1TWCK

Rna polymerase ii complexed with gtp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twcK00
1IW7A 3HOWK 4BY7K 2A69A 3GTGK 3M4OK 4BY1K 1K83C 3HOUC 4A93K 4BXXC 1TWAK 1SMYA 2JA6K 2A6EA 3RZDK 3S1RK 1HQMA 3HOYC 3RZOK 3K7AC 3GTJC 2A6HA 4A3FK 3S14K 1YNNA 5IP7K 3HOXC 1TWHC 2E2IC 2R93K 3GTQC 2R92K 3HOZC 4Q5SA 3DXJA 3FKIK 4AYBD 1WCMC 3PO2K 1ZYRA 2PA8L 4OIPA 5M5YK 5M5WK 5C3EC 4A3BK 2WB1D 1TWFC 4X6AK 2JA8K 3S15K 4QIWL 1R9TK 2NVYC 5TMCA 4A3CC 3H0GC 2O5IA 4A3MK 2JA7K 1YNJA 2JA5K 3HOVC 4LLGA 5IYDC 4MQ9A 4Y7NC 4MEYA 4OIRA 1Y1VC 4YFXA 3GTLC 2PMZL 4BBRK 2WAQD 4LK0A 4Q4ZA 4A3JC 2E2JC 3H3VL 3S2HK 4A3GC 3CQZC 2YU9K 1I6HC 1Y1WC 3GTMK 4C3HK 4XSXA 1TWGC 4BY7C 3S16C 3M4OC 3GTGC 4A93C 4C2MK 4BY1C 2NVXK 3I4MK 2JA6C 3S1MC 5FLMK 4A3IK 3S1RC 2A68A 2B63K 3I4NK 3RZOC 5IYBK 3S1QC 5C4JK 4A3KK 2R93C 4G7OA 4KN7A 3M3YK 3FKIC 4Y52C 2VUMK 3GTKK 3PO2C 4QIWD 3GTOK 2R7ZK 3PO3C 3S17C 5M5XK 4A3BC 5IP9C 2JA8C 4YFNA 3S15C 2Y0SD 1TWCK 2CW0A 5M3FK 5C4XC 3GTPK 4A3MC 4BXXK 4NOIA 2JA5C 4YFKA 3HOYK 4ZH4A 4GZYA 3HOXK 4A3LC 5C44C 2NVQC 4BBRC 4QJVA 3HOZK 4BBSK 4KN4A 2E2HK 1WCMK 1XPPA 2YU9C 3HOWC 5IYCK 4AYBL 1TWAC 1TWFK 4XLPA 3HKZL 3WODA 4A3DK 4MEXA 3RZDC 4A3EK 4LK1A 3S14C 4A3FC 1I6VA 5IP7C 3S1NK 2B63C 3I4NC 2NVTK 5IYBC 3S2DK 4Y7NK 1SFOK 5C4JC 2PA8D 4JK1A 4A3KC 2R92C 4C3JK 4YG2A 1I50K 1Y1VK 5TMFA 3GTLK 4KMUA 4XSZA 3M3YC 2VUMC 1I3QK 1BDFA 4A3JK 3GTKC 1I6HK 4OINA 1R9TC 3CQZK 4LJZA 2R7ZC 3GTOC 2O5JA 1K83K 1Y1WK 2JA7C 3HOUK 1TWGK 1TWCC 4G7HA 3S16K 3GTPC 4OIOA 3K7AK 3GTJK 3S1MK 2PMZD 1TWHK 2E2IK 3S1QK 3H3VD 5M3MK 4X6AC 3GTQK 4OIQA 4QJVB 3S2HC 4XLNA 2BE5A 4BBSC 4G7ZA 3GTMC 5C3EK 4Y52K 2E2HC 3HKZD 5IYCC 2NVYK 4A3CK 3PO3K 3S17K 3H0GK 2WB1L 5IP9K 2NVXC 3I4MC 4A3DC 3HOVK 5FLMC 4A3EC 4A3IC 5C4XK 5IYDK 2Y0SL 5D4DA 3S1NC 2NVTC 3S2DC 1SFOC 5FJ8K 4A3GK 4A3LK 3EQLA 2PPBA 2E2JK 1I50C 5C44K 2NVQK 2WAQL 1I3QC 4C3IK
chains in the Genus database with same CATH superfamily
1F9NA 1O28A 4BLBA 3GTGK 4BXXC 3HOUC 4J3NA 2JA6K 3RZDK 1HQMA 2A6HA 1IBAA 4KM9A 2GSNA 3ADAC 3G4CA 3FKIK 4AYBD 1WCMC 1ZYRA 4A3BK 4QIWL 1WQFA 4LR2A 2JA5K 3HOVC 4LLGA 4MQ9A 3AD8C 3MMLB 1YCLA 3CQZC 1TWAA 3GTMK 4C3HK 3S16C 1WOOA 4BY1C 3I4MK 4WJ3M 2R92A 2B63K 5IYBK 5HL8A 2VUMA 4G7OA 3M3YK 2VUMK 1JVIA 3GTOK 3OREA 5IP9C 2GSUA 2JA8C 1TWCK 5C4XC 2GSOA 4M1XA 5IOSA 3AH5A 4ZH4A 1ZQ1C 2E2HA 4BBRC 3LPXA 5JVOA 2E2HK 2W7VA 1TWFK 4XLPA 3WODA 4LK1A 2XCOA 3S14C 2CFAA 4ILDA 1JOEA 2CFAB 4Y7NK 3GTLK 1VH2A 1J98A 3GTPA 4OINA 1I6HK 4LJZA 2O5JA 2R7ZC 4X6AC 1B4AA 1WOSA 1O25A 3GTPC 1YX2A 3A8JA 3S1MK 2E2IK 3TFHA 3S2HC 4WILA 2BE5A 1BJTA 4GTFA 5IYCC 2NVYK 3PO3K 3S17K 2EBBA 4A3IC 5IYDK 4KARA 3GEHA 4G0VA 1Y1VA 4KB4A 3L4KA 3EQLA 2E2JK 1Y1WA 2NVQK 1UV7A 3AQOA 3GDZA 1B4BA 2ZUFA 3IPJA 3GTJA 3HOWK 4A93K 1SMYA 2A6EA 3S1RK 3HOYC 3RZOK 3GTJC 4A3FK 5IP7K 3HOXC 1ZBSA 3CAGA 4Q5SA 3DXJA 1EQRA 2PA8L 2PHCB 5M5WK 2WB1D 1O29A 1R9TK 5TMCA 1USMA 3N0CA 2JA7K 4GTCA 3BUEA 4AH6A 1VJEA 2YU9A 1J6WA 4KMAA 2WAQD 4Q4ZA 4A3JC 3GTGA 2YU9K 2JA6A 4BLAA 2Y3PA 1TWGC 4GFQA 3FOEA 3GTGC 2NVXK 2JA6C 1WORA 5FLMK 1HI9A 3I4NK 3FKIA 5C4JK 4A3KK 3GSIA 3FKIC 3GTKK 1O2FB 3LAJA 1DCOA 1C0AA 2JA5A 4A3BC 4BXXK 2JA5C 3TFIA 3FOFA 1WSRA 1O24A 3BP8C 5C44C 3GTMA 4QJVA 4P9SA 3ERED 4BBSK 1WCMK 1XZQA 4O2DA 1O2AA 4C3HC 1TWAC 2B63A 4A3DK 3AD9C 3T02A 1I6VA 2B63C 2NVTK 1VGXA 5IYBC 3S2DK 1SFOK 2R92C 2PA8D 4JK1A 3GTOA 1I50K 3M3YC 1TWCA 2VUMC 1PJ6A 3GTOC 3CQZK 1PJ7A 1ZVUA 1K83K 3G4AA 1TWCC 3S16K 4OIOA 3K7AK 3T01A 1TWHK 2V6SA 5M3MK 3GTQK 1TWFA 5C3EK 2E2HC 3H0GA 4A3CK 3H0GK 2WB1L 1IS1A 4G0UA 5IP9K 4KMDA 5C4XK 5JFEA 4C45A 5IORA 3GTLA 3LAPA 4A3GK 1XXCA 1XXAA 2WAQL 1IW7A 4BY7K 2A69A 3M4OK 5EGEA 4G0WA 2E2IA 2P5MA 3S14K 1YNNA 2E2IC 2GAGC 2R93K 3HOZC 1G51A 2NVYA 3PO2K 1KQ4A 5L46A 1F7UA 4X6AK 3S15K 2NVYC 1XXBA 3T00A 2O5IA 4A3MK 3A8IA 5E68A 5IYDC 1V5VA 4MEYA 4OIRA 1Y1VC 5TJ3A 2V6UA 4YFXA 2PMZL 3H3VL 2E2JC 3S2HK 1WIHA 1Y1WC 4XSXA 4A93C 4C2MK 1VRQC 3S1RC 5CJ9A 4A3IK 3RZOC 3S1QC 3VA7A 4KN7A 4GT9A 1R9TA 4Y52C 3V4GA 2JA7A 4BKWA 4KM8A 5M5XK 4YFNA 2CW0A 4WJ4A 3OEPA 2V6TA 4NOIA 3HOYK 3L4JA 3HOXK 1ISEA 4A3LC 3QX3A 4C3IC 2FQTA 2GAHC 2YU9C 2NVXA 5IOQA 3S0XA 2ZFZA 2ZUEA 1VLOA 4MEXA 3RZDC 4A3EK 3N3YA 4KATA 3S1NK 3AQPA 3I4NC 2D6FC 4GTBA 4LOWA 1EFWA 3GTKA 5C4JC 4A3KC 4C3JK 1J6XA 4YG2A 5TMFA 2KWAA 4KMUA 4XSZA 3GTKC 1I3QK 4A3JK 3HOUK 4GTEA 1TWGK 4KAWX 2PMZD 3H3VD 1WOPA 1WCMA 4QJVB 4XLNA 1XZQB 4BBSC 3GTMC 1WQHA 1O26A 3HKZD 4A3DC 3I4MC 4KB2A 3HOVK 1SFOA 3FHZA 1XZPA 1XZPB 2Y0SL 4GTAA 1I50A 5D4DA 2NVTC 3S2DC 1DD5A 1SFOC 3CQZA 5FJ8K 4RMFA 1K83A 1I50C 5C44K 4BY1K 1K83C 1TWHA 1TWAK 3GIRA 3GTQA 3K7AC 1TWHC 1GE9A 4LQYA 3GTQC 2R92K 1IL2A 1JQWA 3Q3QA 1WSVA 1O27A 1BGWA 2RH6A 4OIPA 5M5YK 5C3EC 1TWFC 2JA8K 4PABA 2RGRA 1J6VA 1X31C 4KC6A 4A3CC 3H0GC 1YNJA 4FZBA 4GTDA 1IQ0A 1PJ5A 4Y7NC 3GTLC 4BBRK 3N0BA 2FQOA 4LK0A 4A3GC 1F93A 1I6HC 1EH1A 4BY7C 3M4OC 3TTGA 2R93A 3S1MC 2A68A 1USOA 3SZZA 3BP3A 2R93C 1DCHA 2P8TA 2R7ZA 3PO2C 4QIWD 4GTLA 2R7ZK 3PO3C 1L0WA 4KDDA 3TFJA 3S17C 3A8KA 3S15C 2Y0SD 5IOTA 5M3FK 3GTPK 4A3MC 4DDQA 4YFKA 1EI6A 4P5BA 4GZYA 3HXAA 1ZXOA 2NVQC 1DCPA 3HOZK 4KN4A 1XPPA 3GEIA 3HOWC 5IYCK 4PAAA 4AYBL 2JH3A 3HKZL 3NUHA 5EGHA 4C2MC 4A3FC 5IP7C 4FM9A 3AD7C 1Y1VK 1EK8A 1AB4A 1BDFA 1F7VA 1R9TC 4KMHA 1Y1WK 2JA7C 4G7HA 2XCRB 1INNA 3GTJK 3JSTA 3S1QK 1RU0A 4OIQA 3SZYA 3OPFA 4G7ZA 1WQGA 2XCQA 4Y52K 1O2BA 4XCHA 3GEEA 2NVXC 4P5AA 5FLMC 1IE0A 4A3EC 5CHPA 1BS2A 3S1NC 1I3QA 4A3LK 4C3JC 2PPBA 4KASA 1TWGA 1I3QC 4C3IK
chains in the Genus database with same CATH topology
1IW7A 3HOWK 4BY7K 2A69A 3GTGK 3M4OK 4BY1K 1K83C 3HOUC 4A93K 4BXXC 1TWAK 1SMYA 2JA6K 2A6EA 3RZDK 3S1RK 1HQMA 3HOYC 3RZOK 3K7AC 3GTJC 2A6HA 4A3FK 3S14K 1YNNA 5IP7K 3HOXC 1TWHC 2E2IC 2R93K 3GTQC 2R92K 3HOZC 4Q5SA 3DXJA 3FKIK 4AYBD 1WCMC 3PO2K 1ZYRA 2PA8L 4OIPA 5M5YK 5M5WK 5C3EC 4A3BK 2WB1D 1TWFC 4X6AK 2JA8K 3S15K 4QIWL 1R9TK 2NVYC 5TMCA 4A3CC 3H0GC 2O5IA 4A3MK 2JA7K 1YNJA 2JA5K 3HOVC 4LLGA 5IYDC 4MQ9A 4Y7NC 4MEYA 4OIRA 1Y1VC 4YFXA 3GTLC 2PMZL 4BBRK 2WAQD 4LK0A 4Q4ZA 4A3JC 2E2JC 3H3VL 3S2HK 4A3GC 3CQZC 2YU9K 1I6HC 1Y1WC 3GTMK 4C3HK 4XSXA 1TWGC 4BY7C 3S16C 3M4OC 3GTGC 4A93C 4C2MK 4BY1C 2NVXK 3I4MK 2JA6C 3S1MC 5FLMK 4A3IK 3S1RC 2A68A 2B63K 3I4NK 3RZOC 5IYBK 3S1QC 5C4JK 4A3KK 2R93C 4G7OA 4KN7A 3M3YK 3FKIC 4Y52C 2VUMK 3GTKK 3PO2C 4QIWD 3GTOK 2R7ZK 3PO3C 3S17C 5M5XK 4A3BC 5IP9C 2JA8C 4YFNA 3S15C 2Y0SD 1TWCK 2CW0A 5M3FK 5C4XC 3GTPK 4A3MC 4BXXK 4NOIA 2JA5C 4YFKA 3HOYK 4ZH4A 4GZYA 3HOXK 4A3LC 5C44C 2NVQC 4BBRC 4QJVA 3HOZK 4BBSK 4KN4A 2E2HK 1WCMK 1XPPA 2YU9C 3HOWC 5IYCK 4AYBL 1TWAC 1TWFK 4XLPA 3HKZL 3WODA 4A3DK 4MEXA 3RZDC 4A3EK 4LK1A 3S14C 4A3FC 1I6VA 5IP7C 3S1NK 2B63C 3I4NC 2NVTK 5IYBC 3S2DK 4Y7NK 1SFOK 5C4JC 2PA8D 4JK1A 4A3KC 2R92C 4C3JK 4YG2A 1I50K 1Y1VK 5TMFA 3GTLK 4KMUA 4XSZA 3M3YC 2VUMC 1I3QK 1BDFA 4A3JK 3GTKC 1I6HK 4OINA 1R9TC 3CQZK 4LJZA 2R7ZC 3GTOC 2O5JA 1K83K 1Y1WK 2JA7C 3HOUK 1TWGK 1TWCC 4G7HA 3S16K 3GTPC 4OIOA 3K7AK 3GTJK 3S1MK 2PMZD 1TWHK 2E2IK 3S1QK 3H3VD 5M3MK 4X6AC 3GTQK 4OIQA 4QJVB 3S2HC 4XLNA 2BE5A 4BBSC 4G7ZA 3GTMC 5C3EK 4Y52K 2E2HC 3HKZD 5IYCC 2NVYK 4A3CK 3PO3K 3S17K 3H0GK 2WB1L 5IP9K 2NVXC 3I4MC 4A3DC 3HOVK 5FLMC 4A3EC 4A3IC 5C4XK 5IYDK 2Y0SL 5D4DA 3S1NC 2NVTC 3S2DC 1SFOC 5FJ8K 4A3GK 4A3LK 3EQLA 2PPBA 2E2JK 1I50C 5C44K 2NVQK 2WAQL 1I3QC 4C3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 A;  3HOW K;  4BY7 K;  2A69 A;  3GTG K;  3M4O K;  4BY1 K;  1K83 C;  3HOU C;  4A93 K;  4BXX C;  1TWA K;  1SMY A;  2JA6 K;  2A6E A;  3RZD K;  3S1R K;  1HQM A;  3HOY C;  3RZO K;  3K7A C;  3GTJ C;  2A6H A;  4A3F K;  3S14 K;  1YNN A;  5IP7 K;  3HOX C;  1TWH C;  2E2I C;  2R93 K;  3GTQ C;  2R92 K;  3HOZ C;  4Q5S A;  3DXJ A;  3FKI K;  4AYB D;  1WCM C;  3PO2 K;  1ZYR A;  2PA8 L;  4OIP A;  5M5Y K;  5M5W K;  5C3E C;  4A3B K;  2WB1 D;  1TWF C;  4X6A K;  2JA8 K;  3S15 K;  4QIW L;  1R9T K;  2NVY C;  5TMC A;  4A3C C;  3H0G C;  2O5I A;  4A3M K;  2JA7 K;  1YNJ A;  2JA5 K;  3HOV C;  4LLG A;  5IYD C;  4MQ9 A;  4Y7N C;  4MEY A;  4OIR A;  1Y1V C;  4YFX A;  3GTL C;  2PMZ L;  4BBR K;  2WAQ D;  4LK0 A;  4Q4Z A;  4A3J C;  2E2J C;  3H3V L;  3S2H K;  4A3G C;  3CQZ C;  2YU9 K;  1I6H C;  1Y1W C;  3GTM K;  4C3H K;  4XSX A;  1TWG C;  4BY7 C;  3S16 C;  3M4O C;  3GTG C;  4A93 C;  4C2M K;  4BY1 C;  2NVX K;  3I4M K;  2JA6 C;  3S1M C;  5FLM K;  4A3I K;  3S1R C;  2A68 A;  2B63 K;  3I4N K;  3RZO C;  5IYB K;  3S1Q C;  5C4J K;  4A3K K;  2R93 C;  4G7O A;  4KN7 A;  3M3Y K;  3FKI C;  4Y52 C;  2VUM K;  3GTK K;  3PO2 C;  4QIW D;  3GTO K;  2R7Z K;  3PO3 C;  3S17 C;  5M5X K;  4A3B C;  5IP9 C;  2JA8 C;  4YFN A;  3S15 C;  2Y0S D;  1TWC K;  2CW0 A;  5M3F K;  5C4X C;  3GTP K;  4A3M C;  4BXX K;  4NOI A;  2JA5 C;  4YFK A;  3HOY K;  4ZH4 A;  4GZY A;  3HOX K;  4A3L C;  5C44 C;  2NVQ C;  4BBR C;  4QJV A;  3HOZ K;  4BBS K;  4KN4 A;  2E2H K;  1WCM K;  1XPP A;  2YU9 C;  3HOW C;  5IYC K;  4AYB L;  1TWA C;  1TWF K;  4XLP A;  3HKZ L;  3WOD A;  4A3D K;  4MEX A;  3RZD C;  4A3E K;  4LK1 A;  3S14 C;  4A3F C;  1I6V A;  5IP7 C;  3S1N K;  2B63 C;  3I4N C;  2NVT K;  5IYB C;  3S2D K;  4Y7N K;  1SFO K;  5C4J C;  2PA8 D;  4JK1 A;  4A3K C;  2R92 C;  4C3J K;  4YG2 A;  1I50 K;  1Y1V K;  5TMF A;  3GTL K;  4KMU A;  4XSZ A;  3M3Y C;  2VUM C;  1I3Q K;  1BDF A;  4A3J K;  3GTK C;  1I6H K;  4OIN A;  1R9T C;  3CQZ K;  4LJZ A;  2R7Z C;  3GTO C;  2O5J A;  1K83 K;  1Y1W K;  2JA7 C;  3HOU K;  1TWG K;  1TWC C;  4G7H A;  3S16 K;  3GTP C;  4OIO A;  3K7A K;  3GTJ K;  3S1M K;  2PMZ D;  1TWH K;  2E2I K;  3S1Q K;  3H3V D;  5M3M K;  4X6A C;  3GTQ K;  4OIQ A;  4QJV B;  3S2H C;  4XLN A;  2BE5 A;  4BBS C;  4G7Z A;  3GTM C;  5C3E K;  4Y52 K;  2E2H C;  3HKZ D;  5IYC C;  2NVY K;  4A3C K;  3PO3 K;  3S17 K;  3H0G K;  2WB1 L;  5IP9 K;  2NVX C;  3I4M C;  4A3D C;  3HOV K;  5FLM C;  4A3E C;  4A3I C;  5C4X K;  5IYD K;  2Y0S L;  5D4D A;  3S1N C;  2NVT C;  3S2D C;  1SFO C;  5FJ8 K;  4A3G K;  4A3L K;  3EQL A;  2PPB A;  2E2J K;  1I50 C;  5C44 K;  2NVQ K;  2WAQ L;  1I3Q C;  4C3I K; 
#chains in the Genus database with same CATH topology
 1F9N A;  1O28 A;  4BLB A;  3GTG K;  4BXX C;  3HOU C;  4J3N A;  2JA6 K;  3RZD K;  1HQM A;  2A6H A;  1IBA A;  4KM9 A;  2GSN A;  3ADA C;  3G4C A;  3FKI K;  4AYB D;  1WCM C;  1ZYR A;  4A3B K;  4QIW L;  1WQF A;  4LR2 A;  2JA5 K;  3HOV C;  4LLG A;  4MQ9 A;  3AD8 C;  3MML B;  1YCL A;  3CQZ C;  1TWA A;  3GTM K;  4C3H K;  3S16 C;  1WOO A;  4BY1 C;  3I4M K;  4WJ3 M;  2R92 A;  2B63 K;  5IYB K;  5HL8 A;  2VUM A;  4G7O A;  3M3Y K;  2VUM K;  1JVI A;  3GTO K;  3ORE A;  5IP9 C;  2GSU A;  2JA8 C;  1TWC K;  5C4X C;  2GSO A;  4M1X A;  5IOS A;  3AH5 A;  4ZH4 A;  1ZQ1 C;  2E2H A;  4BBR C;  3LPX A;  5JVO A;  2E2H K;  2W7V A;  1TWF K;  4XLP A;  3WOD A;  4LK1 A;  2XCO A;  3S14 C;  2CFA A;  4ILD A;  1JOE A;  2CFA B;  4Y7N K;  3GTL K;  1VH2 A;  1J98 A;  3GTP A;  4OIN A;  1I6H K;  4LJZ A;  2O5J A;  2R7Z C;  4X6A C;  1B4A A;  1WOS A;  1O25 A;  3GTP C;  1YX2 A;  3A8J A;  3S1M K;  2E2I K;  3TFH A;  3S2H C;  4WIL A;  2BE5 A;  1BJT A;  4GTF A;  5IYC C;  2NVY K;  3PO3 K;  3S17 K;  2EBB A;  4A3I C;  5IYD K;  4KAR A;  3GEH A;  4G0V A;  1Y1V A;  4KB4 A;  3L4K A;  3EQL A;  2E2J K;  1Y1W A;  2NVQ K;  1UV7 A;  3AQO A;  3GDZ A;  1B4B A;  2ZUF A;  3IPJ A;  3GTJ A;  3HOW K;  4A93 K;  1SMY A;  2A6E A;  3S1R K;  3HOY C;  3RZO K;  3GTJ C;  4A3F K;  5IP7 K;  3HOX C;  1ZBS A;  3CAG A;  4Q5S A;  3DXJ A;  1EQR A;  2PA8 L;  2PHC B;  5M5W K;  2WB1 D;  1O29 A;  1R9T K;  5TMC A;  1USM A;  3N0C A;  2JA7 K;  4GTC A;  3BUE A;  4AH6 A;  1VJE A;  2YU9 A;  1J6W A;  4KMA A;  2WAQ D;  4Q4Z A;  4A3J C;  3GTG A;  2YU9 K;  2JA6 A;  4BLA A;  2Y3P A;  1TWG C;  4GFQ A;  3FOE A;  3GTG C;  2NVX K;  2JA6 C;  1WOR A;  5FLM K;  1HI9 A;  3I4N K;  3FKI A;  5C4J K;  4A3K K;  3GSI A;  3FKI C;  3GTK K;  1O2F B;  3LAJ A;  1DCO A;  1C0A A;  2JA5 A;  4A3B C;  4BXX K;  2JA5 C;  3TFI A;  3FOF A;  1WSR A;  1O24 A;  3BP8 C;  5C44 C;  3GTM A;  4QJV A;  4P9S A;  3ERE D;  4BBS K;  1WCM K;  1XZQ A;  4O2D A;  1O2A A;  4C3H C;  1TWA C;  2B63 A;  4A3D K;  3AD9 C;  3T02 A;  1I6V A;  2B63 C;  2NVT K;  1VGX A;  5IYB C;  3S2D K;  1SFO K;  2R92 C;  2PA8 D;  4JK1 A;  3GTO A;  1I50 K;  3M3Y C;  1TWC A;  2VUM C;  1PJ6 A;  3GTO C;  3CQZ K;  1PJ7 A;  1ZVU A;  1K83 K;  3G4A A;  1TWC C;  3S16 K;  4OIO A;  3K7A K;  3T01 A;  1TWH K;  2V6S A;  5M3M K;  3GTQ K;  1TWF A;  5C3E K;  2E2H C;  3H0G A;  4A3C K;  3H0G K;  2WB1 L;  1IS1 A;  4G0U A;  5IP9 K;  4KMD A;  5C4X K;  5JFE A;  4C45 A;  5IOR A;  3GTL A;  3LAP A;  4A3G K;  1XXC A;  1XXA A;  2WAQ L;  1IW7 A;  4BY7 K;  2A69 A;  3M4O K;  5EGE A;  4G0W A;  2E2I A;  2P5M A;  3S14 K;  1YNN A;  2E2I C;  2GAG C;  2R93 K;  3HOZ C;  1G51 A;  2NVY A;  3PO2 K;  1KQ4 A;  5L46 A;  1F7U A;  4X6A K;  3S15 K;  2NVY C;  1XXB A;  3T00 A;  2O5I A;  4A3M K;  3A8I A;  5E68 A;  5IYD C;  1V5V A;  4MEY A;  4OIR A;  1Y1V C;  5TJ3 A;  2V6U A;  4YFX A;  2PMZ L;  3H3V L;  2E2J C;  3S2H K;  1WIH A;  1Y1W C;  4XSX A;  4A93 C;  4C2M K;  1VRQ C;  3S1R C;  5CJ9 A;  4A3I K;  3RZO C;  3S1Q C;  3VA7 A;  4KN7 A;  4GT9 A;  1R9T A;  4Y52 C;  3V4G A;  2JA7 A;  4BKW A;  4KM8 A;  5M5X K;  4YFN A;  2CW0 A;  4WJ4 A;  3OEP A;  2V6T A;  4NOI A;  3HOY K;  3L4J A;  3HOX K;  1ISE A;  4A3L C;  3QX3 A;  4C3I C;  2FQT A;  2GAH C;  2YU9 C;  2NVX A;  5IOQ A;  3S0X A;  2ZFZ A;  2ZUE A;  1VLO A;  4MEX A;  3RZD C;  4A3E K;  3N3Y A;  4KAT A;  3S1N K;  3AQP A;  3I4N C;  2D6F C;  4GTB A;  4LOW A;  1EFW A;  3GTK A;  5C4J C;  4A3K C;  4C3J K;  1J6X A;  4YG2 A;  5TMF A;  2KWA A;  4KMU A;  4XSZ A;  3GTK C;  1I3Q K;  4A3J K;  3HOU K;  4GTE A;  1TWG K;  4KAW X;  2PMZ D;  3H3V D;  1WOP A;  1WCM A;  4QJV B;  4XLN A;  1XZQ B;  4BBS C;  3GTM C;  1WQH A;  1O26 A;  3HKZ D;  4A3D C;  3I4M C;  4KB2 A;  3HOV K;  1SFO A;  3FHZ A;  1XZP A;  1XZP B;  2Y0S L;  4GTA A;  1I50 A;  5D4D A;  2NVT C;  3S2D C;  1DD5 A;  1SFO C;  3CQZ A;  5FJ8 K;  4RMF A;  1K83 A;  1I50 C;  5C44 K;  4BY1 K;  1K83 C;  1TWH A;  1TWA K;  3GIR A;  3GTQ A;  3K7A C;  1TWH C;  1GE9 A;  4LQY A;  3GTQ C;  2R92 K;  1IL2 A;  1JQW A;  3Q3Q A;  1WSV A;  1O27 A;  1BGW A;  2RH6 A;  4OIP A;  5M5Y K;  5C3E C;  1TWF C;  2JA8 K;  4PAB A;  2RGR A;  1J6V A;  1X31 C;  4KC6 A;  4A3C C;  3H0G C;  1YNJ A;  4FZB A;  4GTD A;  1IQ0 A;  1PJ5 A;  4Y7N C;  3GTL C;  4BBR K;  3N0B A;  2FQO A;  4LK0 A;  4A3G C;  1F93 A;  1I6H C;  1EH1 A;  4BY7 C;  3M4O C;  3TTG A;  2R93 A;  3S1M C;  2A68 A;  1USO A;  3SZZ A;  3BP3 A;  2R93 C;  1DCH A;  2P8T A;  2R7Z A;  3PO2 C;  4QIW D;  4GTL A;  2R7Z K;  3PO3 C;  1L0W A;  4KDD A;  3TFJ A;  3S17 C;  3A8K A;  3S15 C;  2Y0S D;  5IOT A;  5M3F K;  3GTP K;  4A3M C;  4DDQ A;  4YFK A;  1EI6 A;  4P5B A;  4GZY A;  3HXA A;  1ZXO A;  2NVQ C;  1DCP A;  3HOZ K;  4KN4 A;  1XPP A;  3GEI A;  3HOW C;  5IYC K;  4PAA A;  4AYB L;  2JH3 A;  3HKZ L;  3NUH A;  5EGH A;  4C2M C;  4A3F C;  5IP7 C;  4FM9 A;  3AD7 C;  1Y1V K;  1EK8 A;  1AB4 A;  1BDF A;  1F7V A;  1R9T C;  4KMH A;  1Y1W K;  2JA7 C;  4G7H A;  2XCR B;  1INN A;  3GTJ K;  3JST A;  3S1Q K;  1RU0 A;  4OIQ A;  3SZY A;  3OPF A;  4G7Z A;  1WQG A;  2XCQ A;  4Y52 K;  1O2B A;  4XCH A;  3GEE A;  2NVX C;  4P5A A;  5FLM C;  1IE0 A;  4A3E C;  5CHP A;  1BS2 A;  3S1N C;  1I3Q A;  4A3L K;  4C3J C;  2PPB A;  4KAS A;  1TWG A;  1I3Q C;  4C3I K; 
#chains in the Genus database with same CATH homology
 1IW7 A;  3HOW K;  4BY7 K;  2A69 A;  3GTG K;  3M4O K;  4BY1 K;  1K83 C;  3HOU C;  4A93 K;  4BXX C;  1TWA K;  1SMY A;  2JA6 K;  2A6E A;  3RZD K;  3S1R K;  1HQM A;  3HOY C;  3RZO K;  3K7A C;  3GTJ C;  2A6H A;  4A3F K;  3S14 K;  1YNN A;  5IP7 K;  3HOX C;  1TWH C;  2E2I C;  2R93 K;  3GTQ C;  2R92 K;  3HOZ C;  4Q5S A;  3DXJ A;  3FKI K;  4AYB D;  1WCM C;  3PO2 K;  1ZYR A;  2PA8 L;  4OIP A;  5M5Y K;  5M5W K;  5C3E C;  4A3B K;  2WB1 D;  1TWF C;  4X6A K;  2JA8 K;  3S15 K;  4QIW L;  1R9T K;  2NVY C;  5TMC A;  4A3C C;  3H0G C;  2O5I A;  4A3M K;  2JA7 K;  1YNJ A;  2JA5 K;  3HOV C;  4LLG A;  5IYD C;  4MQ9 A;  4Y7N C;  4MEY A;  4OIR A;  1Y1V C;  4YFX A;  3GTL C;  2PMZ L;  4BBR K;  2WAQ D;  4LK0 A;  4Q4Z A;  4A3J C;  2E2J C;  3H3V L;  3S2H K;  4A3G C;  3CQZ C;  2YU9 K;  1I6H C;  1Y1W C;  3GTM K;  4C3H K;  4XSX A;  1TWG C;  4BY7 C;  3S16 C;  3M4O C;  3GTG C;  4A93 C;  4C2M K;  4BY1 C;  2NVX K;  3I4M K;  2JA6 C;  3S1M C;  5FLM K;  4A3I K;  3S1R C;  2A68 A;  2B63 K;  3I4N K;  3RZO C;  5IYB K;  3S1Q C;  5C4J K;  4A3K K;  2R93 C;  4G7O A;  4KN7 A;  3M3Y K;  3FKI C;  4Y52 C;  2VUM K;  3GTK K;  3PO2 C;  4QIW D;  3GTO K;  2R7Z K;  3PO3 C;  3S17 C;  5M5X K;  4A3B C;  5IP9 C;  2JA8 C;  4YFN A;  3S15 C;  2Y0S D;  1TWC K;  2CW0 A;  5M3F K;  5C4X C;  3GTP K;  4A3M C;  4BXX K;  4NOI A;  2JA5 C;  4YFK A;  3HOY K;  4ZH4 A;  4GZY A;  3HOX K;  4A3L C;  5C44 C;  2NVQ C;  4BBR C;  4QJV A;  3HOZ K;  4BBS K;  4KN4 A;  2E2H K;  1WCM K;  1XPP A;  2YU9 C;  3HOW C;  5IYC K;  4AYB L;  1TWA C;  1TWF K;  4XLP A;  3HKZ L;  3WOD A;  4A3D K;  4MEX A;  3RZD C;  4A3E K;  4LK1 A;  3S14 C;  4A3F C;  1I6V A;  5IP7 C;  3S1N K;  2B63 C;  3I4N C;  2NVT K;  5IYB C;  3S2D K;  4Y7N K;  1SFO K;  5C4J C;  2PA8 D;  4JK1 A;  4A3K C;  2R92 C;  4C3J K;  4YG2 A;  1I50 K;  1Y1V K;  5TMF A;  3GTL K;  4KMU A;  4XSZ A;  3M3Y C;  2VUM C;  1I3Q K;  1BDF A;  4A3J K;  3GTK C;  1I6H K;  4OIN A;  1R9T C;  3CQZ K;  4LJZ A;  2R7Z C;  3GTO C;  2O5J A;  1K83 K;  1Y1W K;  2JA7 C;  3HOU K;  1TWG K;  1TWC C;  4G7H A;  3S16 K;  3GTP C;  4OIO A;  3K7A K;  3GTJ K;  3S1M K;  2PMZ D;  1TWH K;  2E2I K;  3S1Q K;  3H3V D;  5M3M K;  4X6A C;  3GTQ K;  4OIQ A;  4QJV B;  3S2H C;  4XLN A;  2BE5 A;  4BBS C;  4G7Z A;  3GTM C;  5C3E K;  4Y52 K;  2E2H C;  3HKZ D;  5IYC C;  2NVY K;  4A3C K;  3PO3 K;  3S17 K;  3H0G K;  2WB1 L;  5IP9 K;  2NVX C;  3I4M C;  4A3D C;  3HOV K;  5FLM C;  4A3E C;  4A3I C;  5C4X K;  5IYD K;  2Y0S L;  5D4D A;  3S1N C;  2NVT C;  3S2D C;  1SFO C;  5FJ8 K;  4A3G K;  4A3L K;  3EQL A;  2PPB A;  2E2J K;  1I50 C;  5C44 K;  2NVQ K;  2WAQ L;  1I3Q C;  4C3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...