1YCLA

Crystal structure of b. subtilis luxs in complex with a catalytic 2-ketone intermediate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGAQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords S-ribosylhomocysteinase
publication title Crystal Structure of S-Ribosylhomocysteinase (LuxS) in Complex with a Catalytic 2-Ketone Intermediate.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1yclA00
1VJEA 2FQTA 1YCLA 1INNA 4XCHA 2FQOA 1VH2A 1J6VA 1J6WA 1J98A 1JOEA 1JQWA 5E68A 1J6XA 1JVIA 1IE0A 1VGXA
chains in the Genus database with same CATH superfamily
1VJEA 1EH1A 4LLGA 4C3JK 1TWFK 3GTJC 1VLOA 4OINA 2NVXA 5IP7K 3K7AC 2NVXK 4A3JK 1USMA 5D4DA 3LPXA 3HOZC 1DCPA 3OPFA 1I50A 2PA8D 5JVOA 1I50K 3GTOA 3HOUC 1EFWA 4GZYA 3GTOK 1WQFA 3H3VL 2R93K 4A3MK 3S2DK 3M4OK 2CW0A 3HOYC 4QJVB 5M5YK 4KM9A 2CFAB 4BBSK 2R93C 3HOXK 5IORA 1I6VA 1TWFC 4XLNA 1SFOA 1WOPA 3T02A 2RH6A 4X6AC 5C44K 5IP9C 2NVXC 1HQMA 1O2BA 1ZYRA 2PMZL 5M5XK 4WILA 3S17K 4Q5SA 3CAGA 3S1NK 1I50C 5HL8A 4BXXK 1WIHA 4FZBA 5IOQA 1R9TK 3GTOC 5IOSA 1WOOA 1ZXOA 3IPJA 3S2DC 4M1XA 4G7HA 3M4OC 2EBBA 4A3LK 1WOSA 4WJ3M 3TTGA 1Y1WK 4BBSC 3G4AA 3HOXC 3OEPA 1O29A 2A68A 1SFOC 4KM8A 2WAQL 5C44C 2JH3A 3NUHA 3HXAA 2RGRA 4Q4ZA 4QIWL 4A3FC 1I3QA 3GTGK 4XCHA 1I3QK 3FHZA 3S1QK 3S17C 3GTLA 4Y52K 1O28A 3S1NC 1O24A 3GTLK 2XCQA 4P5BA 4A3BK 4MQ9A 4BXXC 1YNJA 3MMLB 2D6FC 2PPBA 3EQLA 5EGHA 1WORA 1BJTA 1WSRA 5C4XK 1WCMK 2A6HA 1J98A 4C3HK 4A3LC 3S1MK 2VUMA 2VUMK 3BP8C 3WODA 2ZFZA 4KC6A 3GTJK 2E2IK 3Q3QA 4YFNA 1TWGK 1TWCA 5L46A 1TWCK 3TFHA 1TWFA 1I3QC 3S1QC 4Y52C 2JA8K 2PHCB 3VA7A 3GTLC 3HOUK 1PJ7A 1JOEA 2E2HA 5C4XC 4GFQA 1TWHA 2E2HK 4C3HC 3T01A 1TWHK 4KAWX 3FOFA 3S1MC 4XLPA 2VUMC 1BGWA 4AYBL 2NVYA 5TJ3A 4X6AK 4MEYA 2NVYK 2E2IC 1Y1VA 1XXAA 3T00A 1TWGC 5IP9K 3FOEA 4BY1K 1Y1VK 3A8KA 1EQRA 3HKZD 5M3FK 1TWCC 3GTQA 1INNA 4KARA 3GTQK 4KB2A 3PO2K 1F7VA 2GAHC 1IW7A 4XSZA 2JA8C 2O5JA 1WQHA 1ZVUA 2Y0SL 2GSUA 3A8JA 3SZZA 3ERED 4KDDA 2E2JC 2GAGC 4JK1A 2E2HC 1TWHC 1AB4A 4KB4A 4DDQA 3L4JA 2ZUEA 1YNNA 1SFOK 1YCLA 3FKIA 2NVYC 4BY7K 1XZPA 1VH2A 3FKIK 4BY1C 1Y1VC 5C4JK 3V4GA 4A3FK 1VGXA 3AD7C 3S1RK 1XPPA 3LAJA 3GTQC 1V5VA 3PO2C 4A3DK 4C3IK 5CHPA 3QX3A 3RZOK 5IYCC 4A3IC 1X31C 5JFEA 2V6TA 1RU0A 3A8IA 1IL2A 3S2HK 1G51A 4C45A 4LK1A 1IS1A 4GTDA 4LOWA 3H3VD 4BY7C 1I6HK 3FKIC 5M3MK 5C4JC 2WB1L 3BP3A 3S1RC 4A3GK 1J6WA 4A3DC 5IYBK 4C3IC 5E68A 3RZOC 1L0WA 3L4KA 1PJ6A 2ZUFA 1TWAA 2P5MA 4KMDA 4YFKA 2PMZD 1TWAK 1XZQA 4MEXA 3S2HC 2P8TA 2R7ZA 4J3NA 3AD8C 2A6EA 2R7ZK 1B4AA 1O25A 3DXJA 3RZDK 1O26A 1DCOA 1F93A 1I6HC 4GTEA 3I4MK 2YU9A 2NVQK 2YU9K 4A3GC 3HKZL 3GEEA 4A3KK 2R92A 5IYBC 3I4NK 2R92K 3HOWC 2JA5A 5IOTA 2WAQD 2PA8L 3TFJA 2E2JK 4WJ4A 4O2DA 2GSNA 3N0CA 3S16K 1TWAC 2B63A 1GE9A 2B63K 1ISEA 4BBRK 1DD5A 2R7ZC 2XCRB 4Y7NK 3RZDC 1C0AA 3I4MC 4YFXA 1F7UA 2NVQC 4KMUA 2YU9C 4BLAA 4GTFA 3SZYA 5FJ8K 4A3KC 3M3YK 3HOVK 3I4NC 5IYCK 4A3IK 2R92C 4OIQA 5EGEA 3ADAC 5IYDC 2JA5C 4LR2A 1XXCA 2FQOA 2KWAA 2O5IA 3CQZA 1HI9A 3S16C 3CQZK 4G0WA 2B63C 1F9NA 1XZPB 4BBRC 1EI6A 4BLBA 4A3EK 4AH6A 4Y7NC 1O27A 2BE5A 4LQYA 4NOIA 3N3YA 1SMYA 4G0VA 5TMFA 4G7OA 4FM9A 1O2AA 1J6VA 3S15K 3GTPA 4PABA 4GTLA 1K83A 5C3EK 5M5WK 3GTPK 3AQPA 1K83K 4AYBD 3M3YC 3PO3K 2JA6A 3HOVC 2JA6K 4C3JC 2XCOA 4QJVA 3GIRA 1USOA 1XXBA 2CFAA 1J6XA 5IP7C 3CQZC 3GTMA 4A3JC 3GTMK 1DCHA 3GSIA 2Y0SD 5FLMK 4A3EC 5TMCA 1UV7A 1KQ4A 1R9TA 4OIRA 2NVTK 3H0GA 4LK0A 4RMFA 3H0GK 4A3CK 3S15C 4A3MC 3AD9C 5C3EC 3GTPC 1K83C 2JA7A 3PO3C 1O2FB 1EK8A 2Y3PA 4GT9A 4BKWA 1Y1WA 4P9SA 1JVIA 2JA6C 1IQ0A 2JA7K 3HOWK 1XZQB 1YX2A 2V6SA 3AH5A 3S0XA 4A93K 3GTGA 3S14K 3GEHA 3GTMC 4ZH4A 4GTBA 1VRQC 1JQWA 4C2MK 5FLMC 1BS2A 4KATA 1ZBSA 3BUEA 3GDZA 4GTCA 2NVTC 3GTKA 1IBAA 1R9TC 3GTKK 3H0GC 4A3CC 1ZQ1C 1WCMA 2V6UA 2FQTA 3AQOA 1WSVA 4G0UA 4KMHA 2JA7C 1Y1WC 4OIPA 4G7ZA 3JSTA 5IYDK 2JA5K 3GTJA 2E2IA 1BDFA 4QIWD 1TWGA 2WB1D 1IE0A 4A93C 3K7AK 3TFIA 3S14C 1WQGA 4KN4A 3GTGC 1PJ5A 4GTAA 3HOZK 3N0BA 3G4CA 5CJ9A 2W7VA 4P5AA 4XSXA 4YG2A 4C2MC 2A69A 3OREA 3GEIA 4A3BC 2GSOA 3LAPA 3GTKC 4PAAA 4LJZA 4KN7A 1B4BA 1WCMC 3HOYK 4KMAA 2R93A 4ILDA 4OIOA 4KASA
chains in the Genus database with same CATH topology
1VJEA 2FQTA 1YCLA 1INNA 4XCHA 2FQOA 1VH2A 1J6VA 1J6WA 1J98A 1JOEA 1JQWA 5E68A 1J6XA 1JVIA 1IE0A 1VGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJE A;  2FQT A;  1YCL A;  1INN A;  4XCH A;  2FQO A;  1VH2 A;  1J6V A;  1J6W A;  1J98 A;  1JOE A;  1JQW A;  5E68 A;  1J6X A;  1JVI A;  1IE0 A;  1VGX A; 
#chains in the Genus database with same CATH topology
 1VJE A;  1EH1 A;  4LLG A;  4C3J K;  1TWF K;  3GTJ C;  1VLO A;  4OIN A;  2NVX A;  5IP7 K;  3K7A C;  2NVX K;  4A3J K;  1USM A;  5D4D A;  3LPX A;  3HOZ C;  1DCP A;  3OPF A;  1I50 A;  2PA8 D;  5JVO A;  1I50 K;  3GTO A;  3HOU C;  1EFW A;  4GZY A;  3GTO K;  1WQF A;  3H3V L;  2R93 K;  4A3M K;  3S2D K;  3M4O K;  2CW0 A;  3HOY C;  4QJV B;  5M5Y K;  4KM9 A;  2CFA B;  4BBS K;  2R93 C;  3HOX K;  5IOR A;  1I6V A;  1TWF C;  4XLN A;  1SFO A;  1WOP A;  3T02 A;  2RH6 A;  4X6A C;  5C44 K;  5IP9 C;  2NVX C;  1HQM A;  1O2B A;  1ZYR A;  2PMZ L;  5M5X K;  4WIL A;  3S17 K;  4Q5S A;  3CAG A;  3S1N K;  1I50 C;  5HL8 A;  4BXX K;  1WIH A;  4FZB A;  5IOQ A;  1R9T K;  3GTO C;  5IOS A;  1WOO A;  1ZXO A;  3IPJ A;  3S2D C;  4M1X A;  4G7H A;  3M4O C;  2EBB A;  4A3L K;  1WOS A;  4WJ3 M;  3TTG A;  1Y1W K;  4BBS C;  3G4A A;  3HOX C;  3OEP A;  1O29 A;  2A68 A;  1SFO C;  4KM8 A;  2WAQ L;  5C44 C;  2JH3 A;  3NUH A;  3HXA A;  2RGR A;  4Q4Z A;  4QIW L;  4A3F C;  1I3Q A;  3GTG K;  4XCH A;  1I3Q K;  3FHZ A;  3S1Q K;  3S17 C;  3GTL A;  4Y52 K;  1O28 A;  3S1N C;  1O24 A;  3GTL K;  2XCQ A;  4P5B A;  4A3B K;  4MQ9 A;  4BXX C;  1YNJ A;  3MML B;  2D6F C;  2PPB A;  3EQL A;  5EGH A;  1WOR A;  1BJT A;  1WSR A;  5C4X K;  1WCM K;  2A6H A;  1J98 A;  4C3H K;  4A3L C;  3S1M K;  2VUM A;  2VUM K;  3BP8 C;  3WOD A;  2ZFZ A;  4KC6 A;  3GTJ K;  2E2I K;  3Q3Q A;  4YFN A;  1TWG K;  1TWC A;  5L46 A;  1TWC K;  3TFH A;  1TWF A;  1I3Q C;  3S1Q C;  4Y52 C;  2JA8 K;  2PHC B;  3VA7 A;  3GTL C;  3HOU K;  1PJ7 A;  1JOE A;  2E2H A;  5C4X C;  4GFQ A;  1TWH A;  2E2H K;  4C3H C;  3T01 A;  1TWH K;  4KAW X;  3FOF A;  3S1M C;  4XLP A;  2VUM C;  1BGW A;  4AYB L;  2NVY A;  5TJ3 A;  4X6A K;  4MEY A;  2NVY K;  2E2I C;  1Y1V A;  1XXA A;  3T00 A;  1TWG C;  5IP9 K;  3FOE A;  4BY1 K;  1Y1V K;  3A8K A;  1EQR A;  3HKZ D;  5M3F K;  1TWC C;  3GTQ A;  1INN A;  4KAR A;  3GTQ K;  4KB2 A;  3PO2 K;  1F7V A;  2GAH C;  1IW7 A;  4XSZ A;  2JA8 C;  2O5J A;  1WQH A;  1ZVU A;  2Y0S L;  2GSU A;  3A8J A;  3SZZ A;  3ERE D;  4KDD A;  2E2J C;  2GAG C;  4JK1 A;  2E2H C;  1TWH C;  1AB4 A;  4KB4 A;  4DDQ A;  3L4J A;  2ZUE A;  1YNN A;  1SFO K;  1YCL A;  3FKI A;  2NVY C;  4BY7 K;  1XZP A;  1VH2 A;  3FKI K;  4BY1 C;  1Y1V C;  5C4J K;  3V4G A;  4A3F K;  1VGX A;  3AD7 C;  3S1R K;  1XPP A;  3LAJ A;  3GTQ C;  1V5V A;  3PO2 C;  4A3D K;  4C3I K;  5CHP A;  3QX3 A;  3RZO K;  5IYC C;  4A3I C;  1X31 C;  5JFE A;  2V6T A;  1RU0 A;  3A8I A;  1IL2 A;  3S2H K;  1G51 A;  4C45 A;  4LK1 A;  1IS1 A;  4GTD A;  4LOW A;  3H3V D;  4BY7 C;  1I6H K;  3FKI C;  5M3M K;  5C4J C;  2WB1 L;  3BP3 A;  3S1R C;  4A3G K;  1J6W A;  4A3D C;  5IYB K;  4C3I C;  5E68 A;  3RZO C;  1L0W A;  3L4K A;  1PJ6 A;  2ZUF A;  1TWA A;  2P5M A;  4KMD A;  4YFK A;  2PMZ D;  1TWA K;  1XZQ A;  4MEX A;  3S2H C;  2P8T A;  2R7Z A;  4J3N A;  3AD8 C;  2A6E A;  2R7Z K;  1B4A A;  1O25 A;  3DXJ A;  3RZD K;  1O26 A;  1DCO A;  1F93 A;  1I6H C;  4GTE A;  3I4M K;  2YU9 A;  2NVQ K;  2YU9 K;  4A3G C;  3HKZ L;  3GEE A;  4A3K K;  2R92 A;  5IYB C;  3I4N K;  2R92 K;  3HOW C;  2JA5 A;  5IOT A;  2WAQ D;  2PA8 L;  3TFJ A;  2E2J K;  4WJ4 A;  4O2D A;  2GSN A;  3N0C A;  3S16 K;  1TWA C;  2B63 A;  1GE9 A;  2B63 K;  1ISE A;  4BBR K;  1DD5 A;  2R7Z C;  2XCR B;  4Y7N K;  3RZD C;  1C0A A;  3I4M C;  4YFX A;  1F7U A;  2NVQ C;  4KMU A;  2YU9 C;  4BLA A;  4GTF A;  3SZY A;  5FJ8 K;  4A3K C;  3M3Y K;  3HOV K;  3I4N C;  5IYC K;  4A3I K;  2R92 C;  4OIQ A;  5EGE A;  3ADA C;  5IYD C;  2JA5 C;  4LR2 A;  1XXC A;  2FQO A;  2KWA A;  2O5I A;  3CQZ A;  1HI9 A;  3S16 C;  3CQZ K;  4G0W A;  2B63 C;  1F9N A;  1XZP B;  4BBR C;  1EI6 A;  4BLB A;  4A3E K;  4AH6 A;  4Y7N C;  1O27 A;  2BE5 A;  4LQY A;  4NOI A;  3N3Y A;  1SMY A;  4G0V A;  5TMF A;  4G7O A;  4FM9 A;  1O2A A;  1J6V A;  3S15 K;  3GTP A;  4PAB A;  4GTL A;  1K83 A;  5C3E K;  5M5W K;  3GTP K;  3AQP A;  1K83 K;  4AYB D;  3M3Y C;  3PO3 K;  2JA6 A;  3HOV C;  2JA6 K;  4C3J C;  2XCO A;  4QJV A;  3GIR A;  1USO A;  1XXB A;  2CFA A;  1J6X A;  5IP7 C;  3CQZ C;  3GTM A;  4A3J C;  3GTM K;  1DCH A;  3GSI A;  2Y0S D;  5FLM K;  4A3E C;  5TMC A;  1UV7 A;  1KQ4 A;  1R9T A;  4OIR A;  2NVT K;  3H0G A;  4LK0 A;  4RMF A;  3H0G K;  4A3C K;  3S15 C;  4A3M C;  3AD9 C;  5C3E C;  3GTP C;  1K83 C;  2JA7 A;  3PO3 C;  1O2F B;  1EK8 A;  2Y3P A;  4GT9 A;  4BKW A;  1Y1W A;  4P9S A;  1JVI A;  2JA6 C;  1IQ0 A;  2JA7 K;  3HOW K;  1XZQ B;  1YX2 A;  2V6S A;  3AH5 A;  3S0X A;  4A93 K;  3GTG A;  3S14 K;  3GEH A;  3GTM C;  4ZH4 A;  4GTB A;  1VRQ C;  1JQW A;  4C2M K;  5FLM C;  1BS2 A;  4KAT A;  1ZBS A;  3BUE A;  3GDZ A;  4GTC A;  2NVT C;  3GTK A;  1IBA A;  1R9T C;  3GTK K;  3H0G C;  4A3C C;  1ZQ1 C;  1WCM A;  2V6U A;  2FQT A;  3AQO A;  1WSV A;  4G0U A;  4KMH A;  2JA7 C;  1Y1W C;  4OIP A;  4G7Z A;  3JST A;  5IYD K;  2JA5 K;  3GTJ A;  2E2I A;  1BDF A;  4QIW D;  1TWG A;  2WB1 D;  1IE0 A;  4A93 C;  3K7A K;  3TFI A;  3S14 C;  1WQG A;  4KN4 A;  3GTG C;  1PJ5 A;  4GTA A;  3HOZ K;  3N0B A;  3G4C A;  5CJ9 A;  2W7V A;  4P5A A;  4XSX A;  4YG2 A;  4C2M C;  2A69 A;  3ORE A;  3GEI A;  4A3B C;  2GSO A;  3LAP A;  3GTK C;  4PAA A;  4LJZ A;  4KN7 A;  1B4B A;  1WCM C;  3HOY K;  4KMA A;  2R93 A;  4ILD A;  4OIO A;  4KAS A; 
#chains in the Genus database with same CATH homology
 1VJE A;  2FQT A;  1YCL A;  1INN A;  4XCH A;  2FQO A;  1VH2 A;  1J6V A;  1J6W A;  1J98 A;  1JOE A;  1JQW A;  5E68 A;  1J6X A;  1JVI A;  1IE0 A;  1VGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...