1TWCK

Rna polymerase ii complexed with gtp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twcK00
3GTOK 3HOWK 1XPPA 5IYCK 5C44C 4BY1K 2Y0SD 3PO2K 3I4NC 4LK1A 1Y1VC 5C4JC 2PA8D 3S17K 2A68A 3CQZC 2B63C 4A3EC 5FLMC 1Y1WK 2NVYC 1WCMK 1K83C 5IYBC 2O5JA 3HOVK 4QIWD 4BBSC 2WAQL 1YNJA 1SFOC 3S1RC 4YFNA 2E2HC 5M5WK 3S16C 3S15C 1HQMA 1BDFA 3HKZL 5D4DA 2WB1L 4X6AK 4A3JK 5FJ8K 2PMZD 4AYBL 4A3KC 3S1MK 3HOZK 3WODA 3GTKC 4A3MC 2JA7K 3GTJK 4A3BC 2R92C 3H0GC 1TWGC 4A3IC 4MEXA 4NOIA 4A93K 4LJZA 4G7ZA 2NVQC 3GTLC 3S2HK 1I6HC 3RZDC 3GTQK 4OIPA 5IP7C 4Y7NK 4MEYA 5IYDC 4Y52K 2JA6C 2JA8K 3S2DC 5TMFA 3K7AC 4BBRK 3PO3C 3FKIC 1TWFC 5M5XK 3HOXC 3M4OC 4BY7C 4XLNA 4A3GK 4A3FC 4JK1A 4QJVA 3HOYC 1I50C 2VUMK 4A3LC 2A6EA 2NVTC 2JA5C 3I4MC 3H3VL 1TWCK 4BY1C 4OIOA 4XSXA 5C3EK 2BE5A 2R93C 3S1NK 3I4NK 3S1QK 3GTGK 5IP9K 1Y1VK 3GTMK 2NVXC 4ZH4A 4BXXK 3M3YC 3CQZK 1Y1WC 2B63K 3GTPC 4C3JK 1WCMC 3HOUK 4A3CC 2NVYK 4OIQA 2R7ZK 3HOVC 3S14K 1TWAK 5TMCA 4A3DK 2PPBA 4X6AC 2O5IA 5C4XK 4XSZA 1TWHC 2E2JC 4QJVB 1R9TC 2WAQD 3HOZC 1SMYA 2JA7C 4G7OA 1I3QK 4LK0A 3HKZD 4YFKA 2E2IK 2WB1D 3H0GK 1TWGK 2YU9K 4A93C 4AYBD 3HOWC 2Y0SL 4Y52C 4YFXA 4G7HA 4OINA 2CW0A 3GTQC 3RZOC 2PA8L 2A69A 3GTOC 3RZDK 2JA8C 3DXJA 5IYCC 3PO2C 1I6HK 5IYDK 4KMUA 4C3HK 5C44K 3K7AK 1ZYRA 3S17C 3PO3K 1I6VA 1TWFK 3FKIK 4XLPA 5C4JK 2VUMC 4A3FK 4QIWL 4C3IK 4A3EK 4A3LK 4GZYA 5FLMK 3I4MK 5C3EC 1K83K 3S1NC 5IYBK 3S1QC 2R93K 2PMZL 3GTGC 5IP9C 3GTMC 4BBSK 5M3MK 3H3VD 4BXXC 4LLGA 1SFOK 3S1RK 4A3JC 2E2HK 2NVXK 3S15K 3S16K 3HOUC 3M3YK 3S1MC 1YNNA 3GTPK 3GTJC 4A3KK 2R7ZC 4Q4ZA 3GTKK 4MQ9A 4A3MK 3S14C 1TWAC 4A3CK 2R92K 4A3BK 4Q5SA 4A3IK 3S2HC 4A3DC 4YG2A 4Y7NC 5C4XC 2A6HA 2NVQK 3GTLK 5IP7K 1IW7A 1TWHK 2E2JK 2JA6K 4BBRC 3S2DK 1I3QC 4KN7A 5M5YK 1R9TK 4KN4A 4A3GC 5M3FK 4C2MK 2E2IC 3M4OK 2YU9C 3HOXK 3EQLA 4BY7K 3HOYK 1I50K 4OIRA 2NVTK 3RZOK 2JA5K 1TWCC
chains in the Genus database with same CATH superfamily
2PHCB 3FKIA 1TWFA 5C44C 4LR2A 4BY1K 3LAJA 4AH6A 1X31C 1XXCA 5FLMC 3FHZA 1Y1WK 4QIWD 1SFOA 2WAQL 4KMDA 2NVXA 1SFOC 1O24A 5E68A 1HQMA 4A3JK 2R92A 4A3KC 3HOZK 3WODA 2R92C 3GIRA 4Y52K 3RZDC 3GTQK 1R9TA 5IYDC 3S2DC 4GTFA 4G0UA 4JK1A 5CJ9A 2RH6A 3I4MC 4OIOA 2R93C 3GTGK 3GTPC 2B63K 3HOVC 5TMCA 3BP3A 1YCLA 4KARA 4XSZA 2XCOA 4WJ3M 2JA7A 3TTGA 1ZXOA 1SMYA 2JA7C 1J98A 1JQWA 3HKZD 2E2IK 3H0GK 4YFXA 4PAAA 2A69A 3SZZA 2JA8C 5IYCC 3PO2C 4KASA 1ZYRA 3PO3K 5C4JK 1XZPA 2FQOA 4A3FK 4QIWL 4A3LK 1WSRA 4C45A 1VH2A 5C3EC 5EGHA 1K83K 1Y1VA 1O27A 1XXBA 3GEHA 3H3VD 2ZUEA 3S1RK 3S15K 2NVYA 2R7ZA 3S1MC 2GAHC 1WQGA 1TWAA 3OREA 4KMAA 3GTJC 3L4KA 4Q4ZA 2R7ZC 4GTAA 3TFIA 4A3MK 4A3CK 1TWAC 1VLOA 4A3IK 3S2HC 1WOPA 4Y7NC 5C4XC 1TWHK 1RU0A 4WJ4A 2YU9A 4WILA 5IOTA 4C2MK 2YU9C 3VA7A 3A8IA 1I50K 1IQ0A 1TWCC 2GSUA 3Q3QA 3GTOK 4C3HC 1GE9A 1XPPA 1ZBSA 4O2DA 5CHPA 1PJ6A 2A68A 3CQZC 4A3EC 2EBBA 3JSTA 1IS1A 2W7VA 3CAGA 4GTDA 4BLAA 1O28A 4YFNA 1ZQ1C 3S16C 4X6AK 1BDFA 3HKZL 3GTKA 2PMZD 1EQRA 3GTKC 3TFJA 1TWGC 4NOIA 4GT9A 4G7ZA 4GFQA 2JA6A 4P9SA 1J6XA 3T02A 2JA6C 1EI6A 4KDDA 5TMFA 4BBRK 3FKIC 1TWFC 5M5XK 2P8TA 4BKWA 3HOXC 3M4OC 4A3GK 2JA5A 3N3YA 2A6EA 2NVTC 2JA5C 3H3VL 1DD5A 2V6TA 4BY1C 3OPFA 3S1QK 4KATA 2Y3PA 1Y1WA 1BJTA 2NVXC 4ZH4A 3AQOA 3M3YC 1Y1WC 4OIQA 1USMA 3S14K 2V6UA 1BS2A 4DDQA 3AD7C 2E2JC 1VJEA 1KQ4A 2FQTA 2JH3A 4QJVB 1R9TC 3HOZC 1G51A 1B4AA 1I3QK 3GTQA 4AYBD 3HOWC 4Y52C 3ERED 4G7HA 4OINA 3GTQC 4KAWX 5HL8A 3RZDK 3NUHA 5IYDK 3S0XA 4RMFA 2ZFZA 3S17C 5TJ3A 1C0AA 3I4MK 1UV7A 1AB4A 2V6SA 3GTGA 2CFAB 5IYBK 2R93K 2PMZL 3GTGC 4BBSK 2B63A 2E2HK 1YNNA 3GTPK 4A3BK 1L0WA 1HI9A 2A6HA 2NVQK 3GTLK 5IP7K 1IW7A 3G4CA 2E2IA 3H0GA 5M3FK 2E2IC 4BY7K 3HOYK 1JVIA 2RGRA 3BP8C 4GTEA 5IYCK 3PO2K 3I4NC 2Y0SD 1Y1VC 3G4AA 5C4JC 4LQYA 3AD8C 5IOSA 1K83A 1F9NA 2NVYC 1EH1A 3MMLB 1WCMK 1K83C 1XZQB 2O5JA 4FM9A 3S1RC 1V5VA 3S15C 5M5WK 5D4DA 5FJ8K 4AYBL 3S1MK 3AH5A 4A3MC 3GTJK 4XCHA 4A3IC 1O26A 2D6FC 4A93K 1B4BA 1TWHA 4LJZA 3S2HK 1I6HC 4Y7NK 3K7AC 4PABA 1XXAA 4KM9A 4C2MC 1EFWA 3GSIA 1I50A 4XLNA 1I50C 1O25A 4C3IC 3GDZA 2VUMK 4KB4A 3GTOA 2GAGC 4KMHA 3L4JA 1TWCK 4XSXA 2BE5A 3OEPA 3S1NK 5IP9K 3GTMK 4BXXK 3CQZK 4C3JK 4GTCA 3HOUK 3T00A 5JFEA 1BGWA 1F7UA 4A3DK 2PPBA 4X6AC 1ISEA 3TFHA 4G7OA 1WQHA 4LK0A 1WQFA 4J3NA 2WB1D 4ILDA 1TWGK 2P5MA 4FZBA 1IL2A 2Y0SL 4G0VA 3RZOC 1EK8A 1DCPA 5C44K 4LOWA 3GEIA 3FKIK 1TWFK 4GZYA 5IORA 5FLMK 1PJ7A 5IOQA 3S1QC 3N0CA 1O2AA 5M3MK 3V4GA 4LLGA 1SFOK 4A3JC 2NVXK 3M3YK 4A3KK 4P5BA 3S14C 4MQ9A 3N0BA 4Q5SA 2R92K 4GTLA 1F93A 3A8JA 1I3QA 1JOEA 4M1XA 2E2JK 3S2DK 1XZPB 1I3QC 4KN7A 1R9TK 3AQPA 3HOWK 4P5AA 4LK1A 2PA8D 3S17K 1O2FB 2B63C 3FOFA 2R93A 5L46A 5IYBC 2KWAA 3HOVK 2ZUFA 2E2HA 4BBSC 1YNJA 3GTPA 2E2HC 2WB1L 4KC6A 1ZVUA 1WSVA 2JA7K 4A3BC 3H0GC 3GTLA 4MEXA 3FOEA 2NVQC 3GTLC 4OIPA 5IP7C 4MEYA 1WORA 3SZYA 2JA8K 3PO3C 4BY7C 1J6WA 4A3FC 4QJVA 3HOYC 1YX2A 4A3LC 1VGXA 3BUEA 5C3EK 1DCHA 3I4NK 1Y1VK 4BLBA 1PJ5A 1WCMA 4G0WA 1WOSA 2XCRB 1WCMC 4A3CC 2NVYK 2R7ZK 1TWAK 1O29A 1O2BA 3AD9C 2O5IA 2CFAA 5C4XK 1TWHC 3GTJA 2WAQD 1IBAA 1VRQC 4YFKA 4A93C 2YU9K 1WIHA 2CW0A 2PA8L 3GTOC 1I6HK 3DXJA 1F7VA 4KMUA 4C3HK 3A8KA 3K7AK 2VUMA 1WOOA 1I6VA 4XLPA 2VUMC 4KM8A 1TWCA 4C3IK 4A3EK 3S1NC 3GTMA 3IPJA 4KB2A 5JVOA 5IP9C 3GTMC 3CQZA 4BXXC 5EGEA 3S16K 4C3JC 4GTBA 3HOUC 1USOA 3T01A 3LAPA 3GTKK 3QX3A 4A3DC 1INNA 4YG2A 2XCQA 2GSOA 3GEEA 3HXAA 1XZQA 3ADAC 1IE0A 2JA6K 4BBRC 1DCOA 5M5YK 1TWGA 4A3GC 4KN4A 3M4OK 3HOXK 2GSNA 3EQLA 3LPXA 4OIRA 2NVTK 1J6VA 3RZOK 2JA5K
chains in the Genus database with same CATH topology
3GTOK 3HOWK 1XPPA 5IYCK 5C44C 4BY1K 2Y0SD 3PO2K 3I4NC 4LK1A 1Y1VC 5C4JC 2PA8D 3S17K 2A68A 3CQZC 2B63C 4A3EC 5FLMC 1Y1WK 2NVYC 1WCMK 1K83C 5IYBC 2O5JA 3HOVK 4QIWD 4BBSC 2WAQL 1YNJA 1SFOC 3S1RC 4YFNA 2E2HC 5M5WK 3S16C 3S15C 1HQMA 1BDFA 3HKZL 5D4DA 2WB1L 4X6AK 4A3JK 5FJ8K 2PMZD 4AYBL 4A3KC 3S1MK 3HOZK 3WODA 3GTKC 4A3MC 2JA7K 3GTJK 4A3BC 2R92C 3H0GC 1TWGC 4A3IC 4MEXA 4NOIA 4A93K 4LJZA 4G7ZA 2NVQC 3GTLC 3S2HK 1I6HC 3RZDC 3GTQK 4OIPA 5IP7C 4Y7NK 4MEYA 5IYDC 4Y52K 2JA6C 2JA8K 3S2DC 5TMFA 3K7AC 4BBRK 3PO3C 3FKIC 1TWFC 5M5XK 3HOXC 3M4OC 4BY7C 4XLNA 4A3GK 4A3FC 4JK1A 4QJVA 3HOYC 1I50C 2VUMK 4A3LC 2A6EA 2NVTC 2JA5C 3I4MC 3H3VL 1TWCK 4BY1C 4OIOA 4XSXA 5C3EK 2BE5A 2R93C 3S1NK 3I4NK 3S1QK 3GTGK 5IP9K 1Y1VK 3GTMK 2NVXC 4ZH4A 4BXXK 3M3YC 3CQZK 1Y1WC 2B63K 3GTPC 4C3JK 1WCMC 3HOUK 4A3CC 2NVYK 4OIQA 2R7ZK 3HOVC 3S14K 1TWAK 5TMCA 4A3DK 2PPBA 4X6AC 2O5IA 5C4XK 4XSZA 1TWHC 2E2JC 4QJVB 1R9TC 2WAQD 3HOZC 1SMYA 2JA7C 4G7OA 1I3QK 4LK0A 3HKZD 4YFKA 2E2IK 2WB1D 3H0GK 1TWGK 2YU9K 4A93C 4AYBD 3HOWC 2Y0SL 4Y52C 4YFXA 4G7HA 4OINA 2CW0A 3GTQC 3RZOC 2PA8L 2A69A 3GTOC 3RZDK 2JA8C 3DXJA 5IYCC 3PO2C 1I6HK 5IYDK 4KMUA 4C3HK 5C44K 3K7AK 1ZYRA 3S17C 3PO3K 1I6VA 1TWFK 3FKIK 4XLPA 5C4JK 2VUMC 4A3FK 4QIWL 4C3IK 4A3EK 4A3LK 4GZYA 5FLMK 3I4MK 5C3EC 1K83K 3S1NC 5IYBK 3S1QC 2R93K 2PMZL 3GTGC 5IP9C 3GTMC 4BBSK 5M3MK 3H3VD 4BXXC 4LLGA 1SFOK 3S1RK 4A3JC 2E2HK 2NVXK 3S15K 3S16K 3HOUC 3M3YK 3S1MC 1YNNA 3GTPK 3GTJC 4A3KK 2R7ZC 4Q4ZA 3GTKK 4MQ9A 4A3MK 3S14C 1TWAC 4A3CK 2R92K 4A3BK 4Q5SA 4A3IK 3S2HC 4A3DC 4YG2A 4Y7NC 5C4XC 2A6HA 2NVQK 3GTLK 5IP7K 1IW7A 1TWHK 2E2JK 2JA6K 4BBRC 3S2DK 1I3QC 4KN7A 5M5YK 1R9TK 4KN4A 4A3GC 5M3FK 4C2MK 2E2IC 3M4OK 2YU9C 3HOXK 3EQLA 4BY7K 3HOYK 1I50K 4OIRA 2NVTK 3RZOK 2JA5K 1TWCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO K;  3HOW K;  1XPP A;  5IYC K;  5C44 C;  4BY1 K;  2Y0S D;  3PO2 K;  3I4N C;  4LK1 A;  1Y1V C;  5C4J C;  2PA8 D;  3S17 K;  2A68 A;  3CQZ C;  2B63 C;  4A3E C;  5FLM C;  1Y1W K;  2NVY C;  1WCM K;  1K83 C;  5IYB C;  2O5J A;  3HOV K;  4QIW D;  4BBS C;  2WAQ L;  1YNJ A;  1SFO C;  3S1R C;  4YFN A;  2E2H C;  5M5W K;  3S16 C;  3S15 C;  1HQM A;  1BDF A;  3HKZ L;  5D4D A;  2WB1 L;  4X6A K;  4A3J K;  5FJ8 K;  2PMZ D;  4AYB L;  4A3K C;  3S1M K;  3HOZ K;  3WOD A;  3GTK C;  4A3M C;  2JA7 K;  3GTJ K;  4A3B C;  2R92 C;  3H0G C;  1TWG C;  4A3I C;  4MEX A;  4NOI A;  4A93 K;  4LJZ A;  4G7Z A;  2NVQ C;  3GTL C;  3S2H K;  1I6H C;  3RZD C;  3GTQ K;  4OIP A;  5IP7 C;  4Y7N K;  4MEY A;  5IYD C;  4Y52 K;  2JA6 C;  2JA8 K;  3S2D C;  5TMF A;  3K7A C;  4BBR K;  3PO3 C;  3FKI C;  1TWF C;  5M5X K;  3HOX C;  3M4O C;  4BY7 C;  4XLN A;  4A3G K;  4A3F C;  4JK1 A;  4QJV A;  3HOY C;  1I50 C;  2VUM K;  4A3L C;  2A6E A;  2NVT C;  2JA5 C;  3I4M C;  3H3V L;  1TWC K;  4BY1 C;  4OIO A;  4XSX A;  5C3E K;  2BE5 A;  2R93 C;  3S1N K;  3I4N K;  3S1Q K;  3GTG K;  5IP9 K;  1Y1V K;  3GTM K;  2NVX C;  4ZH4 A;  4BXX K;  3M3Y C;  3CQZ K;  1Y1W C;  2B63 K;  3GTP C;  4C3J K;  1WCM C;  3HOU K;  4A3C C;  2NVY K;  4OIQ A;  2R7Z K;  3HOV C;  3S14 K;  1TWA K;  5TMC A;  4A3D K;  2PPB A;  4X6A C;  2O5I A;  5C4X K;  4XSZ A;  1TWH C;  2E2J C;  4QJV B;  1R9T C;  2WAQ D;  3HOZ C;  1SMY A;  2JA7 C;  4G7O A;  1I3Q K;  4LK0 A;  3HKZ D;  4YFK A;  2E2I K;  2WB1 D;  3H0G K;  1TWG K;  2YU9 K;  4A93 C;  4AYB D;  3HOW C;  2Y0S L;  4Y52 C;  4YFX A;  4G7H A;  4OIN A;  2CW0 A;  3GTQ C;  3RZO C;  2PA8 L;  2A69 A;  3GTO C;  3RZD K;  2JA8 C;  3DXJ A;  5IYC C;  3PO2 C;  1I6H K;  5IYD K;  4KMU A;  4C3H K;  5C44 K;  3K7A K;  1ZYR A;  3S17 C;  3PO3 K;  1I6V A;  1TWF K;  3FKI K;  4XLP A;  5C4J K;  2VUM C;  4A3F K;  4QIW L;  4C3I K;  4A3E K;  4A3L K;  4GZY A;  5FLM K;  3I4M K;  5C3E C;  1K83 K;  3S1N C;  5IYB K;  3S1Q C;  2R93 K;  2PMZ L;  3GTG C;  5IP9 C;  3GTM C;  4BBS K;  5M3M K;  3H3V D;  4BXX C;  4LLG A;  1SFO K;  3S1R K;  4A3J C;  2E2H K;  2NVX K;  3S15 K;  3S16 K;  3HOU C;  3M3Y K;  3S1M C;  1YNN A;  3GTP K;  3GTJ C;  4A3K K;  2R7Z C;  4Q4Z A;  3GTK K;  4MQ9 A;  4A3M K;  3S14 C;  1TWA C;  4A3C K;  2R92 K;  4A3B K;  4Q5S A;  4A3I K;  3S2H C;  4A3D C;  4YG2 A;  4Y7N C;  5C4X C;  2A6H A;  2NVQ K;  3GTL K;  5IP7 K;  1IW7 A;  1TWH K;  2E2J K;  2JA6 K;  4BBR C;  3S2D K;  1I3Q C;  4KN7 A;  5M5Y K;  1R9T K;  4KN4 A;  4A3G C;  5M3F K;  4C2M K;  2E2I C;  3M4O K;  2YU9 C;  3HOX K;  3EQL A;  4BY7 K;  3HOY K;  1I50 K;  4OIR A;  2NVT K;  3RZO K;  2JA5 K;  1TWC C; 
#chains in the Genus database with same CATH topology
 2PHC B;  3FKI A;  1TWF A;  5C44 C;  4LR2 A;  4BY1 K;  3LAJ A;  4AH6 A;  1X31 C;  1XXC A;  5FLM C;  3FHZ A;  1Y1W K;  4QIW D;  1SFO A;  2WAQ L;  4KMD A;  2NVX A;  1SFO C;  1O24 A;  5E68 A;  1HQM A;  4A3J K;  2R92 A;  4A3K C;  3HOZ K;  3WOD A;  2R92 C;  3GIR A;  4Y52 K;  3RZD C;  3GTQ K;  1R9T A;  5IYD C;  3S2D C;  4GTF A;  4G0U A;  4JK1 A;  5CJ9 A;  2RH6 A;  3I4M C;  4OIO A;  2R93 C;  3GTG K;  3GTP C;  2B63 K;  3HOV C;  5TMC A;  3BP3 A;  1YCL A;  4KAR A;  4XSZ A;  2XCO A;  4WJ3 M;  2JA7 A;  3TTG A;  1ZXO A;  1SMY A;  2JA7 C;  1J98 A;  1JQW A;  3HKZ D;  2E2I K;  3H0G K;  4YFX A;  4PAA A;  2A69 A;  3SZZ A;  2JA8 C;  5IYC C;  3PO2 C;  4KAS A;  1ZYR A;  3PO3 K;  5C4J K;  1XZP A;  2FQO A;  4A3F K;  4QIW L;  4A3L K;  1WSR A;  4C45 A;  1VH2 A;  5C3E C;  5EGH A;  1K83 K;  1Y1V A;  1O27 A;  1XXB A;  3GEH A;  3H3V D;  2ZUE A;  3S1R K;  3S15 K;  2NVY A;  2R7Z A;  3S1M C;  2GAH C;  1WQG A;  1TWA A;  3ORE A;  4KMA A;  3GTJ C;  3L4K A;  4Q4Z A;  2R7Z C;  4GTA A;  3TFI A;  4A3M K;  4A3C K;  1TWA C;  1VLO A;  4A3I K;  3S2H C;  1WOP A;  4Y7N C;  5C4X C;  1TWH K;  1RU0 A;  4WJ4 A;  2YU9 A;  4WIL A;  5IOT A;  4C2M K;  2YU9 C;  3VA7 A;  3A8I A;  1I50 K;  1IQ0 A;  1TWC C;  2GSU A;  3Q3Q A;  3GTO K;  4C3H C;  1GE9 A;  1XPP A;  1ZBS A;  4O2D A;  5CHP A;  1PJ6 A;  2A68 A;  3CQZ C;  4A3E C;  2EBB A;  3JST A;  1IS1 A;  2W7V A;  3CAG A;  4GTD A;  4BLA A;  1O28 A;  4YFN A;  1ZQ1 C;  3S16 C;  4X6A K;  1BDF A;  3HKZ L;  3GTK A;  2PMZ D;  1EQR A;  3GTK C;  3TFJ A;  1TWG C;  4NOI A;  4GT9 A;  4G7Z A;  4GFQ A;  2JA6 A;  4P9S A;  1J6X A;  3T02 A;  2JA6 C;  1EI6 A;  4KDD A;  5TMF A;  4BBR K;  3FKI C;  1TWF C;  5M5X K;  2P8T A;  4BKW A;  3HOX C;  3M4O C;  4A3G K;  2JA5 A;  3N3Y A;  2A6E A;  2NVT C;  2JA5 C;  3H3V L;  1DD5 A;  2V6T A;  4BY1 C;  3OPF A;  3S1Q K;  4KAT A;  2Y3P A;  1Y1W A;  1BJT A;  2NVX C;  4ZH4 A;  3AQO A;  3M3Y C;  1Y1W C;  4OIQ A;  1USM A;  3S14 K;  2V6U A;  1BS2 A;  4DDQ A;  3AD7 C;  2E2J C;  1VJE A;  1KQ4 A;  2FQT A;  2JH3 A;  4QJV B;  1R9T C;  3HOZ C;  1G51 A;  1B4A A;  1I3Q K;  3GTQ A;  4AYB D;  3HOW C;  4Y52 C;  3ERE D;  4G7H A;  4OIN A;  3GTQ C;  4KAW X;  5HL8 A;  3RZD K;  3NUH A;  5IYD K;  3S0X A;  4RMF A;  2ZFZ A;  3S17 C;  5TJ3 A;  1C0A A;  3I4M K;  1UV7 A;  1AB4 A;  2V6S A;  3GTG A;  2CFA B;  5IYB K;  2R93 K;  2PMZ L;  3GTG C;  4BBS K;  2B63 A;  2E2H K;  1YNN A;  3GTP K;  4A3B K;  1L0W A;  1HI9 A;  2A6H A;  2NVQ K;  3GTL K;  5IP7 K;  1IW7 A;  3G4C A;  2E2I A;  3H0G A;  5M3F K;  2E2I C;  4BY7 K;  3HOY K;  1JVI A;  2RGR A;  3BP8 C;  4GTE A;  5IYC K;  3PO2 K;  3I4N C;  2Y0S D;  1Y1V C;  3G4A A;  5C4J C;  4LQY A;  3AD8 C;  5IOS A;  1K83 A;  1F9N A;  2NVY C;  1EH1 A;  3MML B;  1WCM K;  1K83 C;  1XZQ B;  2O5J A;  4FM9 A;  3S1R C;  1V5V A;  3S15 C;  5M5W K;  5D4D A;  5FJ8 K;  4AYB L;  3S1M K;  3AH5 A;  4A3M C;  3GTJ K;  4XCH A;  4A3I C;  1O26 A;  2D6F C;  4A93 K;  1B4B A;  1TWH A;  4LJZ A;  3S2H K;  1I6H C;  4Y7N K;  3K7A C;  4PAB A;  1XXA A;  4KM9 A;  4C2M C;  1EFW A;  3GSI A;  1I50 A;  4XLN A;  1I50 C;  1O25 A;  4C3I C;  3GDZ A;  2VUM K;  4KB4 A;  3GTO A;  2GAG C;  4KMH A;  3L4J A;  1TWC K;  4XSX A;  2BE5 A;  3OEP A;  3S1N K;  5IP9 K;  3GTM K;  4BXX K;  3CQZ K;  4C3J K;  4GTC A;  3HOU K;  3T00 A;  5JFE A;  1BGW A;  1F7U A;  4A3D K;  2PPB A;  4X6A C;  1ISE A;  3TFH A;  4G7O A;  1WQH A;  4LK0 A;  1WQF A;  4J3N A;  2WB1 D;  4ILD A;  1TWG K;  2P5M A;  4FZB A;  1IL2 A;  2Y0S L;  4G0V A;  3RZO C;  1EK8 A;  1DCP A;  5C44 K;  4LOW A;  3GEI A;  3FKI K;  1TWF K;  4GZY A;  5IOR A;  5FLM K;  1PJ7 A;  5IOQ A;  3S1Q C;  3N0C A;  1O2A A;  5M3M K;  3V4G A;  4LLG A;  1SFO K;  4A3J C;  2NVX K;  3M3Y K;  4A3K K;  4P5B A;  3S14 C;  4MQ9 A;  3N0B A;  4Q5S A;  2R92 K;  4GTL A;  1F93 A;  3A8J A;  1I3Q A;  1JOE A;  4M1X A;  2E2J K;  3S2D K;  1XZP B;  1I3Q C;  4KN7 A;  1R9T K;  3AQP A;  3HOW K;  4P5A A;  4LK1 A;  2PA8 D;  3S17 K;  1O2F B;  2B63 C;  3FOF A;  2R93 A;  5L46 A;  5IYB C;  2KWA A;  3HOV K;  2ZUF A;  2E2H A;  4BBS C;  1YNJ A;  3GTP A;  2E2H C;  2WB1 L;  4KC6 A;  1ZVU A;  1WSV A;  2JA7 K;  4A3B C;  3H0G C;  3GTL A;  4MEX A;  3FOE A;  2NVQ C;  3GTL C;  4OIP A;  5IP7 C;  4MEY A;  1WOR A;  3SZY A;  2JA8 K;  3PO3 C;  4BY7 C;  1J6W A;  4A3F C;  4QJV A;  3HOY C;  1YX2 A;  4A3L C;  1VGX A;  3BUE A;  5C3E K;  1DCH A;  3I4N K;  1Y1V K;  4BLB A;  1PJ5 A;  1WCM A;  4G0W A;  1WOS A;  2XCR B;  1WCM C;  4A3C C;  2NVY K;  2R7Z K;  1TWA K;  1O29 A;  1O2B A;  3AD9 C;  2O5I A;  2CFA A;  5C4X K;  1TWH C;  3GTJ A;  2WAQ D;  1IBA A;  1VRQ C;  4YFK A;  4A93 C;  2YU9 K;  1WIH A;  2CW0 A;  2PA8 L;  3GTO C;  1I6H K;  3DXJ A;  1F7V A;  4KMU A;  4C3H K;  3A8K A;  3K7A K;  2VUM A;  1WOO A;  1I6V A;  4XLP A;  2VUM C;  4KM8 A;  1TWC A;  4C3I K;  4A3E K;  3S1N C;  3GTM A;  3IPJ A;  4KB2 A;  5JVO A;  5IP9 C;  3GTM C;  3CQZ A;  4BXX C;  5EGE A;  3S16 K;  4C3J C;  4GTB A;  3HOU C;  1USO A;  3T01 A;  3LAP A;  3GTK K;  3QX3 A;  4A3D C;  1INN A;  4YG2 A;  2XCQ A;  2GSO A;  3GEE A;  3HXA A;  1XZQ A;  3ADA C;  1IE0 A;  2JA6 K;  4BBR C;  1DCO A;  5M5Y K;  1TWG A;  4A3G C;  4KN4 A;  3M4O K;  3HOX K;  2GSN A;  3EQL A;  3LPX A;  4OIR A;  2NVT K;  1J6V A;  3RZO K;  2JA5 K; 
#chains in the Genus database with same CATH homology
 3GTO K;  3HOW K;  1XPP A;  5IYC K;  5C44 C;  4BY1 K;  2Y0S D;  3PO2 K;  3I4N C;  4LK1 A;  1Y1V C;  5C4J C;  2PA8 D;  3S17 K;  2A68 A;  3CQZ C;  2B63 C;  4A3E C;  5FLM C;  1Y1W K;  2NVY C;  1WCM K;  1K83 C;  5IYB C;  2O5J A;  3HOV K;  4QIW D;  4BBS C;  2WAQ L;  1YNJ A;  1SFO C;  3S1R C;  4YFN A;  2E2H C;  5M5W K;  3S16 C;  3S15 C;  1HQM A;  1BDF A;  3HKZ L;  5D4D A;  2WB1 L;  4X6A K;  4A3J K;  5FJ8 K;  2PMZ D;  4AYB L;  4A3K C;  3S1M K;  3HOZ K;  3WOD A;  3GTK C;  4A3M C;  2JA7 K;  3GTJ K;  4A3B C;  2R92 C;  3H0G C;  1TWG C;  4A3I C;  4MEX A;  4NOI A;  4A93 K;  4LJZ A;  4G7Z A;  2NVQ C;  3GTL C;  3S2H K;  1I6H C;  3RZD C;  3GTQ K;  4OIP A;  5IP7 C;  4Y7N K;  4MEY A;  5IYD C;  4Y52 K;  2JA6 C;  2JA8 K;  3S2D C;  5TMF A;  3K7A C;  4BBR K;  3PO3 C;  3FKI C;  1TWF C;  5M5X K;  3HOX C;  3M4O C;  4BY7 C;  4XLN A;  4A3G K;  4A3F C;  4JK1 A;  4QJV A;  3HOY C;  1I50 C;  2VUM K;  4A3L C;  2A6E A;  2NVT C;  2JA5 C;  3I4M C;  3H3V L;  1TWC K;  4BY1 C;  4OIO A;  4XSX A;  5C3E K;  2BE5 A;  2R93 C;  3S1N K;  3I4N K;  3S1Q K;  3GTG K;  5IP9 K;  1Y1V K;  3GTM K;  2NVX C;  4ZH4 A;  4BXX K;  3M3Y C;  3CQZ K;  1Y1W C;  2B63 K;  3GTP C;  4C3J K;  1WCM C;  3HOU K;  4A3C C;  2NVY K;  4OIQ A;  2R7Z K;  3HOV C;  3S14 K;  1TWA K;  5TMC A;  4A3D K;  2PPB A;  4X6A C;  2O5I A;  5C4X K;  4XSZ A;  1TWH C;  2E2J C;  4QJV B;  1R9T C;  2WAQ D;  3HOZ C;  1SMY A;  2JA7 C;  4G7O A;  1I3Q K;  4LK0 A;  3HKZ D;  4YFK A;  2E2I K;  2WB1 D;  3H0G K;  1TWG K;  2YU9 K;  4A93 C;  4AYB D;  3HOW C;  2Y0S L;  4Y52 C;  4YFX A;  4G7H A;  4OIN A;  2CW0 A;  3GTQ C;  3RZO C;  2PA8 L;  2A69 A;  3GTO C;  3RZD K;  2JA8 C;  3DXJ A;  5IYC C;  3PO2 C;  1I6H K;  5IYD K;  4KMU A;  4C3H K;  5C44 K;  3K7A K;  1ZYR A;  3S17 C;  3PO3 K;  1I6V A;  1TWF K;  3FKI K;  4XLP A;  5C4J K;  2VUM C;  4A3F K;  4QIW L;  4C3I K;  4A3E K;  4A3L K;  4GZY A;  5FLM K;  3I4M K;  5C3E C;  1K83 K;  3S1N C;  5IYB K;  3S1Q C;  2R93 K;  2PMZ L;  3GTG C;  5IP9 C;  3GTM C;  4BBS K;  5M3M K;  3H3V D;  4BXX C;  4LLG A;  1SFO K;  3S1R K;  4A3J C;  2E2H K;  2NVX K;  3S15 K;  3S16 K;  3HOU C;  3M3Y K;  3S1M C;  1YNN A;  3GTP K;  3GTJ C;  4A3K K;  2R7Z C;  4Q4Z A;  3GTK K;  4MQ9 A;  4A3M K;  3S14 C;  1TWA C;  4A3C K;  2R92 K;  4A3B K;  4Q5S A;  4A3I K;  3S2H C;  4A3D C;  4YG2 A;  4Y7N C;  5C4X C;  2A6H A;  2NVQ K;  3GTL K;  5IP7 K;  1IW7 A;  1TWH K;  2E2J K;  2JA6 K;  4BBR C;  3S2D K;  1I3Q C;  4KN7 A;  5M5Y K;  1R9T K;  4KN4 A;  4A3G C;  5M3F K;  4C2M K;  2E2I C;  3M4O K;  2YU9 C;  3HOX K;  3EQL A;  4BY7 K;  3HOY K;  1I50 K;  4OIR A;  2NVT K;  3RZO K;  2JA5 K;  1TWC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...