2E2JK

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2jK00
2PPBA 4OINA 2PMZD 2R7ZC 4YFNA 2R92C 4A3KC 5C44K 2PA8D 4A3KK 3RZOK 4A3LK 3S2DC 1YNNA 4XSXA 4LK1A 4A3FK 5M5YK 3M3YC 1WCMK 2JA7K 3S15C 4BXXC 2Y0SL 5M5WK 4A3DK 2JA5K 4X6AK 1I6VA 1R9TC 4MEXA 1TWHK 4C2MK 4XSZA 1HQMA 4C3HK 3GTGC 1Y1VC 4Y7NC 5C3EK 2NVXK 4A3BK 1TWAK 5IYDK 3EQLA 2A69A 1I3QC 4BY7K 2PA8L 2E2HC 3PO2C 3H3VD 1IW7A 4A3DC 5IP9C 4A3IK 2O5JA 3GTQC 5M5XK 3S15K 2NVTC 3M3YK 1I50K 5FLMC 4A3EC 4A3FC 5C4JC 4LJZA 2E2IK 3CQZC 4LLGA 1K83C 2PMZL 4BBRC 2R7ZK 4KN7A 1SFOK 1TWGC 2NVTK 3S1QK 3K7AC 4C3IK 5IYBK 5IP7C 2VUMC 1I6HK 3GTPK 3H3VL 3WODA 2E2JC 4A3CC 2E2HK 3S2DK 3S1NC 4G7ZA 3GTOC 3H0GC 5FJ8K 2JA6C 2BE5A 4GZYA 1SMYA 3I4NK 2JA6K 2R93K 3H0GK 4XLNA 5C3EC 5TMFA 4Q4ZA 2YU9K 3M4OC 3HOVK 3S2HK 4QIWL 4A3JC 1Y1WC 1I6HC 5IYBC 4OIPA 4Y52K 3S1QC 4BXXK 3GTLC 3S1RC 1TWGK 4ZH4A 1K83K 4JK1A 4MEYA 5TMCA 3GTMC 3CQZK 2R92K 4A3GK 3DXJA 4BBSK 4QIWD 5C4JK 4A3MK 3HOUC 1I50C 1TWFC 5FLMK 4A3EK 3S1RK 2NVYC 4A3IC 2WAQD 4OIOA 4A3JK 2WB1L 3S17K 3S2HC 4KMUA 4LK0A 3GTJC 3PO2K 3M4OK 1I3QK 4BY7C 2R93C 3I4NC 5IYDC 5C4XK 3S14C 4XLPA 4BY1C 2O5IA 3GTKK 3S14K 5C4XC 5M3MK 4Y7NK 4A93K 3GTGK 2WAQL 3S1NK 2B63K 3GTJK 3HKZL 5D4DA 4AYBD 4A3CK 1R9TK 3RZDK 3S17C 3GTPC 4X6AC 2CW0A 3HOWC 3K7AK 1WCMC 5M3FK 1TWFK 4G7HA 2JA8K 2JA7C 4BBRK 3HOUK 4A3MC 4NOIA 1TWCK 1ZYRA 4YG2A 4C3JK 4BBSC 4A3GC 3HOXC 2A6HA 5C44C 3HOXK 3GTMK 3RZOC 4A3LC 2E2IC 4Q5SA 1TWCC 3HOZK 4OIQA 2JA8C 3GTLK 3GTQK 3FKIK 5IYCC 4Y52C 3HOWK 3I4MC 5IP9K 1Y1WK 1YNJA 2A68A 3RZDC 2NVQK 3HOVC 3S16K 3S1MC 3HOYC 2B63C 3PO3K 4A93C 2YU9C 2WB1D 4BY1K 1TWAC 3GTKC 2Y0SD 3GTOK 1Y1VK 2NVXC 4A3BC 2A6EA 4YFXA 4OIRA 3HOYK 2E2JK 1TWHC 4MQ9A 4QJVA 4YFKA 2NVQC 3PO3C 3S16C 2JA5C 3S1MK 1BDFA 4QJVB 2NVYK 5IP7K 2VUMK 3FKIC 4KN4A 5IYCK 3HKZD 1XPPA 4AYBL 3I4MK 4G7OA 1SFOC 3HOZC
chains in the Genus database with same CATH superfamily
1O2BA 3ADAC 4YFNA 5C44K 4A3LK 4A3KK 5IOSA 3FOEA 5JFEA 4KMDA 4XSXA 5M5YK 4BKWA 1XZPB 2ZUEA 1O26A 1WSRA 1HQMA 3GTGC 4A3BK 5C3EK 1PJ6A 3EQLA 3GSIA 1EQRA 2ZUFA 4BY7K 1IW7A 5IP9C 3M3YK 1I50K 1ZXOA 5C4JC 1IE0A 2XCOA 4BBRC 4G0VA 4KN7A 4J3NA 1USOA 4KAWX 2NVTK 2R7ZK 2NVXA 3K7AC 4C45A 4C3IK 3GTPK 2E2JC 1USMA 2P8TA 3GTOC 3H0GC 4KARA 5TJ3A 2BE5A 4GZYA 2D6FC 4KDDA 3JSTA 2JA6K 4Q4ZA 5CJ9A 1BJTA 2R92A 4QIWL 3NUHA 4A3JC 3V4GA 1I6HC 5IYBC 4Y52K 4ZH4A 1WSVA 4PABA 4MEYA 3GTMC 3T02A 3AH5A 3CQZK 2R92K 3S1RK 1F7VA 3G4AA 4GTFA 3OREA 2Y3PA 2V6UA 5EGHA 4LK0A 1J6VA 1I3QK 1JQWA 2R93C 5IYDC 5HL8A 3GTKK 3S14K 1IBAA 2RH6A 5M3MK 1TWCA 4Y7NK 2CFAB 3GDZA 4A93K 3RZDK 2CW0A 3AD7C 1UV7A 1O29A 4WILA 2JA7C 3HOUK 4A3MC 4NOIA 1WORA 3HOXC 3HOXK 1DCOA 2VUMA 1TWGA 5IYCC 3N3YA 1O25A 1YNJA 3RZDC 1VLOA 1PJ5A 4A93C 3GTKC 1TWAC 4C3HC 2W7VA 3HOYK 4QJVA 4MQ9A 4YFKA 1HI9A 4QJVB 4G7OA 3I4MK 4DDQA 1O27A 2R92C 1ZQ1C 2PA8D 1F93A 1YNNA 4LK1A 1WCMK 5M5WK 3SZZA 4X6AK 4MEXA 2GAGC 4XSZA 1Y1VC 2NVXK 1DCHA 3QX3A 1XXBA 3L4KA 2PHCB 3PO2C 4GTCA 4P9SA 4BLBA 2CFAA 1Y1VA 3GEIA 2NVTC 3TFJA 4LJZA 1J6WA 4M1XA 1K83C 4KASA 1JVIA 4G0UA 1F9NA 1WIHA 2EBBA 3H3VL 3WODA 2E2IA 4A3CC 1C0AA 3BP8C 4KB4A 2GSNA 1J98A 3OPFA 5FJ8K 3S0XA 2P5MA 4GFQA 1SMYA 5IOQA 3I4NK 4XLNA 5C3EC 1O24A 3M4OC 1WOOA 1ZBSA 3AQOA 4O2DA 5EGEA 1WCMA 1VH2A 3S1QC 1TWGK 2JA5A 1J6XA 1TWHA 3LAJA 4QIWD 3AD9C 4A3MK 3HOUC 5FLMK 3TFIA 4A3EK 2RGRA 1YCLA 4A3IC 2WAQD 4OIOA 1VGXA 4RMFA 3M4OK 3I4NC 3S14C 4BY1C 4KC6A 4A3CK 4C2MC 1JOEA 4XCHA 1R9TK 3TTGA 3HOWC 2JA8K 1O2FB 1RU0A 2A6HA 5IORA 3GTMK 3RZOC 2KWAA 1WOSA 3HOZK 4OIQA 3A8KA 4Y52C 1AB4A 2A68A 2NVQK 4KB2A 3S16K 3S1MC 3Q3QA 2R7ZA 1WQHA 2WB1D 3GTOK 1Y1VK 2NVXC 2A6EA 1I3QA 2E2JK 2NVQC 3S16C 3S1MK 2NVYK 1XPPA 3HOZC 3N0BA 2PPBA 4OINA 2R7ZC 3TFHA 3RZOK 3A8JA 4KM9A 3M3YC 1I6VA 1R9TC 1R9TA 4C2MK 4C3HK 3GEHA 1TWAK 1WQFA 2A69A 4KMAA 4A3IK 2O5JA 3OEPA 3GTQA 3BUEA 5FLMC 4A3EC 1B4AA 1VJEA 1INNA 4FZBA 5JVOA 1TWGC 3S1QK 4KATA 4BLAA 2YU9A 2VUMC 1IQ0A 1B4BA 2E2HK 4KMHA 3FOFA 2R93K 2YU9K 5TMFA 4GTBA 3IPJA 1BS2A 3GTPA 1DCPA 1O28A 1PJ7A 4OIPA 4BXXK 3GTLC 3S1RC 3L4JA 1K83K 3GTJA 2JA6A 4JK1A 1EI6A 3GIRA 4A3GK 3DXJA 4BBSK 3SZYA 4A3JK 3GTMA 3S17K 4FM9A 4KMUA 3PO2K 3GTJC 1XXAA 5C4XK 4XLPA 2NVYA 4LQYA 2WAQL 3G4CA 2B63K 3HKZL 5D4DA 2FQOA 3GTPC 4GTEA 4X6AC 5CHPA 3T01A 4C3IC 3K7AK 1WCMC 5M3FK 1TWFK 4BBRK 1TWCK 4P5BA 4YG2A 4G0WA 1EH1A 4Q5SA 1TWCC 1XZPA 4GTAA 3I4MC 2R93A 5IP9K 1Y1WK 2XCQA 3A8IA 3HOVC 3GTGA 3HOYC 2B63C 2JH3A 4LR2A 3MMLB 2Y0SD 4A3BC 4AH6A 4OIRA 2ZFZA 5IP7K 5IYCK 3HKZD 1SFOC 4WJ3M 2PMZD 3ERED 1WOPA 4A3KC 4A3FK 1ZVUA 2GSOA 2JA7K 4BXXC 3S15C 2Y0SL 4A3DK 2JA5K 3AD8C 4KM8A 3LAPA 1TWHK 2FQTA 1V5VA 4Y7NC 1EFWA 5IYDK 1I3QC 4P5AA 2E2HA 2PA8L 2E2HC 3H3VD 1DD5A 4ILDA 3GEEA 4A3DC 5E68A 3GTQC 5M5XK 3S15K 4A3FC 3LPXA 2E2IK 3CQZC 4C3JC 4LLGA 1BGWA 2GSUA 2PMZL 1EK8A 1SFOK 5IYBK 5IP7C 3GTKA 1I6HK 2GAHC 1IL2A 2V6SA 3S2DK 3S1NC 2B63A 4G7ZA 1VRQC 3AQPA 2JA6C 3H0GK 1XZQB 1O2AA 3HOVK 3S2HK 3FHZA 1Y1WC 1TWAA 3BP3A 2JA7A 1XZQA 3H0GA 5IOTA 5TMCA 1Y1WA 4GT9A 5C4JK 3T00A 1I50C 1TWFC 1TWFA 1I50A 3VA7A 1L0WA 2NVYC 2WB1L 1GE9A 3S2HC 4GTLA 4GTDA 4BY7C 1X31C 2XCRB 2O5IA 5C4XC 3GTGK 3S1NK 3S2DC 3GTJK 1K83A 4AYBD 3S17C 2V6TA 3GTLA 4G7HA 3CAGA 4PAAA 1ZYRA 4C3JK 4BBSC 4A3GC 5C44C 4A3LC 1YX2A 2E2IC 1XXCA 2JA8C 3GTLK 3GTQK 3FKIK 3HOWK 3GTOA 1KQ4A 3N0CA 3CQZA 3HXAA 1F7UA 3PO3K 2YU9C 4BY1K 3FKIA 1IS1A 5L46A 1G51A 4YFXA 1ISEA 3PO3C 4WJ4A 1TWHC 2JA5C 1BDFA 2VUMK 4LOWA 3FKIC 4KN4A 4AYBL 1SFOA 1WQGA
chains in the Genus database with same CATH topology
2PPBA 4OINA 2PMZD 2R7ZC 4YFNA 2R92C 4A3KC 5C44K 2PA8D 4A3KK 3RZOK 4A3LK 3S2DC 1YNNA 4XSXA 4LK1A 4A3FK 5M5YK 3M3YC 1WCMK 2JA7K 3S15C 4BXXC 2Y0SL 5M5WK 4A3DK 2JA5K 4X6AK 1I6VA 1R9TC 4MEXA 1TWHK 4C2MK 4XSZA 1HQMA 4C3HK 3GTGC 1Y1VC 4Y7NC 5C3EK 2NVXK 4A3BK 1TWAK 5IYDK 3EQLA 2A69A 1I3QC 4BY7K 2PA8L 2E2HC 3PO2C 3H3VD 1IW7A 4A3DC 5IP9C 4A3IK 2O5JA 3GTQC 5M5XK 3S15K 2NVTC 3M3YK 1I50K 5FLMC 4A3EC 4A3FC 5C4JC 4LJZA 2E2IK 3CQZC 4LLGA 1K83C 2PMZL 4BBRC 2R7ZK 4KN7A 1SFOK 1TWGC 2NVTK 3S1QK 3K7AC 4C3IK 5IYBK 5IP7C 2VUMC 1I6HK 3GTPK 3H3VL 3WODA 2E2JC 4A3CC 2E2HK 3S2DK 3S1NC 4G7ZA 3GTOC 3H0GC 5FJ8K 2JA6C 2BE5A 4GZYA 1SMYA 3I4NK 2JA6K 2R93K 3H0GK 4XLNA 5C3EC 5TMFA 4Q4ZA 2YU9K 3M4OC 3HOVK 3S2HK 4QIWL 4A3JC 1Y1WC 1I6HC 5IYBC 4OIPA 4Y52K 3S1QC 4BXXK 3GTLC 3S1RC 1TWGK 4ZH4A 1K83K 4JK1A 4MEYA 5TMCA 3GTMC 3CQZK 2R92K 4A3GK 3DXJA 4BBSK 4QIWD 5C4JK 4A3MK 3HOUC 1I50C 1TWFC 5FLMK 4A3EK 3S1RK 2NVYC 4A3IC 2WAQD 4OIOA 4A3JK 2WB1L 3S17K 3S2HC 4KMUA 4LK0A 3GTJC 3PO2K 3M4OK 1I3QK 4BY7C 2R93C 3I4NC 5IYDC 5C4XK 3S14C 4XLPA 4BY1C 2O5IA 3GTKK 3S14K 5C4XC 5M3MK 4Y7NK 4A93K 3GTGK 2WAQL 3S1NK 2B63K 3GTJK 3HKZL 5D4DA 4AYBD 4A3CK 1R9TK 3RZDK 3S17C 3GTPC 4X6AC 2CW0A 3HOWC 3K7AK 1WCMC 5M3FK 1TWFK 4G7HA 2JA8K 2JA7C 4BBRK 3HOUK 4A3MC 4NOIA 1TWCK 1ZYRA 4YG2A 4C3JK 4BBSC 4A3GC 3HOXC 2A6HA 5C44C 3HOXK 3GTMK 3RZOC 4A3LC 2E2IC 4Q5SA 1TWCC 3HOZK 4OIQA 2JA8C 3GTLK 3GTQK 3FKIK 5IYCC 4Y52C 3HOWK 3I4MC 5IP9K 1Y1WK 1YNJA 2A68A 3RZDC 2NVQK 3HOVC 3S16K 3S1MC 3HOYC 2B63C 3PO3K 4A93C 2YU9C 2WB1D 4BY1K 1TWAC 3GTKC 2Y0SD 3GTOK 1Y1VK 2NVXC 4A3BC 2A6EA 4YFXA 4OIRA 3HOYK 2E2JK 1TWHC 4MQ9A 4QJVA 4YFKA 2NVQC 3PO3C 3S16C 2JA5C 3S1MK 1BDFA 4QJVB 2NVYK 5IP7K 2VUMK 3FKIC 4KN4A 5IYCK 3HKZD 1XPPA 4AYBL 3I4MK 4G7OA 1SFOC 3HOZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPB A;  4OIN A;  2PMZ D;  2R7Z C;  4YFN A;  2R92 C;  4A3K C;  5C44 K;  2PA8 D;  4A3K K;  3RZO K;  4A3L K;  3S2D C;  1YNN A;  4XSX A;  4LK1 A;  4A3F K;  5M5Y K;  3M3Y C;  1WCM K;  2JA7 K;  3S15 C;  4BXX C;  2Y0S L;  5M5W K;  4A3D K;  2JA5 K;  4X6A K;  1I6V A;  1R9T C;  4MEX A;  1TWH K;  4C2M K;  4XSZ A;  1HQM A;  4C3H K;  3GTG C;  1Y1V C;  4Y7N C;  5C3E K;  2NVX K;  4A3B K;  1TWA K;  5IYD K;  3EQL A;  2A69 A;  1I3Q C;  4BY7 K;  2PA8 L;  2E2H C;  3PO2 C;  3H3V D;  1IW7 A;  4A3D C;  5IP9 C;  4A3I K;  2O5J A;  3GTQ C;  5M5X K;  3S15 K;  2NVT C;  3M3Y K;  1I50 K;  5FLM C;  4A3E C;  4A3F C;  5C4J C;  4LJZ A;  2E2I K;  3CQZ C;  4LLG A;  1K83 C;  2PMZ L;  4BBR C;  2R7Z K;  4KN7 A;  1SFO K;  1TWG C;  2NVT K;  3S1Q K;  3K7A C;  4C3I K;  5IYB K;  5IP7 C;  2VUM C;  1I6H K;  3GTP K;  3H3V L;  3WOD A;  2E2J C;  4A3C C;  2E2H K;  3S2D K;  3S1N C;  4G7Z A;  3GTO C;  3H0G C;  5FJ8 K;  2JA6 C;  2BE5 A;  4GZY A;  1SMY A;  3I4N K;  2JA6 K;  2R93 K;  3H0G K;  4XLN A;  5C3E C;  5TMF A;  4Q4Z A;  2YU9 K;  3M4O C;  3HOV K;  3S2H K;  4QIW L;  4A3J C;  1Y1W C;  1I6H C;  5IYB C;  4OIP A;  4Y52 K;  3S1Q C;  4BXX K;  3GTL C;  3S1R C;  1TWG K;  4ZH4 A;  1K83 K;  4JK1 A;  4MEY A;  5TMC A;  3GTM C;  3CQZ K;  2R92 K;  4A3G K;  3DXJ A;  4BBS K;  4QIW D;  5C4J K;  4A3M K;  3HOU C;  1I50 C;  1TWF C;  5FLM K;  4A3E K;  3S1R K;  2NVY C;  4A3I C;  2WAQ D;  4OIO A;  4A3J K;  2WB1 L;  3S17 K;  3S2H C;  4KMU A;  4LK0 A;  3GTJ C;  3PO2 K;  3M4O K;  1I3Q K;  4BY7 C;  2R93 C;  3I4N C;  5IYD C;  5C4X K;  3S14 C;  4XLP A;  4BY1 C;  2O5I A;  3GTK K;  3S14 K;  5C4X C;  5M3M K;  4Y7N K;  4A93 K;  3GTG K;  2WAQ L;  3S1N K;  2B63 K;  3GTJ K;  3HKZ L;  5D4D A;  4AYB D;  4A3C K;  1R9T K;  3RZD K;  3S17 C;  3GTP C;  4X6A C;  2CW0 A;  3HOW C;  3K7A K;  1WCM C;  5M3F K;  1TWF K;  4G7H A;  2JA8 K;  2JA7 C;  4BBR K;  3HOU K;  4A3M C;  4NOI A;  1TWC K;  1ZYR A;  4YG2 A;  4C3J K;  4BBS C;  4A3G C;  3HOX C;  2A6H A;  5C44 C;  3HOX K;  3GTM K;  3RZO C;  4A3L C;  2E2I C;  4Q5S A;  1TWC C;  3HOZ K;  4OIQ A;  2JA8 C;  3GTL K;  3GTQ K;  3FKI K;  5IYC C;  4Y52 C;  3HOW K;  3I4M C;  5IP9 K;  1Y1W K;  1YNJ A;  2A68 A;  3RZD C;  2NVQ K;  3HOV C;  3S16 K;  3S1M C;  3HOY C;  2B63 C;  3PO3 K;  4A93 C;  2YU9 C;  2WB1 D;  4BY1 K;  1TWA C;  3GTK C;  2Y0S D;  3GTO K;  1Y1V K;  2NVX C;  4A3B C;  2A6E A;  4YFX A;  4OIR A;  3HOY K;  2E2J K;  1TWH C;  4MQ9 A;  4QJV A;  4YFK A;  2NVQ C;  3PO3 C;  3S16 C;  2JA5 C;  3S1M K;  1BDF A;  4QJV B;  2NVY K;  5IP7 K;  2VUM K;  3FKI C;  4KN4 A;  5IYC K;  3HKZ D;  1XPP A;  4AYB L;  3I4M K;  4G7O A;  1SFO C;  3HOZ C; 
#chains in the Genus database with same CATH topology
 1O2B A;  3ADA C;  4YFN A;  5C44 K;  4A3L K;  4A3K K;  5IOS A;  3FOE A;  5JFE A;  4KMD A;  4XSX A;  5M5Y K;  4BKW A;  1XZP B;  2ZUE A;  1O26 A;  1WSR A;  1HQM A;  3GTG C;  4A3B K;  5C3E K;  1PJ6 A;  3EQL A;  3GSI A;  1EQR A;  2ZUF A;  4BY7 K;  1IW7 A;  5IP9 C;  3M3Y K;  1I50 K;  1ZXO A;  5C4J C;  1IE0 A;  2XCO A;  4BBR C;  4G0V A;  4KN7 A;  4J3N A;  1USO A;  4KAW X;  2NVT K;  2R7Z K;  2NVX A;  3K7A C;  4C45 A;  4C3I K;  3GTP K;  2E2J C;  1USM A;  2P8T A;  3GTO C;  3H0G C;  4KAR A;  5TJ3 A;  2BE5 A;  4GZY A;  2D6F C;  4KDD A;  3JST A;  2JA6 K;  4Q4Z A;  5CJ9 A;  1BJT A;  2R92 A;  4QIW L;  3NUH A;  4A3J C;  3V4G A;  1I6H C;  5IYB C;  4Y52 K;  4ZH4 A;  1WSV A;  4PAB A;  4MEY A;  3GTM C;  3T02 A;  3AH5 A;  3CQZ K;  2R92 K;  3S1R K;  1F7V A;  3G4A A;  4GTF A;  3ORE A;  2Y3P A;  2V6U A;  5EGH A;  4LK0 A;  1J6V A;  1I3Q K;  1JQW A;  2R93 C;  5IYD C;  5HL8 A;  3GTK K;  3S14 K;  1IBA A;  2RH6 A;  5M3M K;  1TWC A;  4Y7N K;  2CFA B;  3GDZ A;  4A93 K;  3RZD K;  2CW0 A;  3AD7 C;  1UV7 A;  1O29 A;  4WIL A;  2JA7 C;  3HOU K;  4A3M C;  4NOI A;  1WOR A;  3HOX C;  3HOX K;  1DCO A;  2VUM A;  1TWG A;  5IYC C;  3N3Y A;  1O25 A;  1YNJ A;  3RZD C;  1VLO A;  1PJ5 A;  4A93 C;  3GTK C;  1TWA C;  4C3H C;  2W7V A;  3HOY K;  4QJV A;  4MQ9 A;  4YFK A;  1HI9 A;  4QJV B;  4G7O A;  3I4M K;  4DDQ A;  1O27 A;  2R92 C;  1ZQ1 C;  2PA8 D;  1F93 A;  1YNN A;  4LK1 A;  1WCM K;  5M5W K;  3SZZ A;  4X6A K;  4MEX A;  2GAG C;  4XSZ A;  1Y1V C;  2NVX K;  1DCH A;  3QX3 A;  1XXB A;  3L4K A;  2PHC B;  3PO2 C;  4GTC A;  4P9S A;  4BLB A;  2CFA A;  1Y1V A;  3GEI A;  2NVT C;  3TFJ A;  4LJZ A;  1J6W A;  4M1X A;  1K83 C;  4KAS A;  1JVI A;  4G0U A;  1F9N A;  1WIH A;  2EBB A;  3H3V L;  3WOD A;  2E2I A;  4A3C C;  1C0A A;  3BP8 C;  4KB4 A;  2GSN A;  1J98 A;  3OPF A;  5FJ8 K;  3S0X A;  2P5M A;  4GFQ A;  1SMY A;  5IOQ A;  3I4N K;  4XLN A;  5C3E C;  1O24 A;  3M4O C;  1WOO A;  1ZBS A;  3AQO A;  4O2D A;  5EGE A;  1WCM A;  1VH2 A;  3S1Q C;  1TWG K;  2JA5 A;  1J6X A;  1TWH A;  3LAJ A;  4QIW D;  3AD9 C;  4A3M K;  3HOU C;  5FLM K;  3TFI A;  4A3E K;  2RGR A;  1YCL A;  4A3I C;  2WAQ D;  4OIO A;  1VGX A;  4RMF A;  3M4O K;  3I4N C;  3S14 C;  4BY1 C;  4KC6 A;  4A3C K;  4C2M C;  1JOE A;  4XCH A;  1R9T K;  3TTG A;  3HOW C;  2JA8 K;  1O2F B;  1RU0 A;  2A6H A;  5IOR A;  3GTM K;  3RZO C;  2KWA A;  1WOS A;  3HOZ K;  4OIQ A;  3A8K A;  4Y52 C;  1AB4 A;  2A68 A;  2NVQ K;  4KB2 A;  3S16 K;  3S1M C;  3Q3Q A;  2R7Z A;  1WQH A;  2WB1 D;  3GTO K;  1Y1V K;  2NVX C;  2A6E A;  1I3Q A;  2E2J K;  2NVQ C;  3S16 C;  3S1M K;  2NVY K;  1XPP A;  3HOZ C;  3N0B A;  2PPB A;  4OIN A;  2R7Z C;  3TFH A;  3RZO K;  3A8J A;  4KM9 A;  3M3Y C;  1I6V A;  1R9T C;  1R9T A;  4C2M K;  4C3H K;  3GEH A;  1TWA K;  1WQF A;  2A69 A;  4KMA A;  4A3I K;  2O5J A;  3OEP A;  3GTQ A;  3BUE A;  5FLM C;  4A3E C;  1B4A A;  1VJE A;  1INN A;  4FZB A;  5JVO A;  1TWG C;  3S1Q K;  4KAT A;  4BLA A;  2YU9 A;  2VUM C;  1IQ0 A;  1B4B A;  2E2H K;  4KMH A;  3FOF A;  2R93 K;  2YU9 K;  5TMF A;  4GTB A;  3IPJ A;  1BS2 A;  3GTP A;  1DCP A;  1O28 A;  1PJ7 A;  4OIP A;  4BXX K;  3GTL C;  3S1R C;  3L4J A;  1K83 K;  3GTJ A;  2JA6 A;  4JK1 A;  1EI6 A;  3GIR A;  4A3G K;  3DXJ A;  4BBS K;  3SZY A;  4A3J K;  3GTM A;  3S17 K;  4FM9 A;  4KMU A;  3PO2 K;  3GTJ C;  1XXA A;  5C4X K;  4XLP A;  2NVY A;  4LQY A;  2WAQ L;  3G4C A;  2B63 K;  3HKZ L;  5D4D A;  2FQO A;  3GTP C;  4GTE A;  4X6A C;  5CHP A;  3T01 A;  4C3I C;  3K7A K;  1WCM C;  5M3F K;  1TWF K;  4BBR K;  1TWC K;  4P5B A;  4YG2 A;  4G0W A;  1EH1 A;  4Q5S A;  1TWC C;  1XZP A;  4GTA A;  3I4M C;  2R93 A;  5IP9 K;  1Y1W K;  2XCQ A;  3A8I A;  3HOV C;  3GTG A;  3HOY C;  2B63 C;  2JH3 A;  4LR2 A;  3MML B;  2Y0S D;  4A3B C;  4AH6 A;  4OIR A;  2ZFZ A;  5IP7 K;  5IYC K;  3HKZ D;  1SFO C;  4WJ3 M;  2PMZ D;  3ERE D;  1WOP A;  4A3K C;  4A3F K;  1ZVU A;  2GSO A;  2JA7 K;  4BXX C;  3S15 C;  2Y0S L;  4A3D K;  2JA5 K;  3AD8 C;  4KM8 A;  3LAP A;  1TWH K;  2FQT A;  1V5V A;  4Y7N C;  1EFW A;  5IYD K;  1I3Q C;  4P5A A;  2E2H A;  2PA8 L;  2E2H C;  3H3V D;  1DD5 A;  4ILD A;  3GEE A;  4A3D C;  5E68 A;  3GTQ C;  5M5X K;  3S15 K;  4A3F C;  3LPX A;  2E2I K;  3CQZ C;  4C3J C;  4LLG A;  1BGW A;  2GSU A;  2PMZ L;  1EK8 A;  1SFO K;  5IYB K;  5IP7 C;  3GTK A;  1I6H K;  2GAH C;  1IL2 A;  2V6S A;  3S2D K;  3S1N C;  2B63 A;  4G7Z A;  1VRQ C;  3AQP A;  2JA6 C;  3H0G K;  1XZQ B;  1O2A A;  3HOV K;  3S2H K;  3FHZ A;  1Y1W C;  1TWA A;  3BP3 A;  2JA7 A;  1XZQ A;  3H0G A;  5IOT A;  5TMC A;  1Y1W A;  4GT9 A;  5C4J K;  3T00 A;  1I50 C;  1TWF C;  1TWF A;  1I50 A;  3VA7 A;  1L0W A;  2NVY C;  2WB1 L;  1GE9 A;  3S2H C;  4GTL A;  4GTD A;  4BY7 C;  1X31 C;  2XCR B;  2O5I A;  5C4X C;  3GTG K;  3S1N K;  3S2D C;  3GTJ K;  1K83 A;  4AYB D;  3S17 C;  2V6T A;  3GTL A;  4G7H A;  3CAG A;  4PAA A;  1ZYR A;  4C3J K;  4BBS C;  4A3G C;  5C44 C;  4A3L C;  1YX2 A;  2E2I C;  1XXC A;  2JA8 C;  3GTL K;  3GTQ K;  3FKI K;  3HOW K;  3GTO A;  1KQ4 A;  3N0C A;  3CQZ A;  3HXA A;  1F7U A;  3PO3 K;  2YU9 C;  4BY1 K;  3FKI A;  1IS1 A;  5L46 A;  1G51 A;  4YFX A;  1ISE A;  3PO3 C;  4WJ4 A;  1TWH C;  2JA5 C;  1BDF A;  2VUM K;  4LOW A;  3FKI C;  4KN4 A;  4AYB L;  1SFO A;  1WQG A; 
#chains in the Genus database with same CATH homology
 2PPB A;  4OIN A;  2PMZ D;  2R7Z C;  4YFN A;  2R92 C;  4A3K C;  5C44 K;  2PA8 D;  4A3K K;  3RZO K;  4A3L K;  3S2D C;  1YNN A;  4XSX A;  4LK1 A;  4A3F K;  5M5Y K;  3M3Y C;  1WCM K;  2JA7 K;  3S15 C;  4BXX C;  2Y0S L;  5M5W K;  4A3D K;  2JA5 K;  4X6A K;  1I6V A;  1R9T C;  4MEX A;  1TWH K;  4C2M K;  4XSZ A;  1HQM A;  4C3H K;  3GTG C;  1Y1V C;  4Y7N C;  5C3E K;  2NVX K;  4A3B K;  1TWA K;  5IYD K;  3EQL A;  2A69 A;  1I3Q C;  4BY7 K;  2PA8 L;  2E2H C;  3PO2 C;  3H3V D;  1IW7 A;  4A3D C;  5IP9 C;  4A3I K;  2O5J A;  3GTQ C;  5M5X K;  3S15 K;  2NVT C;  3M3Y K;  1I50 K;  5FLM C;  4A3E C;  4A3F C;  5C4J C;  4LJZ A;  2E2I K;  3CQZ C;  4LLG A;  1K83 C;  2PMZ L;  4BBR C;  2R7Z K;  4KN7 A;  1SFO K;  1TWG C;  2NVT K;  3S1Q K;  3K7A C;  4C3I K;  5IYB K;  5IP7 C;  2VUM C;  1I6H K;  3GTP K;  3H3V L;  3WOD A;  2E2J C;  4A3C C;  2E2H K;  3S2D K;  3S1N C;  4G7Z A;  3GTO C;  3H0G C;  5FJ8 K;  2JA6 C;  2BE5 A;  4GZY A;  1SMY A;  3I4N K;  2JA6 K;  2R93 K;  3H0G K;  4XLN A;  5C3E C;  5TMF A;  4Q4Z A;  2YU9 K;  3M4O C;  3HOV K;  3S2H K;  4QIW L;  4A3J C;  1Y1W C;  1I6H C;  5IYB C;  4OIP A;  4Y52 K;  3S1Q C;  4BXX K;  3GTL C;  3S1R C;  1TWG K;  4ZH4 A;  1K83 K;  4JK1 A;  4MEY A;  5TMC A;  3GTM C;  3CQZ K;  2R92 K;  4A3G K;  3DXJ A;  4BBS K;  4QIW D;  5C4J K;  4A3M K;  3HOU C;  1I50 C;  1TWF C;  5FLM K;  4A3E K;  3S1R K;  2NVY C;  4A3I C;  2WAQ D;  4OIO A;  4A3J K;  2WB1 L;  3S17 K;  3S2H C;  4KMU A;  4LK0 A;  3GTJ C;  3PO2 K;  3M4O K;  1I3Q K;  4BY7 C;  2R93 C;  3I4N C;  5IYD C;  5C4X K;  3S14 C;  4XLP A;  4BY1 C;  2O5I A;  3GTK K;  3S14 K;  5C4X C;  5M3M K;  4Y7N K;  4A93 K;  3GTG K;  2WAQ L;  3S1N K;  2B63 K;  3GTJ K;  3HKZ L;  5D4D A;  4AYB D;  4A3C K;  1R9T K;  3RZD K;  3S17 C;  3GTP C;  4X6A C;  2CW0 A;  3HOW C;  3K7A K;  1WCM C;  5M3F K;  1TWF K;  4G7H A;  2JA8 K;  2JA7 C;  4BBR K;  3HOU K;  4A3M C;  4NOI A;  1TWC K;  1ZYR A;  4YG2 A;  4C3J K;  4BBS C;  4A3G C;  3HOX C;  2A6H A;  5C44 C;  3HOX K;  3GTM K;  3RZO C;  4A3L C;  2E2I C;  4Q5S A;  1TWC C;  3HOZ K;  4OIQ A;  2JA8 C;  3GTL K;  3GTQ K;  3FKI K;  5IYC C;  4Y52 C;  3HOW K;  3I4M C;  5IP9 K;  1Y1W K;  1YNJ A;  2A68 A;  3RZD C;  2NVQ K;  3HOV C;  3S16 K;  3S1M C;  3HOY C;  2B63 C;  3PO3 K;  4A93 C;  2YU9 C;  2WB1 D;  4BY1 K;  1TWA C;  3GTK C;  2Y0S D;  3GTO K;  1Y1V K;  2NVX C;  4A3B C;  2A6E A;  4YFX A;  4OIR A;  3HOY K;  2E2J K;  1TWH C;  4MQ9 A;  4QJV A;  4YFK A;  2NVQ C;  3PO3 C;  3S16 C;  2JA5 C;  3S1M K;  1BDF A;  4QJV B;  2NVY K;  5IP7 K;  2VUM K;  3FKI C;  4KN4 A;  5IYC K;  3HKZ D;  1XPP A;  4AYB L;  3I4M K;  4G7O A;  1SFO C;  3HOZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...