1YCLA

Crystal structure of b. subtilis luxs in complex with a catalytic 2-ketone intermediate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGAQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of S-Ribosylhomocysteinase (LuxS) in Complex with a Catalytic 2-Ketone Intermediate.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords S-ribosylhomocysteinase
total genus 44
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1yclA00
1JQWA 1VGXA 5E68A 1VJEA 1J98A 1YCLA 2FQOA 1J6WA 2FQTA 1JOEA 4XCHA 1J6VA 1VH2A 1IE0A 1J6XA 1INNA 1JVIA
chains in the Genus database with same CATH superfamily
1TWHK 1ISEA 4BXXK 2Y0SD 4KATA 4BBSC 3L4KA 2E2IA 5FJ8K 3GTQK 4BLBA 2O5IA 2A6EA 3S15C 3RZDC 4Y52K 2R93C 3GTGC 2YU9K 1O25A 4G0WA 1ZVUA 3GTMA 5C4XC 4ILDA 4KB2A 4AYBD 5JFEA 2P8TA 4GZYA 1XXCA 3RZDK 2R92C 1F93A 3ERED 3S14C 2V6SA 1DCOA 1TWAA 1XZPA 2R7ZA 3M4OC 3ADAC 3T02A 3AD7C 1WQFA 4A3IC 2E2JC 3GEHA 5IOQA 2ZUFA 2R92A 3FOFA 3M4OK 3AQPA 1WSRA 3GTLK 4C3JC 1Y1VK 2Y0SL 3I4NK 3GTQA 4A3BK 1KQ4A 3GIRA 4GT9A 5C4XK 2WAQL 1DD5A 3GTGK 4XCHA 1XPPA 5EGHA 2Y3PA 4Y52C 3CQZK 3K7AC 4YG2A 2JA7K 2VUMA 1WIHA 4G7HA 1WOOA 4BXXC 3AD8C 4FM9A 4OIOA 1HI9A 1Y1VC 2P5MA 5IYDC 1TWCC 4C3JK 1EQRA 3BP8C 4PABA 1JOEA 1RU0A 4LOWA 1PJ7A 5IYBK 3I4MK 4XSXA 1BGWA 3GTJK 1HQMA 3HOZK 2JA8C 1X31C 3FHZA 4BY1K 1TWGA 3PO2C 3H3VL 1Y1VA 5JVOA 3GTKC 1IE0A 1K83C 1WQHA 4YFKA 3EQLA 3T00A 3HOYC 2WB1L 2R92K 3GTPK 4KMHA 2JA6C 1I6HC 3GTOK 1I50C 3GTPA 4G7ZA 2XCQA 2NVQK 2R7ZK 2CFAB 3GTMC 4A3GK 1R9TA 5CHPA 1EH1A 4QJVA 2E2HA 1O24A 3IPJA 3S17C 1Y1WC 1EFWA 4LK0A 4A3JK 5M3MK 3WODA 4MEXA 1YNJA 2NVTK 1IS1A 3SZYA 2NVYC 4G0UA 4KB4A 2E2IC 5M3FK 5C4JK 4GTLA 2XCOA 1WORA 3V4GA 3H3VD 1WQGA 4LJZA 3A8JA 5IP7C 3OPFA 1G51A 5M5WK 4X6AC 3GTLA 4BLAA 3HOWK 3G4CA 1SFOK 2NVXK 3TFHA 4G0VA 3S16C 1TWFC 2GSUA 2NVQC 4KN7A 4A3EC 4A93K 3HKZL 3RZOC 4C3IK 4MQ9A 1I6HK 2JA5A 3FKIK 4BBRK 1WOPA 3QX3A 1SFOC 4A3DK 1ZBSA 1TWFK 4A3LK 5C3EK 2KWAA 3JSTA 5C4JC 1L0WA 4XLPA 3GTJC 4A3JC 5TMCA 3SZZA 3LAPA 2FQOA 3BP3A 1TWHA 3HXAA 4P5AA 3A8KA 4JK1A 1PJ6A 1XXAA 4A3GC 3N0BA 3S17K 2E2HC 1TWFA 3OREA 3M3YC 4GTFA 3A8IA 3N0CA 2GSNA 2RH6A 4QJVB 2A68A 4MEYA 4C3IC 2B63K 3HOXC 5TJ3A 4A93C 4GTAA 4DDQA 2JA6K 2O5JA 3DXJA 1F7VA 4AH6A 4BY1C 2NVXC 3GTKK 3MMLB 5IYBC 3PO2K 2ZFZA 1VRQC 2GSOA 3H0GC 4YFXA 4BKWA 2E2IK 1O29A 3S2DC 4WJ3M 5EGEA 3S2HC 4OIRA 2NVTC 2JH3A 1TWAK 3S1MK 1IW7A 1AB4A 1IBAA 4QIWL 3HOVK 4KAWX 3HOUC 3AH5A 1VLOA 3GTMK 1O2BA 5TMFA 5IYCK 4LQYA 4A3CK 2BE5A 1I3QA 1USMA 1WCMK 2EBBA 4A3BC 4BY7C 2CFAA 3HOUK 3HOYK 1IQ0A 3S1QK 1SFOA 2R93A 1TWHC 2PMZD 3S1MC 4C3HC 3TTGA 4J3NA 1O2AA 1YX2A 3GEEA 3S0XA 1ZYRA 1VH2A 1WCMA 1TWGK 4GTCA 3S1NK 5IOTA 3GTLC 2JA6A 4M1XA 1YCLA 4FZBA 3H0GK 3I4MC 3GSIA 1I6VA 4KM9A 3S1NC 1J6VA 3GTOA 2PA8L 4OIQA 4QIWD 4GTDA 3S14K 2A6HA 1F9NA 3S1QC 1INNA 5FLMC 2JA7C 5M5XK 3CQZC 3K7AK 2YU9C 1DCHA 5IYCC 4Q5SA 3N3YA 4GTEA 4Q4ZA 3GTQC 4BBSK 5FLMK 2WAQD 2R93K 2YU9A 1UV7A 1C0AA 2V6UA 4XLNA 3S2DK 1I3QK 4KN4A 1USOA 3S1RC 1GE9A 2D6FC 2JA5K 1BDFA 3PO3K 2GAGC 3GEIA 1JVIA 5L46A 4A3LC 4C3HK 3LAJA 4G7OA 3TFJA 4KMUA 4LK1A 1R9TC 3HOXK 4KDDA 1WCMC 4BY7K 4RMFA 3M3YK 4LLGA 2RGRA 2W7VA 1YNNA 1B4AA 3Q3QA 1XZPB 4A3FK 2B63C 1ZQ1C 4A3EK 4A3CC 4KARA 4C2MK 3GTKA 3G4AA 3AD9C 3S15K 3HOVC 1B4BA 4WILA 1O28A 1JQWA 1VGXA 1WOSA 1TWAC 2B63A 1BJTA 1J6XA 3T01A 4Y7NC 5C44C 2XCRB 3S2HK 2NVYK 2A69A 1ZXOA 3FKIA 5C44K 1VJEA 2V6TA 2VUMK 3NUHA 4P5BA 4AYBL 4OINA 1O2FB 3GTGA 4ZH4A 1XZQA 4KMDA 3GDZA 4GFQA 5C3EC 3BUEA 4C2MC 4A3MC 3FKIC 4KC6A 4BBRC 1I50K 3GTOC 4KASA 3GTJA 5IP9C 5CJ9A 3S16K 5IP9K 2CW0A 3RZOK 1EI6A 2E2HK 5IP7K 1IL2A 4A3MK 3L4JA 5IORA 4OIPA 4A3KC 1WSVA 1XXBA 3LPXA 1F7UA 2JA8K 3VA7A 1V5VA 3HOWC 2JA5C 3PO3C 3S1RK 3H0GA 1PJ5A 2GAHC 5HL8A 1TWCA 2PHCB 1DCPA 1I3QC 4O2DA 1TWCK 4Y7NK 4NOIA 1SMYA 1Y1WK 4A3KK 1O26A 4LR2A 2R7ZC 5IOSA 4C45A 4A3DC 4A3FC 1J6WA 1K83A 2PPBA 4WJ4A 3FOEA 3OEPA 1Y1WA 5D4DA 4XSZA 2PMZL 1K83K 2FQTA 5M5YK 2PA8D 3HKZD 1BS2A 4PAAA 1I50A 3GTPC 3CAGA 4YFNA 2ZUEA 3I4NC 3HOZC 3TFIA 1R9TK 4P9SA 4X6AK 1O27A 2WB1D 2JA7A 3CQZA 4KMAA 1EK8A 2VUMC 5E68A 1TWGC 1J98A 1XZQB 4A3IK 2E2JK 5IYDK 4KM8A 3AQOA 2NVXA 2NVYA 4GTBA
chains in the Genus database with same CATH topology
1JQWA 1VGXA 5E68A 1VJEA 1J98A 1YCLA 2FQOA 1J6WA 2FQTA 1JOEA 4XCHA 1J6VA 1VH2A 1IE0A 1J6XA 1INNA 1JVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  1VGX A;  5E68 A;  1VJE A;  1J98 A;  1YCL A;  2FQO A;  1J6W A;  2FQT A;  1JOE A;  4XCH A;  1J6V A;  1VH2 A;  1IE0 A;  1J6X A;  1INN A;  1JVI A; 
#chains in the Genus database with same CATH topology
 1TWH K;  1ISE A;  4BXX K;  2Y0S D;  4KAT A;  4BBS C;  3L4K A;  2E2I A;  5FJ8 K;  3GTQ K;  4BLB A;  2O5I A;  2A6E A;  3S15 C;  3RZD C;  4Y52 K;  2R93 C;  3GTG C;  2YU9 K;  1O25 A;  4G0W A;  1ZVU A;  3GTM A;  5C4X C;  4ILD A;  4KB2 A;  4AYB D;  5JFE A;  2P8T A;  4GZY A;  1XXC A;  3RZD K;  2R92 C;  1F93 A;  3ERE D;  3S14 C;  2V6S A;  1DCO A;  1TWA A;  1XZP A;  2R7Z A;  3M4O C;  3ADA C;  3T02 A;  3AD7 C;  1WQF A;  4A3I C;  2E2J C;  3GEH A;  5IOQ A;  2ZUF A;  2R92 A;  3FOF A;  3M4O K;  3AQP A;  1WSR A;  3GTL K;  4C3J C;  1Y1V K;  2Y0S L;  3I4N K;  3GTQ A;  4A3B K;  1KQ4 A;  3GIR A;  4GT9 A;  5C4X K;  2WAQ L;  1DD5 A;  3GTG K;  4XCH A;  1XPP A;  5EGH A;  2Y3P A;  4Y52 C;  3CQZ K;  3K7A C;  4YG2 A;  2JA7 K;  2VUM A;  1WIH A;  4G7H A;  1WOO A;  4BXX C;  3AD8 C;  4FM9 A;  4OIO A;  1HI9 A;  1Y1V C;  2P5M A;  5IYD C;  1TWC C;  4C3J K;  1EQR A;  3BP8 C;  4PAB A;  1JOE A;  1RU0 A;  4LOW A;  1PJ7 A;  5IYB K;  3I4M K;  4XSX A;  1BGW A;  3GTJ K;  1HQM A;  3HOZ K;  2JA8 C;  1X31 C;  3FHZ A;  4BY1 K;  1TWG A;  3PO2 C;  3H3V L;  1Y1V A;  5JVO A;  3GTK C;  1IE0 A;  1K83 C;  1WQH A;  4YFK A;  3EQL A;  3T00 A;  3HOY C;  2WB1 L;  2R92 K;  3GTP K;  4KMH A;  2JA6 C;  1I6H C;  3GTO K;  1I50 C;  3GTP A;  4G7Z A;  2XCQ A;  2NVQ K;  2R7Z K;  2CFA B;  3GTM C;  4A3G K;  1R9T A;  5CHP A;  1EH1 A;  4QJV A;  2E2H A;  1O24 A;  3IPJ A;  3S17 C;  1Y1W C;  1EFW A;  4LK0 A;  4A3J K;  5M3M K;  3WOD A;  4MEX A;  1YNJ A;  2NVT K;  1IS1 A;  3SZY A;  2NVY C;  4G0U A;  4KB4 A;  2E2I C;  5M3F K;  5C4J K;  4GTL A;  2XCO A;  1WOR A;  3V4G A;  3H3V D;  1WQG A;  4LJZ A;  3A8J A;  5IP7 C;  3OPF A;  1G51 A;  5M5W K;  4X6A C;  3GTL A;  4BLA A;  3HOW K;  3G4C A;  1SFO K;  2NVX K;  3TFH A;  4G0V A;  3S16 C;  1TWF C;  2GSU A;  2NVQ C;  4KN7 A;  4A3E C;  4A93 K;  3HKZ L;  3RZO C;  4C3I K;  4MQ9 A;  1I6H K;  2JA5 A;  3FKI K;  4BBR K;  1WOP A;  3QX3 A;  1SFO C;  4A3D K;  1ZBS A;  1TWF K;  4A3L K;  5C3E K;  2KWA A;  3JST A;  5C4J C;  1L0W A;  4XLP A;  3GTJ C;  4A3J C;  5TMC A;  3SZZ A;  3LAP A;  2FQO A;  3BP3 A;  1TWH A;  3HXA A;  4P5A A;  3A8K A;  4JK1 A;  1PJ6 A;  1XXA A;  4A3G C;  3N0B A;  3S17 K;  2E2H C;  1TWF A;  3ORE A;  3M3Y C;  4GTF A;  3A8I A;  3N0C A;  2GSN A;  2RH6 A;  4QJV B;  2A68 A;  4MEY A;  4C3I C;  2B63 K;  3HOX C;  5TJ3 A;  4A93 C;  4GTA A;  4DDQ A;  2JA6 K;  2O5J A;  3DXJ A;  1F7V A;  4AH6 A;  4BY1 C;  2NVX C;  3GTK K;  3MML B;  5IYB C;  3PO2 K;  2ZFZ A;  1VRQ C;  2GSO A;  3H0G C;  4YFX A;  4BKW A;  2E2I K;  1O29 A;  3S2D C;  4WJ3 M;  5EGE A;  3S2H C;  4OIR A;  2NVT C;  2JH3 A;  1TWA K;  3S1M K;  1IW7 A;  1AB4 A;  1IBA A;  4QIW L;  3HOV K;  4KAW X;  3HOU C;  3AH5 A;  1VLO A;  3GTM K;  1O2B A;  5TMF A;  5IYC K;  4LQY A;  4A3C K;  2BE5 A;  1I3Q A;  1USM A;  1WCM K;  2EBB A;  4A3B C;  4BY7 C;  2CFA A;  3HOU K;  3HOY K;  1IQ0 A;  3S1Q K;  1SFO A;  2R93 A;  1TWH C;  2PMZ D;  3S1M C;  4C3H C;  3TTG A;  4J3N A;  1O2A A;  1YX2 A;  3GEE A;  3S0X A;  1ZYR A;  1VH2 A;  1WCM A;  1TWG K;  4GTC A;  3S1N K;  5IOT A;  3GTL C;  2JA6 A;  4M1X A;  1YCL A;  4FZB A;  3H0G K;  3I4M C;  3GSI A;  1I6V A;  4KM9 A;  3S1N C;  1J6V A;  3GTO A;  2PA8 L;  4OIQ A;  4QIW D;  4GTD A;  3S14 K;  2A6H A;  1F9N A;  3S1Q C;  1INN A;  5FLM C;  2JA7 C;  5M5X K;  3CQZ C;  3K7A K;  2YU9 C;  1DCH A;  5IYC C;  4Q5S A;  3N3Y A;  4GTE A;  4Q4Z A;  3GTQ C;  4BBS K;  5FLM K;  2WAQ D;  2R93 K;  2YU9 A;  1UV7 A;  1C0A A;  2V6U A;  4XLN A;  3S2D K;  1I3Q K;  4KN4 A;  1USO A;  3S1R C;  1GE9 A;  2D6F C;  2JA5 K;  1BDF A;  3PO3 K;  2GAG C;  3GEI A;  1JVI A;  5L46 A;  4A3L C;  4C3H K;  3LAJ A;  4G7O A;  3TFJ A;  4KMU A;  4LK1 A;  1R9T C;  3HOX K;  4KDD A;  1WCM C;  4BY7 K;  4RMF A;  3M3Y K;  4LLG A;  2RGR A;  2W7V A;  1YNN A;  1B4A A;  3Q3Q A;  1XZP B;  4A3F K;  2B63 C;  1ZQ1 C;  4A3E K;  4A3C C;  4KAR A;  4C2M K;  3GTK A;  3G4A A;  3AD9 C;  3S15 K;  3HOV C;  1B4B A;  4WIL A;  1O28 A;  1JQW A;  1VGX A;  1WOS A;  1TWA C;  2B63 A;  1BJT A;  1J6X A;  3T01 A;  4Y7N C;  5C44 C;  2XCR B;  3S2H K;  2NVY K;  2A69 A;  1ZXO A;  3FKI A;  5C44 K;  1VJE A;  2V6T A;  2VUM K;  3NUH A;  4P5B A;  4AYB L;  4OIN A;  1O2F B;  3GTG A;  4ZH4 A;  1XZQ A;  4KMD A;  3GDZ A;  4GFQ A;  5C3E C;  3BUE A;  4C2M C;  4A3M C;  3FKI C;  4KC6 A;  4BBR C;  1I50 K;  3GTO C;  4KAS A;  3GTJ A;  5IP9 C;  5CJ9 A;  3S16 K;  5IP9 K;  2CW0 A;  3RZO K;  1EI6 A;  2E2H K;  5IP7 K;  1IL2 A;  4A3M K;  3L4J A;  5IOR A;  4OIP A;  4A3K C;  1WSV A;  1XXB A;  3LPX A;  1F7U A;  2JA8 K;  3VA7 A;  1V5V A;  3HOW C;  2JA5 C;  3PO3 C;  3S1R K;  3H0G A;  1PJ5 A;  2GAH C;  5HL8 A;  1TWC A;  2PHC B;  1DCP A;  1I3Q C;  4O2D A;  1TWC K;  4Y7N K;  4NOI A;  1SMY A;  1Y1W K;  4A3K K;  1O26 A;  4LR2 A;  2R7Z C;  5IOS A;  4C45 A;  4A3D C;  4A3F C;  1J6W A;  1K83 A;  2PPB A;  4WJ4 A;  3FOE A;  3OEP A;  1Y1W A;  5D4D A;  4XSZ A;  2PMZ L;  1K83 K;  2FQT A;  5M5Y K;  2PA8 D;  3HKZ D;  1BS2 A;  4PAA A;  1I50 A;  3GTP C;  3CAG A;  4YFN A;  2ZUE A;  3I4N C;  3HOZ C;  3TFI A;  1R9T K;  4P9S A;  4X6A K;  1O27 A;  2WB1 D;  2JA7 A;  3CQZ A;  4KMA A;  1EK8 A;  2VUM C;  5E68 A;  1TWG C;  1J98 A;  1XZQ B;  4A3I K;  2E2J K;  5IYD K;  4KM8 A;  3AQO A;  2NVX A;  2NVY A;  4GTB A; 
#chains in the Genus database with same CATH homology
 1JQW A;  1VGX A;  5E68 A;  1VJE A;  1J98 A;  1YCL A;  2FQO A;  1J6W A;  2FQT A;  1JOE A;  4XCH A;  1J6V A;  1VH2 A;  1IE0 A;  1J6X A;  1INN A;  1JVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...