2NVYK

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvyK00
2A68A 3K7AC 3S1NC 3S1MK 1SFOC 3GTKK 1Y1WC 1IW7A 4A93C 4BBSC 3M4OC 3GTGK 3GTQK 2Y0SL 5IYCC 3CQZC 2B63K 2NVYC 2Y0SD 4OIOA 4OINA 4C2MK 4BY1C 3S2DC 3M4OK 5M5WK 3HOVC 4G7HA 5IYCK 4LK1A 1TWAC 4BY7K 3CQZK 4LJZA 4A3EK 4MEYA 2NVYK 2NVQK 3H0GC 5IYBC 4A3BK 2JA5C 3EQLA 4QIWL 5C4XK 2NVTK 3S1QC 3M3YC 2NVXC 4QIWD 4GZYA 4BXXC 4A3CC 5FJ8K 4OIPA 3GTPK 2WAQD 5IP9C 1YNJA 3HOUC 4AYBD 4BBRC 4MQ9A 2JA5K 5M5XK 2JA7C 2VUMC 4XLNA 1TWCC 2BE5A 4A3KK 4LLGA 1Y1VC 4A3FC 5TMCA 4A3MC 2NVXK 4BXXK 1TWFK 2PMZD 2E2IK 2YU9K 5M3MK 3HOUK 5C4JC 3HOYK 2E2JC 3S14C 4A3LC 2VUMK 3PO2C 4YG2A 2JA7K 3GTLC 4Q5SA 4C3HK 4A3JC 1TWGC 1I50C 3RZOC 1Y1VK 2WB1L 1TWHK 5IP7C 4A3FK 4OIRA 3S2HC 5M3FK 3FKIK 2E2JK 2JA8C 3K7AK 3PO2K 3S1NK 4XSZA 3GTLK 1SFOK 3DXJA 1HQMA 4A3JK 1Y1WK 4YFNA 4Y7NC 1WCMC 1R9TC 5C3EC 5FLMC 3RZOK 3S16C 3S2HK 3HKZL 2CW0A 4BY1K 2JA6C 1I3QC 3S2DK 1SMYA 4LK0A 3HOVK 3S16K 1BDFA 1TWAK 2R93C 2A6HA 4YFXA 3H0GK 5IYBK 2E2HC 3I4NC 1ZYRA 2R7ZC 4QJVB 3M3YK 3S1QK 1K83C 4A3CK 2R92C 1XPPA 2R93K 4OIQA 5IP9K 5TMFA 3WODA 4BBRK 3S15C 2R7ZK 3GTMC 1TWCK 4A3MK 3I4MC 5C44C 4A3IC 3S1RC 2R92K 3HOZC 4A93K 2WB1D 5C4JK 5D4DA 3S14K 4A3LK 3HOXC 1TWGK 1I50K 5C44K 3RZDC 3S1RK 5IP7K 4KN7A 4Y52C 3H3VL 2O5JA 2JA8K 4NOIA 3HKZD 3HOXK 4C3IK 1R9TK 3S1MC 4Y7NK 1WCMK 5M5YK 5C3EK 5FLMK 4XLPA 3RZDK 2PA8L 4QJVA 4A3GC 4ZH4A 2PA8D 2JA6K 1I3QK 3GTJC 4A3GK 4BY7C 4JK1A 4A3EC 2NVQC 2E2HK 3I4NK 4X6AC 4G7ZA 3S17C 4A3BC 4KMUA 3GTOC 1I6HC 2NVTC 5C4XC 1K83K 4G7OA 3GTJK 4KN4A 2PPBA 3HOWC 1I6VA 2O5IA 3GTPC 1YNNA 4C3JK 4X6AK 3S15K 3S17K 3GTOK 3GTMK 1I6HK 4XSXA 3I4MK 5IYDC 4A3IK 4A3KC 3PO3C 3HOWK 2WAQL 4YFKA 4AYBL 1TWFC 3HOZK 2E2IC 2YU9C 3HOYC 4A3DC 2A6EA 3H3VD 3GTKC 5IYDK 4Q4ZA 2PMZL 4MEXA 3GTGC 3GTQC 1TWHC 2A69A 3PO3K 4Y52K 2B63C 4BBSK 4A3DK 3FKIC
chains in the Genus database with same CATH superfamily
2ZUFA 3N0CA 1SFOC 4GTFA 3GTQK 1F7VA 1HI9A 5IORA 4C2MK 1ISEA 4GFQA 3S2DC 3S0XA 3M4OK 5M5WK 4BY7K 3CQZK 4LJZA 1USOA 1WCMA 5IYBC 1J98A 3EQLA 5C4XK 1VRQC 2NVTK 3GEHA 1JVIA 1L0WA 3BP8C 2JA5K 2GSOA 5M5XK 2NVXK 4LLGA 5TMCA 3FOFA 1UV7A 5M3MK 3HOUK 1WQGA 2E2JC 4YG2A 1ZBSA 4C3HK 1I50C 1Y1VK 4OIRA 5CJ9A 4LQYA 4KMHA 3K7AK 3PO2K 3S1NK 1VJEA 1AB4A 1HQMA 3RZOK 4LR2A 1IBAA 1PJ7A 2CW0A 4BY1K 2B63C 3S16K 1TWAK 2GSUA 3H0GK 1ZYRA 2R7ZC 4QJVB 4A3CK 2R92C 4BBRK 4A3MK 3S1RC 3FHZA 4GT9A 5C4JK 1O2FB 1WORA 3HOXC 1PJ6A 1WOOA 3G4AA 4Y52C 4G0VA 2JA8K 1JOEA 3HKZD 1DCPA 1YCLA 1G51A 4ZH4A 2PA8D 1F7UA 4C2MC 2JA6K 4BKWA 3GTJC 4KAWX 4BY7C 4PABA 1XXCA 1Y1WA 2E2HK 3S17C 3GTOC 5C4XC 2NVTC 2NVYA 1J6VA 4G0UA 3N0BA 2KWAA 3S15K 3GTMK 1I6HK 3I4MK 4A3IK 3HOWK 4YFKA 4AYBL 1IE0A 2P8TA 2A6EA 3ERED 1O2AA 3GTKC 2VUMA 3GTGC 2JA7A 4WJ3M 4A3DK 1DCHA 4O2DA 2A68A 3K7AC 2D6FC 3S1NC 2FQTA 1IW7A 1PJ5A 3GTLA 5IYCC 1DCOA 1TWGA 4OIOA 4BY1C 4LK1A 1TWAC 1R9TA 4A3EK 4MEYA 2NVYK 4KATA 2NVQK 3H0GC 3SZYA 4GZYA 1EQRA 4A3CC 4BXXC 4OIPA 1I3QA 2W7VA 3GTPK 1YNJA 4BBRC 4MQ9A 2GAGC 4FM9A 4XLNA 4A3MC 1BS2A 4M1XA 4P9SA 1DD5A 1K83A 2PMZD 5C4JC 4KB4A 2VUMK 2JA7K 1JQWA 3S2HC 3GDZA 4A3FK 1TWHK 5M3FK 2JA8C 1WQHA 3GTLK 3DXJA 4KASA 4A3JK 4YFNA 1ZXOA 5HL8A 3TFHA 2JA6C 3T00A 4LOWA 1SMYA 1BDFA 2CFAB 4PAAA 2R93C 2A6HA 2E2HC 2V6TA 3S1QK 3M3YK 4WJ4A 3IPJA 5JVOA 2GAHC 4C45A 5IP9K 2Y3PA 3OEPA 3S15C 1ZQ1C 3GTMC 3GEEA 1TWCK 3I4MC 4A3IC 2WB1D 4KARA 5D4DA 4A3LK 3BUEA 4C3IC 1GE9A 1XZPB 4AH6A 5C44K 3RZDC 2EBBA 3H3VL 1TWFA 4KMAA 2YU9A 2E2IA 4WILA 4Y7NK 1WCMK 1BJTA 5L46A 4XLPA 1EK8A 3ADAC 1XZQA 2B63A 1O26A 3FKIA 4A3GK 2ZFZA 1SFOA 4JK1A 4A3EC 2NVQC 4X6AC 3SZZA 4G7OA 4DDQA 2O5IA 3GTPC 3GSIA 3T02A 5E68A 4C3JK 1VLOA 3HOZK 1X31C 5TJ3A 3G4CA 4J3NA 5IYDK 4Q4ZA 4MEXA 3PO3K 3GTQC 1TWHC 3LAPA 3S1MK 3M4OC 2PHCB 2Y0SL 3CQZC 3GEIA 1I50A 2B63K 4OINA 3TFJA 5IOSA 3LPXA 3VA7A 4A3BK 2JA5C 4QIWL 3S1QC 3M3YC 1WIHA 2NVXC 5FJ8K 3AD9C 2XCOA 2WAQD 5IP9C 3HOUC 3JSTA 4C3HC 1TWCC 1Y1VC 2R7ZA 3TFIA 4A3LC 3AQPA 4KM9A 2R92A 3PO2C 1WSVA 4GTCA 2XCQA 2GSNA 3RZOC 1ZVUA 2E2JK 1O24A 1Y1WK 4A93K 4BBSK 3OPFA 4Y7NC 1WCMC 3S16C 1EI6A 1RU0A 2P5MA 3HKZL 3Q3QA 2CFAA 2V6SA 1B4AA 4LK0A 3HOVK 2RH6A 5IOQA 2RGRA 3AH5A 1XPPA 3GTJA 5TMFA 1IQ0A 2R7ZK 1O29A 4KMDA 3GTOA 2R92K 3HOZC 1XZPA 3S14K 1TWGK 3S1RK 5IP7K 1XXBA 2JH3A 2O5JA 1VH2A 3HOXK 1R9TK 3S1MC 5IOTA 5C3EK 5FLMK 4GTEA 4QJVA 3GTKA 3GTGA 1I3QK 1B4BA 1J6XA 4BLAA 3I4NK 4G7ZA 4ILDA 4A3BC 1I6HC 1K83K 3GTJK 4KN4A 2PPBA 3HOWC 1I6VA 4G0WA 1TWAA 3S17K 3GTOK 3H0GA 1YX2A 1J6WA 3L4KA 4A3DC 4XCHA 2PMZL 1F93A 2A69A 1O28A 3NUHA 3GTKK 1Y1WC 4A93C 4BBSC 3GTGK 3AQOA 1XXAA 2NVYC 1WOPA 2Y0SD 1IL2A 4KDDA 3HOVC 4G7HA 5IYCK 2FQOA 3OREA 4QIWD 1WSRA 2JA6A 4AYBD 2VUMC 2R93A 2JA7C 2BE5A 4A3KK 2E2HA 4A3FC 4BXXK 1VGXA 4BLBA 1TWFK 4KM8A 2E2IK 2YU9K 3HOYK 3S14C 3N3YA 3GTLC 4Q5SA 4A3JC 1INNA 1TWGC 2WB1L 1O25A 5EGHA 5IP7C 3GTMA 1WQFA 3FKIK 4RMFA 4XSZA 1SFOK 1R9TC 3S2HK 1O2BA 5FLMC 5C3EC 5CHPA 4GTLA 5EGEA 1I3QC 3S2DK 5JFEA 2ZUEA 3QX3A 3A8KA 4YFXA 5IYBK 3I4NC 4GTDA 1IS1A 1K83C 1XZQB 1V5VA 2R93K 4OIQA 3WODA 1WOSA 2V6UA 5C44C 3GIRA 1KQ4A 3HXAA 3LAJA 3BP3A 1BGWA 3GTPA 1I50K 3L4JA 4GTAA 4KN7A 3FOEA 3MMLB 4KB2A 4NOIA 3A8JA 4C3IK 3RZDK 5M5YK 3T01A 4A3GC 2PA8L 3TTGA 3V4GA 3GTQA 1TWHA 4GTBA 1EFWA 4P5BA 2XCRB 1F9NA 1USMA 4C3JC 3CQZA 4KMUA 3A8IA 4FZBA 4KC6A 1YNNA 4X6AK 3CAGA 1C0AA 4XSXA 3AD8C 5IYDC 4A3KC 2JA5A 3PO3C 3AD7C 2WAQL 1TWFC 1O27A 2NVXA 2E2IC 2YU9C 3HOYC 3H3VD 4P5AA 4Y52K 1TWCA 1Y1VA 1EH1A 3FKIC
chains in the Genus database with same CATH topology
2A68A 3K7AC 3S1NC 3S1MK 1SFOC 3GTKK 1Y1WC 1IW7A 4A93C 4BBSC 3M4OC 3GTGK 3GTQK 2Y0SL 5IYCC 3CQZC 2B63K 2NVYC 2Y0SD 4OIOA 4OINA 4C2MK 4BY1C 3S2DC 3M4OK 5M5WK 3HOVC 4G7HA 5IYCK 4LK1A 1TWAC 4BY7K 3CQZK 4LJZA 4A3EK 4MEYA 2NVYK 2NVQK 3H0GC 5IYBC 4A3BK 2JA5C 3EQLA 4QIWL 5C4XK 2NVTK 3S1QC 3M3YC 2NVXC 4QIWD 4GZYA 4BXXC 4A3CC 5FJ8K 4OIPA 3GTPK 2WAQD 5IP9C 1YNJA 3HOUC 4AYBD 4BBRC 4MQ9A 2JA5K 5M5XK 2JA7C 2VUMC 4XLNA 1TWCC 2BE5A 4A3KK 4LLGA 1Y1VC 4A3FC 5TMCA 4A3MC 2NVXK 4BXXK 1TWFK 2PMZD 2E2IK 2YU9K 5M3MK 3HOUK 5C4JC 3HOYK 2E2JC 3S14C 4A3LC 2VUMK 3PO2C 4YG2A 2JA7K 3GTLC 4Q5SA 4C3HK 4A3JC 1TWGC 1I50C 3RZOC 1Y1VK 2WB1L 1TWHK 5IP7C 4A3FK 4OIRA 3S2HC 5M3FK 3FKIK 2E2JK 2JA8C 3K7AK 3PO2K 3S1NK 4XSZA 3GTLK 1SFOK 3DXJA 1HQMA 4A3JK 1Y1WK 4YFNA 4Y7NC 1WCMC 1R9TC 5C3EC 5FLMC 3RZOK 3S16C 3S2HK 3HKZL 2CW0A 4BY1K 2JA6C 1I3QC 3S2DK 1SMYA 4LK0A 3HOVK 3S16K 1BDFA 1TWAK 2R93C 2A6HA 4YFXA 3H0GK 5IYBK 2E2HC 3I4NC 1ZYRA 2R7ZC 4QJVB 3M3YK 3S1QK 1K83C 4A3CK 2R92C 1XPPA 2R93K 4OIQA 5IP9K 5TMFA 3WODA 4BBRK 3S15C 2R7ZK 3GTMC 1TWCK 4A3MK 3I4MC 5C44C 4A3IC 3S1RC 2R92K 3HOZC 4A93K 2WB1D 5C4JK 5D4DA 3S14K 4A3LK 3HOXC 1TWGK 1I50K 5C44K 3RZDC 3S1RK 5IP7K 4KN7A 4Y52C 3H3VL 2O5JA 2JA8K 4NOIA 3HKZD 3HOXK 4C3IK 1R9TK 3S1MC 4Y7NK 1WCMK 5M5YK 5C3EK 5FLMK 4XLPA 3RZDK 2PA8L 4QJVA 4A3GC 4ZH4A 2PA8D 2JA6K 1I3QK 3GTJC 4A3GK 4BY7C 4JK1A 4A3EC 2NVQC 2E2HK 3I4NK 4X6AC 4G7ZA 3S17C 4A3BC 4KMUA 3GTOC 1I6HC 2NVTC 5C4XC 1K83K 4G7OA 3GTJK 4KN4A 2PPBA 3HOWC 1I6VA 2O5IA 3GTPC 1YNNA 4C3JK 4X6AK 3S15K 3S17K 3GTOK 3GTMK 1I6HK 4XSXA 3I4MK 5IYDC 4A3IK 4A3KC 3PO3C 3HOWK 2WAQL 4YFKA 4AYBL 1TWFC 3HOZK 2E2IC 2YU9C 3HOYC 4A3DC 2A6EA 3H3VD 3GTKC 5IYDK 4Q4ZA 2PMZL 4MEXA 3GTGC 3GTQC 1TWHC 2A69A 3PO3K 4Y52K 2B63C 4BBSK 4A3DK 3FKIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 A;  3K7A C;  3S1N C;  3S1M K;  1SFO C;  3GTK K;  1Y1W C;  1IW7 A;  4A93 C;  4BBS C;  3M4O C;  3GTG K;  3GTQ K;  2Y0S L;  5IYC C;  3CQZ C;  2B63 K;  2NVY C;  2Y0S D;  4OIO A;  4OIN A;  4C2M K;  4BY1 C;  3S2D C;  3M4O K;  5M5W K;  3HOV C;  4G7H A;  5IYC K;  4LK1 A;  1TWA C;  4BY7 K;  3CQZ K;  4LJZ A;  4A3E K;  4MEY A;  2NVY K;  2NVQ K;  3H0G C;  5IYB C;  4A3B K;  2JA5 C;  3EQL A;  4QIW L;  5C4X K;  2NVT K;  3S1Q C;  3M3Y C;  2NVX C;  4QIW D;  4GZY A;  4BXX C;  4A3C C;  5FJ8 K;  4OIP A;  3GTP K;  2WAQ D;  5IP9 C;  1YNJ A;  3HOU C;  4AYB D;  4BBR C;  4MQ9 A;  2JA5 K;  5M5X K;  2JA7 C;  2VUM C;  4XLN A;  1TWC C;  2BE5 A;  4A3K K;  4LLG A;  1Y1V C;  4A3F C;  5TMC A;  4A3M C;  2NVX K;  4BXX K;  1TWF K;  2PMZ D;  2E2I K;  2YU9 K;  5M3M K;  3HOU K;  5C4J C;  3HOY K;  2E2J C;  3S14 C;  4A3L C;  2VUM K;  3PO2 C;  4YG2 A;  2JA7 K;  3GTL C;  4Q5S A;  4C3H K;  4A3J C;  1TWG C;  1I50 C;  3RZO C;  1Y1V K;  2WB1 L;  1TWH K;  5IP7 C;  4A3F K;  4OIR A;  3S2H C;  5M3F K;  3FKI K;  2E2J K;  2JA8 C;  3K7A K;  3PO2 K;  3S1N K;  4XSZ A;  3GTL K;  1SFO K;  3DXJ A;  1HQM A;  4A3J K;  1Y1W K;  4YFN A;  4Y7N C;  1WCM C;  1R9T C;  5C3E C;  5FLM C;  3RZO K;  3S16 C;  3S2H K;  3HKZ L;  2CW0 A;  4BY1 K;  2JA6 C;  1I3Q C;  3S2D K;  1SMY A;  4LK0 A;  3HOV K;  3S16 K;  1BDF A;  1TWA K;  2R93 C;  2A6H A;  4YFX A;  3H0G K;  5IYB K;  2E2H C;  3I4N C;  1ZYR A;  2R7Z C;  4QJV B;  3M3Y K;  3S1Q K;  1K83 C;  4A3C K;  2R92 C;  1XPP A;  2R93 K;  4OIQ A;  5IP9 K;  5TMF A;  3WOD A;  4BBR K;  3S15 C;  2R7Z K;  3GTM C;  1TWC K;  4A3M K;  3I4M C;  5C44 C;  4A3I C;  3S1R C;  2R92 K;  3HOZ C;  4A93 K;  2WB1 D;  5C4J K;  5D4D A;  3S14 K;  4A3L K;  3HOX C;  1TWG K;  1I50 K;  5C44 K;  3RZD C;  3S1R K;  5IP7 K;  4KN7 A;  4Y52 C;  3H3V L;  2O5J A;  2JA8 K;  4NOI A;  3HKZ D;  3HOX K;  4C3I K;  1R9T K;  3S1M C;  4Y7N K;  1WCM K;  5M5Y K;  5C3E K;  5FLM K;  4XLP A;  3RZD K;  2PA8 L;  4QJV A;  4A3G C;  4ZH4 A;  2PA8 D;  2JA6 K;  1I3Q K;  3GTJ C;  4A3G K;  4BY7 C;  4JK1 A;  4A3E C;  2NVQ C;  2E2H K;  3I4N K;  4X6A C;  4G7Z A;  3S17 C;  4A3B C;  4KMU A;  3GTO C;  1I6H C;  2NVT C;  5C4X C;  1K83 K;  4G7O A;  3GTJ K;  4KN4 A;  2PPB A;  3HOW C;  1I6V A;  2O5I A;  3GTP C;  1YNN A;  4C3J K;  4X6A K;  3S15 K;  3S17 K;  3GTO K;  3GTM K;  1I6H K;  4XSX A;  3I4M K;  5IYD C;  4A3I K;  4A3K C;  3PO3 C;  3HOW K;  2WAQ L;  4YFK A;  4AYB L;  1TWF C;  3HOZ K;  2E2I C;  2YU9 C;  3HOY C;  4A3D C;  2A6E A;  3H3V D;  3GTK C;  5IYD K;  4Q4Z A;  2PMZ L;  4MEX A;  3GTG C;  3GTQ C;  1TWH C;  2A69 A;  3PO3 K;  4Y52 K;  2B63 C;  4BBS K;  4A3D K;  3FKI C; 
#chains in the Genus database with same CATH topology
 2ZUF A;  3N0C A;  1SFO C;  4GTF A;  3GTQ K;  1F7V A;  1HI9 A;  5IOR A;  4C2M K;  1ISE A;  4GFQ A;  3S2D C;  3S0X A;  3M4O K;  5M5W K;  4BY7 K;  3CQZ K;  4LJZ A;  1USO A;  1WCM A;  5IYB C;  1J98 A;  3EQL A;  5C4X K;  1VRQ C;  2NVT K;  3GEH A;  1JVI A;  1L0W A;  3BP8 C;  2JA5 K;  2GSO A;  5M5X K;  2NVX K;  4LLG A;  5TMC A;  3FOF A;  1UV7 A;  5M3M K;  3HOU K;  1WQG A;  2E2J C;  4YG2 A;  1ZBS A;  4C3H K;  1I50 C;  1Y1V K;  4OIR A;  5CJ9 A;  4LQY A;  4KMH A;  3K7A K;  3PO2 K;  3S1N K;  1VJE A;  1AB4 A;  1HQM A;  3RZO K;  4LR2 A;  1IBA A;  1PJ7 A;  2CW0 A;  4BY1 K;  2B63 C;  3S16 K;  1TWA K;  2GSU A;  3H0G K;  1ZYR A;  2R7Z C;  4QJV B;  4A3C K;  2R92 C;  4BBR K;  4A3M K;  3S1R C;  3FHZ A;  4GT9 A;  5C4J K;  1O2F B;  1WOR A;  3HOX C;  1PJ6 A;  1WOO A;  3G4A A;  4Y52 C;  4G0V A;  2JA8 K;  1JOE A;  3HKZ D;  1DCP A;  1YCL A;  1G51 A;  4ZH4 A;  2PA8 D;  1F7U A;  4C2M C;  2JA6 K;  4BKW A;  3GTJ C;  4KAW X;  4BY7 C;  4PAB A;  1XXC A;  1Y1W A;  2E2H K;  3S17 C;  3GTO C;  5C4X C;  2NVT C;  2NVY A;  1J6V A;  4G0U A;  3N0B A;  2KWA A;  3S15 K;  3GTM K;  1I6H K;  3I4M K;  4A3I K;  3HOW K;  4YFK A;  4AYB L;  1IE0 A;  2P8T A;  2A6E A;  3ERE D;  1O2A A;  3GTK C;  2VUM A;  3GTG C;  2JA7 A;  4WJ3 M;  4A3D K;  1DCH A;  4O2D A;  2A68 A;  3K7A C;  2D6F C;  3S1N C;  2FQT A;  1IW7 A;  1PJ5 A;  3GTL A;  5IYC C;  1DCO A;  1TWG A;  4OIO A;  4BY1 C;  4LK1 A;  1TWA C;  1R9T A;  4A3E K;  4MEY A;  2NVY K;  4KAT A;  2NVQ K;  3H0G C;  3SZY A;  4GZY A;  1EQR A;  4A3C C;  4BXX C;  4OIP A;  1I3Q A;  2W7V A;  3GTP K;  1YNJ A;  4BBR C;  4MQ9 A;  2GAG C;  4FM9 A;  4XLN A;  4A3M C;  1BS2 A;  4M1X A;  4P9S A;  1DD5 A;  1K83 A;  2PMZ D;  5C4J C;  4KB4 A;  2VUM K;  2JA7 K;  1JQW A;  3S2H C;  3GDZ A;  4A3F K;  1TWH K;  5M3F K;  2JA8 C;  1WQH A;  3GTL K;  3DXJ A;  4KAS A;  4A3J K;  4YFN A;  1ZXO A;  5HL8 A;  3TFH A;  2JA6 C;  3T00 A;  4LOW A;  1SMY A;  1BDF A;  2CFA B;  4PAA A;  2R93 C;  2A6H A;  2E2H C;  2V6T A;  3S1Q K;  3M3Y K;  4WJ4 A;  3IPJ A;  5JVO A;  2GAH C;  4C45 A;  5IP9 K;  2Y3P A;  3OEP A;  3S15 C;  1ZQ1 C;  3GTM C;  3GEE A;  1TWC K;  3I4M C;  4A3I C;  2WB1 D;  4KAR A;  5D4D A;  4A3L K;  3BUE A;  4C3I C;  1GE9 A;  1XZP B;  4AH6 A;  5C44 K;  3RZD C;  2EBB A;  3H3V L;  1TWF A;  4KMA A;  2YU9 A;  2E2I A;  4WIL A;  4Y7N K;  1WCM K;  1BJT A;  5L46 A;  4XLP A;  1EK8 A;  3ADA C;  1XZQ A;  2B63 A;  1O26 A;  3FKI A;  4A3G K;  2ZFZ A;  1SFO A;  4JK1 A;  4A3E C;  2NVQ C;  4X6A C;  3SZZ A;  4G7O A;  4DDQ A;  2O5I A;  3GTP C;  3GSI A;  3T02 A;  5E68 A;  4C3J K;  1VLO A;  3HOZ K;  1X31 C;  5TJ3 A;  3G4C A;  4J3N A;  5IYD K;  4Q4Z A;  4MEX A;  3PO3 K;  3GTQ C;  1TWH C;  3LAP A;  3S1M K;  3M4O C;  2PHC B;  2Y0S L;  3CQZ C;  3GEI A;  1I50 A;  2B63 K;  4OIN A;  3TFJ A;  5IOS A;  3LPX A;  3VA7 A;  4A3B K;  2JA5 C;  4QIW L;  3S1Q C;  3M3Y C;  1WIH A;  2NVX C;  5FJ8 K;  3AD9 C;  2XCO A;  2WAQ D;  5IP9 C;  3HOU C;  3JST A;  4C3H C;  1TWC C;  1Y1V C;  2R7Z A;  3TFI A;  4A3L C;  3AQP A;  4KM9 A;  2R92 A;  3PO2 C;  1WSV A;  4GTC A;  2XCQ A;  2GSN A;  3RZO C;  1ZVU A;  2E2J K;  1O24 A;  1Y1W K;  4A93 K;  4BBS K;  3OPF A;  4Y7N C;  1WCM C;  3S16 C;  1EI6 A;  1RU0 A;  2P5M A;  3HKZ L;  3Q3Q A;  2CFA A;  2V6S A;  1B4A A;  4LK0 A;  3HOV K;  2RH6 A;  5IOQ A;  2RGR A;  3AH5 A;  1XPP A;  3GTJ A;  5TMF A;  1IQ0 A;  2R7Z K;  1O29 A;  4KMD A;  3GTO A;  2R92 K;  3HOZ C;  1XZP A;  3S14 K;  1TWG K;  3S1R K;  5IP7 K;  1XXB A;  2JH3 A;  2O5J A;  1VH2 A;  3HOX K;  1R9T K;  3S1M C;  5IOT A;  5C3E K;  5FLM K;  4GTE A;  4QJV A;  3GTK A;  3GTG A;  1I3Q K;  1B4B A;  1J6X A;  4BLA A;  3I4N K;  4G7Z A;  4ILD A;  4A3B C;  1I6H C;  1K83 K;  3GTJ K;  4KN4 A;  2PPB A;  3HOW C;  1I6V A;  4G0W A;  1TWA A;  3S17 K;  3GTO K;  3H0G A;  1YX2 A;  1J6W A;  3L4K A;  4A3D C;  4XCH A;  2PMZ L;  1F93 A;  2A69 A;  1O28 A;  3NUH A;  3GTK K;  1Y1W C;  4A93 C;  4BBS C;  3GTG K;  3AQO A;  1XXA A;  2NVY C;  1WOP A;  2Y0S D;  1IL2 A;  4KDD A;  3HOV C;  4G7H A;  5IYC K;  2FQO A;  3ORE A;  4QIW D;  1WSR A;  2JA6 A;  4AYB D;  2VUM C;  2R93 A;  2JA7 C;  2BE5 A;  4A3K K;  2E2H A;  4A3F C;  4BXX K;  1VGX A;  4BLB A;  1TWF K;  4KM8 A;  2E2I K;  2YU9 K;  3HOY K;  3S14 C;  3N3Y A;  3GTL C;  4Q5S A;  4A3J C;  1INN A;  1TWG C;  2WB1 L;  1O25 A;  5EGH A;  5IP7 C;  3GTM A;  1WQF A;  3FKI K;  4RMF A;  4XSZ A;  1SFO K;  1R9T C;  3S2H K;  1O2B A;  5FLM C;  5C3E C;  5CHP A;  4GTL A;  5EGE A;  1I3Q C;  3S2D K;  5JFE A;  2ZUE A;  3QX3 A;  3A8K A;  4YFX A;  5IYB K;  3I4N C;  4GTD A;  1IS1 A;  1K83 C;  1XZQ B;  1V5V A;  2R93 K;  4OIQ A;  3WOD A;  1WOS A;  2V6U A;  5C44 C;  3GIR A;  1KQ4 A;  3HXA A;  3LAJ A;  3BP3 A;  1BGW A;  3GTP A;  1I50 K;  3L4J A;  4GTA A;  4KN7 A;  3FOE A;  3MML B;  4KB2 A;  4NOI A;  3A8J A;  4C3I K;  3RZD K;  5M5Y K;  3T01 A;  4A3G C;  2PA8 L;  3TTG A;  3V4G A;  3GTQ A;  1TWH A;  4GTB A;  1EFW A;  4P5B A;  2XCR B;  1F9N A;  1USM A;  4C3J C;  3CQZ A;  4KMU A;  3A8I A;  4FZB A;  4KC6 A;  1YNN A;  4X6A K;  3CAG A;  1C0A A;  4XSX A;  3AD8 C;  5IYD C;  4A3K C;  2JA5 A;  3PO3 C;  3AD7 C;  2WAQ L;  1TWF C;  1O27 A;  2NVX A;  2E2I C;  2YU9 C;  3HOY C;  3H3V D;  4P5A A;  4Y52 K;  1TWC A;  1Y1V A;  1EH1 A;  3FKI C; 
#chains in the Genus database with same CATH homology
 2A68 A;  3K7A C;  3S1N C;  3S1M K;  1SFO C;  3GTK K;  1Y1W C;  1IW7 A;  4A93 C;  4BBS C;  3M4O C;  3GTG K;  3GTQ K;  2Y0S L;  5IYC C;  3CQZ C;  2B63 K;  2NVY C;  2Y0S D;  4OIO A;  4OIN A;  4C2M K;  4BY1 C;  3S2D C;  3M4O K;  5M5W K;  3HOV C;  4G7H A;  5IYC K;  4LK1 A;  1TWA C;  4BY7 K;  3CQZ K;  4LJZ A;  4A3E K;  4MEY A;  2NVY K;  2NVQ K;  3H0G C;  5IYB C;  4A3B K;  2JA5 C;  3EQL A;  4QIW L;  5C4X K;  2NVT K;  3S1Q C;  3M3Y C;  2NVX C;  4QIW D;  4GZY A;  4BXX C;  4A3C C;  5FJ8 K;  4OIP A;  3GTP K;  2WAQ D;  5IP9 C;  1YNJ A;  3HOU C;  4AYB D;  4BBR C;  4MQ9 A;  2JA5 K;  5M5X K;  2JA7 C;  2VUM C;  4XLN A;  1TWC C;  2BE5 A;  4A3K K;  4LLG A;  1Y1V C;  4A3F C;  5TMC A;  4A3M C;  2NVX K;  4BXX K;  1TWF K;  2PMZ D;  2E2I K;  2YU9 K;  5M3M K;  3HOU K;  5C4J C;  3HOY K;  2E2J C;  3S14 C;  4A3L C;  2VUM K;  3PO2 C;  4YG2 A;  2JA7 K;  3GTL C;  4Q5S A;  4C3H K;  4A3J C;  1TWG C;  1I50 C;  3RZO C;  1Y1V K;  2WB1 L;  1TWH K;  5IP7 C;  4A3F K;  4OIR A;  3S2H C;  5M3F K;  3FKI K;  2E2J K;  2JA8 C;  3K7A K;  3PO2 K;  3S1N K;  4XSZ A;  3GTL K;  1SFO K;  3DXJ A;  1HQM A;  4A3J K;  1Y1W K;  4YFN A;  4Y7N C;  1WCM C;  1R9T C;  5C3E C;  5FLM C;  3RZO K;  3S16 C;  3S2H K;  3HKZ L;  2CW0 A;  4BY1 K;  2JA6 C;  1I3Q C;  3S2D K;  1SMY A;  4LK0 A;  3HOV K;  3S16 K;  1BDF A;  1TWA K;  2R93 C;  2A6H A;  4YFX A;  3H0G K;  5IYB K;  2E2H C;  3I4N C;  1ZYR A;  2R7Z C;  4QJV B;  3M3Y K;  3S1Q K;  1K83 C;  4A3C K;  2R92 C;  1XPP A;  2R93 K;  4OIQ A;  5IP9 K;  5TMF A;  3WOD A;  4BBR K;  3S15 C;  2R7Z K;  3GTM C;  1TWC K;  4A3M K;  3I4M C;  5C44 C;  4A3I C;  3S1R C;  2R92 K;  3HOZ C;  4A93 K;  2WB1 D;  5C4J K;  5D4D A;  3S14 K;  4A3L K;  3HOX C;  1TWG K;  1I50 K;  5C44 K;  3RZD C;  3S1R K;  5IP7 K;  4KN7 A;  4Y52 C;  3H3V L;  2O5J A;  2JA8 K;  4NOI A;  3HKZ D;  3HOX K;  4C3I K;  1R9T K;  3S1M C;  4Y7N K;  1WCM K;  5M5Y K;  5C3E K;  5FLM K;  4XLP A;  3RZD K;  2PA8 L;  4QJV A;  4A3G C;  4ZH4 A;  2PA8 D;  2JA6 K;  1I3Q K;  3GTJ C;  4A3G K;  4BY7 C;  4JK1 A;  4A3E C;  2NVQ C;  2E2H K;  3I4N K;  4X6A C;  4G7Z A;  3S17 C;  4A3B C;  4KMU A;  3GTO C;  1I6H C;  2NVT C;  5C4X C;  1K83 K;  4G7O A;  3GTJ K;  4KN4 A;  2PPB A;  3HOW C;  1I6V A;  2O5I A;  3GTP C;  1YNN A;  4C3J K;  4X6A K;  3S15 K;  3S17 K;  3GTO K;  3GTM K;  1I6H K;  4XSX A;  3I4M K;  5IYD C;  4A3I K;  4A3K C;  3PO3 C;  3HOW K;  2WAQ L;  4YFK A;  4AYB L;  1TWF C;  3HOZ K;  2E2I C;  2YU9 C;  3HOY C;  4A3D C;  2A6E A;  3H3V D;  3GTK C;  5IYD K;  4Q4Z A;  2PMZ L;  4MEX A;  3GTG C;  3GTQ C;  1TWH C;  2A69 A;  3PO3 K;  4Y52 K;  2B63 C;  4BBS K;  4A3D K;  3FKI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...