1TWCK

Rna polymerase ii complexed with gtp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twcK00
4LJZA 2WAQD 5M3MK 3S1NK 4A93C 1HQMA 4BY1C 1Y1WK 3WODA 2O5IA 4OIPA 3S16K 3S14K 2JA8C 2A69A 1TWGK 1K83C 2CW0A 3GTGK 4OIOA 2VUMK 4Y7NC 3GTMC 2E2HK 4XSXA 2B63K 3PO2C 3M4OC 1TWHC 4MEYA 3S2DK 2PMZL 1I6HK 4YG2A 1SMYA 2NVXC 4YFKA 4AYBD 5IYCC 4BY1K 4A93K 5C3EC 3RZOC 4KN7A 5TMCA 2JA8K 4LLGA 4QIWL 3GTMK 1K83K 3PO2K 3RZDC 4Y7NK 3M4OK 1TWHK 3CQZC 1TWAC 4C3JK 2JA5C 5M3FK 2NVXK 3H3VD 5C4XC 5IYCK 3DXJA 4A3IC 2E2HC 5C3EK 3FKIC 3GTOC 2A68A 3RZOK 3K7AC 3RZDK 2R93C 4KMUA 5C4JC 4Y52C 3GTJC 2PMZD 1YNJA 4BY7C 5IYBC 3CQZK 1TWAK 4C3HK 5FJ8K 4BBRC 5C4XK 2JA5K 2YU9C 1XPPA 2E2IC 4A3IK 3FKIK 3GTOK 3K7AK 4BBSC 2WB1D 4QIWD 1ZYRA 4A3MC 3GTKC 3HKZL 3H0GC 2R93K 1Y1VC 2R92C 1I50C 3S1RC 5C4JK 4Q5SA 3GTJK 4Y52K 4G7OA 4X6AC 4G7ZA 4BY7K 5IYBK 4C2MK 2YU9K 3S15C 3I4NC 4QJVA 4QJVB 4BBRK 4KN4A 2E2IK 2NVQC 2R7ZC 4BBSK 4XLPA 4A3MK 3HOUC 3GTKK 3HOZC 2O5JA 5FLMC 3H0GK 2BE5A 1SFOC 1Y1VK 2R92K 1I50K 3S1RK 1TWCC 4Q4ZA 4X6AK 1YNNA 2JA7C 3S15K 4A3DC 3I4NK 2PA8L 2R7ZK 2NVQK 3S1QC 1I3QC 1WCMC 2A6EA 3GTPC 4A3LC 4OIRA 3GTLC 3HKZD 3HOUK 3HOZK 5IP9C 5FLMK 1SFOK 4GZYA 3S2HC 5C44C 4A3GC 1TWCK 5IYDC 3S17C 4YFXA 2JA7K 2NVYC 3PO3C 4A3DK 1BDFA 4MEXA 4JK1A 5D4DA 4A3JC 4A3FC 3I4MC 3S1QK 4A3KC 1I3QK 1TWFC 1WCMK 3GTPK 4A3LK 5TMFA 3GTLK 2JA6K 3HOYC 5IP9K 4A3EC 3S2HK 5C44K 4A3GK 2E2JC 3HOXC 5IYDK 4LK1A 3EQLA 3S17K 2NVYK 2PPBA 3PO3K 4YFNA 2A6HA 5M5XK 4A3CC 3M3YC 3H3VL 4A3JK 4A3FK 3HOVC 3I4MK 4A3KK 2NVTC 1TWFK 2Y0SL 1I6HC 4LK0A 3HOWC 4G7HA 3HOYK 4C3IK 4ZH4A 4A3EK 1R9TC 5IP7C 4BXXC 3S1MC 2WAQL 3HOXK 2E2JK 3GTQC 2JA6C 4A3BC 5M5YK 4A3CK 3M3YK 4OINA 1I6VA 3HOVK 2NVTK 5M5WK 3HOWK 2WB1L 1R9TK 5IP7K 3S1NC 4BXXK 3S1MK 4AYBL 1Y1WC 3GTQK 4MQ9A 3S16C 3S14C 4A3BK 1TWGC 3GTGC 4NOIA 2Y0SD 2VUMC 4XSZA 2B63C 1IW7A 4OIQA 3S2DC 2PA8D 4XLNA
chains in the Genus database with same CATH superfamily
4DDQA 5M3MK 4FM9A 3OREA 3FHZA 4PAAA 1TWAA 2JA5A 3S14K 3GTGA 2VUMA 1PJ6A 1TWGK 1BGWA 2B63K 3GEEA 4MEYA 4C3JC 4A93K 4BY1K 2GSUA 1EQRA 2FQTA 3G4AA 4LLGA 3GTMK 3PO2K 3RZDC 4KARA 4Y7NK 3M4OK 3N0CA 3CQZC 3T02A 4GTEA 4C3HC 3DXJA 1V5VA 1WSVA 4KMUA 1IQ0A 3CQZA 4Y52C 3GTJC 1YNJA 4BY7C 4RMFA 4C2MC 2YU9C 5C4XK 4KMDA 1EH1A 3GTOK 3K7AK 4G0UA 1ZYRA 3GTJA 1I50C 3S1RC 2YU9A 3OEPA 4X6AC 1VLOA 3I4NC 4BBRK 2ZFZA 2E2IK 5IORA 3OPFA 1I50A 1EFWA 2O5JA 1TWFA 1F7VA 1TWCC 1X31C 1ZVUA 3LAPA 1YNNA 4A3DC 1WOPA 3S1QC 2GSNA 3BUEA 3LPXA 3GTLC 1TWCA 5IP9C 3IPJA 1WQHA 1WQFA 4A3GC 4FZBA 1R9TA 4P5AA 1VGXA 3GTLA 4A3KC 3HOYC 4A3EC 3S2HK 5C44K 3EQLA 3S17K 2PPBA 5M5XK 4A3CC 3H3VL 4A3JK 4BXXC 3FOEA 2E2JK 3GTQC 3Q3QA 4M1XA 5HL8A 3HOVK 3AQOA 2NVTK 3HOWK 1XZPB 2P8TA 1AB4A 3GTQA 4G0VA 3S1MK 1Y1WC 3TFIA 4P9SA 1O2AA 2NVXA 1VH2A 1IBAA 4NOIA 4KM8A 4ILDA 3S2DC 3AD7C 1I6HC 1WIHA 1Y1WA 2WAQD 1HQMA 2PHCB 2JA8C 1RU0A 3GTGK 1BS2A 2VUMK 4XSXA 1O28A 1TWHC 2GSOA 1SMYA 2XCOA 1F7UA 4KATA 5TMCA 1TWHA 1DD5A 3H0GA 4XCHA 1TWAC 4C3JK 2JA5C 3H3VD 1F93A 3SZZA 2A68A 3RZDK 2R93C 4P5BA 4GTCA 5C4JC 2PMZD 3CQZK 4C3HK 5EGEA 1XPPA 2JA7A 1PJ5A 4LR2A 4BLBA 4BBSC 4QIWD 1ZBSA 2R93A 4A3MC 3GTPA 2R92C 4Y52K 4GFQA 3GTJK 4G7OA 4G7ZA 5IOTA 4BY7K 4C2MK 2YU9K 3S15C 4QJVB 2V6UA 2R7ZC 4BKWA 3ADAC 1WSRA 3HOUC 2R92A 5IOSA 2BE5A 1I50K 5IOQA 3AH5A 4Q4ZA 3S1RK 4KM9A 4X6AK 2R7ZA 4KDDA 2CFAB 3I4NK 4KB2A 1WCMC 1BJTA 4A3LC 4OIRA 1INNA 1XXAA 5CJ9A 1TWCK 5IYDC 3N0BA 2NVYC 3PO3C 4A3DK 3AD9C 4JK1A 1WCMA 3S1QK 4A3FC 3I4MC 3SZYA 1TWFC 5TMFA 3LAJA 3GTLK 5IP9K 1J6WA 4A3GK 2NVYA 1ZXOA 3QX3A 1O26A 3M3YC 1DCOA 4A3KK 1USOA 1VRQC 3HOYK 4A3EK 1R9TC 2WAQL 4BLAA 4GTBA 4J3NA 5M5YK 4A3CK 2XCRB 5M5WK 1XZPA 1UV7A 3S1NC 4BXXK 3GTQK 1DCPA 2RGRA 3S16C 4O2DA 2Y0SD 4XSZA 1O25A 3T00A 1IW7A 4OIQA 4GTLA 3GDZA 1Y1WK 3WODA 4OIPA 2E2HA 2A69A 1K83C 2CW0A 4OIOA 2FQOA 3S2DK 2PMZL 2XCQA 4YG2A 1I6HK 2NVXC 3V4GA 3G4CA 5IYCC 1L0WA 1XXBA 5C3EC 3RZOC 2EBBA 1K83A 4KC6A 4QIWL 2JA8K 1JOEA 1TWHK 1J6VA 1WOOA 5M3FK 1B4AA 3CAGA 4A3IC 1B4BA 3TFJA 3A8JA 3FKIC 1O2FB 5IYBC 1TWAK 5FJ8K 2JA5K 3FKIA 4LQYA 3GTKC 3H0GC 1F9NA 2R93K 1Y1VC 5C4JK 4Q5SA 2Y3PA 4GTFA 4QJVA 3MMLB 4KN4A 2NVQC 1C0AA 3VA7A 3GTKA 1ZQ1C 4BBSK 1Y1VA 4XLPA 4A3MK 3HOZC 5FLMC 1SFOC 2R92K 2JA7C 2CFAA 3S15K 1O27A 2PA8L 2R7ZK 1I3QC 2A6EA 3GTPC 5TJ3A 1SFOA 3HKZD 3HOUK 1PJ7A 4GZYA 5L46A 1VJEA 3FOFA 4YFXA 2V6TA 2JH3A 1I3QA 5D4DA 2JA6A 1WCMK 5E68A 4A3LK 3TTGA 4C3IC 1JVIA 3BP8C 3HOXC 5IYDK 5JVOA 2ZUFA 2NVYK 3PO3K 2A6HA 4PABA 4A3FK 3I4MK 1TWFK 2Y0SL 1YX2A 4LK0A 1USMA 1XZQB 3GEHA 4AH6A 4ZH4A 5IP7C 4G0WA 4A3BC 3M3YK 4OINA 1I6VA 2P5MA 3GEIA 2V6SA 3AQPA 1J98A 2WB1L 1R9TK 2GAHC 4WJ4A 4KB4A 3S14C 2ZUEA 4C45A 1TWGC 2GAGC 2B63C 1O29A 1EK8A 3GSIA 2PA8D 4LJZA 1ISEA 3S1NK 4A93C 4WILA 4BY1C 4GTAA 2O5IA 1G51A 1XXCA 1TWGA 3S16K 3AD8C 3GTMC 3NUHA 2B63A 1EI6A 3S0XA 3N3YA 3ERED 4Y7NC 3PO2C 2E2HK 3M4OC 1JQWA 4YFKA 4AYBD 3GTMA 4KN7A 1WQGA 1K83K 4KMHA 2NVXK 5C4XC 5IYCK 4LOWA 5C3EK 2E2HC 3GTOC 3RZOK 3K7AC 3A8KA 1O24A 4GTDA 1DCHA 5EGHA 4BBRC 2E2IC 3GTOA 4A3IK 3TFHA 3FKIK 1WOSA 2WB1D 1HI9A 3HKZL 3L4JA 3GIRA 3L4KA 5IYBK 2E2IA 3GTKK 2D6FC 3H0GK 1Y1VK 5CHPA 3BP3A 2NVQK 1WORA 4KAWX 5JFEA 4GT9A 3HOZK 5FLMK 1SFOK 3S2HC 5C44C 2RH6A 3S17C 2JA7K 1BDFA 4MEXA 4A3JC 1YCLA 1I3QK 1IL2A 1IS1A 3A8IA 3GTPK 2JA6K 2W7VA 4KASA 2E2JC 4LK1A 4YFNA 3HOVC 2NVTC 3HOWC 1XZQA 4G7HA 4C3IK 3S1MC 3HOXK 2JA6C 1J6XA 1IE0A 3JSTA 1KQ4A 5IP7K 4WJ3M 4AYBL 4MQ9A 3T01A 2KWAA 1O2BA 4A3BK 4KMAA 3GTGC 2VUMC 3HXAA 1GE9A 4XLNA
chains in the Genus database with same CATH topology
4LJZA 2WAQD 5M3MK 3S1NK 4A93C 1HQMA 4BY1C 1Y1WK 3WODA 2O5IA 4OIPA 3S16K 3S14K 2JA8C 2A69A 1TWGK 1K83C 2CW0A 3GTGK 4OIOA 2VUMK 4Y7NC 3GTMC 2E2HK 4XSXA 2B63K 3PO2C 3M4OC 1TWHC 4MEYA 3S2DK 2PMZL 1I6HK 4YG2A 1SMYA 2NVXC 4YFKA 4AYBD 5IYCC 4BY1K 4A93K 5C3EC 3RZOC 4KN7A 5TMCA 2JA8K 4LLGA 4QIWL 3GTMK 1K83K 3PO2K 3RZDC 4Y7NK 3M4OK 1TWHK 3CQZC 1TWAC 4C3JK 2JA5C 5M3FK 2NVXK 3H3VD 5C4XC 5IYCK 3DXJA 4A3IC 2E2HC 5C3EK 3FKIC 3GTOC 2A68A 3RZOK 3K7AC 3RZDK 2R93C 4KMUA 5C4JC 4Y52C 3GTJC 2PMZD 1YNJA 4BY7C 5IYBC 3CQZK 1TWAK 4C3HK 5FJ8K 4BBRC 5C4XK 2JA5K 2YU9C 1XPPA 2E2IC 4A3IK 3FKIK 3GTOK 3K7AK 4BBSC 2WB1D 4QIWD 1ZYRA 4A3MC 3GTKC 3HKZL 3H0GC 2R93K 1Y1VC 2R92C 1I50C 3S1RC 5C4JK 4Q5SA 3GTJK 4Y52K 4G7OA 4X6AC 4G7ZA 4BY7K 5IYBK 4C2MK 2YU9K 3S15C 3I4NC 4QJVA 4QJVB 4BBRK 4KN4A 2E2IK 2NVQC 2R7ZC 4BBSK 4XLPA 4A3MK 3HOUC 3GTKK 3HOZC 2O5JA 5FLMC 3H0GK 2BE5A 1SFOC 1Y1VK 2R92K 1I50K 3S1RK 1TWCC 4Q4ZA 4X6AK 1YNNA 2JA7C 3S15K 4A3DC 3I4NK 2PA8L 2R7ZK 2NVQK 3S1QC 1I3QC 1WCMC 2A6EA 3GTPC 4A3LC 4OIRA 3GTLC 3HKZD 3HOUK 3HOZK 5IP9C 5FLMK 1SFOK 4GZYA 3S2HC 5C44C 4A3GC 1TWCK 5IYDC 3S17C 4YFXA 2JA7K 2NVYC 3PO3C 4A3DK 1BDFA 4MEXA 4JK1A 5D4DA 4A3JC 4A3FC 3I4MC 3S1QK 4A3KC 1I3QK 1TWFC 1WCMK 3GTPK 4A3LK 5TMFA 3GTLK 2JA6K 3HOYC 5IP9K 4A3EC 3S2HK 5C44K 4A3GK 2E2JC 3HOXC 5IYDK 4LK1A 3EQLA 3S17K 2NVYK 2PPBA 3PO3K 4YFNA 2A6HA 5M5XK 4A3CC 3M3YC 3H3VL 4A3JK 4A3FK 3HOVC 3I4MK 4A3KK 2NVTC 1TWFK 2Y0SL 1I6HC 4LK0A 3HOWC 4G7HA 3HOYK 4C3IK 4ZH4A 4A3EK 1R9TC 5IP7C 4BXXC 3S1MC 2WAQL 3HOXK 2E2JK 3GTQC 2JA6C 4A3BC 5M5YK 4A3CK 3M3YK 4OINA 1I6VA 3HOVK 2NVTK 5M5WK 3HOWK 2WB1L 1R9TK 5IP7K 3S1NC 4BXXK 3S1MK 4AYBL 1Y1WC 3GTQK 4MQ9A 3S16C 3S14C 4A3BK 1TWGC 3GTGC 4NOIA 2Y0SD 2VUMC 4XSZA 2B63C 1IW7A 4OIQA 3S2DC 2PA8D 4XLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJZ A;  2WAQ D;  5M3M K;  3S1N K;  4A93 C;  1HQM A;  4BY1 C;  1Y1W K;  3WOD A;  2O5I A;  4OIP A;  3S16 K;  3S14 K;  2JA8 C;  2A69 A;  1TWG K;  1K83 C;  2CW0 A;  3GTG K;  4OIO A;  2VUM K;  4Y7N C;  3GTM C;  2E2H K;  4XSX A;  2B63 K;  3PO2 C;  3M4O C;  1TWH C;  4MEY A;  3S2D K;  2PMZ L;  1I6H K;  4YG2 A;  1SMY A;  2NVX C;  4YFK A;  4AYB D;  5IYC C;  4BY1 K;  4A93 K;  5C3E C;  3RZO C;  4KN7 A;  5TMC A;  2JA8 K;  4LLG A;  4QIW L;  3GTM K;  1K83 K;  3PO2 K;  3RZD C;  4Y7N K;  3M4O K;  1TWH K;  3CQZ C;  1TWA C;  4C3J K;  2JA5 C;  5M3F K;  2NVX K;  3H3V D;  5C4X C;  5IYC K;  3DXJ A;  4A3I C;  2E2H C;  5C3E K;  3FKI C;  3GTO C;  2A68 A;  3RZO K;  3K7A C;  3RZD K;  2R93 C;  4KMU A;  5C4J C;  4Y52 C;  3GTJ C;  2PMZ D;  1YNJ A;  4BY7 C;  5IYB C;  3CQZ K;  1TWA K;  4C3H K;  5FJ8 K;  4BBR C;  5C4X K;  2JA5 K;  2YU9 C;  1XPP A;  2E2I C;  4A3I K;  3FKI K;  3GTO K;  3K7A K;  4BBS C;  2WB1 D;  4QIW D;  1ZYR A;  4A3M C;  3GTK C;  3HKZ L;  3H0G C;  2R93 K;  1Y1V C;  2R92 C;  1I50 C;  3S1R C;  5C4J K;  4Q5S A;  3GTJ K;  4Y52 K;  4G7O A;  4X6A C;  4G7Z A;  4BY7 K;  5IYB K;  4C2M K;  2YU9 K;  3S15 C;  3I4N C;  4QJV A;  4QJV B;  4BBR K;  4KN4 A;  2E2I K;  2NVQ C;  2R7Z C;  4BBS K;  4XLP A;  4A3M K;  3HOU C;  3GTK K;  3HOZ C;  2O5J A;  5FLM C;  3H0G K;  2BE5 A;  1SFO C;  1Y1V K;  2R92 K;  1I50 K;  3S1R K;  1TWC C;  4Q4Z A;  4X6A K;  1YNN A;  2JA7 C;  3S15 K;  4A3D C;  3I4N K;  2PA8 L;  2R7Z K;  2NVQ K;  3S1Q C;  1I3Q C;  1WCM C;  2A6E A;  3GTP C;  4A3L C;  4OIR A;  3GTL C;  3HKZ D;  3HOU K;  3HOZ K;  5IP9 C;  5FLM K;  1SFO K;  4GZY A;  3S2H C;  5C44 C;  4A3G C;  1TWC K;  5IYD C;  3S17 C;  4YFX A;  2JA7 K;  2NVY C;  3PO3 C;  4A3D K;  1BDF A;  4MEX A;  4JK1 A;  5D4D A;  4A3J C;  4A3F C;  3I4M C;  3S1Q K;  4A3K C;  1I3Q K;  1TWF C;  1WCM K;  3GTP K;  4A3L K;  5TMF A;  3GTL K;  2JA6 K;  3HOY C;  5IP9 K;  4A3E C;  3S2H K;  5C44 K;  4A3G K;  2E2J C;  3HOX C;  5IYD K;  4LK1 A;  3EQL A;  3S17 K;  2NVY K;  2PPB A;  3PO3 K;  4YFN A;  2A6H A;  5M5X K;  4A3C C;  3M3Y C;  3H3V L;  4A3J K;  4A3F K;  3HOV C;  3I4M K;  4A3K K;  2NVT C;  1TWF K;  2Y0S L;  1I6H C;  4LK0 A;  3HOW C;  4G7H A;  3HOY K;  4C3I K;  4ZH4 A;  4A3E K;  1R9T C;  5IP7 C;  4BXX C;  3S1M C;  2WAQ L;  3HOX K;  2E2J K;  3GTQ C;  2JA6 C;  4A3B C;  5M5Y K;  4A3C K;  3M3Y K;  4OIN A;  1I6V A;  3HOV K;  2NVT K;  5M5W K;  3HOW K;  2WB1 L;  1R9T K;  5IP7 K;  3S1N C;  4BXX K;  3S1M K;  4AYB L;  1Y1W C;  3GTQ K;  4MQ9 A;  3S16 C;  3S14 C;  4A3B K;  1TWG C;  3GTG C;  4NOI A;  2Y0S D;  2VUM C;  4XSZ A;  2B63 C;  1IW7 A;  4OIQ A;  3S2D C;  2PA8 D;  4XLN A; 
#chains in the Genus database with same CATH topology
 4DDQ A;  5M3M K;  4FM9 A;  3ORE A;  3FHZ A;  4PAA A;  1TWA A;  2JA5 A;  3S14 K;  3GTG A;  2VUM A;  1PJ6 A;  1TWG K;  1BGW A;  2B63 K;  3GEE A;  4MEY A;  4C3J C;  4A93 K;  4BY1 K;  2GSU A;  1EQR A;  2FQT A;  3G4A A;  4LLG A;  3GTM K;  3PO2 K;  3RZD C;  4KAR A;  4Y7N K;  3M4O K;  3N0C A;  3CQZ C;  3T02 A;  4GTE A;  4C3H C;  3DXJ A;  1V5V A;  1WSV A;  4KMU A;  1IQ0 A;  3CQZ A;  4Y52 C;  3GTJ C;  1YNJ A;  4BY7 C;  4RMF A;  4C2M C;  2YU9 C;  5C4X K;  4KMD A;  1EH1 A;  3GTO K;  3K7A K;  4G0U A;  1ZYR A;  3GTJ A;  1I50 C;  3S1R C;  2YU9 A;  3OEP A;  4X6A C;  1VLO A;  3I4N C;  4BBR K;  2ZFZ A;  2E2I K;  5IOR A;  3OPF A;  1I50 A;  1EFW A;  2O5J A;  1TWF A;  1F7V A;  1TWC C;  1X31 C;  1ZVU A;  3LAP A;  1YNN A;  4A3D C;  1WOP A;  3S1Q C;  2GSN A;  3BUE A;  3LPX A;  3GTL C;  1TWC A;  5IP9 C;  3IPJ A;  1WQH A;  1WQF A;  4A3G C;  4FZB A;  1R9T A;  4P5A A;  1VGX A;  3GTL A;  4A3K C;  3HOY C;  4A3E C;  3S2H K;  5C44 K;  3EQL A;  3S17 K;  2PPB A;  5M5X K;  4A3C C;  3H3V L;  4A3J K;  4BXX C;  3FOE A;  2E2J K;  3GTQ C;  3Q3Q A;  4M1X A;  5HL8 A;  3HOV K;  3AQO A;  2NVT K;  3HOW K;  1XZP B;  2P8T A;  1AB4 A;  3GTQ A;  4G0V A;  3S1M K;  1Y1W C;  3TFI A;  4P9S A;  1O2A A;  2NVX A;  1VH2 A;  1IBA A;  4NOI A;  4KM8 A;  4ILD A;  3S2D C;  3AD7 C;  1I6H C;  1WIH A;  1Y1W A;  2WAQ D;  1HQM A;  2PHC B;  2JA8 C;  1RU0 A;  3GTG K;  1BS2 A;  2VUM K;  4XSX A;  1O28 A;  1TWH C;  2GSO A;  1SMY A;  2XCO A;  1F7U A;  4KAT A;  5TMC A;  1TWH A;  1DD5 A;  3H0G A;  4XCH A;  1TWA C;  4C3J K;  2JA5 C;  3H3V D;  1F93 A;  3SZZ A;  2A68 A;  3RZD K;  2R93 C;  4P5B A;  4GTC A;  5C4J C;  2PMZ D;  3CQZ K;  4C3H K;  5EGE A;  1XPP A;  2JA7 A;  1PJ5 A;  4LR2 A;  4BLB A;  4BBS C;  4QIW D;  1ZBS A;  2R93 A;  4A3M C;  3GTP A;  2R92 C;  4Y52 K;  4GFQ A;  3GTJ K;  4G7O A;  4G7Z A;  5IOT A;  4BY7 K;  4C2M K;  2YU9 K;  3S15 C;  4QJV B;  2V6U A;  2R7Z C;  4BKW A;  3ADA C;  1WSR A;  3HOU C;  2R92 A;  5IOS A;  2BE5 A;  1I50 K;  5IOQ A;  3AH5 A;  4Q4Z A;  3S1R K;  4KM9 A;  4X6A K;  2R7Z A;  4KDD A;  2CFA B;  3I4N K;  4KB2 A;  1WCM C;  1BJT A;  4A3L C;  4OIR A;  1INN A;  1XXA A;  5CJ9 A;  1TWC K;  5IYD C;  3N0B A;  2NVY C;  3PO3 C;  4A3D K;  3AD9 C;  4JK1 A;  1WCM A;  3S1Q K;  4A3F C;  3I4M C;  3SZY A;  1TWF C;  5TMF A;  3LAJ A;  3GTL K;  5IP9 K;  1J6W A;  4A3G K;  2NVY A;  1ZXO A;  3QX3 A;  1O26 A;  3M3Y C;  1DCO A;  4A3K K;  1USO A;  1VRQ C;  3HOY K;  4A3E K;  1R9T C;  2WAQ L;  4BLA A;  4GTB A;  4J3N A;  5M5Y K;  4A3C K;  2XCR B;  5M5W K;  1XZP A;  1UV7 A;  3S1N C;  4BXX K;  3GTQ K;  1DCP A;  2RGR A;  3S16 C;  4O2D A;  2Y0S D;  4XSZ A;  1O25 A;  3T00 A;  1IW7 A;  4OIQ A;  4GTL A;  3GDZ A;  1Y1W K;  3WOD A;  4OIP A;  2E2H A;  2A69 A;  1K83 C;  2CW0 A;  4OIO A;  2FQO A;  3S2D K;  2PMZ L;  2XCQ A;  4YG2 A;  1I6H K;  2NVX C;  3V4G A;  3G4C A;  5IYC C;  1L0W A;  1XXB A;  5C3E C;  3RZO C;  2EBB A;  1K83 A;  4KC6 A;  4QIW L;  2JA8 K;  1JOE A;  1TWH K;  1J6V A;  1WOO A;  5M3F K;  1B4A A;  3CAG A;  4A3I C;  1B4B A;  3TFJ A;  3A8J A;  3FKI C;  1O2F B;  5IYB C;  1TWA K;  5FJ8 K;  2JA5 K;  3FKI A;  4LQY A;  3GTK C;  3H0G C;  1F9N A;  2R93 K;  1Y1V C;  5C4J K;  4Q5S A;  2Y3P A;  4GTF A;  4QJV A;  3MML B;  4KN4 A;  2NVQ C;  1C0A A;  3VA7 A;  3GTK A;  1ZQ1 C;  4BBS K;  1Y1V A;  4XLP A;  4A3M K;  3HOZ C;  5FLM C;  1SFO C;  2R92 K;  2JA7 C;  2CFA A;  3S15 K;  1O27 A;  2PA8 L;  2R7Z K;  1I3Q C;  2A6E A;  3GTP C;  5TJ3 A;  1SFO A;  3HKZ D;  3HOU K;  1PJ7 A;  4GZY A;  5L46 A;  1VJE A;  3FOF A;  4YFX A;  2V6T A;  2JH3 A;  1I3Q A;  5D4D A;  2JA6 A;  1WCM K;  5E68 A;  4A3L K;  3TTG A;  4C3I C;  1JVI A;  3BP8 C;  3HOX C;  5IYD K;  5JVO A;  2ZUF A;  2NVY K;  3PO3 K;  2A6H A;  4PAB A;  4A3F K;  3I4M K;  1TWF K;  2Y0S L;  1YX2 A;  4LK0 A;  1USM A;  1XZQ B;  3GEH A;  4AH6 A;  4ZH4 A;  5IP7 C;  4G0W A;  4A3B C;  3M3Y K;  4OIN A;  1I6V A;  2P5M A;  3GEI A;  2V6S A;  3AQP A;  1J98 A;  2WB1 L;  1R9T K;  2GAH C;  4WJ4 A;  4KB4 A;  3S14 C;  2ZUE A;  4C45 A;  1TWG C;  2GAG C;  2B63 C;  1O29 A;  1EK8 A;  3GSI A;  2PA8 D;  4LJZ A;  1ISE A;  3S1N K;  4A93 C;  4WIL A;  4BY1 C;  4GTA A;  2O5I A;  1G51 A;  1XXC A;  1TWG A;  3S16 K;  3AD8 C;  3GTM C;  3NUH A;  2B63 A;  1EI6 A;  3S0X A;  3N3Y A;  3ERE D;  4Y7N C;  3PO2 C;  2E2H K;  3M4O C;  1JQW A;  4YFK A;  4AYB D;  3GTM A;  4KN7 A;  1WQG A;  1K83 K;  4KMH A;  2NVX K;  5C4X C;  5IYC K;  4LOW A;  5C3E K;  2E2H C;  3GTO C;  3RZO K;  3K7A C;  3A8K A;  1O24 A;  4GTD A;  1DCH A;  5EGH A;  4BBR C;  2E2I C;  3GTO A;  4A3I K;  3TFH A;  3FKI K;  1WOS A;  2WB1 D;  1HI9 A;  3HKZ L;  3L4J A;  3GIR A;  3L4K A;  5IYB K;  2E2I A;  3GTK K;  2D6F C;  3H0G K;  1Y1V K;  5CHP A;  3BP3 A;  2NVQ K;  1WOR A;  4KAW X;  5JFE A;  4GT9 A;  3HOZ K;  5FLM K;  1SFO K;  3S2H C;  5C44 C;  2RH6 A;  3S17 C;  2JA7 K;  1BDF A;  4MEX A;  4A3J C;  1YCL A;  1I3Q K;  1IL2 A;  1IS1 A;  3A8I A;  3GTP K;  2JA6 K;  2W7V A;  4KAS A;  2E2J C;  4LK1 A;  4YFN A;  3HOV C;  2NVT C;  3HOW C;  1XZQ A;  4G7H A;  4C3I K;  3S1M C;  3HOX K;  2JA6 C;  1J6X A;  1IE0 A;  3JST A;  1KQ4 A;  5IP7 K;  4WJ3 M;  4AYB L;  4MQ9 A;  3T01 A;  2KWA A;  1O2B A;  4A3B K;  4KMA A;  3GTG C;  2VUM C;  3HXA A;  1GE9 A;  4XLN A; 
#chains in the Genus database with same CATH homology
 4LJZ A;  2WAQ D;  5M3M K;  3S1N K;  4A93 C;  1HQM A;  4BY1 C;  1Y1W K;  3WOD A;  2O5I A;  4OIP A;  3S16 K;  3S14 K;  2JA8 C;  2A69 A;  1TWG K;  1K83 C;  2CW0 A;  3GTG K;  4OIO A;  2VUM K;  4Y7N C;  3GTM C;  2E2H K;  4XSX A;  2B63 K;  3PO2 C;  3M4O C;  1TWH C;  4MEY A;  3S2D K;  2PMZ L;  1I6H K;  4YG2 A;  1SMY A;  2NVX C;  4YFK A;  4AYB D;  5IYC C;  4BY1 K;  4A93 K;  5C3E C;  3RZO C;  4KN7 A;  5TMC A;  2JA8 K;  4LLG A;  4QIW L;  3GTM K;  1K83 K;  3PO2 K;  3RZD C;  4Y7N K;  3M4O K;  1TWH K;  3CQZ C;  1TWA C;  4C3J K;  2JA5 C;  5M3F K;  2NVX K;  3H3V D;  5C4X C;  5IYC K;  3DXJ A;  4A3I C;  2E2H C;  5C3E K;  3FKI C;  3GTO C;  2A68 A;  3RZO K;  3K7A C;  3RZD K;  2R93 C;  4KMU A;  5C4J C;  4Y52 C;  3GTJ C;  2PMZ D;  1YNJ A;  4BY7 C;  5IYB C;  3CQZ K;  1TWA K;  4C3H K;  5FJ8 K;  4BBR C;  5C4X K;  2JA5 K;  2YU9 C;  1XPP A;  2E2I C;  4A3I K;  3FKI K;  3GTO K;  3K7A K;  4BBS C;  2WB1 D;  4QIW D;  1ZYR A;  4A3M C;  3GTK C;  3HKZ L;  3H0G C;  2R93 K;  1Y1V C;  2R92 C;  1I50 C;  3S1R C;  5C4J K;  4Q5S A;  3GTJ K;  4Y52 K;  4G7O A;  4X6A C;  4G7Z A;  4BY7 K;  5IYB K;  4C2M K;  2YU9 K;  3S15 C;  3I4N C;  4QJV A;  4QJV B;  4BBR K;  4KN4 A;  2E2I K;  2NVQ C;  2R7Z C;  4BBS K;  4XLP A;  4A3M K;  3HOU C;  3GTK K;  3HOZ C;  2O5J A;  5FLM C;  3H0G K;  2BE5 A;  1SFO C;  1Y1V K;  2R92 K;  1I50 K;  3S1R K;  1TWC C;  4Q4Z A;  4X6A K;  1YNN A;  2JA7 C;  3S15 K;  4A3D C;  3I4N K;  2PA8 L;  2R7Z K;  2NVQ K;  3S1Q C;  1I3Q C;  1WCM C;  2A6E A;  3GTP C;  4A3L C;  4OIR A;  3GTL C;  3HKZ D;  3HOU K;  3HOZ K;  5IP9 C;  5FLM K;  1SFO K;  4GZY A;  3S2H C;  5C44 C;  4A3G C;  1TWC K;  5IYD C;  3S17 C;  4YFX A;  2JA7 K;  2NVY C;  3PO3 C;  4A3D K;  1BDF A;  4MEX A;  4JK1 A;  5D4D A;  4A3J C;  4A3F C;  3I4M C;  3S1Q K;  4A3K C;  1I3Q K;  1TWF C;  1WCM K;  3GTP K;  4A3L K;  5TMF A;  3GTL K;  2JA6 K;  3HOY C;  5IP9 K;  4A3E C;  3S2H K;  5C44 K;  4A3G K;  2E2J C;  3HOX C;  5IYD K;  4LK1 A;  3EQL A;  3S17 K;  2NVY K;  2PPB A;  3PO3 K;  4YFN A;  2A6H A;  5M5X K;  4A3C C;  3M3Y C;  3H3V L;  4A3J K;  4A3F K;  3HOV C;  3I4M K;  4A3K K;  2NVT C;  1TWF K;  2Y0S L;  1I6H C;  4LK0 A;  3HOW C;  4G7H A;  3HOY K;  4C3I K;  4ZH4 A;  4A3E K;  1R9T C;  5IP7 C;  4BXX C;  3S1M C;  2WAQ L;  3HOX K;  2E2J K;  3GTQ C;  2JA6 C;  4A3B C;  5M5Y K;  4A3C K;  3M3Y K;  4OIN A;  1I6V A;  3HOV K;  2NVT K;  5M5W K;  3HOW K;  2WB1 L;  1R9T K;  5IP7 K;  3S1N C;  4BXX K;  3S1M K;  4AYB L;  1Y1W C;  3GTQ K;  4MQ9 A;  3S16 C;  3S14 C;  4A3B K;  1TWG C;  3GTG C;  4NOI A;  2Y0S D;  2VUM C;  4XSZ A;  2B63 C;  1IW7 A;  4OIQ A;  3S2D C;  2PA8 D;  4XLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...