2NVYK

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
molecule tags Transcription
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvyK00
1Y1VK 1WCMK 1SMYA 5IP7K 4Q5SA 5IYCK 4Y7NK 1K83K 4MEYA 1SFOC 2E2JC 2E2IK 2JA7C 4X6AK 2YU9C 3S1NK 4YFNA 5C4JK 2NVXK 4A3CC 5IP7C 4A3BC 4XSXA 3I4MC 4BXXK 2NVQK 4AYBD 2R7ZK 3CQZC 3RZOK 2NVXC 2R92C 3HOWC 5D4DA 5IYDK 1Y1WC 1YNNA 4A3MC 4MEXA 3GTGK 5IYCC 2JA7K 1TWFK 2PMZL 5IYBC 4NOIA 4X6AC 2O5JA 4KMUA 5M5YK 5M3MK 4XSZA 3WODA 4AYBL 4BY1K 2Y0SL 2NVTK 4A93K 2O5IA 3HOVC 3GTKK 2A69A 3S1RK 3S17C 1TWAK 5IP9K 3H0GC 4OIPA 4C3IK 5TMCA 4Y7NC 5IYDC 3RZDC 1Y1WK 2E2IC 2R93K 4A3LC 3GTMK 3M3YC 3S16K 5C4XC 4A3FK 4A3EC 3HOUK 3S1MC 3M4OK 5C3EC 3GTKC 4KN4A 1I6HC 3RZOC 1TWGC 3HOXC 3S14C 4LK1A 3H3VD 1I3QC 4BBSC 3FKIK 4A3EK 4ZH4A 2JA8K 3HOYK 4A3DK 4A3GK 4G7ZA 3PO2C 3PO3C 1HQMA 1XPPA 4C3HK 2WAQL 3GTMC 2R93C 2PA8D 5TMFA 5M3FK 4A3DC 4BY7K 2JA8C 3HOWK 2JA5K 5C44C 5M5WK 3HKZD 3H3VL 3HOVK 3HOUC 3S1MK 1IW7A 3I4NC 4Y52K 4A3JK 4Q4ZA 3GTJC 2PA8L 2A6HA 3GTQC 5FLMK 3GTPC 3S15C 4MQ9A 3GTLC 4A3IK 1SFOK 2E2JK 4OINA 1TWHC 4BY7C 1TWAC 3S1RC 3GTQK 5FLMC 1I50K 3I4NK 3I4MK 4BXXC 2E2HK 4BBSK 3K7AK 2B63K 2A68A 2PMZD 2JA6C 3HOZK 3S2HC 4BBRK 4A3CK 4OIQA 3M4OC 1YNJA 4A3MK 3S1QC 1BDFA 2A6EA 1TWFC 5IYBK 4XLNA 3GTGC 3S17K 3GTOC 3CQZK 4BBRC 1Y1VC 5FJ8K 2R92K 1TWCC 3S1QK 4XLPA 3HOYC 4G7OA 2E2HC 2NVYC 4Y52C 4LK0A 2Y0SD 3EQLA 1I6VA 2YU9K 3S1NC 4A3FC 5C4JC 4LJZA 2JA5C 3GTLK 4JK1A 2VUMC 4A3IC 4A3LK 3S2HK 1K83C 4QJVA 3S2DK 3GTOK 4C3JK 3FKIC 4A3GC 5M5XK 5IP9C 2WB1L 1I50C 4KN7A 4OIOA 3DXJA 4A3BK 4YG2A 4QIWD 4A3KC 5C3EK 1I6HK 2NVYK 3K7AC 2PPBA 2B63C 1TWHK 2BE5A 4LLGA 2JA6K 2WAQD 5C44K 5C4XK 4G7HA 4QJVB 4BY1C 2NVTC 3M3YK 4A93C 3PO2K 1WCMC 4YFKA 3PO3K 2VUMK 2WB1D 3S2DC 3HKZL 3GTJK 2CW0A 4QIWL 1R9TC 1TWGK 4C2MK 3HOXK 3S14K 3H0GK 1I3QK 3RZDK 3HOZC 4GZYA 4A3JC 3GTPK 3S15K 4A3KK 2NVQC 1R9TK 2R7ZC 3S16C 1ZYRA 4OIRA 1TWCK 4YFXA
chains in the Genus database with same CATH superfamily
4BLAA 5IP7K 4Q5SA 4Y7NK 1K83K 1F9NA 4MEYA 1SFOC 2CFAB 3AH5A 1J6XA 4A3CC 4A3BC 3I4MC 4BXXK 2R7ZK 3RZOK 2NVXC 4C45A 2R92C 4C3IC 1YNNA 3L4JA 1ZBSA 5IYCC 5CJ9A 2RH6A 3LAJA 5IOTA 2D6FC 1V5VA 2O5IA 3HOVC 2GSNA 3TFJA 4LR2A 2ZUFA 2VUMA 1TWAK 1TWGA 2V6TA 4C3IK 4C3JC 4A3FK 4GT9A 5C3EC 4KAWX 3GTKC 3S14C 4A3EK 3OREA 3SZYA 3PO2C 1XZPA 1TWCA 1WOOA 5M3FK 3AQPA 2JA5K 1TWAA 5M5WK 3H3VL 3HOUC 1WQGA 4Y52K 2JA5A 3GTJC 1WIHA 3S15C 3NUHA 1AB4A 3BP8C 1O28A 2E2JK 1JQWA 3S1RC 1WQFA 3GEIA 1EQRA 3FHZA 2PMZD 1ISEA 4GTFA 5TJ3A 1C0AA 4A3CK 3A8IA 4A3MK 3GTGC 4DDQA 1JVIA 3S17K 3GTOC 4BBRC 1VH2A 3ERED 2XCQA 3HOYC 1ZVUA 4XCHA 1I6VA 2V6UA 4LJZA 2VUMC 4P5AA 3FKIC 1WOPA 1TWHA 2WB1L 4KN7A 3DXJA 3G4AA 1ZXOA 1O25A 4A3KC 1I6HK 2NVYK 1IBAA 2PPBA 2B63C 3S2HK 4LLGA 1TWHK 2BE5A 3AD7C 5C44K 3M3YK 2XCOA 3PO2K 4YFKA 4KARA 3GTKA 2CW0A 3S14K 3H0GK 3HOZC 4GZYA 5E68A 3H0GA 1XXBA 1F7UA 4A3JC 4P5BA 3S1QC 3CQZA 3G4CA 1PJ7A 1SMYA 2JA7C 4X6AK 2E2JC 4GTDA 4KC6A 4G0VA 5C4JK 3SZZA 4XSXA 4AYBD 3VA7A 5D4DA 4O2DA 3A8KA 4NOIA 2GAGC 2FQTA 4KMUA 3GIRA 4PAAA 4PABA 3WODA 4BY1K 2Y0SL 1XZQB 3GSIA 3N0CA 4KB2A 1VGXA 2ZUEA 4G0UA 2A69A 3S17C 1X31C 1KQ4A 1PJ5A 3RZDC 5TMCA 4Y7NC 5IYDC 3LPXA 3A8JA 3M4OK 3Q3QA 4KN4A 4G0WA 3FKIK 4G7ZA 4WILA 1HQMA 5JFEA 2WAQL 2PA8D 5TMFA 4A3DC 2JA8C 5L46A 3HOVK 3S1MK 3I4NC 4A3JK 2PA8L 5FLMK 2P5MA 5IOQA 2PHCB 1F7VA 1WORA 4A3IK 1SFOK 1B4BA 3GTQK 1JOEA 1USMA 3GTMA 3N3YA 3I4MK 4BXXC 4GFQA 2B63K 3S2HC 3HOZK 4OIQA 1WSRA 4XLNA 3N0BA 4WJ3M 1Y1VA 2E2HC 2NVYC 4Y52C 4LQYA 2Y0SD 3EQLA 2YU9K 3S1NC 2JA5C 2GAHC 1WQHA 3S0XA 5IOSA 5EGEA 2NVYA 1J6WA 4ILDA 5M5XK 1I50C 4OIOA 5C3EK 1XZQA 1IS1A 2NVTC 4A93C 4QJVB 3PO3K 3TFIA 3HXAA 1O24A 3RZDK 2YU9A 3S15K 3MMLB 4A3KK 2NVQC 1J6VA 3S16C 1ZYRA 4YFXA 3T00A 1Y1VK 1WCMK 2E2IK 2B63A 1XXCA 2YU9C 3S1NK 1L0WA 1WSVA 3FKIA 1EI6A 2NVQK 1VLOA 1SFOA 3GTQA 5IYDK 1Y1WC 2JA6A 4A3MC 4MEXA 2JA7K 4X6AC 2PMZL 4C3HC 5CHPA 5M3MK 4AH6A 1TWFA 4KM8A 1F93A 3GTKK 3GTPA 5IP9K 1IQ0A 3H0GC 1Y1WK 2E2HA 3OEPA 1O2AA 2P8TA 3GTMK 4A3LC 3M3YC 1O26A 3S1MC 2JH3A 4GTBA 1I6HC 1TWGC 3HOXC 4LK1A 4A3DK 1I3QC 4A3GK 2JA8K 2R93C 3GTMC 2W7VA 4J3NA 4BY7K 1XZPB 2JA7A 2R92A 1VJEA 1USOA 3GTQC 2RGRA 3GTLC 2FQOA 4BY7C 1TWAC 4M1XA 5FLMC 3GTGA 1I50K 4BBSK 3K7AK 2A68A 4KASA 1O27A 1RU0A 4KATA 1Y1VC 2R92K 3S1QK 4XLPA 1K83A 4G7OA 1WCMA 4LK0A 1INNA 4FM9A 3TFHA 1I3QA 5C4JC 1YX2A 1O2BA 1YCLA 4A3IC 4A3LK 1K83C 2ZFZA 1BS2A 4QJVA 3GTOK 1PJ6A 5IP9C 3LAPA 4A3BK 4YG2A 3BP3A 4GTEA 2JA6K 2WAQD 4C2MC 4BY1C 5HL8A 3OPFA 1BGWA 4QIWL 1R9TC 1TWGK 3HOXK 1I3QK 3GTPK 4LOWA 1Y1WA 3GEHA 4OIRA 5EGHA 5IYCK 4RMFA 4YFNA 4GTLA 2NVXK 2KWAA 5IP7C 3CQZC 1EH1A 3BUEA 3HOWC 4KMAA 1EK8A 1O2FB 3GTGK 1TWFK 5IYBC 3TTGA 5M5YK 2O5JA 4XSZA 4AYBL 2NVTK 4A93K 2GSUA 4KDDA 3T01A 3ADAC 3GTOA 2GSOA 2R93A 3AD9C 3S1RK 4OIPA 2E2IC 2R93K 2XCRB 3CAGA 1I50A 3FOEA 4KB4A 5C4XC 3S16K 3L4KA 4A3EC 3HOUK 2E2IA 3RZOC 4BBSC 1G51A 3H3VD 4ZH4A 1IL2A 3HOYK 1XXAA 2CFAA 2NVXA 3PO3C 4C3HK 1XPPA 2Y3PA 4P9SA 3HOWK 5C44C 3HKZD 1IW7A 3AD8C 4Q4ZA 4FZBA 4KM9A 3QX3A 2A6HA 3GTJA 3FOFA 3GTPC 4MQ9A 4OINA 1TWHC 1EFWA 1B4AA 3GEEA 1DCHA 4BLBA 3I4NK 2E2HK 1IE0A 2JA6C 4BBRK 3M4OC 1YNJA 1BDFA 2A6EA 1TWFC 5IYBK 3IPJA 4GTCA 1DD5A 1UV7A 3CQZK 5FJ8K 3T02A 1TWCC 3GDZA 4KMDA 1BJTA 4BKWA 4A3FC 3GTLK 4JK1A 3JSTA 1WOSA 5JVOA 3S2DK 4C3JK 4A3GC 2EBBA 1GE9A 4QIWD 5IORA 3K7AC 1VRQC 1DCPA 1O29A 1J98A 5C4XK 4G7HA 1HI9A 1WCMC 3V4GA 2R7ZA 2VUMK 2WB1D 3S2DC 1ZQ1C 3HKZL 3GTJK 4WJ4A 4C2MK 1R9TA 3AQOA 4GTAA 3GTLA 1DCOA 2V6SA 1R9TK 2R7ZC 4KMHA 1TWCK
chains in the Genus database with same CATH topology
1Y1VK 1WCMK 1SMYA 5IP7K 4Q5SA 5IYCK 4Y7NK 1K83K 4MEYA 1SFOC 2E2JC 2E2IK 2JA7C 4X6AK 2YU9C 3S1NK 4YFNA 5C4JK 2NVXK 4A3CC 5IP7C 4A3BC 4XSXA 3I4MC 4BXXK 2NVQK 4AYBD 2R7ZK 3CQZC 3RZOK 2NVXC 2R92C 3HOWC 5D4DA 5IYDK 1Y1WC 1YNNA 4A3MC 4MEXA 3GTGK 5IYCC 2JA7K 1TWFK 2PMZL 5IYBC 4NOIA 4X6AC 2O5JA 4KMUA 5M5YK 5M3MK 4XSZA 3WODA 4AYBL 4BY1K 2Y0SL 2NVTK 4A93K 2O5IA 3HOVC 3GTKK 2A69A 3S1RK 3S17C 1TWAK 5IP9K 3H0GC 4OIPA 4C3IK 5TMCA 4Y7NC 5IYDC 3RZDC 1Y1WK 2E2IC 2R93K 4A3LC 3GTMK 3M3YC 3S16K 5C4XC 4A3FK 4A3EC 3HOUK 3S1MC 3M4OK 5C3EC 3GTKC 4KN4A 1I6HC 3RZOC 1TWGC 3HOXC 3S14C 4LK1A 3H3VD 1I3QC 4BBSC 3FKIK 4A3EK 4ZH4A 2JA8K 3HOYK 4A3DK 4A3GK 4G7ZA 3PO2C 3PO3C 1HQMA 1XPPA 4C3HK 2WAQL 3GTMC 2R93C 2PA8D 5TMFA 5M3FK 4A3DC 4BY7K 2JA8C 3HOWK 2JA5K 5C44C 5M5WK 3HKZD 3H3VL 3HOVK 3HOUC 3S1MK 1IW7A 3I4NC 4Y52K 4A3JK 4Q4ZA 3GTJC 2PA8L 2A6HA 3GTQC 5FLMK 3GTPC 3S15C 4MQ9A 3GTLC 4A3IK 1SFOK 2E2JK 4OINA 1TWHC 4BY7C 1TWAC 3S1RC 3GTQK 5FLMC 1I50K 3I4NK 3I4MK 4BXXC 2E2HK 4BBSK 3K7AK 2B63K 2A68A 2PMZD 2JA6C 3HOZK 3S2HC 4BBRK 4A3CK 4OIQA 3M4OC 1YNJA 4A3MK 3S1QC 1BDFA 2A6EA 1TWFC 5IYBK 4XLNA 3GTGC 3S17K 3GTOC 3CQZK 4BBRC 1Y1VC 5FJ8K 2R92K 1TWCC 3S1QK 4XLPA 3HOYC 4G7OA 2E2HC 2NVYC 4Y52C 4LK0A 2Y0SD 3EQLA 1I6VA 2YU9K 3S1NC 4A3FC 5C4JC 4LJZA 2JA5C 3GTLK 4JK1A 2VUMC 4A3IC 4A3LK 3S2HK 1K83C 4QJVA 3S2DK 3GTOK 4C3JK 3FKIC 4A3GC 5M5XK 5IP9C 2WB1L 1I50C 4KN7A 4OIOA 3DXJA 4A3BK 4YG2A 4QIWD 4A3KC 5C3EK 1I6HK 2NVYK 3K7AC 2PPBA 2B63C 1TWHK 2BE5A 4LLGA 2JA6K 2WAQD 5C44K 5C4XK 4G7HA 4QJVB 4BY1C 2NVTC 3M3YK 4A93C 3PO2K 1WCMC 4YFKA 3PO3K 2VUMK 2WB1D 3S2DC 3HKZL 3GTJK 2CW0A 4QIWL 1R9TC 1TWGK 4C2MK 3HOXK 3S14K 3H0GK 1I3QK 3RZDK 3HOZC 4GZYA 4A3JC 3GTPK 3S15K 4A3KK 2NVQC 1R9TK 2R7ZC 3S16C 1ZYRA 4OIRA 1TWCK 4YFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V K;  1WCM K;  1SMY A;  5IP7 K;  4Q5S A;  5IYC K;  4Y7N K;  1K83 K;  4MEY A;  1SFO C;  2E2J C;  2E2I K;  2JA7 C;  4X6A K;  2YU9 C;  3S1N K;  4YFN A;  5C4J K;  2NVX K;  4A3C C;  5IP7 C;  4A3B C;  4XSX A;  3I4M C;  4BXX K;  2NVQ K;  4AYB D;  2R7Z K;  3CQZ C;  3RZO K;  2NVX C;  2R92 C;  3HOW C;  5D4D A;  5IYD K;  1Y1W C;  1YNN A;  4A3M C;  4MEX A;  3GTG K;  5IYC C;  2JA7 K;  1TWF K;  2PMZ L;  5IYB C;  4NOI A;  4X6A C;  2O5J A;  4KMU A;  5M5Y K;  5M3M K;  4XSZ A;  3WOD A;  4AYB L;  4BY1 K;  2Y0S L;  2NVT K;  4A93 K;  2O5I A;  3HOV C;  3GTK K;  2A69 A;  3S1R K;  3S17 C;  1TWA K;  5IP9 K;  3H0G C;  4OIP A;  4C3I K;  5TMC A;  4Y7N C;  5IYD C;  3RZD C;  1Y1W K;  2E2I C;  2R93 K;  4A3L C;  3GTM K;  3M3Y C;  3S16 K;  5C4X C;  4A3F K;  4A3E C;  3HOU K;  3S1M C;  3M4O K;  5C3E C;  3GTK C;  4KN4 A;  1I6H C;  3RZO C;  1TWG C;  3HOX C;  3S14 C;  4LK1 A;  3H3V D;  1I3Q C;  4BBS C;  3FKI K;  4A3E K;  4ZH4 A;  2JA8 K;  3HOY K;  4A3D K;  4A3G K;  4G7Z A;  3PO2 C;  3PO3 C;  1HQM A;  1XPP A;  4C3H K;  2WAQ L;  3GTM C;  2R93 C;  2PA8 D;  5TMF A;  5M3F K;  4A3D C;  4BY7 K;  2JA8 C;  3HOW K;  2JA5 K;  5C44 C;  5M5W K;  3HKZ D;  3H3V L;  3HOV K;  3HOU C;  3S1M K;  1IW7 A;  3I4N C;  4Y52 K;  4A3J K;  4Q4Z A;  3GTJ C;  2PA8 L;  2A6H A;  3GTQ C;  5FLM K;  3GTP C;  3S15 C;  4MQ9 A;  3GTL C;  4A3I K;  1SFO K;  2E2J K;  4OIN A;  1TWH C;  4BY7 C;  1TWA C;  3S1R C;  3GTQ K;  5FLM C;  1I50 K;  3I4N K;  3I4M K;  4BXX C;  2E2H K;  4BBS K;  3K7A K;  2B63 K;  2A68 A;  2PMZ D;  2JA6 C;  3HOZ K;  3S2H C;  4BBR K;  4A3C K;  4OIQ A;  3M4O C;  1YNJ A;  4A3M K;  3S1Q C;  1BDF A;  2A6E A;  1TWF C;  5IYB K;  4XLN A;  3GTG C;  3S17 K;  3GTO C;  3CQZ K;  4BBR C;  1Y1V C;  5FJ8 K;  2R92 K;  1TWC C;  3S1Q K;  4XLP A;  3HOY C;  4G7O A;  2E2H C;  2NVY C;  4Y52 C;  4LK0 A;  2Y0S D;  3EQL A;  1I6V A;  2YU9 K;  3S1N C;  4A3F C;  5C4J C;  4LJZ A;  2JA5 C;  3GTL K;  4JK1 A;  2VUM C;  4A3I C;  4A3L K;  3S2H K;  1K83 C;  4QJV A;  3S2D K;  3GTO K;  4C3J K;  3FKI C;  4A3G C;  5M5X K;  5IP9 C;  2WB1 L;  1I50 C;  4KN7 A;  4OIO A;  3DXJ A;  4A3B K;  4YG2 A;  4QIW D;  4A3K C;  5C3E K;  1I6H K;  2NVY K;  3K7A C;  2PPB A;  2B63 C;  1TWH K;  2BE5 A;  4LLG A;  2JA6 K;  2WAQ D;  5C44 K;  5C4X K;  4G7H A;  4QJV B;  4BY1 C;  2NVT C;  3M3Y K;  4A93 C;  3PO2 K;  1WCM C;  4YFK A;  3PO3 K;  2VUM K;  2WB1 D;  3S2D C;  3HKZ L;  3GTJ K;  2CW0 A;  4QIW L;  1R9T C;  1TWG K;  4C2M K;  3HOX K;  3S14 K;  3H0G K;  1I3Q K;  3RZD K;  3HOZ C;  4GZY A;  4A3J C;  3GTP K;  3S15 K;  4A3K K;  2NVQ C;  1R9T K;  2R7Z C;  3S16 C;  1ZYR A;  4OIR A;  1TWC K;  4YFX A; 
#chains in the Genus database with same CATH topology
 4BLA A;  5IP7 K;  4Q5S A;  4Y7N K;  1K83 K;  1F9N A;  4MEY A;  1SFO C;  2CFA B;  3AH5 A;  1J6X A;  4A3C C;  4A3B C;  3I4M C;  4BXX K;  2R7Z K;  3RZO K;  2NVX C;  4C45 A;  2R92 C;  4C3I C;  1YNN A;  3L4J A;  1ZBS A;  5IYC C;  5CJ9 A;  2RH6 A;  3LAJ A;  5IOT A;  2D6F C;  1V5V A;  2O5I A;  3HOV C;  2GSN A;  3TFJ A;  4LR2 A;  2ZUF A;  2VUM A;  1TWA K;  1TWG A;  2V6T A;  4C3I K;  4C3J C;  4A3F K;  4GT9 A;  5C3E C;  4KAW X;  3GTK C;  3S14 C;  4A3E K;  3ORE A;  3SZY A;  3PO2 C;  1XZP A;  1TWC A;  1WOO A;  5M3F K;  3AQP A;  2JA5 K;  1TWA A;  5M5W K;  3H3V L;  3HOU C;  1WQG A;  4Y52 K;  2JA5 A;  3GTJ C;  1WIH A;  3S15 C;  3NUH A;  1AB4 A;  3BP8 C;  1O28 A;  2E2J K;  1JQW A;  3S1R C;  1WQF A;  3GEI A;  1EQR A;  3FHZ A;  2PMZ D;  1ISE A;  4GTF A;  5TJ3 A;  1C0A A;  4A3C K;  3A8I A;  4A3M K;  3GTG C;  4DDQ A;  1JVI A;  3S17 K;  3GTO C;  4BBR C;  1VH2 A;  3ERE D;  2XCQ A;  3HOY C;  1ZVU A;  4XCH A;  1I6V A;  2V6U A;  4LJZ A;  2VUM C;  4P5A A;  3FKI C;  1WOP A;  1TWH A;  2WB1 L;  4KN7 A;  3DXJ A;  3G4A A;  1ZXO A;  1O25 A;  4A3K C;  1I6H K;  2NVY K;  1IBA A;  2PPB A;  2B63 C;  3S2H K;  4LLG A;  1TWH K;  2BE5 A;  3AD7 C;  5C44 K;  3M3Y K;  2XCO A;  3PO2 K;  4YFK A;  4KAR A;  3GTK A;  2CW0 A;  3S14 K;  3H0G K;  3HOZ C;  4GZY A;  5E68 A;  3H0G A;  1XXB A;  1F7U A;  4A3J C;  4P5B A;  3S1Q C;  3CQZ A;  3G4C A;  1PJ7 A;  1SMY A;  2JA7 C;  4X6A K;  2E2J C;  4GTD A;  4KC6 A;  4G0V A;  5C4J K;  3SZZ A;  4XSX A;  4AYB D;  3VA7 A;  5D4D A;  4O2D A;  3A8K A;  4NOI A;  2GAG C;  2FQT A;  4KMU A;  3GIR A;  4PAA A;  4PAB A;  3WOD A;  4BY1 K;  2Y0S L;  1XZQ B;  3GSI A;  3N0C A;  4KB2 A;  1VGX A;  2ZUE A;  4G0U A;  2A69 A;  3S17 C;  1X31 C;  1KQ4 A;  1PJ5 A;  3RZD C;  5TMC A;  4Y7N C;  5IYD C;  3LPX A;  3A8J A;  3M4O K;  3Q3Q A;  4KN4 A;  4G0W A;  3FKI K;  4G7Z A;  4WIL A;  1HQM A;  5JFE A;  2WAQ L;  2PA8 D;  5TMF A;  4A3D C;  2JA8 C;  5L46 A;  3HOV K;  3S1M K;  3I4N C;  4A3J K;  2PA8 L;  5FLM K;  2P5M A;  5IOQ A;  2PHC B;  1F7V A;  1WOR A;  4A3I K;  1SFO K;  1B4B A;  3GTQ K;  1JOE A;  1USM A;  3GTM A;  3N3Y A;  3I4M K;  4BXX C;  4GFQ A;  2B63 K;  3S2H C;  3HOZ K;  4OIQ A;  1WSR A;  4XLN A;  3N0B A;  4WJ3 M;  1Y1V A;  2E2H C;  2NVY C;  4Y52 C;  4LQY A;  2Y0S D;  3EQL A;  2YU9 K;  3S1N C;  2JA5 C;  2GAH C;  1WQH A;  3S0X A;  5IOS A;  5EGE A;  2NVY A;  1J6W A;  4ILD A;  5M5X K;  1I50 C;  4OIO A;  5C3E K;  1XZQ A;  1IS1 A;  2NVT C;  4A93 C;  4QJV B;  3PO3 K;  3TFI A;  3HXA A;  1O24 A;  3RZD K;  2YU9 A;  3S15 K;  3MML B;  4A3K K;  2NVQ C;  1J6V A;  3S16 C;  1ZYR A;  4YFX A;  3T00 A;  1Y1V K;  1WCM K;  2E2I K;  2B63 A;  1XXC A;  2YU9 C;  3S1N K;  1L0W A;  1WSV A;  3FKI A;  1EI6 A;  2NVQ K;  1VLO A;  1SFO A;  3GTQ A;  5IYD K;  1Y1W C;  2JA6 A;  4A3M C;  4MEX A;  2JA7 K;  4X6A C;  2PMZ L;  4C3H C;  5CHP A;  5M3M K;  4AH6 A;  1TWF A;  4KM8 A;  1F93 A;  3GTK K;  3GTP A;  5IP9 K;  1IQ0 A;  3H0G C;  1Y1W K;  2E2H A;  3OEP A;  1O2A A;  2P8T A;  3GTM K;  4A3L C;  3M3Y C;  1O26 A;  3S1M C;  2JH3 A;  4GTB A;  1I6H C;  1TWG C;  3HOX C;  4LK1 A;  4A3D K;  1I3Q C;  4A3G K;  2JA8 K;  2R93 C;  3GTM C;  2W7V A;  4J3N A;  4BY7 K;  1XZP B;  2JA7 A;  2R92 A;  1VJE A;  1USO A;  3GTQ C;  2RGR A;  3GTL C;  2FQO A;  4BY7 C;  1TWA C;  4M1X A;  5FLM C;  3GTG A;  1I50 K;  4BBS K;  3K7A K;  2A68 A;  4KAS A;  1O27 A;  1RU0 A;  4KAT A;  1Y1V C;  2R92 K;  3S1Q K;  4XLP A;  1K83 A;  4G7O A;  1WCM A;  4LK0 A;  1INN A;  4FM9 A;  3TFH A;  1I3Q A;  5C4J C;  1YX2 A;  1O2B A;  1YCL A;  4A3I C;  4A3L K;  1K83 C;  2ZFZ A;  1BS2 A;  4QJV A;  3GTO K;  1PJ6 A;  5IP9 C;  3LAP A;  4A3B K;  4YG2 A;  3BP3 A;  4GTE A;  2JA6 K;  2WAQ D;  4C2M C;  4BY1 C;  5HL8 A;  3OPF A;  1BGW A;  4QIW L;  1R9T C;  1TWG K;  3HOX K;  1I3Q K;  3GTP K;  4LOW A;  1Y1W A;  3GEH A;  4OIR A;  5EGH A;  5IYC K;  4RMF A;  4YFN A;  4GTL A;  2NVX K;  2KWA A;  5IP7 C;  3CQZ C;  1EH1 A;  3BUE A;  3HOW C;  4KMA A;  1EK8 A;  1O2F B;  3GTG K;  1TWF K;  5IYB C;  3TTG A;  5M5Y K;  2O5J A;  4XSZ A;  4AYB L;  2NVT K;  4A93 K;  2GSU A;  4KDD A;  3T01 A;  3ADA C;  3GTO A;  2GSO A;  2R93 A;  3AD9 C;  3S1R K;  4OIP A;  2E2I C;  2R93 K;  2XCR B;  3CAG A;  1I50 A;  3FOE A;  4KB4 A;  5C4X C;  3S16 K;  3L4K A;  4A3E C;  3HOU K;  2E2I A;  3RZO C;  4BBS C;  1G51 A;  3H3V D;  4ZH4 A;  1IL2 A;  3HOY K;  1XXA A;  2CFA A;  2NVX A;  3PO3 C;  4C3H K;  1XPP A;  2Y3P A;  4P9S A;  3HOW K;  5C44 C;  3HKZ D;  1IW7 A;  3AD8 C;  4Q4Z A;  4FZB A;  4KM9 A;  3QX3 A;  2A6H A;  3GTJ A;  3FOF A;  3GTP C;  4MQ9 A;  4OIN A;  1TWH C;  1EFW A;  1B4A A;  3GEE A;  1DCH A;  4BLB A;  3I4N K;  2E2H K;  1IE0 A;  2JA6 C;  4BBR K;  3M4O C;  1YNJ A;  1BDF A;  2A6E A;  1TWF C;  5IYB K;  3IPJ A;  4GTC A;  1DD5 A;  1UV7 A;  3CQZ K;  5FJ8 K;  3T02 A;  1TWC C;  3GDZ A;  4KMD A;  1BJT A;  4BKW A;  4A3F C;  3GTL K;  4JK1 A;  3JST A;  1WOS A;  5JVO A;  3S2D K;  4C3J K;  4A3G C;  2EBB A;  1GE9 A;  4QIW D;  5IOR A;  3K7A C;  1VRQ C;  1DCP A;  1O29 A;  1J98 A;  5C4X K;  4G7H A;  1HI9 A;  1WCM C;  3V4G A;  2R7Z A;  2VUM K;  2WB1 D;  3S2D C;  1ZQ1 C;  3HKZ L;  3GTJ K;  4WJ4 A;  4C2M K;  1R9T A;  3AQO A;  4GTA A;  3GTL A;  1DCO A;  2V6S A;  1R9T K;  2R7Z C;  4KMH A;  1TWC K; 
#chains in the Genus database with same CATH homology
 1Y1V K;  1WCM K;  1SMY A;  5IP7 K;  4Q5S A;  5IYC K;  4Y7N K;  1K83 K;  4MEY A;  1SFO C;  2E2J C;  2E2I K;  2JA7 C;  4X6A K;  2YU9 C;  3S1N K;  4YFN A;  5C4J K;  2NVX K;  4A3C C;  5IP7 C;  4A3B C;  4XSX A;  3I4M C;  4BXX K;  2NVQ K;  4AYB D;  2R7Z K;  3CQZ C;  3RZO K;  2NVX C;  2R92 C;  3HOW C;  5D4D A;  5IYD K;  1Y1W C;  1YNN A;  4A3M C;  4MEX A;  3GTG K;  5IYC C;  2JA7 K;  1TWF K;  2PMZ L;  5IYB C;  4NOI A;  4X6A C;  2O5J A;  4KMU A;  5M5Y K;  5M3M K;  4XSZ A;  3WOD A;  4AYB L;  4BY1 K;  2Y0S L;  2NVT K;  4A93 K;  2O5I A;  3HOV C;  3GTK K;  2A69 A;  3S1R K;  3S17 C;  1TWA K;  5IP9 K;  3H0G C;  4OIP A;  4C3I K;  5TMC A;  4Y7N C;  5IYD C;  3RZD C;  1Y1W K;  2E2I C;  2R93 K;  4A3L C;  3GTM K;  3M3Y C;  3S16 K;  5C4X C;  4A3F K;  4A3E C;  3HOU K;  3S1M C;  3M4O K;  5C3E C;  3GTK C;  4KN4 A;  1I6H C;  3RZO C;  1TWG C;  3HOX C;  3S14 C;  4LK1 A;  3H3V D;  1I3Q C;  4BBS C;  3FKI K;  4A3E K;  4ZH4 A;  2JA8 K;  3HOY K;  4A3D K;  4A3G K;  4G7Z A;  3PO2 C;  3PO3 C;  1HQM A;  1XPP A;  4C3H K;  2WAQ L;  3GTM C;  2R93 C;  2PA8 D;  5TMF A;  5M3F K;  4A3D C;  4BY7 K;  2JA8 C;  3HOW K;  2JA5 K;  5C44 C;  5M5W K;  3HKZ D;  3H3V L;  3HOV K;  3HOU C;  3S1M K;  1IW7 A;  3I4N C;  4Y52 K;  4A3J K;  4Q4Z A;  3GTJ C;  2PA8 L;  2A6H A;  3GTQ C;  5FLM K;  3GTP C;  3S15 C;  4MQ9 A;  3GTL C;  4A3I K;  1SFO K;  2E2J K;  4OIN A;  1TWH C;  4BY7 C;  1TWA C;  3S1R C;  3GTQ K;  5FLM C;  1I50 K;  3I4N K;  3I4M K;  4BXX C;  2E2H K;  4BBS K;  3K7A K;  2B63 K;  2A68 A;  2PMZ D;  2JA6 C;  3HOZ K;  3S2H C;  4BBR K;  4A3C K;  4OIQ A;  3M4O C;  1YNJ A;  4A3M K;  3S1Q C;  1BDF A;  2A6E A;  1TWF C;  5IYB K;  4XLN A;  3GTG C;  3S17 K;  3GTO C;  3CQZ K;  4BBR C;  1Y1V C;  5FJ8 K;  2R92 K;  1TWC C;  3S1Q K;  4XLP A;  3HOY C;  4G7O A;  2E2H C;  2NVY C;  4Y52 C;  4LK0 A;  2Y0S D;  3EQL A;  1I6V A;  2YU9 K;  3S1N C;  4A3F C;  5C4J C;  4LJZ A;  2JA5 C;  3GTL K;  4JK1 A;  2VUM C;  4A3I C;  4A3L K;  3S2H K;  1K83 C;  4QJV A;  3S2D K;  3GTO K;  4C3J K;  3FKI C;  4A3G C;  5M5X K;  5IP9 C;  2WB1 L;  1I50 C;  4KN7 A;  4OIO A;  3DXJ A;  4A3B K;  4YG2 A;  4QIW D;  4A3K C;  5C3E K;  1I6H K;  2NVY K;  3K7A C;  2PPB A;  2B63 C;  1TWH K;  2BE5 A;  4LLG A;  2JA6 K;  2WAQ D;  5C44 K;  5C4X K;  4G7H A;  4QJV B;  4BY1 C;  2NVT C;  3M3Y K;  4A93 C;  3PO2 K;  1WCM C;  4YFK A;  3PO3 K;  2VUM K;  2WB1 D;  3S2D C;  3HKZ L;  3GTJ K;  2CW0 A;  4QIW L;  1R9T C;  1TWG K;  4C2M K;  3HOX K;  3S14 K;  3H0G K;  1I3Q K;  3RZD K;  3HOZ C;  4GZY A;  4A3J C;  3GTP K;  3S15 K;  4A3K K;  2NVQ C;  1R9T K;  2R7Z C;  3S16 C;  1ZYR A;  4OIR A;  1TWC K;  4YFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...