1TWCK

Rna polymerase ii complexed with gtp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twcK00
4LK1A 2B63K 3HOXC 4MEXA 5IYDC 1YNNA 5IYBC 4ZH4A 2E2HK 3HOWK 3S1NK 3GTKC 4A93K 3GTJK 3PO2K 4A3CK 1YNJA 4C3JK 5FLMC 4A3EK 2NVQC 5IP9C 2PMZD 1TWFK 2JA5K 2NVYC 4BBSK 4YFNA 1R9TK 2VUMC 5D4DA 1I6HC 1Y1VK 2Y0SD 2E2JC 4KN7A 4BY1C 4OINA 2NVXK 3S14K 1XPPA 2PMZL 4A3IC 4YG2A 2JA7K 4BY7C 4G7ZA 4YFXA 2JA8K 2PA8D 4QJVB 4NOIA 3HKZL 4A3GC 1TWHC 5M3MK 3GTLC 3H0GC 2PPBA 2R7ZK 1IW7A 3S2HK 3I4NC 3HOUK 3S1MC 5M5YK 2R92K 3GTPC 4QIWD 4AYBL 4Y7NC 4LK0A 5C44C 5C4JK 2E2IK 1I50C 3M4OC 1TWCK 4C3IK 2R93K 3RZDK 1I6VA 3RZOK 4G7OA 3DXJA 5IP7K 2B63C 3HOZK 5M5XK 3S1NC 5TMFA 2E2HC 5C3EK 4A3KC 3HOWC 4A93C 4Y52K 3GTGK 2WB1L 1WCMC 3EQLA 4QIWL 4OIOA 3GTJC 3PO2C 4A3CC 3S17K 3M3YK 4A3EC 1TWFC 2JA5C 1TWGK 4Q4ZA 1SMYA 2NVTK 3S15K 2WAQL 4KN4A 1R9TC 3HKZD 4QJVA 1Y1VC 4A3LK 4A3JK 2NVXC 1BDFA 5TMCA 4A3MK 3S16K 4BXXK 2A69A 4OIPA 2JA7C 1K83K 3CQZK 2A6EA 4MQ9A 3WODA 4AYBD 4BBRC 4C2MK 5M5WK 5M3FK 3S1QK 4XSXA 4KMUA 4C3HK 4X6AC 3S2HC 4A3FK 1Y1WK 2R7ZC 3HOUC 1I3QK 3S1RK 2JA6K 3I4MK 3PO3K 2WB1D 2R92C 4XSZA 5C4JC 3HOVC 2E2IC 4A3DK 2NVQK 1TWCC 5IP9K 3H3VL 4XLNA 3RZDC 5IP7C 3HOZC 2WAQD 5C3EC 1I6HK 4Y52C 3GTGC 1TWAK 5C4XC 3GTOK 3GTMK 4BBSC 4BY7K 3FKIK 3HOYK 4OIQA 1TWGC 2NVTC 3S15C 3GTQK 1TWHK 4OIRA 3GTLK 3H0GK 4A3LC 4A3JC 3S14C 4A3MC 4BXXC 3S2DK 4A3BK 1HQMA 3S1MK 1K83C 3S1QC 2JA8C 2YU9K 1SFOK 3H3VD 5IYCK 3K7AK 4G7HA 3HOXK 5C4XK 5IYDK 5IYBK 4A3FC 1Y1WC 3GTKK 4A3KK 1I3QC 3S1RC 2JA6C 3I4MC 3PO3C 1WCMK 2CW0A 2O5JA 2BE5A 5FLMK 4GZYA 2R93C 4A3DC 3RZOC 2NVYK 2VUMK 2E2JK 4BY1K 2A6HA 1TWAC 4MEYA 4A3IK 3S17C 3M3YC 4Q5SA 3GTOC 3GTMC 4BBRK 3FKIC 4LLGA 3HOYC 2A68A 4A3GK 4X6AK 2Y0SL 3GTQC 2O5IA 3I4NK 3S16C 4YFKA 3S2DC 4A3BC 3CQZC 3GTPK 4XLPA 4Y7NK 4LJZA 5C44K 1I50K 5FJ8K 3HOVK 2PA8L 4JK1A 2YU9C 3M4OK 1SFOC 1ZYRA 5IYCC 3K7AC
chains in the Genus database with same CATH superfamily
3HOXC 2XCRB 4A93K 3PO2K 3GTPA 1YNJA 1IS1A 1I50A 4KB4A 4KATA 5JVOA 1KQ4A 2Y0SD 2E2JC 3TFJA 2NVXK 1XXCA 3S14K 1EQRA 4BY7C 5CHPA 4G7ZA 4G0WA 1F9NA 4PABA 4NOIA 3HKZL 3AH5A 2R7ZK 1BJTA 2NVXA 3HOUK 4KMAA 4GTBA 1IE0A 2R92K 3RZOK 1O2AA 2R7ZA 4G7OA 3S1NC 2E2HC 1J6XA 4A3CC 4OIOA 2FQOA 2R92A 4C3JC 4A3EC 3A8KA 1YX2A 1WORA 3L4KA 1EK8A 1EI6A 4A3LK 3V4GA 2ZUFA 4BBRC 3GEIA 1YCLA 1B4BA 3S2HC 4A3FK 2E2IC 2NVQK 4XLNA 1IQ0A 1UV7A 4GFQA 3RZDC 5IP7C 3HOZC 1ZBSA 4RMFA 1VRQC 4M1XA 1G51A 5EGHA 1TWGC 3ADAC 1DCOA 1TWHK 1O28A 1WOPA 3H0GK 4A3MC 4BLBA 4GT9A 3Q3QA 4LR2A 1SFOK 1JQWA 4WJ3M 5JFEA 5C4XK 3H0GA 2CFAB 3GTKK 4A3KK 3CQZA 3PO3C 2CW0A 2BE5A 5FLMK 3VA7A 1SFOA 4DDQA 2VUMK 3GDZA 3GTKA 4BY1K 1TWAC 3M3YC 1VLOA 1BS2A 3CAGA 3GTMC 3HOYC 2VUMA 1VGXA 4GTCA 2Y0SL 4A3GK 4X6AK 2O5IA 1WQGA 3S16C 4YFKA 2CFAA 3S2DC 5EGEA 4WJ4A 4LOWA 5C44K 2GAGC 5FJ8K 3HOVK 4JK1A 2V6TA 4FZBA 5IYDC 3GIRA 3G4AA 2RGRA 3A8IA 5IP9C 2PMZD 4KB2A 3QX3A 2NVYC 1DD5A 1R9TK 1XZQB 5D4DA 1I6HC 4OINA 1XZPB 1VJEA 2JA7K 4AH6A 3S0XA 4YFXA 2JA8K 2PA8D 1R9TA 1XXBA 1IW7A 3I4NC 1O24A 2JA7A 3GTPC 5C4JK 4Y7NC 4LK0A 3JSTA 1I50C 1TWCK 1IBAA 4C3IK 4A93C 4Y52K 1XZQA 4QIWL 3EQLA 3PO2C 1F7VA 1XZPA 1TWCA 1JVIA 4Q4ZA 3S15K 4KN4A 2KWAA 4GTLA 5L46A 4A3JK 2NVXC 1BDFA 1F7UA 4OIPA 3WODA 4AYBD 4P5BA 4XSXA 2R7ZC 1INNA 3HOUC 1O2BA 1I3QK 3S1RK 3I4MK 2R92C 4XSZA 4A3DK 2P8TA 3BP8C 2WAQD 1I3QA 3T02A 4BBSC 4BY7K 3FHZA 3FKIK 4GTEA 4WILA 4OIQA 3GTQK 1WSVA 4A3LC 1DCHA 3MMLB 3ERED 1B4AA 3FKIA 3LPXA 3GTQA 3K7AC 1X31C 5IYBK 4A3FC 1GE9A 1PJ6A 4P9SA 4GZYA 4KMHA 2R93C 3SZYA 2P5MA 1J6WA 3N3YA 3A8JA 4A3IK 3S17C 4KARA 4BBRK 3BP3A 1J6VA 5IOQA 3L4JA 3CQZC 4GTDA 3M4OK 2PA8L 1SFOC 2GSUA 1TWHA 2B63K 4MEXA 5C4XC 1HI9A 1YNNA 4ZH4A 3HOWK 1AB4A 3GTKC 3GTJK 5FLMC 1TWFK 2JA5K 2B63A 2VUMC 1Y1VK 4BY1C 3GTJA 2ZUEA 5CJ9A 2XCQA 4YG2A 1ZQ1C 1BGWA 1TWFA 2JA5A 5IORA 4A3GC 1Y1VA 5M3MK 3GTLC 2GSNA 4C45A 3S1MC 3HXAA 5M5YK 1J98A 4AYBL 5C44C 3IPJA 2GSOA 3DXJA 5C3EK 1USMA 3GTGK 1WCMC 3M3YK 2NVTK 1SMYA 1ZVUA 3LAPA 2WAQL 1R9TC 3TFIA 3GTGA 1WSRA 3N0CA 3S16K 4BXXK 2A69A 1PJ7A 1K83K 5M5WK 2JA7C 1WIHA 3S1QK 4C2MK 1F93A 4LQYA 3GSIA 4P5AA 4C3HK 3TFHA 2ZFZA 2V6SA 1Y1WK 2JA6K 2WB1D 1K83A 3AD8C 5C4JC 1TWCC 5IP9K 4C3IC 1Y1WA 2Y3PA 1I6HK 2JA6A 4Y52C 3FOFA 3GTOK 3S15C 4GTAA 2W7VA 4OIRA 4A3JC 3S14C 4FM9A 4A3BK 4BKWA 3GTOA 1VH2A 3AD7C 2YU9K 3H3VD 5IYCK 3K7AK 4G7HA 3HOXK 1I3QC 4XCHA 3S1RC 3I4MC 2O5JA 5E68A 3TTGA 4G0UA 1O25A 4KDDA 1RU0A 2YU9A 1O2FB 2XCOA 3RZOC 4A3DC 1EFWA 2E2JK 2A6HA 2GAHC 1V5VA 3N0BA 3FKIC 1USOA 2A68A 3GTQC 1EH1A 4KMDA 4XLPA 4LJZA 3OPFA 2V6UA 1IL2A 4LK1A 3S1NK 5IYBC 2E2HK 1ZXOA 4KM9A 4A3CK 4C3JK 1ISEA 1XXAA 2PHCB 3FOEA 4A3EK 2NVQC 4BBSK 3NUHA 4YFNA 3AQOA 4GTFA 2E2HA 2JH3A 4KN7A 1XPPA 2PMZL 4A3IC 4O2DA 4QJVB 1TWHC 3S2HK 4J3NA 3H0GC 2PPBA 5HL8A 5TJ3A 4KM8A 4QIWD 3GEEA 2E2IK 3T00A 2FQTA 3M4OC 2R93K 3RZDK 1I6VA 5IP7K 2B63C 1PJ5A 5M5XK 3HOZK 5TMFA 3HOWC 3LAJA 3GEHA 4A3KC 2WB1L 3GTJC 2E2IA 3S17K 2R93A 1TWFC 5IOSA 2JA5C 1TWGK 3HKZD 4QJVA 1Y1VC 1WOSA 4KC6A 1O26A 4KASA 5TMCA 4A3MK 3CQZK 4PAAA 2A6EA 4MQ9A 5M3FK 1TWGA 4KMUA 4X6AC 3PO3K 1O27A 3HOVC 1C0AA 3H3VL 5C3EC 1O29A 4G0VA 3GTGC 1TWAK 3GTMK 3G4CA 3BUEA 3HOYK 2D6FC 2NVTC 3GTLK 1TWAA 4BXXC 3S2DK 1HQMA 1WQHA 3AQPA 4BLAA 1K83C 3S1MK 3GTMA 3S1QC 4C2MC 2JA8C 4C3HC 3GTLA 5IYDK 1Y1WC 2JA6C 1WCMK 2EBBA 3OEPA 2NVYK 1JOEA 1DCPA 1ZYRA 1WQFA 1WOOA 1WCMA 4MEYA 4Q5SA 3GTOC 2NVYA 4LLGA 4KAWX 2RH6A 3T01A 3SZZA 3I4NK 3AD9C 4A3BC 3GTPK 4Y7NK 1I50K 2YU9C 4ILDA 5IYCC 5IOTA 3OREA 1L0WA
chains in the Genus database with same CATH topology
4LK1A 2B63K 3HOXC 4MEXA 5IYDC 1YNNA 5IYBC 4ZH4A 2E2HK 3HOWK 3S1NK 3GTKC 4A93K 3GTJK 3PO2K 4A3CK 1YNJA 4C3JK 5FLMC 4A3EK 2NVQC 5IP9C 2PMZD 1TWFK 2JA5K 2NVYC 4BBSK 4YFNA 1R9TK 2VUMC 5D4DA 1I6HC 1Y1VK 2Y0SD 2E2JC 4KN7A 4BY1C 4OINA 2NVXK 3S14K 1XPPA 2PMZL 4A3IC 4YG2A 2JA7K 4BY7C 4G7ZA 4YFXA 2JA8K 2PA8D 4QJVB 4NOIA 3HKZL 4A3GC 1TWHC 5M3MK 3GTLC 3H0GC 2PPBA 2R7ZK 1IW7A 3S2HK 3I4NC 3HOUK 3S1MC 5M5YK 2R92K 3GTPC 4QIWD 4AYBL 4Y7NC 4LK0A 5C44C 5C4JK 2E2IK 1I50C 3M4OC 1TWCK 4C3IK 2R93K 3RZDK 1I6VA 3RZOK 4G7OA 3DXJA 5IP7K 2B63C 3HOZK 5M5XK 3S1NC 5TMFA 2E2HC 5C3EK 4A3KC 3HOWC 4A93C 4Y52K 3GTGK 2WB1L 1WCMC 3EQLA 4QIWL 4OIOA 3GTJC 3PO2C 4A3CC 3S17K 3M3YK 4A3EC 1TWFC 2JA5C 1TWGK 4Q4ZA 1SMYA 2NVTK 3S15K 2WAQL 4KN4A 1R9TC 3HKZD 4QJVA 1Y1VC 4A3LK 4A3JK 2NVXC 1BDFA 5TMCA 4A3MK 3S16K 4BXXK 2A69A 4OIPA 2JA7C 1K83K 3CQZK 2A6EA 4MQ9A 3WODA 4AYBD 4BBRC 4C2MK 5M5WK 5M3FK 3S1QK 4XSXA 4KMUA 4C3HK 4X6AC 3S2HC 4A3FK 1Y1WK 2R7ZC 3HOUC 1I3QK 3S1RK 2JA6K 3I4MK 3PO3K 2WB1D 2R92C 4XSZA 5C4JC 3HOVC 2E2IC 4A3DK 2NVQK 1TWCC 5IP9K 3H3VL 4XLNA 3RZDC 5IP7C 3HOZC 2WAQD 5C3EC 1I6HK 4Y52C 3GTGC 1TWAK 5C4XC 3GTOK 3GTMK 4BBSC 4BY7K 3FKIK 3HOYK 4OIQA 1TWGC 2NVTC 3S15C 3GTQK 1TWHK 4OIRA 3GTLK 3H0GK 4A3LC 4A3JC 3S14C 4A3MC 4BXXC 3S2DK 4A3BK 1HQMA 3S1MK 1K83C 3S1QC 2JA8C 2YU9K 1SFOK 3H3VD 5IYCK 3K7AK 4G7HA 3HOXK 5C4XK 5IYDK 5IYBK 4A3FC 1Y1WC 3GTKK 4A3KK 1I3QC 3S1RC 2JA6C 3I4MC 3PO3C 1WCMK 2CW0A 2O5JA 2BE5A 5FLMK 4GZYA 2R93C 4A3DC 3RZOC 2NVYK 2VUMK 2E2JK 4BY1K 2A6HA 1TWAC 4MEYA 4A3IK 3S17C 3M3YC 4Q5SA 3GTOC 3GTMC 4BBRK 3FKIC 4LLGA 3HOYC 2A68A 4A3GK 4X6AK 2Y0SL 3GTQC 2O5IA 3I4NK 3S16C 4YFKA 3S2DC 4A3BC 3CQZC 3GTPK 4XLPA 4Y7NK 4LJZA 5C44K 1I50K 5FJ8K 3HOVK 2PA8L 4JK1A 2YU9C 3M4OK 1SFOC 1ZYRA 5IYCC 3K7AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK1 A;  2B63 K;  3HOX C;  4MEX A;  5IYD C;  1YNN A;  5IYB C;  4ZH4 A;  2E2H K;  3HOW K;  3S1N K;  3GTK C;  4A93 K;  3GTJ K;  3PO2 K;  4A3C K;  1YNJ A;  4C3J K;  5FLM C;  4A3E K;  2NVQ C;  5IP9 C;  2PMZ D;  1TWF K;  2JA5 K;  2NVY C;  4BBS K;  4YFN A;  1R9T K;  2VUM C;  5D4D A;  1I6H C;  1Y1V K;  2Y0S D;  2E2J C;  4KN7 A;  4BY1 C;  4OIN A;  2NVX K;  3S14 K;  1XPP A;  2PMZ L;  4A3I C;  4YG2 A;  2JA7 K;  4BY7 C;  4G7Z A;  4YFX A;  2JA8 K;  2PA8 D;  4QJV B;  4NOI A;  3HKZ L;  4A3G C;  1TWH C;  5M3M K;  3GTL C;  3H0G C;  2PPB A;  2R7Z K;  1IW7 A;  3S2H K;  3I4N C;  3HOU K;  3S1M C;  5M5Y K;  2R92 K;  3GTP C;  4QIW D;  4AYB L;  4Y7N C;  4LK0 A;  5C44 C;  5C4J K;  2E2I K;  1I50 C;  3M4O C;  1TWC K;  4C3I K;  2R93 K;  3RZD K;  1I6V A;  3RZO K;  4G7O A;  3DXJ A;  5IP7 K;  2B63 C;  3HOZ K;  5M5X K;  3S1N C;  5TMF A;  2E2H C;  5C3E K;  4A3K C;  3HOW C;  4A93 C;  4Y52 K;  3GTG K;  2WB1 L;  1WCM C;  3EQL A;  4QIW L;  4OIO A;  3GTJ C;  3PO2 C;  4A3C C;  3S17 K;  3M3Y K;  4A3E C;  1TWF C;  2JA5 C;  1TWG K;  4Q4Z A;  1SMY A;  2NVT K;  3S15 K;  2WAQ L;  4KN4 A;  1R9T C;  3HKZ D;  4QJV A;  1Y1V C;  4A3L K;  4A3J K;  2NVX C;  1BDF A;  5TMC A;  4A3M K;  3S16 K;  4BXX K;  2A69 A;  4OIP A;  2JA7 C;  1K83 K;  3CQZ K;  2A6E A;  4MQ9 A;  3WOD A;  4AYB D;  4BBR C;  4C2M K;  5M5W K;  5M3F K;  3S1Q K;  4XSX A;  4KMU A;  4C3H K;  4X6A C;  3S2H C;  4A3F K;  1Y1W K;  2R7Z C;  3HOU C;  1I3Q K;  3S1R K;  2JA6 K;  3I4M K;  3PO3 K;  2WB1 D;  2R92 C;  4XSZ A;  5C4J C;  3HOV C;  2E2I C;  4A3D K;  2NVQ K;  1TWC C;  5IP9 K;  3H3V L;  4XLN A;  3RZD C;  5IP7 C;  3HOZ C;  2WAQ D;  5C3E C;  1I6H K;  4Y52 C;  3GTG C;  1TWA K;  5C4X C;  3GTO K;  3GTM K;  4BBS C;  4BY7 K;  3FKI K;  3HOY K;  4OIQ A;  1TWG C;  2NVT C;  3S15 C;  3GTQ K;  1TWH K;  4OIR A;  3GTL K;  3H0G K;  4A3L C;  4A3J C;  3S14 C;  4A3M C;  4BXX C;  3S2D K;  4A3B K;  1HQM A;  3S1M K;  1K83 C;  3S1Q C;  2JA8 C;  2YU9 K;  1SFO K;  3H3V D;  5IYC K;  3K7A K;  4G7H A;  3HOX K;  5C4X K;  5IYD K;  5IYB K;  4A3F C;  1Y1W C;  3GTK K;  4A3K K;  1I3Q C;  3S1R C;  2JA6 C;  3I4M C;  3PO3 C;  1WCM K;  2CW0 A;  2O5J A;  2BE5 A;  5FLM K;  4GZY A;  2R93 C;  4A3D C;  3RZO C;  2NVY K;  2VUM K;  2E2J K;  4BY1 K;  2A6H A;  1TWA C;  4MEY A;  4A3I K;  3S17 C;  3M3Y C;  4Q5S A;  3GTO C;  3GTM C;  4BBR K;  3FKI C;  4LLG A;  3HOY C;  2A68 A;  4A3G K;  4X6A K;  2Y0S L;  3GTQ C;  2O5I A;  3I4N K;  3S16 C;  4YFK A;  3S2D C;  4A3B C;  3CQZ C;  3GTP K;  4XLP A;  4Y7N K;  4LJZ A;  5C44 K;  1I50 K;  5FJ8 K;  3HOV K;  2PA8 L;  4JK1 A;  2YU9 C;  3M4O K;  1SFO C;  1ZYR A;  5IYC C;  3K7A C; 
#chains in the Genus database with same CATH topology
 3HOX C;  2XCR B;  4A93 K;  3PO2 K;  3GTP A;  1YNJ A;  1IS1 A;  1I50 A;  4KB4 A;  4KAT A;  5JVO A;  1KQ4 A;  2Y0S D;  2E2J C;  3TFJ A;  2NVX K;  1XXC A;  3S14 K;  1EQR A;  4BY7 C;  5CHP A;  4G7Z A;  4G0W A;  1F9N A;  4PAB A;  4NOI A;  3HKZ L;  3AH5 A;  2R7Z K;  1BJT A;  2NVX A;  3HOU K;  4KMA A;  4GTB A;  1IE0 A;  2R92 K;  3RZO K;  1O2A A;  2R7Z A;  4G7O A;  3S1N C;  2E2H C;  1J6X A;  4A3C C;  4OIO A;  2FQO A;  2R92 A;  4C3J C;  4A3E C;  3A8K A;  1YX2 A;  1WOR A;  3L4K A;  1EK8 A;  1EI6 A;  4A3L K;  3V4G A;  2ZUF A;  4BBR C;  3GEI A;  1YCL A;  1B4B A;  3S2H C;  4A3F K;  2E2I C;  2NVQ K;  4XLN A;  1IQ0 A;  1UV7 A;  4GFQ A;  3RZD C;  5IP7 C;  3HOZ C;  1ZBS A;  4RMF A;  1VRQ C;  4M1X A;  1G51 A;  5EGH A;  1TWG C;  3ADA C;  1DCO A;  1TWH K;  1O28 A;  1WOP A;  3H0G K;  4A3M C;  4BLB A;  4GT9 A;  3Q3Q A;  4LR2 A;  1SFO K;  1JQW A;  4WJ3 M;  5JFE A;  5C4X K;  3H0G A;  2CFA B;  3GTK K;  4A3K K;  3CQZ A;  3PO3 C;  2CW0 A;  2BE5 A;  5FLM K;  3VA7 A;  1SFO A;  4DDQ A;  2VUM K;  3GDZ A;  3GTK A;  4BY1 K;  1TWA C;  3M3Y C;  1VLO A;  1BS2 A;  3CAG A;  3GTM C;  3HOY C;  2VUM A;  1VGX A;  4GTC A;  2Y0S L;  4A3G K;  4X6A K;  2O5I A;  1WQG A;  3S16 C;  4YFK A;  2CFA A;  3S2D C;  5EGE A;  4WJ4 A;  4LOW A;  5C44 K;  2GAG C;  5FJ8 K;  3HOV K;  4JK1 A;  2V6T A;  4FZB A;  5IYD C;  3GIR A;  3G4A A;  2RGR A;  3A8I A;  5IP9 C;  2PMZ D;  4KB2 A;  3QX3 A;  2NVY C;  1DD5 A;  1R9T K;  1XZQ B;  5D4D A;  1I6H C;  4OIN A;  1XZP B;  1VJE A;  2JA7 K;  4AH6 A;  3S0X A;  4YFX A;  2JA8 K;  2PA8 D;  1R9T A;  1XXB A;  1IW7 A;  3I4N C;  1O24 A;  2JA7 A;  3GTP C;  5C4J K;  4Y7N C;  4LK0 A;  3JST A;  1I50 C;  1TWC K;  1IBA A;  4C3I K;  4A93 C;  4Y52 K;  1XZQ A;  4QIW L;  3EQL A;  3PO2 C;  1F7V A;  1XZP A;  1TWC A;  1JVI A;  4Q4Z A;  3S15 K;  4KN4 A;  2KWA A;  4GTL A;  5L46 A;  4A3J K;  2NVX C;  1BDF A;  1F7U A;  4OIP A;  3WOD A;  4AYB D;  4P5B A;  4XSX A;  2R7Z C;  1INN A;  3HOU C;  1O2B A;  1I3Q K;  3S1R K;  3I4M K;  2R92 C;  4XSZ A;  4A3D K;  2P8T A;  3BP8 C;  2WAQ D;  1I3Q A;  3T02 A;  4BBS C;  4BY7 K;  3FHZ A;  3FKI K;  4GTE A;  4WIL A;  4OIQ A;  3GTQ K;  1WSV A;  4A3L C;  1DCH A;  3MML B;  3ERE D;  1B4A A;  3FKI A;  3LPX A;  3GTQ A;  3K7A C;  1X31 C;  5IYB K;  4A3F C;  1GE9 A;  1PJ6 A;  4P9S A;  4GZY A;  4KMH A;  2R93 C;  3SZY A;  2P5M A;  1J6W A;  3N3Y A;  3A8J A;  4A3I K;  3S17 C;  4KAR A;  4BBR K;  3BP3 A;  1J6V A;  5IOQ A;  3L4J A;  3CQZ C;  4GTD A;  3M4O K;  2PA8 L;  1SFO C;  2GSU A;  1TWH A;  2B63 K;  4MEX A;  5C4X C;  1HI9 A;  1YNN A;  4ZH4 A;  3HOW K;  1AB4 A;  3GTK C;  3GTJ K;  5FLM C;  1TWF K;  2JA5 K;  2B63 A;  2VUM C;  1Y1V K;  4BY1 C;  3GTJ A;  2ZUE A;  5CJ9 A;  2XCQ A;  4YG2 A;  1ZQ1 C;  1BGW A;  1TWF A;  2JA5 A;  5IOR A;  4A3G C;  1Y1V A;  5M3M K;  3GTL C;  2GSN A;  4C45 A;  3S1M C;  3HXA A;  5M5Y K;  1J98 A;  4AYB L;  5C44 C;  3IPJ A;  2GSO A;  3DXJ A;  5C3E K;  1USM A;  3GTG K;  1WCM C;  3M3Y K;  2NVT K;  1SMY A;  1ZVU A;  3LAP A;  2WAQ L;  1R9T C;  3TFI A;  3GTG A;  1WSR A;  3N0C A;  3S16 K;  4BXX K;  2A69 A;  1PJ7 A;  1K83 K;  5M5W K;  2JA7 C;  1WIH A;  3S1Q K;  4C2M K;  1F93 A;  4LQY A;  3GSI A;  4P5A A;  4C3H K;  3TFH A;  2ZFZ A;  2V6S A;  1Y1W K;  2JA6 K;  2WB1 D;  1K83 A;  3AD8 C;  5C4J C;  1TWC C;  5IP9 K;  4C3I C;  1Y1W A;  2Y3P A;  1I6H K;  2JA6 A;  4Y52 C;  3FOF A;  3GTO K;  3S15 C;  4GTA A;  2W7V A;  4OIR A;  4A3J C;  3S14 C;  4FM9 A;  4A3B K;  4BKW A;  3GTO A;  1VH2 A;  3AD7 C;  2YU9 K;  3H3V D;  5IYC K;  3K7A K;  4G7H A;  3HOX K;  1I3Q C;  4XCH A;  3S1R C;  3I4M C;  2O5J A;  5E68 A;  3TTG A;  4G0U A;  1O25 A;  4KDD A;  1RU0 A;  2YU9 A;  1O2F B;  2XCO A;  3RZO C;  4A3D C;  1EFW A;  2E2J K;  2A6H A;  2GAH C;  1V5V A;  3N0B A;  3FKI C;  1USO A;  2A68 A;  3GTQ C;  1EH1 A;  4KMD A;  4XLP A;  4LJZ A;  3OPF A;  2V6U A;  1IL2 A;  4LK1 A;  3S1N K;  5IYB C;  2E2H K;  1ZXO A;  4KM9 A;  4A3C K;  4C3J K;  1ISE A;  1XXA A;  2PHC B;  3FOE A;  4A3E K;  2NVQ C;  4BBS K;  3NUH A;  4YFN A;  3AQO A;  4GTF A;  2E2H A;  2JH3 A;  4KN7 A;  1XPP A;  2PMZ L;  4A3I C;  4O2D A;  4QJV B;  1TWH C;  3S2H K;  4J3N A;  3H0G C;  2PPB A;  5HL8 A;  5TJ3 A;  4KM8 A;  4QIW D;  3GEE A;  2E2I K;  3T00 A;  2FQT A;  3M4O C;  2R93 K;  3RZD K;  1I6V A;  5IP7 K;  2B63 C;  1PJ5 A;  5M5X K;  3HOZ K;  5TMF A;  3HOW C;  3LAJ A;  3GEH A;  4A3K C;  2WB1 L;  3GTJ C;  2E2I A;  3S17 K;  2R93 A;  1TWF C;  5IOS A;  2JA5 C;  1TWG K;  3HKZ D;  4QJV A;  1Y1V C;  1WOS A;  4KC6 A;  1O26 A;  4KAS A;  5TMC A;  4A3M K;  3CQZ K;  4PAA A;  2A6E A;  4MQ9 A;  5M3F K;  1TWG A;  4KMU A;  4X6A C;  3PO3 K;  1O27 A;  3HOV C;  1C0A A;  3H3V L;  5C3E C;  1O29 A;  4G0V A;  3GTG C;  1TWA K;  3GTM K;  3G4C A;  3BUE A;  3HOY K;  2D6F C;  2NVT C;  3GTL K;  1TWA A;  4BXX C;  3S2D K;  1HQM A;  1WQH A;  3AQP A;  4BLA A;  1K83 C;  3S1M K;  3GTM A;  3S1Q C;  4C2M C;  2JA8 C;  4C3H C;  3GTL A;  5IYD K;  1Y1W C;  2JA6 C;  1WCM K;  2EBB A;  3OEP A;  2NVY K;  1JOE A;  1DCP A;  1ZYR A;  1WQF A;  1WOO A;  1WCM A;  4MEY A;  4Q5S A;  3GTO C;  2NVY A;  4LLG A;  4KAW X;  2RH6 A;  3T01 A;  3SZZ A;  3I4N K;  3AD9 C;  4A3B C;  3GTP K;  4Y7N K;  1I50 K;  2YU9 C;  4ILD A;  5IYC C;  5IOT A;  3ORE A;  1L0W A; 
#chains in the Genus database with same CATH homology
 4LK1 A;  2B63 K;  3HOX C;  4MEX A;  5IYD C;  1YNN A;  5IYB C;  4ZH4 A;  2E2H K;  3HOW K;  3S1N K;  3GTK C;  4A93 K;  3GTJ K;  3PO2 K;  4A3C K;  1YNJ A;  4C3J K;  5FLM C;  4A3E K;  2NVQ C;  5IP9 C;  2PMZ D;  1TWF K;  2JA5 K;  2NVY C;  4BBS K;  4YFN A;  1R9T K;  2VUM C;  5D4D A;  1I6H C;  1Y1V K;  2Y0S D;  2E2J C;  4KN7 A;  4BY1 C;  4OIN A;  2NVX K;  3S14 K;  1XPP A;  2PMZ L;  4A3I C;  4YG2 A;  2JA7 K;  4BY7 C;  4G7Z A;  4YFX A;  2JA8 K;  2PA8 D;  4QJV B;  4NOI A;  3HKZ L;  4A3G C;  1TWH C;  5M3M K;  3GTL C;  3H0G C;  2PPB A;  2R7Z K;  1IW7 A;  3S2H K;  3I4N C;  3HOU K;  3S1M C;  5M5Y K;  2R92 K;  3GTP C;  4QIW D;  4AYB L;  4Y7N C;  4LK0 A;  5C44 C;  5C4J K;  2E2I K;  1I50 C;  3M4O C;  1TWC K;  4C3I K;  2R93 K;  3RZD K;  1I6V A;  3RZO K;  4G7O A;  3DXJ A;  5IP7 K;  2B63 C;  3HOZ K;  5M5X K;  3S1N C;  5TMF A;  2E2H C;  5C3E K;  4A3K C;  3HOW C;  4A93 C;  4Y52 K;  3GTG K;  2WB1 L;  1WCM C;  3EQL A;  4QIW L;  4OIO A;  3GTJ C;  3PO2 C;  4A3C C;  3S17 K;  3M3Y K;  4A3E C;  1TWF C;  2JA5 C;  1TWG K;  4Q4Z A;  1SMY A;  2NVT K;  3S15 K;  2WAQ L;  4KN4 A;  1R9T C;  3HKZ D;  4QJV A;  1Y1V C;  4A3L K;  4A3J K;  2NVX C;  1BDF A;  5TMC A;  4A3M K;  3S16 K;  4BXX K;  2A69 A;  4OIP A;  2JA7 C;  1K83 K;  3CQZ K;  2A6E A;  4MQ9 A;  3WOD A;  4AYB D;  4BBR C;  4C2M K;  5M5W K;  5M3F K;  3S1Q K;  4XSX A;  4KMU A;  4C3H K;  4X6A C;  3S2H C;  4A3F K;  1Y1W K;  2R7Z C;  3HOU C;  1I3Q K;  3S1R K;  2JA6 K;  3I4M K;  3PO3 K;  2WB1 D;  2R92 C;  4XSZ A;  5C4J C;  3HOV C;  2E2I C;  4A3D K;  2NVQ K;  1TWC C;  5IP9 K;  3H3V L;  4XLN A;  3RZD C;  5IP7 C;  3HOZ C;  2WAQ D;  5C3E C;  1I6H K;  4Y52 C;  3GTG C;  1TWA K;  5C4X C;  3GTO K;  3GTM K;  4BBS C;  4BY7 K;  3FKI K;  3HOY K;  4OIQ A;  1TWG C;  2NVT C;  3S15 C;  3GTQ K;  1TWH K;  4OIR A;  3GTL K;  3H0G K;  4A3L C;  4A3J C;  3S14 C;  4A3M C;  4BXX C;  3S2D K;  4A3B K;  1HQM A;  3S1M K;  1K83 C;  3S1Q C;  2JA8 C;  2YU9 K;  1SFO K;  3H3V D;  5IYC K;  3K7A K;  4G7H A;  3HOX K;  5C4X K;  5IYD K;  5IYB K;  4A3F C;  1Y1W C;  3GTK K;  4A3K K;  1I3Q C;  3S1R C;  2JA6 C;  3I4M C;  3PO3 C;  1WCM K;  2CW0 A;  2O5J A;  2BE5 A;  5FLM K;  4GZY A;  2R93 C;  4A3D C;  3RZO C;  2NVY K;  2VUM K;  2E2J K;  4BY1 K;  2A6H A;  1TWA C;  4MEY A;  4A3I K;  3S17 C;  3M3Y C;  4Q5S A;  3GTO C;  3GTM C;  4BBR K;  3FKI C;  4LLG A;  3HOY C;  2A68 A;  4A3G K;  4X6A K;  2Y0S L;  3GTQ C;  2O5I A;  3I4N K;  3S16 C;  4YFK A;  3S2D C;  4A3B C;  3CQZ C;  3GTP K;  4XLP A;  4Y7N K;  4LJZ A;  5C44 K;  1I50 K;  5FJ8 K;  3HOV K;  2PA8 L;  4JK1 A;  2YU9 C;  3M4O K;  1SFO C;  1ZYR A;  5IYC C;  3K7A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...