2NVYK

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2nvyK00
1Y1VK 2BE5A 4LK1A 2YU9K 3H0GC 5IP9K 2E2IK 3S2DC 4OIPA 3FKIC 5C4JK 3HOZK 1K83C 2NVQC 1I6HK 3S14C 2NVTC 3GTJK 2E2JC 1WCMC 4XSZA 3GTGK 1BDFA 3I4MC 4OIQA 4ZH4A 2R93C 2JA7C 2NVXK 4AYBL 3EQLA 4XLPA 2O5IA 2PMZL 3M3YK 4BY7K 4Q5SA 2A68A 5C4XK 1Y1WK 2JA6K 2VUMK 3S1NK 4A3DC 4A3GC 4LK0A 2WB1L 3HOXK 5IP7K 3RZDC 3PO2K 1TWFC 3M4OC 1TWAC 3S15C 4A3LC 3HOWK 4KMUA 3RZOK 3HOYC 4BY1K 2NVYC 4A3CK 1I6VA 4A3BK 4Y52K 5IYBC 3HOUK 5IYCC 4AYBD 1R9TK 4BBRK 4A3JC 4KN7A 3S1RC 2PMZD 2JA5K 3GTKC 4A93K 5IYDC 4MQ9A 3K7AC 3GTPK 5FLMK 1TWGK 4G7HA 4Y7NC 2WB1D 4MEYA 4A3FK 4C3IK 2R92C 3S1MK 3S1QK 2B63C 3GTQC 4YFNA 4BBSC 1I3QK 3CQZC 4Q4ZA 4A3KC 4C3JK 5TMFA 5C3EK 3I4NC 1ZYRA 5M3MK 4BXXC 2R7ZC 4X6AK 1I50C 4XLNA 5C44C 1HQMA 1Y1VC 3S17K 1SFOK 2YU9C 2E2IC 3GTPC 3GTOK 3S16K 3GTMK 3S2HK 5C4JC 4A3MK 3HOZC 2E2HC 1YNNA 4MEXA 3PO3K 1I6HC 1TWCK 3GTJC 1TWHK 3GTGC 1YNJA 4C3HK 4YFXA 5D4DA 4A3IK 5M5WK 4A3EC 3HKZL 4OIRA 3GTLK 4A3JK 5M5XK 3M3YC 4BY7C 3S1RK 1Y1WC 2JA6C 2Y0SL 3S1NC 3H0GK 4GZYA 3PO2C 5IYDK 3HOXC 5IP7C 3S2DK 3FKIK 1K83K 4Y7NK 2NVQK 2R92K 3HOWC 2CW0A 3S14K 4LLGA 2NVTK 3H3VL 2JA8C 5TMCA 2E2JK 4BY1C 4C2MK 1WCMK 3RZOC 2A6EA 4A3BC 4BBSK 3HOVC 3HOUC 3I4MK 3HKZD 4QIWL 4BBRC 1R9TC 4OINA 2R93K 2JA7K 3WODA 5FJ8K 2WAQD 4A93C 3DXJA 4JK1A 4YFKA 5IP9C 5FLMC 1TWGC 2Y0SD 4G7OA 3S1MC 4A3FC 3S1QC 2O5JA 4A3DK 4A3GK 4QJVB 1I3QC 3RZDK 1TWFK 4OIOA 1TWAK 3H3VD 3S15K 3M4OK 2PA8L 5M3FK 2E2HK 4A3LK 4QJVA 3HOYK 5C3EC 2NVYK 4QIWD 2NVXC 5IYBK 5IYCK 4X6AC 4LJZA 1XPPA 2A6HA 2WAQL 3GTKK 1IW7A 3S17C 4A3EK 5C4XC 1SFOC 4KN4A 2VUMC 3K7AK 3GTOC 3S16C 4XSXA 3GTMC 3S2HC 4NOIA 4G7ZA 4A3MC 3PO3C 2PPBA 2B63K 1TWCC 2PA8D 4Y52C 3GTQK 2A69A 3CQZK 4A3CC 1TWHC 1SMYA 4A3KK 4YG2A 5M5YK 3I4NK 2JA8K 4A3IC 2JA5C 4BXXK 3GTLC 2R7ZK 3HOVK 1I50K 5C44K
chains in the Genus database with same CATH superfamily
4WJ3M 3H0GC 4RMFA 1ZXOA 5C4JK 2NVTC 1BGWA 4XSZA 2R93A 1IQ0A 5E68A 5IOQA 3MMLB 4AYBL 2PMZL 2VUMK 3PO2K 3HOXK 5IP7K 1VH2A 3M4OC 3GSIA 3HOYC 2ZFZA 1I6VA 4A3JC 3L4KA 3FKIA 3IPJA 4A93K 1USMA 4WILA 1ZBSA 1WCMA 2WB1D 4BLAA 3S1QK 3BP8C 3GTQC 4AH6A 5EGHA 1DCHA 2R7ZA 1XXAA 4C3JK 5TMFA 4BXXC 1WIHA 4XLNA 2YU9A 1XXCA 1Y1VC 3S17K 1C0AA 2E2HA 2E2IC 3GTMK 4LQYA 4A3MK 2GSUA 3FOEA 5JVOA 1BJTA 3GTGC 1XZQA 1WQHA 3LPXA 4C3HK 4KC6A 4A3IK 1EK8A 4A3EC 3GTLK 4OIRA 1F9NA 4GTCA 1EFWA 4BY7C 1Y1WC 2JA6C 3S2DK 3FKIK 4Y7NK 3FOFA 1I50A 2JA8C 3RZOC 4BBSK 1WCMK 4GTAA 1R9TC 2XCQA 3JSTA 1TWGA 5FJ8K 3DXJA 4JK1A 2PHCB 5IP9C 1IS1A 4A3FC 3QX3A 4A3DK 4A3GK 3RZDK 2NVXA 2PA8L 1O2BA 2E2HK 1YX2A 1KQ4A 1JOEA 5IYBK 1VRQC 3GEIA 3GTOA 1IW7A 3ERED 1WQFA 4NOIA 3N0BA 4Y52C 4A3CC 1IE0A 1VLOA 1F93A 5M5YK 3GTPA 2JA5C 3HOVK 1O25A 1I50K 3H0GA 4GTEA 1I3QA 2CFAA 1K83C 2NVQC 1I6HK 3S14C 1O28A 3GTJK 3NUHA 1INNA 4OIQA 3GIRA 2NVXK 4GTDA 1JVIA 3M3YK 1ZQ1C 1TWCA 4C45A 2A68A 5C4XK 3S1NK 1TWFC 1TWAC 3FHZA 4KMUA 2NVYC 4P5AA 3HOUK 2FQTA 3GTKC 4KATA 1ZVUA 5IYDC 3K7AC 4O2DA 5FLMK 3GTPK 2R92C 1VGXA 1I3QK 2JA7A 3HXAA 4A3KC 1HI9A 5C3EK 1Y1VA 1XXBA 4X6AK 4G0WA 2E2IA 1O24A 1PJ6A 1SFOK 5IORA 1YCLA 2KWAA 4KDDA 4GTFA 5L46A 3S16K 5C4JC 1TWCK 1XZQB 1F7VA 1TWHK 5IOTA 2D6FC 5D4DA 4A3JK 5M5XK 2B63A 3CQZA 2Y0SL 4GZYA 3PO2C 3HOXC 5IP7C 1BS2A 2W7VA 4LLGA 3H3VL 5TMCA 2E2JK 4C2MK 3I4MK 3HKZD 4OINA 2R93K 2JA7K 4J3NA 4A93C 2O5JA 3LAJA 3S1QC 3AD7C 1F7UA 4FM9A 4OIOA 3S15K 4A3LK 3T01A 5M3FK 4P5BA 4QJVA 4C3JC 1DCPA 4QIWD 5IYCK 3G4AA 2WAQL 2GSNA 3S17C 4A3EK 2Y3PA 4KN4A 3GTMC 3BP3A 1O29A 1X31C 4KMDA 4G7ZA 4A3MC 3CAGA 2B63K 1G51A 3CQZK 2JA5A 1SMYA 4C3HC 3I4NK 2JA8K 4A3IC 1J6VA 3L4JA 3GTLC 2R7ZK 3A8KA 5JFEA 3TFHA 5C44K 2CFAB 4LK1A 2YU9K 5IP9K 3BUEA 3S2DC 3FKIC 3Q3QA 3TFJA 3HOZK 2GAGC 1J6WA 4KAWX 1WOOA 1WCMC 1BDFA 4ZH4A 2RGRA 4GT9A 2P5MA 4GTLA 4P9SA 4A3DC 4A3GC 4LK0A 2WB1L 3RZDC 3HOWK 4XCHA 4BY1K 4A3CK 4Y52K 4KM8A 4A3BK 3GTKA 3ADAC 5IYBC 4AYBD 4BBRK 3S1RC 2PMZD 2JA5K 2R92A 2FQOA 1TWGK 4G7HA 3S1MK 4C3IK 5IOSA 4Q4ZA 3AH5A 5M3MK 3OEPA 1IL2A 1I50C 2V6TA 1HQMA 3GEHA 3GTOK 3S2HK 4M1XA 3VA7A 1YNNA 4MEXA 3PO3K 4G0VA 1I6HC 3GTJC 4YFXA 5M5WK 3SZYA 3M3YC 1O2AA 3GTQA 1J98A 1XZPA 3AD8C 3S1NC 5IYDK 1PJ7A 3H0GK 2R92K 2NVTK 4KASA 2A6EA 2ZUFA 3HOUC 1EH1A 3AD9C 4KM9A 1B4AA 3S0XA 5TJ3A 1RU0A 2WAQD 1UV7A 1DD5A 5FLMC 4G7OA 3GTGA 4QJVB 1I3QC 3TFIA 3M4OK 2XCRB 3GDZA 4KMAA 1IBAA 3HOYK 5C3EC 4LOWA 2V6SA 4X6AC 5EGEA 1Y1WA 2JA6A 2A6HA 3GEEA 3GTMA 1SFOC 2VUMC 5CJ9A 1WORA 3S16C 3T00A 3A8IA 1WSVA 1R9TA 1TWCC 2PA8D 3GTQK 2A69A 1TWHC 3GTLA 4YG2A 4BXXK 1Y1VK 3OREA 2BE5A 1O26A 4KARA 2E2IK 3G4CA 4OIPA 1EI6A 2E2JC 4C2MC 3GTGK 3AQPA 3I4MC 2R93C 2JA7C 3EQLA 4XLPA 2O5IA 4BY7K 4PABA 3SZZA 4Q5SA 1Y1WK 2JA6K 3S15C 4A3LC 2XCOA 3RZOK 1AB4A 4ILDA 4BKWA 5IYCC 1R9TK 3OPFA 4KN7A 2V6UA 1K83A 1DCOA 4MQ9A 1O27A 1PJ5A 4KB2A 4Y7NC 4MEYA 4A3FK 2B63C 4YFNA 4BBSC 2RH6A 3CQZC 1EQRA 1J6XA 4DDQA 1VJEA 3I4NC 1ZYRA 4G0UA 2R7ZC 1V5VA 5C44C 1TWFA 1B4BA 1TWAA 2ZUEA 2YU9C 2NVYA 3GTJA 3HOZC 1WQGA 2E2HC 1JQWA 1YNJA 4GFQA 4FZBA 3AQOA 3HKZL 1USOA 1XZPB 3S1RK 1L0WA 2P8TA 3N3YA 1K83K 3T02A 2NVQK 3HOWC 2CW0A 3S14K 1O2FB 4PAAA 4GTBA 3TTGA 4BY1C 4A3BC 3N0CA 3HOVC 4QIWL 4BBRC 4LR2A 3WODA 4YFKA 1TWGC 2Y0SD 3V4GA 4KMHA 3S1MC 4C3IC 2EBBA 1WOSA 1TWFK 3H3VD 1TWAK 2NVYK 2NVXC 1WSRA 4LJZA 1SFOA 2VUMA 1XPPA 3GTKK 5C4XC 4WJ4A 3K7AK 2JH3A 3GTOC 5CHPA 4XSXA 4BLBA 3S2HC 5HL8A 1WOPA 1TWHA 3LAPA 3PO3C 2GSOA 2PPBA 4KB4A 1GE9A 3A8JA 2GAHC 4A3KK 1ISEA 3GTPC
chains in the Genus database with same CATH topology
1Y1VK 2BE5A 4LK1A 2YU9K 3H0GC 5IP9K 2E2IK 3S2DC 4OIPA 3FKIC 5C4JK 3HOZK 1K83C 2NVQC 1I6HK 3S14C 2NVTC 3GTJK 2E2JC 1WCMC 4XSZA 3GTGK 1BDFA 3I4MC 4OIQA 4ZH4A 2R93C 2JA7C 2NVXK 4AYBL 3EQLA 4XLPA 2O5IA 2PMZL 3M3YK 4BY7K 4Q5SA 2A68A 5C4XK 1Y1WK 2JA6K 2VUMK 3S1NK 4A3DC 4A3GC 4LK0A 2WB1L 3HOXK 5IP7K 3RZDC 3PO2K 1TWFC 3M4OC 1TWAC 3S15C 4A3LC 3HOWK 4KMUA 3RZOK 3HOYC 4BY1K 2NVYC 4A3CK 1I6VA 4A3BK 4Y52K 5IYBC 3HOUK 5IYCC 4AYBD 1R9TK 4BBRK 4A3JC 4KN7A 3S1RC 2PMZD 2JA5K 3GTKC 4A93K 5IYDC 4MQ9A 3K7AC 3GTPK 5FLMK 1TWGK 4G7HA 4Y7NC 2WB1D 4MEYA 4A3FK 4C3IK 2R92C 3S1MK 3S1QK 2B63C 3GTQC 4YFNA 4BBSC 1I3QK 3CQZC 4Q4ZA 4A3KC 4C3JK 5TMFA 5C3EK 3I4NC 1ZYRA 5M3MK 4BXXC 2R7ZC 4X6AK 1I50C 4XLNA 5C44C 1HQMA 1Y1VC 3S17K 1SFOK 2YU9C 2E2IC 3GTPC 3GTOK 3S16K 3GTMK 3S2HK 5C4JC 4A3MK 3HOZC 2E2HC 1YNNA 4MEXA 3PO3K 1I6HC 1TWCK 3GTJC 1TWHK 3GTGC 1YNJA 4C3HK 4YFXA 5D4DA 4A3IK 5M5WK 4A3EC 3HKZL 4OIRA 3GTLK 4A3JK 5M5XK 3M3YC 4BY7C 3S1RK 1Y1WC 2JA6C 2Y0SL 3S1NC 3H0GK 4GZYA 3PO2C 5IYDK 3HOXC 5IP7C 3S2DK 3FKIK 1K83K 4Y7NK 2NVQK 2R92K 3HOWC 2CW0A 3S14K 4LLGA 2NVTK 3H3VL 2JA8C 5TMCA 2E2JK 4BY1C 4C2MK 1WCMK 3RZOC 2A6EA 4A3BC 4BBSK 3HOVC 3HOUC 3I4MK 3HKZD 4QIWL 4BBRC 1R9TC 4OINA 2R93K 2JA7K 3WODA 5FJ8K 2WAQD 4A93C 3DXJA 4JK1A 4YFKA 5IP9C 5FLMC 1TWGC 2Y0SD 4G7OA 3S1MC 4A3FC 3S1QC 2O5JA 4A3DK 4A3GK 4QJVB 1I3QC 3RZDK 1TWFK 4OIOA 1TWAK 3H3VD 3S15K 3M4OK 2PA8L 5M3FK 2E2HK 4A3LK 4QJVA 3HOYK 5C3EC 2NVYK 4QIWD 2NVXC 5IYBK 5IYCK 4X6AC 4LJZA 1XPPA 2A6HA 2WAQL 3GTKK 1IW7A 3S17C 4A3EK 5C4XC 1SFOC 4KN4A 2VUMC 3K7AK 3GTOC 3S16C 4XSXA 3GTMC 3S2HC 4NOIA 4G7ZA 4A3MC 3PO3C 2PPBA 2B63K 1TWCC 2PA8D 4Y52C 3GTQK 2A69A 3CQZK 4A3CC 1TWHC 1SMYA 4A3KK 4YG2A 5M5YK 3I4NK 2JA8K 4A3IC 2JA5C 4BXXK 3GTLC 2R7ZK 3HOVK 1I50K 5C44K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V K;  2BE5 A;  4LK1 A;  2YU9 K;  3H0G C;  5IP9 K;  2E2I K;  3S2D C;  4OIP A;  3FKI C;  5C4J K;  3HOZ K;  1K83 C;  2NVQ C;  1I6H K;  3S14 C;  2NVT C;  3GTJ K;  2E2J C;  1WCM C;  4XSZ A;  3GTG K;  1BDF A;  3I4M C;  4OIQ A;  4ZH4 A;  2R93 C;  2JA7 C;  2NVX K;  4AYB L;  3EQL A;  4XLP A;  2O5I A;  2PMZ L;  3M3Y K;  4BY7 K;  4Q5S A;  2A68 A;  5C4X K;  1Y1W K;  2JA6 K;  2VUM K;  3S1N K;  4A3D C;  4A3G C;  4LK0 A;  2WB1 L;  3HOX K;  5IP7 K;  3RZD C;  3PO2 K;  1TWF C;  3M4O C;  1TWA C;  3S15 C;  4A3L C;  3HOW K;  4KMU A;  3RZO K;  3HOY C;  4BY1 K;  2NVY C;  4A3C K;  1I6V A;  4A3B K;  4Y52 K;  5IYB C;  3HOU K;  5IYC C;  4AYB D;  1R9T K;  4BBR K;  4A3J C;  4KN7 A;  3S1R C;  2PMZ D;  2JA5 K;  3GTK C;  4A93 K;  5IYD C;  4MQ9 A;  3K7A C;  3GTP K;  5FLM K;  1TWG K;  4G7H A;  4Y7N C;  2WB1 D;  4MEY A;  4A3F K;  4C3I K;  2R92 C;  3S1M K;  3S1Q K;  2B63 C;  3GTQ C;  4YFN A;  4BBS C;  1I3Q K;  3CQZ C;  4Q4Z A;  4A3K C;  4C3J K;  5TMF A;  5C3E K;  3I4N C;  1ZYR A;  5M3M K;  4BXX C;  2R7Z C;  4X6A K;  1I50 C;  4XLN A;  5C44 C;  1HQM A;  1Y1V C;  3S17 K;  1SFO K;  2YU9 C;  2E2I C;  3GTP C;  3GTO K;  3S16 K;  3GTM K;  3S2H K;  5C4J C;  4A3M K;  3HOZ C;  2E2H C;  1YNN A;  4MEX A;  3PO3 K;  1I6H C;  1TWC K;  3GTJ C;  1TWH K;  3GTG C;  1YNJ A;  4C3H K;  4YFX A;  5D4D A;  4A3I K;  5M5W K;  4A3E C;  3HKZ L;  4OIR A;  3GTL K;  4A3J K;  5M5X K;  3M3Y C;  4BY7 C;  3S1R K;  1Y1W C;  2JA6 C;  2Y0S L;  3S1N C;  3H0G K;  4GZY A;  3PO2 C;  5IYD K;  3HOX C;  5IP7 C;  3S2D K;  3FKI K;  1K83 K;  4Y7N K;  2NVQ K;  2R92 K;  3HOW C;  2CW0 A;  3S14 K;  4LLG A;  2NVT K;  3H3V L;  2JA8 C;  5TMC A;  2E2J K;  4BY1 C;  4C2M K;  1WCM K;  3RZO C;  2A6E A;  4A3B C;  4BBS K;  3HOV C;  3HOU C;  3I4M K;  3HKZ D;  4QIW L;  4BBR C;  1R9T C;  4OIN A;  2R93 K;  2JA7 K;  3WOD A;  5FJ8 K;  2WAQ D;  4A93 C;  3DXJ A;  4JK1 A;  4YFK A;  5IP9 C;  5FLM C;  1TWG C;  2Y0S D;  4G7O A;  3S1M C;  4A3F C;  3S1Q C;  2O5J A;  4A3D K;  4A3G K;  4QJV B;  1I3Q C;  3RZD K;  1TWF K;  4OIO A;  1TWA K;  3H3V D;  3S15 K;  3M4O K;  2PA8 L;  5M3F K;  2E2H K;  4A3L K;  4QJV A;  3HOY K;  5C3E C;  2NVY K;  4QIW D;  2NVX C;  5IYB K;  5IYC K;  4X6A C;  4LJZ A;  1XPP A;  2A6H A;  2WAQ L;  3GTK K;  1IW7 A;  3S17 C;  4A3E K;  5C4X C;  1SFO C;  4KN4 A;  2VUM C;  3K7A K;  3GTO C;  3S16 C;  4XSX A;  3GTM C;  3S2H C;  4NOI A;  4G7Z A;  4A3M C;  3PO3 C;  2PPB A;  2B63 K;  1TWC C;  2PA8 D;  4Y52 C;  3GTQ K;  2A69 A;  3CQZ K;  4A3C C;  1TWH C;  1SMY A;  4A3K K;  4YG2 A;  5M5Y K;  3I4N K;  2JA8 K;  4A3I C;  2JA5 C;  4BXX K;  3GTL C;  2R7Z K;  3HOV K;  1I50 K;  5C44 K; 
#chains in the Genus database with same CATH topology
 4WJ3 M;  3H0G C;  4RMF A;  1ZXO A;  5C4J K;  2NVT C;  1BGW A;  4XSZ A;  2R93 A;  1IQ0 A;  5E68 A;  5IOQ A;  3MML B;  4AYB L;  2PMZ L;  2VUM K;  3PO2 K;  3HOX K;  5IP7 K;  1VH2 A;  3M4O C;  3GSI A;  3HOY C;  2ZFZ A;  1I6V A;  4A3J C;  3L4K A;  3FKI A;  3IPJ A;  4A93 K;  1USM A;  4WIL A;  1ZBS A;  1WCM A;  2WB1 D;  4BLA A;  3S1Q K;  3BP8 C;  3GTQ C;  4AH6 A;  5EGH A;  1DCH A;  2R7Z A;  1XXA A;  4C3J K;  5TMF A;  4BXX C;  1WIH A;  4XLN A;  2YU9 A;  1XXC A;  1Y1V C;  3S17 K;  1C0A A;  2E2H A;  2E2I C;  3GTM K;  4LQY A;  4A3M K;  2GSU A;  3FOE A;  5JVO A;  1BJT A;  3GTG C;  1XZQ A;  1WQH A;  3LPX A;  4C3H K;  4KC6 A;  4A3I K;  1EK8 A;  4A3E C;  3GTL K;  4OIR A;  1F9N A;  4GTC A;  1EFW A;  4BY7 C;  1Y1W C;  2JA6 C;  3S2D K;  3FKI K;  4Y7N K;  3FOF A;  1I50 A;  2JA8 C;  3RZO C;  4BBS K;  1WCM K;  4GTA A;  1R9T C;  2XCQ A;  3JST A;  1TWG A;  5FJ8 K;  3DXJ A;  4JK1 A;  2PHC B;  5IP9 C;  1IS1 A;  4A3F C;  3QX3 A;  4A3D K;  4A3G K;  3RZD K;  2NVX A;  2PA8 L;  1O2B A;  2E2H K;  1YX2 A;  1KQ4 A;  1JOE A;  5IYB K;  1VRQ C;  3GEI A;  3GTO A;  1IW7 A;  3ERE D;  1WQF A;  4NOI A;  3N0B A;  4Y52 C;  4A3C C;  1IE0 A;  1VLO A;  1F93 A;  5M5Y K;  3GTP A;  2JA5 C;  3HOV K;  1O25 A;  1I50 K;  3H0G A;  4GTE A;  1I3Q A;  2CFA A;  1K83 C;  2NVQ C;  1I6H K;  3S14 C;  1O28 A;  3GTJ K;  3NUH A;  1INN A;  4OIQ A;  3GIR A;  2NVX K;  4GTD A;  1JVI A;  3M3Y K;  1ZQ1 C;  1TWC A;  4C45 A;  2A68 A;  5C4X K;  3S1N K;  1TWF C;  1TWA C;  3FHZ A;  4KMU A;  2NVY C;  4P5A A;  3HOU K;  2FQT A;  3GTK C;  4KAT A;  1ZVU A;  5IYD C;  3K7A C;  4O2D A;  5FLM K;  3GTP K;  2R92 C;  1VGX A;  1I3Q K;  2JA7 A;  3HXA A;  4A3K C;  1HI9 A;  5C3E K;  1Y1V A;  1XXB A;  4X6A K;  4G0W A;  2E2I A;  1O24 A;  1PJ6 A;  1SFO K;  5IOR A;  1YCL A;  2KWA A;  4KDD A;  4GTF A;  5L46 A;  3S16 K;  5C4J C;  1TWC K;  1XZQ B;  1F7V A;  1TWH K;  5IOT A;  2D6F C;  5D4D A;  4A3J K;  5M5X K;  2B63 A;  3CQZ A;  2Y0S L;  4GZY A;  3PO2 C;  3HOX C;  5IP7 C;  1BS2 A;  2W7V A;  4LLG A;  3H3V L;  5TMC A;  2E2J K;  4C2M K;  3I4M K;  3HKZ D;  4OIN A;  2R93 K;  2JA7 K;  4J3N A;  4A93 C;  2O5J A;  3LAJ A;  3S1Q C;  3AD7 C;  1F7U A;  4FM9 A;  4OIO A;  3S15 K;  4A3L K;  3T01 A;  5M3F K;  4P5B A;  4QJV A;  4C3J C;  1DCP A;  4QIW D;  5IYC K;  3G4A A;  2WAQ L;  2GSN A;  3S17 C;  4A3E K;  2Y3P A;  4KN4 A;  3GTM C;  3BP3 A;  1O29 A;  1X31 C;  4KMD A;  4G7Z A;  4A3M C;  3CAG A;  2B63 K;  1G51 A;  3CQZ K;  2JA5 A;  1SMY A;  4C3H C;  3I4N K;  2JA8 K;  4A3I C;  1J6V A;  3L4J A;  3GTL C;  2R7Z K;  3A8K A;  5JFE A;  3TFH A;  5C44 K;  2CFA B;  4LK1 A;  2YU9 K;  5IP9 K;  3BUE A;  3S2D C;  3FKI C;  3Q3Q A;  3TFJ A;  3HOZ K;  2GAG C;  1J6W A;  4KAW X;  1WOO A;  1WCM C;  1BDF A;  4ZH4 A;  2RGR A;  4GT9 A;  2P5M A;  4GTL A;  4P9S A;  4A3D C;  4A3G C;  4LK0 A;  2WB1 L;  3RZD C;  3HOW K;  4XCH A;  4BY1 K;  4A3C K;  4Y52 K;  4KM8 A;  4A3B K;  3GTK A;  3ADA C;  5IYB C;  4AYB D;  4BBR K;  3S1R C;  2PMZ D;  2JA5 K;  2R92 A;  2FQO A;  1TWG K;  4G7H A;  3S1M K;  4C3I K;  5IOS A;  4Q4Z A;  3AH5 A;  5M3M K;  3OEP A;  1IL2 A;  1I50 C;  2V6T A;  1HQM A;  3GEH A;  3GTO K;  3S2H K;  4M1X A;  3VA7 A;  1YNN A;  4MEX A;  3PO3 K;  4G0V A;  1I6H C;  3GTJ C;  4YFX A;  5M5W K;  3SZY A;  3M3Y C;  1O2A A;  3GTQ A;  1J98 A;  1XZP A;  3AD8 C;  3S1N C;  5IYD K;  1PJ7 A;  3H0G K;  2R92 K;  2NVT K;  4KAS A;  2A6E A;  2ZUF A;  3HOU C;  1EH1 A;  3AD9 C;  4KM9 A;  1B4A A;  3S0X A;  5TJ3 A;  1RU0 A;  2WAQ D;  1UV7 A;  1DD5 A;  5FLM C;  4G7O A;  3GTG A;  4QJV B;  1I3Q C;  3TFI A;  3M4O K;  2XCR B;  3GDZ A;  4KMA A;  1IBA A;  3HOY K;  5C3E C;  4LOW A;  2V6S A;  4X6A C;  5EGE A;  1Y1W A;  2JA6 A;  2A6H A;  3GEE A;  3GTM A;  1SFO C;  2VUM C;  5CJ9 A;  1WOR A;  3S16 C;  3T00 A;  3A8I A;  1WSV A;  1R9T A;  1TWC C;  2PA8 D;  3GTQ K;  2A69 A;  1TWH C;  3GTL A;  4YG2 A;  4BXX K;  1Y1V K;  3ORE A;  2BE5 A;  1O26 A;  4KAR A;  2E2I K;  3G4C A;  4OIP A;  1EI6 A;  2E2J C;  4C2M C;  3GTG K;  3AQP A;  3I4M C;  2R93 C;  2JA7 C;  3EQL A;  4XLP A;  2O5I A;  4BY7 K;  4PAB A;  3SZZ A;  4Q5S A;  1Y1W K;  2JA6 K;  3S15 C;  4A3L C;  2XCO A;  3RZO K;  1AB4 A;  4ILD A;  4BKW A;  5IYC C;  1R9T K;  3OPF A;  4KN7 A;  2V6U A;  1K83 A;  1DCO A;  4MQ9 A;  1O27 A;  1PJ5 A;  4KB2 A;  4Y7N C;  4MEY A;  4A3F K;  2B63 C;  4YFN A;  4BBS C;  2RH6 A;  3CQZ C;  1EQR A;  1J6X A;  4DDQ A;  1VJE A;  3I4N C;  1ZYR A;  4G0U A;  2R7Z C;  1V5V A;  5C44 C;  1TWF A;  1B4B A;  1TWA A;  2ZUE A;  2YU9 C;  2NVY A;  3GTJ A;  3HOZ C;  1WQG A;  2E2H C;  1JQW A;  1YNJ A;  4GFQ A;  4FZB A;  3AQO A;  3HKZ L;  1USO A;  1XZP B;  3S1R K;  1L0W A;  2P8T A;  3N3Y A;  1K83 K;  3T02 A;  2NVQ K;  3HOW C;  2CW0 A;  3S14 K;  1O2F B;  4PAA A;  4GTB A;  3TTG A;  4BY1 C;  4A3B C;  3N0C A;  3HOV C;  4QIW L;  4BBR C;  4LR2 A;  3WOD A;  4YFK A;  1TWG C;  2Y0S D;  3V4G A;  4KMH A;  3S1M C;  4C3I C;  2EBB A;  1WOS A;  1TWF K;  3H3V D;  1TWA K;  2NVY K;  2NVX C;  1WSR A;  4LJZ A;  1SFO A;  2VUM A;  1XPP A;  3GTK K;  5C4X C;  4WJ4 A;  3K7A K;  2JH3 A;  3GTO C;  5CHP A;  4XSX A;  4BLB A;  3S2H C;  5HL8 A;  1WOP A;  1TWH A;  3LAP A;  3PO3 C;  2GSO A;  2PPB A;  4KB4 A;  1GE9 A;  3A8J A;  2GAH C;  4A3K K;  1ISE A;  3GTP C; 
#chains in the Genus database with same CATH homology
 1Y1V K;  2BE5 A;  4LK1 A;  2YU9 K;  3H0G C;  5IP9 K;  2E2I K;  3S2D C;  4OIP A;  3FKI C;  5C4J K;  3HOZ K;  1K83 C;  2NVQ C;  1I6H K;  3S14 C;  2NVT C;  3GTJ K;  2E2J C;  1WCM C;  4XSZ A;  3GTG K;  1BDF A;  3I4M C;  4OIQ A;  4ZH4 A;  2R93 C;  2JA7 C;  2NVX K;  4AYB L;  3EQL A;  4XLP A;  2O5I A;  2PMZ L;  3M3Y K;  4BY7 K;  4Q5S A;  2A68 A;  5C4X K;  1Y1W K;  2JA6 K;  2VUM K;  3S1N K;  4A3D C;  4A3G C;  4LK0 A;  2WB1 L;  3HOX K;  5IP7 K;  3RZD C;  3PO2 K;  1TWF C;  3M4O C;  1TWA C;  3S15 C;  4A3L C;  3HOW K;  4KMU A;  3RZO K;  3HOY C;  4BY1 K;  2NVY C;  4A3C K;  1I6V A;  4A3B K;  4Y52 K;  5IYB C;  3HOU K;  5IYC C;  4AYB D;  1R9T K;  4BBR K;  4A3J C;  4KN7 A;  3S1R C;  2PMZ D;  2JA5 K;  3GTK C;  4A93 K;  5IYD C;  4MQ9 A;  3K7A C;  3GTP K;  5FLM K;  1TWG K;  4G7H A;  4Y7N C;  2WB1 D;  4MEY A;  4A3F K;  4C3I K;  2R92 C;  3S1M K;  3S1Q K;  2B63 C;  3GTQ C;  4YFN A;  4BBS C;  1I3Q K;  3CQZ C;  4Q4Z A;  4A3K C;  4C3J K;  5TMF A;  5C3E K;  3I4N C;  1ZYR A;  5M3M K;  4BXX C;  2R7Z C;  4X6A K;  1I50 C;  4XLN A;  5C44 C;  1HQM A;  1Y1V C;  3S17 K;  1SFO K;  2YU9 C;  2E2I C;  3GTP C;  3GTO K;  3S16 K;  3GTM K;  3S2H K;  5C4J C;  4A3M K;  3HOZ C;  2E2H C;  1YNN A;  4MEX A;  3PO3 K;  1I6H C;  1TWC K;  3GTJ C;  1TWH K;  3GTG C;  1YNJ A;  4C3H K;  4YFX A;  5D4D A;  4A3I K;  5M5W K;  4A3E C;  3HKZ L;  4OIR A;  3GTL K;  4A3J K;  5M5X K;  3M3Y C;  4BY7 C;  3S1R K;  1Y1W C;  2JA6 C;  2Y0S L;  3S1N C;  3H0G K;  4GZY A;  3PO2 C;  5IYD K;  3HOX C;  5IP7 C;  3S2D K;  3FKI K;  1K83 K;  4Y7N K;  2NVQ K;  2R92 K;  3HOW C;  2CW0 A;  3S14 K;  4LLG A;  2NVT K;  3H3V L;  2JA8 C;  5TMC A;  2E2J K;  4BY1 C;  4C2M K;  1WCM K;  3RZO C;  2A6E A;  4A3B C;  4BBS K;  3HOV C;  3HOU C;  3I4M K;  3HKZ D;  4QIW L;  4BBR C;  1R9T C;  4OIN A;  2R93 K;  2JA7 K;  3WOD A;  5FJ8 K;  2WAQ D;  4A93 C;  3DXJ A;  4JK1 A;  4YFK A;  5IP9 C;  5FLM C;  1TWG C;  2Y0S D;  4G7O A;  3S1M C;  4A3F C;  3S1Q C;  2O5J A;  4A3D K;  4A3G K;  4QJV B;  1I3Q C;  3RZD K;  1TWF K;  4OIO A;  1TWA K;  3H3V D;  3S15 K;  3M4O K;  2PA8 L;  5M3F K;  2E2H K;  4A3L K;  4QJV A;  3HOY K;  5C3E C;  2NVY K;  4QIW D;  2NVX C;  5IYB K;  5IYC K;  4X6A C;  4LJZ A;  1XPP A;  2A6H A;  2WAQ L;  3GTK K;  1IW7 A;  3S17 C;  4A3E K;  5C4X C;  1SFO C;  4KN4 A;  2VUM C;  3K7A K;  3GTO C;  3S16 C;  4XSX A;  3GTM C;  3S2H C;  4NOI A;  4G7Z A;  4A3M C;  3PO3 C;  2PPB A;  2B63 K;  1TWC C;  2PA8 D;  4Y52 C;  3GTQ K;  2A69 A;  3CQZ K;  4A3C C;  1TWH C;  1SMY A;  4A3K K;  4YG2 A;  5M5Y K;  3I4N K;  2JA8 K;  4A3I C;  2JA5 C;  4BXX K;  3GTL C;  2R7Z K;  3HOV K;  1I50 K;  5C44 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...