1YCLA

Crystal structure of b. subtilis luxs in complex with a catalytic 2-ketone intermediate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
154
Chain Sequence
b'VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGAQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteinase
publication title Crystal Structure of S-Ribosylhomocysteinase (LuxS) in Complex with a Catalytic 2-Ketone Intermediate.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 44
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1yclA00
1VH2A 1JOEA 1VGXA 1IE0A 5E68A 2FQTA 1VJEA 1YCLA 1J6VA 1JVIA 4XCHA 1J6XA 1J6WA 1INNA 2FQOA 1JQWA 1J98A
chains in the Genus database with same CATH superfamily
4Q5SA 3GTOA 2GSOA 4C2MC 3H0GC 1VH2A 2B63C 2A69A 4XSZA 5C4JK 4BY1C 5M5XK 2JA6C 1WOPA 3HOUC 1J6VA 2JA7K 4FZBA 2GSNA 2YU9K 1I6HK 2Y0SL 1WQHA 1USMA 3H0GA 4LK1A 2ZUFA 1Y1WA 2B63A 3GEHA 3HOVC 4NOIA 1BDFA 3S1RK 4M1XA 3GTKA 5IYBC 1Y1VC 3I4MK 5IP9C 1WOOA 2R7ZK 2PA8L 2E2IA 3TFJA 2Y3PA 4WJ3M 1XZQA 2R92K 2O5IA 1V5VA 4BLBA 4G7ZA 1F7UA 3S2HC 1I50A 4A3BK 4AH6A 3GTMK 1XZQB 1WQGA 4LQYA 1WSVA 5HL8A 3S0XA 1USOA 1VRQC 5M3FK 1ZYRA 1ZBSA 3S1MC 4LJZA 3A8JA 3PO3C 2FQOA 1G51A 1F7VA 1J6XA 4XLPA 4DDQA 3OEPA 2R93C 3FKIK 3TFIA 3GIRA 4A3IK 2W7VA 5IP7K 1KQ4A 4BBRK 2JA5C 1I3QC 4LOWA 1WSRA 2A6EA 1DCHA 3PO2K 3S17C 1WCMK 1B4BA 4A3FC 3GTQA 5FLMC 3GEIA 3AQOA 3S1NK 1L0WA 4A3EK 1TWAA 3S2DC 2JA8K 3GTGC 4BY7C 2JA5A 3T01A 5M3MK 4GTCA 3I4NC 3RZOK 1HQMA 3GTPK 3AD7C 1O28A 1SFOC 4BBSK 3K7AC 3MMLB 1TWCA 4GTEA 2BE5A 1HI9A 2JA7A 4QJVA 2YU9A 2PA8D 4C2MK 3Q3QA 3OREA 4BXXC 1VJEA 4WILA 4OIOA 3G4CA 4GZYA 4O2DA 3GSIA 1GE9A 1IW7A 4QJVB 2XCQA 4Y7NK 3HOUK 1O26A 4YFXA 1ISEA 3HOVK 3M3YK 4BKWA 4A3KC 4KAWX 3N0CA 1Y1VK 3GTOC 4KATA 3HOZC 4LLGA 3S15C 1ZQ1C 3GTMA 1AB4A 1O25A 3N0BA 3T00A 1R9TA 5C4XC 2WAQL 5C44C 3S2HK 3GDZA 2EBBA 3S16K 4A3GC 5L46A 2P8TA 3HOYK 4A93C 1Y1WC 4C45A 2E2HA 2VUMK 3S14C 3FKIA 3WODA 3HOXC 4P9SA 3GTKC 5JVOA 4YG2A 3M4OK 3BP8C 1WCMA 1INNA 1K83C 2NVQC 2E2IC 3ADAC 3OPFA 2A68A 2PHCB 1TWGA 1XXBA 2PPBA 1VGXA 5M5WK 3GTJK 1I50C 4KMDA 3L4JA 1K83A 3RZDC 4MEYA 4X6AC 3GTLK 4A3MC 3EQLA 1DD5A 4BY7K 1XXCA 3I4NK 3IPJA 4OIPA 2A6HA 4GTFA 5JFEA 1O2FB 4KN7A 1SFOK 2NVYC 1IQ0A 4G0VA 2GAGC 3LPXA 1TWHK 3HOWK 1TWFK 3JSTA 5IYCC 2XCRB 3GTQC 4QIWD 3FHZA 2WAQD 2NVYA 2O5JA 1J98A 4A3LK 1PJ5A 1TWAC 4KARA 1X31C 2NVXK 1C0AA 4MQ9A 3CQZK 4Q4ZA 1BJTA 2V6TA 4A3JK 4Y52K 3VA7A 4OINA 1DCPA 4GFQA 1TWCC 2CFAA 4KMHA 4C3HK 1PJ6A 1YNJA 4LK0A 4KN4A 2ZFZA 2YU9C 2JA7C 1I6HC 1F93A 3S1QC 3FOFA 3BP3A 3AQPA 1UV7A 3T02A 4A3DC 3A8IA 2VUMA 1XPPA 3S1RC 5C4XK 5TJ3A 2CFAB 3I4MC 1YNNA 4KB4A 2JH3A 3H0GK 2B63K 4G0UA 3TTGA 2R92C 3G4AA 1IL2A 5FJ8K 4BY1K 4C3JC 3HOXK 2JA6K 3GTJA 4A3BC 2R7ZA 1O27A 2NVQK 3GTMC 3GTLA 2R92A 1R9TC 1XXAA 5IYDC 5IOQA 5D4DA 1IE0A 3CAGA 3NUHA 5IYBK 2XCOA 2V6UA 4PAAA 5IP9K 1VLOA 1JQWA 1B4AA 2E2HC 5M5YK 3FKIC 4QIWL 4KB2A 4A3IC 4BBRC 1TWFA 4GTDA 3PO2C 3DXJA 1WCMC 4C3IC 5EGEA 3LAJA 1XZPA 4XSXA 3H3VL 4YFKA 5TMFA 2E2JC 1TWGC 4A3EC 2V6SA 4GTBA 1O2AA 2JA8C 2NVXA 3S1MK 3ERED 3CQZA 1BS2A 5IYCK 3PO3K 1XZPB 3BUEA 3RZOC 2WB1L 4YFNA 3GTQK 1PJ7A 5C3EC 2KWAA 4BBSC 3FOEA 1TWAK 2R93K 4JK1A 4XLNA 2JA5K 3V4GA 1I3QK 4BLAA 3HKZL 4KASA 3GTPA 2CW0A 3S17K 4A3FK 4G7HA 4OIQA 2RH6A 3LAPA 5FLMK 5IORA 5TMCA 4A3CC 2NVTC 1TWCK 3S2DK 4Y7NC 3GTGK 5CHPA 3S1QK 4G7OA 1SMYA 1J6WA 4ILDA 4A3DK 3M3YC 4AYBD 2FQTA 3AD8C 4WJ4A 1ZXOA 2JA6A 4PABA 3K7AK 1O29A 4P5BA 4ZH4A 2PMZD 1RU0A 4RMFA 4BXXK 1F9NA 4KC6A 4C3JK 1WORA 5IOSA 1IS1A 1WOSA 4GTLA 1O2BA 1Y1VA 4XCHA 2GAHC 3S16C 3HOYC 3H3VD 5C4JC 2VUMC 4A3KK 1R9TK 4KM8A 5IYDK 1EH1A 1DCOA 3M4OC 4KMAA 3GTOK 2WB1D 2D6FC 3HOZK 3S15K 3HXAA 1I6VA 1WQFA 4GT9A 3N3YA 2E2HK 2RGRA 4KM9A 4LR2A 4KMUA 5C44K 2ZUEA 4KDDA 3HKZD 3GTJC 2R7ZC 3TFHA 4C3IK 4G0WA 4A3GK 4P5AA 4A93K 3GTLC 1Y1WK 4OIRA 2E2JK 3SZZA 1TWGK 2R93A 3S14K 3QX3A 5EGHA 1I3QA 3GTKK 1O24A 2Y0SD 1ZVUA 3GEEA 1K83K 1JOEA 2E2IK 1EQRA 5C3EK 1BGWA 4GTAA 1WIHA 4AYBL 4MEXA 1YX2A 3GTGA 1TWHC 3HOWC 1TWFC 3AH5A 1I50K 5E68A 4FM9A 3RZDK 4X6AK 1YCLA 2PMZL 2GSUA 1SFOA 3AD9C 4A3CK 4J3NA 3SZYA 4A3MK 2NVTK 4A3LC 2NVXC 5IP7C 1TWHA 3CQZC 1EFWA 3A8KA 4A3JC 4Y52C 1EK8A 1EI6A 1JVIA 2NVYK 5CJ9A 3S1NC 4C3HC 2P5MA 3L4KA 3GTPC 5IOTA 1IBAA
chains in the Genus database with same CATH topology
1VH2A 1JOEA 1VGXA 1IE0A 5E68A 2FQTA 1VJEA 1YCLA 1J6VA 1JVIA 4XCHA 1J6XA 1J6WA 1INNA 2FQOA 1JQWA 1J98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH2 A;  1JOE A;  1VGX A;  1IE0 A;  5E68 A;  2FQT A;  1VJE A;  1YCL A;  1J6V A;  1JVI A;  4XCH A;  1J6X A;  1J6W A;  1INN A;  2FQO A;  1JQW A;  1J98 A; 
#chains in the Genus database with same CATH topology
 4Q5S A;  3GTO A;  2GSO A;  4C2M C;  3H0G C;  1VH2 A;  2B63 C;  2A69 A;  4XSZ A;  5C4J K;  4BY1 C;  5M5X K;  2JA6 C;  1WOP A;  3HOU C;  1J6V A;  2JA7 K;  4FZB A;  2GSN A;  2YU9 K;  1I6H K;  2Y0S L;  1WQH A;  1USM A;  3H0G A;  4LK1 A;  2ZUF A;  1Y1W A;  2B63 A;  3GEH A;  3HOV C;  4NOI A;  1BDF A;  3S1R K;  4M1X A;  3GTK A;  5IYB C;  1Y1V C;  3I4M K;  5IP9 C;  1WOO A;  2R7Z K;  2PA8 L;  2E2I A;  3TFJ A;  2Y3P A;  4WJ3 M;  1XZQ A;  2R92 K;  2O5I A;  1V5V A;  4BLB A;  4G7Z A;  1F7U A;  3S2H C;  1I50 A;  4A3B K;  4AH6 A;  3GTM K;  1XZQ B;  1WQG A;  4LQY A;  1WSV A;  5HL8 A;  3S0X A;  1USO A;  1VRQ C;  5M3F K;  1ZYR A;  1ZBS A;  3S1M C;  4LJZ A;  3A8J A;  3PO3 C;  2FQO A;  1G51 A;  1F7V A;  1J6X A;  4XLP A;  4DDQ A;  3OEP A;  2R93 C;  3FKI K;  3TFI A;  3GIR A;  4A3I K;  2W7V A;  5IP7 K;  1KQ4 A;  4BBR K;  2JA5 C;  1I3Q C;  4LOW A;  1WSR A;  2A6E A;  1DCH A;  3PO2 K;  3S17 C;  1WCM K;  1B4B A;  4A3F C;  3GTQ A;  5FLM C;  3GEI A;  3AQO A;  3S1N K;  1L0W A;  4A3E K;  1TWA A;  3S2D C;  2JA8 K;  3GTG C;  4BY7 C;  2JA5 A;  3T01 A;  5M3M K;  4GTC A;  3I4N C;  3RZO K;  1HQM A;  3GTP K;  3AD7 C;  1O28 A;  1SFO C;  4BBS K;  3K7A C;  3MML B;  1TWC A;  4GTE A;  2BE5 A;  1HI9 A;  2JA7 A;  4QJV A;  2YU9 A;  2PA8 D;  4C2M K;  3Q3Q A;  3ORE A;  4BXX C;  1VJE A;  4WIL A;  4OIO A;  3G4C A;  4GZY A;  4O2D A;  3GSI A;  1GE9 A;  1IW7 A;  4QJV B;  2XCQ A;  4Y7N K;  3HOU K;  1O26 A;  4YFX A;  1ISE A;  3HOV K;  3M3Y K;  4BKW A;  4A3K C;  4KAW X;  3N0C A;  1Y1V K;  3GTO C;  4KAT A;  3HOZ C;  4LLG A;  3S15 C;  1ZQ1 C;  3GTM A;  1AB4 A;  1O25 A;  3N0B A;  3T00 A;  1R9T A;  5C4X C;  2WAQ L;  5C44 C;  3S2H K;  3GDZ A;  2EBB A;  3S16 K;  4A3G C;  5L46 A;  2P8T A;  3HOY K;  4A93 C;  1Y1W C;  4C45 A;  2E2H A;  2VUM K;  3S14 C;  3FKI A;  3WOD A;  3HOX C;  4P9S A;  3GTK C;  5JVO A;  4YG2 A;  3M4O K;  3BP8 C;  1WCM A;  1INN A;  1K83 C;  2NVQ C;  2E2I C;  3ADA C;  3OPF A;  2A68 A;  2PHC B;  1TWG A;  1XXB A;  2PPB A;  1VGX A;  5M5W K;  3GTJ K;  1I50 C;  4KMD A;  3L4J A;  1K83 A;  3RZD C;  4MEY A;  4X6A C;  3GTL K;  4A3M C;  3EQL A;  1DD5 A;  4BY7 K;  1XXC A;  3I4N K;  3IPJ A;  4OIP A;  2A6H A;  4GTF A;  5JFE A;  1O2F B;  4KN7 A;  1SFO K;  2NVY C;  1IQ0 A;  4G0V A;  2GAG C;  3LPX A;  1TWH K;  3HOW K;  1TWF K;  3JST A;  5IYC C;  2XCR B;  3GTQ C;  4QIW D;  3FHZ A;  2WAQ D;  2NVY A;  2O5J A;  1J98 A;  4A3L K;  1PJ5 A;  1TWA C;  4KAR A;  1X31 C;  2NVX K;  1C0A A;  4MQ9 A;  3CQZ K;  4Q4Z A;  1BJT A;  2V6T A;  4A3J K;  4Y52 K;  3VA7 A;  4OIN A;  1DCP A;  4GFQ A;  1TWC C;  2CFA A;  4KMH A;  4C3H K;  1PJ6 A;  1YNJ A;  4LK0 A;  4KN4 A;  2ZFZ A;  2YU9 C;  2JA7 C;  1I6H C;  1F93 A;  3S1Q C;  3FOF A;  3BP3 A;  3AQP A;  1UV7 A;  3T02 A;  4A3D C;  3A8I A;  2VUM A;  1XPP A;  3S1R C;  5C4X K;  5TJ3 A;  2CFA B;  3I4M C;  1YNN A;  4KB4 A;  2JH3 A;  3H0G K;  2B63 K;  4G0U A;  3TTG A;  2R92 C;  3G4A A;  1IL2 A;  5FJ8 K;  4BY1 K;  4C3J C;  3HOX K;  2JA6 K;  3GTJ A;  4A3B C;  2R7Z A;  1O27 A;  2NVQ K;  3GTM C;  3GTL A;  2R92 A;  1R9T C;  1XXA A;  5IYD C;  5IOQ A;  5D4D A;  1IE0 A;  3CAG A;  3NUH A;  5IYB K;  2XCO A;  2V6U A;  4PAA A;  5IP9 K;  1VLO A;  1JQW A;  1B4A A;  2E2H C;  5M5Y K;  3FKI C;  4QIW L;  4KB2 A;  4A3I C;  4BBR C;  1TWF A;  4GTD A;  3PO2 C;  3DXJ A;  1WCM C;  4C3I C;  5EGE A;  3LAJ A;  1XZP A;  4XSX A;  3H3V L;  4YFK A;  5TMF A;  2E2J C;  1TWG C;  4A3E C;  2V6S A;  4GTB A;  1O2A A;  2JA8 C;  2NVX A;  3S1M K;  3ERE D;  3CQZ A;  1BS2 A;  5IYC K;  3PO3 K;  1XZP B;  3BUE A;  3RZO C;  2WB1 L;  4YFN A;  3GTQ K;  1PJ7 A;  5C3E C;  2KWA A;  4BBS C;  3FOE A;  1TWA K;  2R93 K;  4JK1 A;  4XLN A;  2JA5 K;  3V4G A;  1I3Q K;  4BLA A;  3HKZ L;  4KAS A;  3GTP A;  2CW0 A;  3S17 K;  4A3F K;  4G7H A;  4OIQ A;  2RH6 A;  3LAP A;  5FLM K;  5IOR A;  5TMC A;  4A3C C;  2NVT C;  1TWC K;  3S2D K;  4Y7N C;  3GTG K;  5CHP A;  3S1Q K;  4G7O A;  1SMY A;  1J6W A;  4ILD A;  4A3D K;  3M3Y C;  4AYB D;  2FQT A;  3AD8 C;  4WJ4 A;  1ZXO A;  2JA6 A;  4PAB A;  3K7A K;  1O29 A;  4P5B A;  4ZH4 A;  2PMZ D;  1RU0 A;  4RMF A;  4BXX K;  1F9N A;  4KC6 A;  4C3J K;  1WOR A;  5IOS A;  1IS1 A;  1WOS A;  4GTL A;  1O2B A;  1Y1V A;  4XCH A;  2GAH C;  3S16 C;  3HOY C;  3H3V D;  5C4J C;  2VUM C;  4A3K K;  1R9T K;  4KM8 A;  5IYD K;  1EH1 A;  1DCO A;  3M4O C;  4KMA A;  3GTO K;  2WB1 D;  2D6F C;  3HOZ K;  3S15 K;  3HXA A;  1I6V A;  1WQF A;  4GT9 A;  3N3Y A;  2E2H K;  2RGR A;  4KM9 A;  4LR2 A;  4KMU A;  5C44 K;  2ZUE A;  4KDD A;  3HKZ D;  3GTJ C;  2R7Z C;  3TFH A;  4C3I K;  4G0W A;  4A3G K;  4P5A A;  4A93 K;  3GTL C;  1Y1W K;  4OIR A;  2E2J K;  3SZZ A;  1TWG K;  2R93 A;  3S14 K;  3QX3 A;  5EGH A;  1I3Q A;  3GTK K;  1O24 A;  2Y0S D;  1ZVU A;  3GEE A;  1K83 K;  1JOE A;  2E2I K;  1EQR A;  5C3E K;  1BGW A;  4GTA A;  1WIH A;  4AYB L;  4MEX A;  1YX2 A;  3GTG A;  1TWH C;  3HOW C;  1TWF C;  3AH5 A;  1I50 K;  5E68 A;  4FM9 A;  3RZD K;  4X6A K;  1YCL A;  2PMZ L;  2GSU A;  1SFO A;  3AD9 C;  4A3C K;  4J3N A;  3SZY A;  4A3M K;  2NVT K;  4A3L C;  2NVX C;  5IP7 C;  1TWH A;  3CQZ C;  1EFW A;  3A8K A;  4A3J C;  4Y52 C;  1EK8 A;  1EI6 A;  1JVI A;  2NVY K;  5CJ9 A;  3S1N C;  4C3H C;  2P5M A;  3L4K A;  3GTP C;  5IOT A;  1IBA A; 
#chains in the Genus database with same CATH homology
 1VH2 A;  1JOE A;  1VGX A;  1IE0 A;  5E68 A;  2FQT A;  1VJE A;  1YCL A;  1J6V A;  1JVI A;  4XCH A;  1J6X A;  1J6W A;  1INN A;  2FQO A;  1JQW A;  1J98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...