15 K;  3M3Y K;  1TWC K;  3HOZ K;  2WB1 L;  3I4N K;  4QJV A;  4AYB D;  3S2D C;  4ZH4 A;  4A3L K;  1I6V A;  3HOX C; 
#chains in the Genus database with same CATH topology
 2R92 C;  2CFA B;  3HKZ L;  5IP9 C;  4KAT A;  3GTP C;  3DXJ A;  5IYC K;  4A93 K;  4OIQ A;  1PJ6 A;  1WQG A;  3S17 C;  1BGW A;  3HOV C;  4G7O A;  3GTL K;  2V6T A;  3CQZ K;  3GTQ A;  3GTG A;  4LJZ A;  1Y1W C;  4C45 A;  3T01 A;  1JQW A;  3CAG A;  4OIP A;  3A8K A;  1O29 A;  3K7A C;  3S2D K;  1C0A A;  2P8T A;  3HKZ D;  1J6X A;  2V6U A;  4LOW A;  3PO2 C;  3FKI C;  1Y1V A;  2B63 C;  1KQ4 A;  4G7Z A;  3RZD K;  3BUE A;  4Y52 K;  2NVY K;  3SZY A;  3OEP A;  1SFO A;  2R93 A;  3GTJ A;  4FZB A;  5IYB K;  3S16 C;  5C4X K;  3L4K A;  4P5B A;  1VJE A;  1TWG C;  3Q3Q A;  2E2I A;  2ZUF A;  5CHP A;  3TFJ A;  4KMH A;  5C3E C;  3GTQ K;  3GTG K;  4KAW X;  5C4J K;  3H0G A;  4RMF A;  1TWC A;  3G4C A;  1WSR A;  4XCH A;  4GT9 A;  5EGE A;  1Y1V K;  1I50 A;  1WQF A;  1INN A;  1PJ5 A;  4Y7N C;  1V5V A;  4MEX A;  3GTM A;  3HOZ C;  4G7H A;  3LPX A;  1ZYR A;  3GIR A;  1DCH A;  1SFO K;  3S2H C;  2R93 K;  3GTJ K;  4OIO A;  5IOR A;  4KN7 A;  3S1M K;  2E2I K;  5IYC C;  4A93 C;  3GTK A;  4XSZ A;  4GTD A;  2E2H A;  4MEY A;  3GTL C;  1DCO A;  2P5M A;  4GTL A;  4A3I K;  4BY7 K;  3H0G K;  1F9N A;  1TWF A;  3LAP A;  4GZY A;  3S15 K;  1TWC K;  2JA5 A;  4C3I C;  2RH6 A;  3T00 A;  4QJV A;  3S2D C;  2JA6 A;  1HI9 A;  3FOF A;  4A3L K;  3HOU K;  1EH1 A;  1I50 K;  2GSO A;  4Y52 C;  3GTM K;  2NVY C;  4BBR K;  3S1Q K;  2GAH C;  5FLM C;  2PHC B;  5IYB C;  1IQ0 A;  1SMY A;  3S1R K;  2R7Z C;  1BDF A;  1EQR A;  1F7V A;  4C3J K;  4G0W A;  3GTK K;  3BP3 A;  3HOX K;  3GTO A;  2E2H K;  3S0X A;  5IP7 K;  1O26 A;  3GTQ C;  4KMA A;  3GTG C;  3AD8 C;  5C4J C;  1TWF K;  4BKW A;  1X31 C;  5TMC A;  5M5Y K;  5EGH A;  2JA5 K;  4G0U A;  3A8J A;  2FQO A;  1UV7 A;  2JA6 K;  3BP8 C;  3IPJ A;  2RGR A;  3PO3 C;  1XZQ A;  2YU9 A;  1R9T A;  1WCM A;  4Q4Z A;  4OIR A;  3L4J A;  2R93 C;  4KMD A;  3GTJ C;  1TWA C;  1XXC A;  4J3N A;  3S1N K;  2A6H A;  5M3F K;  4KN4 A;  3GTO K;  4A3D K;  3TTG A;  1VGX A;  4BY1 K;  1DCP A;  4GTB A;  4A3J K;  2EBB A;  4A3I C;  4BY7 C;  1I3Q A;  3H0G C;  5IOS A;  1VH2 A;  4P9S A;  4PAB A;  1O24 A;  5TJ3 A;  2A6E A;  3S15 C;  1TWC C;  4C3H K;  1ISE A;  1BS2 A;  2WAQ L;  4A3L C;  1Y1W A;  2GSU A;  4YFK A;  1IS1 A;  1ZQ1 C;  3HOU C;  4A3F K;  3FOE A;  4Q5S A;  3S14 C;  4LK1 A;  1JOE A;  2YU9 K;  1R9T K;  3GTM C;  4BBR C;  3S1Q C;  1WCM K;  1WQH A;  2XCR B;  2VUM C;  4KC6 A;  3QX3 A;  1XXB A;  3WOD A;  3S1R C;  2WAQ D;  4C2M K;  1O2B A;  3M3Y K;  2WB1 L;  3I4N K;  4C3J C;  3HOX C;  4YG2 A;  4BBS K;  2E2H C;  5IP7 C;  3GDZ A;  1XZP B;  1I3Q K;  3HOV K;  5M5X K;  3JST A;  1TWF C;  2XCO A;  2JA5 C;  4BLB A;  2JA6 C;  1Y1W K;  2NVX A;  3VA7 A;  2O5J A;  3N3Y A;  4FM9 A;  2WB1 D;  3CQZ C;  4KDD A;  4PAA A;  1XXA A;  1BJT A;  1O27 A;  1EK8 A;  1EFW A;  1O2F B;  1HQM A;  2V6S A;  1O25 A;  1VRQ C;  1WSV A;  3FHZ A;  3PO2 K;  4KM8 A;  1XZQ B;  3AD7 C;  2PA8 L;  1I6H K;  1AB4 A;  1O2A A;  2A69 A;  4QIW L;  1TWH A;  3NUH A;  4KAR A;  3S1N C;  3RZD C;  4KAS A;  4XSX A;  3GEH A;  3GEE A;  2A68 A;  3GTO C;  4A3D C;  4JK1 A;  3ADA C;  3G4A A;  4BY1 C;  2XCQ A;  4A3K K;  4WIL A;  2PA8 D;  5C4X C;  3HXA A;  1J98 A;  3V4G A;  4C3H C;  1J6V A;  2NVX K;  4QIW D;  4XLN A;  4A3E K;  3RZO K;  1K83 A;  2BE5 A;  1USO A;  4A3F C;  1B4B A;  5IYD K;  3HOY K;  4M1X A;  2YU9 C;  4ILD A;  1WOR A;  1R9T C;  1F7U A;  1RU0 A;  4WJ4 A;  4YFN A;  4A3C K;  4Y7N K;  1WCM C;  1VLO A;  3LAJ A;  1IE0 A;  1Y1V C;  1TWH K;  4KB2 A;  4OIN A;  2NVQ K;  3S2H K;  4C2M C;  4X6A K;  3M3Y C;  3HOW K;  2NVT K;  4LR2 A;  3I4N C;  1DD5 A;  2R7Z A;  5C44 K;  5M5W K;  3OPF A;  4KM9 A;  1SFO C;  2JA7 A;  4A3G K;  4BBS C;  1YNJ A;  1IW7 A;  1I3Q C;  4P5A A;  3S1M C;  2E2J K;  2E2I C;  2R92 A;  3GSI A;  2GAG C;  1WOP A;  4KB4 A;  3I4M K;  2JA8 K;  3GTP A;  4A3B K;  4C3I K;  1K83 K;  1WOS A;  3ORE A;  4ZH4 A;  1WOO A;  1I6V A;  3A8I A;  3M4O K;  5M3M K;  1I6H C;  1ZXO A;  4NOI A;  4QJV B;  3TFH A;  2Y0S L;  4BXX K;  1B4A A;  4GTC A;  1I50 C;  1O28 A;  5FLM K;  5HL8 A;  4A3M K;  3AQO A;  3MML B;  3AQP A;  3FKI A;  5E68 A;  2B63 A;  1TWA A;  2R7Z K;  2JA7 K;  1L0W A;  5D4D A;  1F93 A;  1ZBS A;  4AH6 A;  2GSN A;  4A3K C;  5TMF A;  2CFA A;  2ZFZ A;  3T02 A;  5CJ9 A;  2R92 K;  2Y0S D;  4O2D A;  3GTK C;  5IP9 K;  5JFE A;  2ZUE A;  2Y3P A;  3GTP K;  1TWG A;  2NVX C;  1YNN A;  4A3E C;  3RZO C;  3S17 K;  4BLA A;  3N0C A;  4DDQ A;  3AD9 C;  1ZVU A;  2W7V A;  5IYD C;  3HOY C;  3PO3 K;  3ERE D;  4A3C C;  2JH3 A;  1JVI A;  3EQL A;  3K7A K;  5FJ8 K;  1G51 A;  2PMZ L;  1TWH C;  2NVQ C;  4X6A C;  4LLG A;  2VUM A;  3FKI K;  1PJ7 A;  2B63 K;  2NVT C;  1TWA K;  3HOW C;  1IBA A;  5IOT A;  5C44 C;  1YCL A;  5L46 A;  2FQT A;  1IL2 A;  4A3G C;  1YX2 A;  1EI6 A;  4GTF A;  1USM A;  3H3V L;  2PPB A;  4G0V A;  2KWA A;  2E2J C;  3S16 K;  1GE9 A;  4KMU A;  3I4M C;  1TWG K;  2PMZ D;  2JA8 C;  4A3J C;  1J6W A;  4A3B C;  4LK0 A;  1K83 C;  5C3E K;  4MQ9 A;  3GTL A;  4YFX A;  3CQZ A;  3SZZ A;  3M4O C;  4AYB L;  4GTE A;  4LQY A;  3S14 K;  3H3V D;  3AH5 A;  2O5I A;  3N0B A;  3GEI A;  4BXX C;  2CW0 A;  5IOQ A;  2VUM K;  2D6F C;  4A3M C;  5JVO A;  4WJ3 M;  4GFQ A;  1XPP A;  4XLP A;  2JA7 C;  4GTA A;  3HOZ K;  2NVY A;  1WIH A;  3TFI A;  4AYB D;  1XZP A; 
#chains in the Genus database with same CATH homology
 3M4O K;  4YG2 A;  2R92 C;  3HOU K;  5M3M K;  2E2H C;  4BBS K;  1I6H C;  3HKZ L;  4QJV B;  4NOI A;  5IP9 C;  5IP7 C;  1I50 K;  1I3Q K;  3GTP C;  2Y0S L;  3DXJ A;  5IYC K;  5M5X K;  3HOV K;  4BXX K;  1TWF C;  4A93 K;  4OIQ A;  1I50 C;  3S17 C;  5FLM K;  4Y52 C;  3HOV C;  3GTM K;  2JA5 C;  4G7O A;  2NVY C;  4BBR K;  3GTL K;  3S1Q K;  4A3M K;  3CQZ K;  5FLM C;  2JA6 C;  1Y1W K;  2R7Z K;  2O5J A;  2WB1 D;  4LJZ A;  3CQZ C;  5IYB C;  3S1R K;  1SMY A;  2JA7 K;  5D4D A;  1Y1W C;  2R7Z C;  1BDF A;  4OIP A;  3K7A C;  4C3J K;  1HQM A;  3S2D K;  4A3K C;  5TMF A;  3GTK K;  3HKZ D;  3PO2 K;  3HOX K;  2R92 K;  2Y0S D;  2E2H K;  3GTK C;  2PA8 L;  1I6H K;  5IP9 K;  5IP7 K;  3PO2 C;  3FKI C;  2B63 C;  3GTP K;  3GTQ C;  2NVX C;  3GTG C;  1YNN A;  5C4J C;  1TWF K;  4A3E C;  2A69 A;  5TMC A;  5M5Y K;  4G7Z A;  3RZD K;  3RZO C;  3S17 K;  4QIW L;  4Y52 K;  2JA5 K;  2NVY K;  3S1N C;  3RZD C;  2JA6 K;  5IYD C;  3HOY C;  4XSX A;  5IYB K;  2A68 A;  3GTO C;  3PO3 K;  4JK1 A;  3S16 C;  4A3D C;  4BY1 C;  5C4X K;  4A3C C;  3EQL A;  3K7A K;  3PO3 C;  5FJ8 K;  1TWG C;  4A3K K;  2PA8 D;  5C4X C;  2PMZ L;  1TWH C;  2NVQ C;  4X6A C;  4LLG A;  5C3E C;  3FKI K;  2B63 K;  3HOW C;  2NVT C;  1TWA K;  3GTQ K;  4Q4Z A;  4QIW D;  2NVX K;  4OIR A;  3GTG K;  5C4J K;  2R93 C;  4XLN A;  3GTJ C;  5C44 C;  4A3E K;  3RZO K;  1TWA C;  2BE5 A;  4A3G C;  3S1N K;  4A3F C;  2A6H A;  5M3F K;  5IYD K;  3HOY K;  3H3V L;  2PPB A;  2YU9 C;  4KN4 A;  2E2J C;  3GTO K;  3S16 K;  4A3D K;  1R9T C;  4BY1 K;  4A3J K;  4YFN A;  4A3C K;  4KMU A;  1Y1V K;  4Y7N K;  1WCM C;  3I4M C;  1TWG K;  2PMZ D;  4A3I C;  2JA8 C;  4BY7 C;  4A3J C;  3H0G C;  4Y7N C;  1Y1V C;  4A3B C;  4LK0 A;  1K83 C;  1TWH K;  4OIN A;  2NVQ K;  3S2H K;  4X6A K;  2A6E A;  3S15 C;  5C3E K;  4MEX A;  3M3Y C;  1TWC C;  4G7H A;  3HOZ C;  4C3H K;  4MQ9 A;  3HOW K;  2NVT K;  4YFX A;  3I4N C;  1ZYR A;  2WAQ L;  1SFO K;  3S2H C;  2R93 K;  4A3L C;  3GTJ K;  5C44 K;  4OIO A;  4YFK A;  5M5W K;  3M4O C;  4AYB L;  4KN7 A;  1SFO C;  3HOU C;  3S14 K;  4A3G K;  4BBS C;  3H3V D;  3S1M K;  4A3F K;  2O5I A;  4Q5S A;  1YNJ A;  3S14 C;  1IW7 A;  1I3Q C;  4LK1 A;  2E2I K;  4BXX C;  5IYC C;  3S1M C;  2YU9 K;  4A93 C;  4XSZ A;  2E2J K;  2E2I C;  2CW0 A;  1R9T K;  3GTM C;  2VUM K;  4MEY A;  4BBR C;  3GTL C;  3S1Q C;  1WCM K;  4A3M C;  3I4M K;  4A3I K;  2JA8 K;  4BY7 K;  3H0G K;  2VUM C;  4A3B K;  1XPP A;  4XLP A;  3WOD A;  1K83 K;  4C3I K;  3S1R C;  2JA7 C;  2WAQ D;  4C2M K;  4GZY A;  3S15 K;  3M3Y K;  1TWC K;  3HOZ K;  2WB1 L;  3I4N K;  4QJV A;  4AYB D;  3S2D C;  4ZH4 A;  4A3L K;  1I6V A;  3HOX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...