1TWCK

Rna polymerase ii complexed with gtp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1twcK00
1WCMC 3HKZL 5M5WK 1K83K 2VUMC 4OIOA 3GTJK 3PO3C 5TMCA 3HKZD 3S17K 2A6EA 4Y7NK 2NVXC 5C4XC 2JA8C 5C4JK 3GTLC 3S1NK 3H0GK 4XSZA 4LK1A 4BY1C 4QIWL 3S1MC 3S16K 3S1QC 4YG2A 4BBSK 2A6HA 5IYBC 4XLPA 5M5XK 2JA8K 3HOZK 4QJVA 4A3BC 3H3VD 3M3YK 4C3IK 3RZDK 2NVYK 3GTMK 5IYBK 5M5YK 5C3EK 4A3LK 4KN7A 1XPPA 4ZH4A 2Y0SL 3WODA 2WAQD 4Q4ZA 4G7ZA 3PO2K 4A3GC 4AYBL 5IP7C 3FKIC 4A3LC 1ZYRA 2WAQL 3EQLA 2JA6K 3PO2C 2E2HC 2R7ZK 4A3MK 4G7OA 4A3EC 3GTGC 1TWHC 4A3FC 1Y1WK 4LK0A 4QIWD 4MQ9A 2PPBA 3S17C 4BY1K 3I4MK 3S16C 5IP9C 1Y1WC 4G7HA 2BE5A 3RZDC 1TWHK 3S2DC 4A3DK 1IW7A 2E2JK 3GTPK 4X6AC 3GTJC 1TWAK 5D4DA 2CW0A 4YFXA 4KN4A 5FLMC 2NVQK 4LJZA 2YU9C 2B63K 3GTLK 1SMYA 3FKIK 1TWFK 4OINA 2R92C 3S2DK 5FJ8K 4KMUA 3HOXK 3RZOK 4A93K 4A3GK 4BBRC 4A3CK 2Y0SD 1I6VA 2NVYC 4MEYA 3GTMC 3K7AC 2E2IC 3HOWC 4BXXK 1Y1VC 4A3DC 3GTKC 4JK1A 4BBRK 3S15K 1K83C 4BXXC 5C44C 5IP9K 4LLGA 3RZOC 2JA6C 3I4MC 4A93C 3M4OC 3S15C 3S2HK 2PMZD 4Y52C 2A69A 5IYDK 3HOVK 2NVQC 2VUMK 5M3MK 1HQMA 3HOVC 3GTOC 3S14C 4OIPA 1TWFC 2R92K 1I6HC 3GTQK 1YNNA 4BY7C 1I50K 1YNJA 2PA8D 3HOXC 4A3IC 4OIQA 4Q5SA 3GTQC 4XSXA 3GTKK 3CQZK 3S14K 3K7AK 2YU9K 2B63C 1SFOC 5FLMK 4YFKA 5TMFA 4A3EK 4A3JC 3GTGK 2NVTC 3HOUK 4BBSC 3I4NK 5IP7K 2WB1D 5C44K 2E2HK 2R7ZC 5C3EC 2E2JC 3GTPC 4X6AK 1I3QC 4NOIA 2JA7C 1TWGK 5IYCC 1R9TK 2PA8L 3HOYC 4MEXA 4GZYA 4C3JK 2A68A 5C4JC 3H0GC 3HOYK 4Y7NC 1SFOK 1I3QK 2JA7K 1TWGC 4QJVB 3GTOK 3HOUC 4C3HK 4A3CC 2NVTK 1TWAC 4A3FK 1I50C 4A3IK 4A3KC 2PMZL 2R93C 4XLNA 2NVXK 3CQZC 3I4NC 2WB1L 4C2MK 3S1MK 2JA5C 4AYBD 3S1NC 2O5JA 1TWCK 5IYCK 4A3JK 1Y1VK 4YFNA 5IYDC 1R9TC 4A3BK 3M3YC 2R93K 5M3FK 3S1RK 2E2IK 3HOZC 3H3VL 1TWCC 4A3MC 3S1QK 2JA5K 4OIRA 1WCMK 3M4OK 2O5IA 1BDFA 1I6HK 4Y52K 4BY7K 3DXJA 3S1RC 3S2HC 5C4XK 3HOWK 3PO3K 4A3KK
chains in the Genus database with same CATH superfamily
1TWFA 3MMLB 5M5WK 1K83K 3GTLA 4OIOA 1BGWA 5IOSA 3S17K 5C4XC 5C4JK 3H0GK 4LK1A 3AD8C 4QIWL 3S16K 1O28A 1J98A 1TWHA 1BS2A 4XLPA 2JA8K 1JOEA 3H3VD 4KC6A 4A3GC 3FHZA 1XZQB 1F93A 1PJ5A 2WAQD 3AQPA 3WODA 3TFJA 4AYBL 4Q4ZA 4KM8A 1EFWA 4G0UA 2E2HC 4G0WA 3GTGC 3A8JA 1BJTA 4BY1K 3I4MK 4G7HA 4C3IC 3RZDC 3S2DC 1JQWA 4YFXA 1O29A 4KN4A 1WIHA 2YU9C 5FJ8K 3A8KA 4KMUA 3CQZA 4A3CK 4MEYA 1I6VA 4A3LC 4LOWA 3HOWC 5CJ9A 4GTEA 3GTKC 4JK1A 4BBRK 3GDZA 5IP9K 4LLGA 3NUHA 4DDQA 4WJ4A 3Q3QA 1Y1VA 1DD5A 2VUMK 4P5BA 3N3YA 3HOVC 1ZXOA 4OIPA 1TWFC 1I50K 2PA8D 3GEHA 1I3QA 3A8IA 1SFOA 3GTQC 2Y3PA 3CQZK 1KQ4A 3K7AK 2B63C 3V4GA 4A3EK 3GTGK 1IS1A 1WOPA 4BBSC 2JH3A 2E2HA 3L4JA 4PAAA 3I4NK 5IP7K 4KMDA 1C0AA 5C44K 4KAWX 1I3QC 4NOIA 4RMFA 4ILDA 4MEXA 4C3JK 1XXCA 2A68A 3S0XA 3GSIA 3FOEA 4LR2A 4FM9A 2JA6A 1L0WA 4A3CC 3GEEA 2NVTK 1TWAC 4A3KC 1I50C 4C2MC 1GE9A 5IORA 3CQZC 1USOA 3S1MK 1VH2A 1B4BA 1WCMK 3G4CA 3LAPA 3HOWK 4A3KK 1WCMC 3PO3C 2PHCB 3GIRA 2NVXC 2GAGC 2E2IA 4BBSK 1VGXA 3IPJA 1ZQ1C 5M5XK 2XCQA 3HOZK 4QJVA 4A3BC 3M3YK 3ADAC 3GTMK 5IYBK 5M5YK 5C3EK 4KM9A 1Y1WA 2Y0SL 2GSUA 5IP7C 1ZYRA 3T01A 3EQLA 3GTOA 3JSTA 4A3EC 5L46A 1TWHC 1F9NA 2PPBA 1R9TA 4KARA 4KB4A 2CFAA 1Y1WC 4BLAA 1TWHK 4X6AC 1EH1A 4KMAA 1TWAK 5D4DA 5FLMC 2RGRA 2GSOA 4LJZA 4J3NA 2B63K 4OINA 3FKIK 1TWFK 1PJ6A 2D6FC 3S2DK 3GTGA 2R93A 2YU9A 4KDDA 4BBRC 4C3HC 4BXXK 4LQYA 3K7AC 1WQHA 1VJEA 3AH5A 5C44C 1DCHA 3N0BA 1IL2A 3M4OC 3S2HK 4Y52C 5E68A 1B4AA 4WILA 2NVXA 5M3MK 3FOFA 1O25A 1J6WA 1PJ7A 3S14C 3GTQK 1YNNA 3QX3A 1O2AA 1YNJA 3HOXC 4A3IC 4GTDA 2JA7A 4XSXA 3GTKK 3L4KA 4WJ3M 4YFKA 4GTFA 3AD7C 2WB1D 3GTPA 2GSNA 5C3EC 3BP3A 4X6AK 2JA7C 1TWGK 2PA8L 4GZYA 5C4JC 3HOYK 4Y7NC 1I3QK 1TWGC 4GFQA 4C3HK 2R93C 4A3IK 2W7VA 4XLNA 2WB1L 1UV7A 4AYBD 4A3JK 3M3YC 2E2IK 4OIRA 3M4OK 1BDFA 3CAGA 3GTJA 4Y52K 3DXJA 1XZPA 3PO3K 2R93K 2V6UA 3FKIA 3GTJK 1RU0A 1XXAA 4Y7NK 2JA8C 1ZBSA 3GTLC 3S1QC 4XSZA 4BY1C 1X31C 5IYBC 4M1XA 3T00A 2NVYK 3PO2K 4G7ZA 1WOSA 4C45A 3AD9C 3N0CA 2R7ZA 2WAQL 2XCRB 3PO2C 3TTGA 2FQTA 1HI9A 1ZVUA 1O2BA 1WSRA 4GTCA 1TWGA 1XXBA 1EI6A 4KB2A 2E2JK 2P5MA 2CW0A 2KWAA 1ISEA 3HOXK 5IOTA 1YCLA 4A93K 3GTMC 4A3DC 1Y1VC 2JA5A 4GTBA 4A93C 2JA6C 3S15C 1XZPB 2PMZD 2ZUEA 2A69A 4FZBA 3HOVK 1DCPA 4KMHA 1HQMA 4G0VA 3GTOC 2R92K 1USMA 3G4AA 4P5AA 4OIQA 1VRQC 2P8TA 3S14K 3TFIA 1SFOC 5FLMK 5TMFA 2NVTC 1J6XA 3HOUK 2B63A 2ZUFA 2ZFZA 3VA7A 2R7ZC 4AH6A 2E2JC 3BP8C 3ERED 1R9TK 5JVOA 5EGHA 1WSVA 3AQOA 3GTKA 4GT9A 3H0GC 1SFOK 2JA7K 1I50A 3GTOK 1F7UA 3HOUC 2XCOA 2NVXK 3I4NC 3GTMA 4C2MK 2JA5C 3S1NC 1F7VA 2O5JA 1IE0A 1R9TC 4A3BK 3S1RK 3H0GA 3H3VL 4KASA 1TWCC 4A3MC 3OEPA 2JA5K 4C3JC 1JVIA 1I6HK 3GEIA 3S1RC 5C4XK 3S17C 4A3DK 3HKZL 3BUEA 2VUMC 2RH6A 5TMCA 3HKZD 1WCMA 2A6EA 3S1NK 3S1MC 4YG2A 1TWCA 2A6HA 4C3IK 3RZDK 4A3LK 1G51A 1XPPA 4KN7A 4ZH4A 5HL8A 3SZZA 3FKIC 1DCOA 2CFAB 2JA6K 2R7ZK 4A3MK 4G7OA 4PABA 4GTLA 1VLOA 4KATA 1Y1WK 4LK0A 4QIWD 4MQ9A 3TFHA 3LAJA 3S16C 1EQRA 1WQGA 1WQFA 5IP9C 2BE5A 3SZYA 1IW7A 3GTPK 2GAHC 3GTJC 1XZQA 2NVQK 3GTLK 3S1QK 1SMYA 1O2FB 2R92C 3LPXA 3OPFA 3RZOK 1INNA 4A3GK 1O24A 2Y0SD 5JFEA 2NVYC 2E2IC 4BKWA 3S15K 1K83C 3GTQA 4BXXC 1WOOA 3RZOC 3I4MC 4P9SA 2FQOA 2VUMA 5IYDK 4O2DA 2NVQC 1WORA 1I6HC 4BY7C 1IQ0A 5IOQA 4Q5SA 2YU9K 1V5VA 4A3JC 5TJ3A 1YX2A 4XCHA 1EK8A 1TWAA 4GTAA 4BLBA 3HXAA 2E2HK 5CHPA 3GTPC 5IYCC 3HOYC 4QJVB 5EGEA 3T02A 1AB4A 2R92A 2V6TA 4A3FK 3OREA 2PMZL 1J6VA 2NVYA 2V6SA 2EBBA 1TWCK 5IYCK 1Y1VK 4YFNA 5IYDC 5M3FK 1O26A 3HOZC 2O5IA 1K83A 4BY7K 3S2HC 1IBAA 1O27A 4A3FC
chains in the Genus database with same CATH topology
1WCMC 3HKZL 5M5WK 1K83K 2VUMC 4OIOA 3GTJK 3PO3C 5TMCA 3HKZD 3S17K 2A6EA 4Y7NK 2NVXC 5C4XC 2JA8C 5C4JK 3GTLC 3S1NK 3H0GK 4XSZA 4LK1A 4BY1C 4QIWL 3S1MC 3S16K 3S1QC 4YG2A 4BBSK 2A6HA 5IYBC 4XLPA 5M5XK 2JA8K 3HOZK 4QJVA 4A3BC 3H3VD 3M3YK 4C3IK 3RZDK 2NVYK 3GTMK 5IYBK 5M5YK 5C3EK 4A3LK 4KN7A 1XPPA 4ZH4A 2Y0SL 3WODA 2WAQD 4Q4ZA 4G7ZA 3PO2K 4A3GC 4AYBL 5IP7C 3FKIC 4A3LC 1ZYRA 2WAQL 3EQLA 2JA6K 3PO2C 2E2HC 2R7ZK 4A3MK 4G7OA 4A3EC 3GTGC 1TWHC 4A3FC 1Y1WK 4LK0A 4QIWD 4MQ9A 2PPBA 3S17C 4BY1K 3I4MK 3S16C 5IP9C 1Y1WC 4G7HA 2BE5A 3RZDC 1TWHK 3S2DC 4A3DK 1IW7A 2E2JK 3GTPK 4X6AC 3GTJC 1TWAK 5D4DA 2CW0A 4YFXA 4KN4A 5FLMC 2NVQK 4LJZA 2YU9C 2B63K 3GTLK 1SMYA 3FKIK 1TWFK 4OINA 2R92C 3S2DK 5FJ8K 4KMUA 3HOXK 3RZOK 4A93K 4A3GK 4BBRC 4A3CK 2Y0SD 1I6VA 2NVYC 4MEYA 3GTMC 3K7AC 2E2IC 3HOWC 4BXXK 1Y1VC 4A3DC 3GTKC 4JK1A 4BBRK 3S15K 1K83C 4BXXC 5C44C 5IP9K 4LLGA 3RZOC 2JA6C 3I4MC 4A93C 3M4OC 3S15C 3S2HK 2PMZD 4Y52C 2A69A 5IYDK 3HOVK 2NVQC 2VUMK 5M3MK 1HQMA 3HOVC 3GTOC 3S14C 4OIPA 1TWFC 2R92K 1I6HC 3GTQK 1YNNA 4BY7C 1I50K 1YNJA 2PA8D 3HOXC 4A3IC 4OIQA 4Q5SA 3GTQC 4XSXA 3GTKK 3CQZK 3S14K 3K7AK 2YU9K 2B63C 1SFOC 5FLMK 4YFKA 5TMFA 4A3EK 4A3JC 3GTGK 2NVTC 3HOUK 4BBSC 3I4NK 5IP7K 2WB1D 5C44K 2E2HK 2R7ZC 5C3EC 2E2JC 3GTPC 4X6AK 1I3QC 4NOIA 2JA7C 1TWGK 5IYCC 1R9TK 2PA8L 3HOYC 4MEXA 4GZYA 4C3JK 2A68A 5C4JC 3H0GC 3HOYK 4Y7NC 1SFOK 1I3QK 2JA7K 1TWGC 4QJVB 3GTOK 3HOUC 4C3HK 4A3CC 2NVTK 1TWAC 4A3FK 1I50C 4A3IK 4A3KC 2PMZL 2R93C 4XLNA 2NVXK 3CQZC 3I4NC 2WB1L 4C2MK 3S1MK 2JA5C 4AYBD 3S1NC 2O5JA 1TWCK 5IYCK 4A3JK 1Y1VK 4YFNA 5IYDC 1R9TC 4A3BK 3M3YC 2R93K 5M3FK 3S1RK 2E2IK 3HOZC 3H3VL 1TWCC 4A3MC 3S1QK 2JA5K 4OIRA 1WCMK 3M4OK 2O5IA 1BDFA 1I6HK 4Y52K 4BY7K 3DXJA 3S1RC 3S2HC 5C4XK 3HOWK 3PO3K 4A3KK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM C;  3HKZ L;  5M5W K;  1K83 K;  2VUM C;  4OIO A;  3GTJ K;  3PO3 C;  5TMC A;  3HKZ D;  3S17 K;  2A6E A;  4Y7N K;  2NVX C;  5C4X C;  2JA8 C;  5C4J K;  3GTL C;  3S1N K;  3H0G K;  4XSZ A;  4LK1 A;  4BY1 C;  4QIW L;  3S1M C;  3S16 K;  3S1Q C;  4YG2 A;  4BBS K;  2A6H A;  5IYB C;  4XLP A;  5M5X K;  2JA8 K;  3HOZ K;  4QJV A;  4A3B C;  3H3V D;  3M3Y K;  4C3I K;  3RZD K;  2NVY K;  3GTM K;  5IYB K;  5M5Y K;  5C3E K;  4A3L K;  4KN7 A;  1XPP A;  4ZH4 A;  2Y0S L;  3WOD A;  2WAQ D;  4Q4Z A;  4G7Z A;  3PO2 K;  4A3G C;  4AYB L;  5IP7 C;  3FKI C;  4A3L C;  1ZYR A;  2WAQ L;  3EQL A;  2JA6 K;  3PO2 C;  2E2H C;  2R7Z K;  4A3M K;  4G7O A;  4A3E C;  3GTG C;  1TWH C;  4A3F C;  1Y1W K;  4LK0 A;  4QIW D;  4MQ9 A;  2PPB A;  3S17 C;  4BY1 K;  3I4M K;  3S16 C;  5IP9 C;  1Y1W C;  4G7H A;  2BE5 A;  3RZD C;  1TWH K;  3S2D C;  4A3D K;  1IW7 A;  2E2J K;  3GTP K;  4X6A C;  3GTJ C;  1TWA K;  5D4D A;  2CW0 A;  4YFX A;  4KN4 A;  5FLM C;  2NVQ K;  4LJZ A;  2YU9 C;  2B63 K;  3GTL K;  1SMY A;  3FKI K;  1TWF K;  4OIN A;  2R92 C;  3S2D K;  5FJ8 K;  4KMU A;  3HOX K;  3RZO K;  4A93 K;  4A3G K;  4BBR C;  4A3C K;  2Y0S D;  1I6V A;  2NVY C;  4MEY A;  3GTM C;  3K7A C;  2E2I C;  3HOW C;  4BXX K;  1Y1V C;  4A3D C;  3GTK C;  4JK1 A;  4BBR K;  3S15 K;  1K83 C;  4BXX C;  5C44 C;  5IP9 K;  4LLG A;  3RZO C;  2JA6 C;  3I4M C;  4A93 C;  3M4O C;  3S15 C;  3S2H K;  2PMZ D;  4Y52 C;  2A69 A;  5IYD K;  3HOV K;  2NVQ C;  2VUM K;  5M3M K;  1HQM A;  3HOV C;  3GTO C;  3S14 C;  4OIP A;  1TWF C;  2R92 K;  1I6H C;  3GTQ K;  1YNN A;  4BY7 C;  1I50 K;  1YNJ A;  2PA8 D;  3HOX C;  4A3I C;  4OIQ A;  4Q5S A;  3GTQ C;  4XSX A;  3GTK K;  3CQZ K;  3S14 K;  3K7A K;  2YU9 K;  2B63 C;  1SFO C;  5FLM K;  4YFK A;  5TMF A;  4A3E K;  4A3J C;  3GTG K;  2NVT C;  3HOU K;  4BBS C;  3I4N K;  5IP7 K;  2WB1 D;  5C44 K;  2E2H K;  2R7Z C;  5C3E C;  2E2J C;  3GTP C;  4X6A K;  1I3Q C;  4NOI A;  2JA7 C;  1TWG K;  5IYC C;  1R9T K;  2PA8 L;  3HOY C;  4MEX A;  4GZY A;  4C3J K;  2A68 A;  5C4J C;  3H0G C;  3HOY K;  4Y7N C;  1SFO K;  1I3Q K;  2JA7 K;  1TWG C;  4QJV B;  3GTO K;  3HOU C;  4C3H K;  4A3C C;  2NVT K;  1TWA C;  4A3F K;  1I50 C;  4A3I K;  4A3K C;  2PMZ L;  2R93 C;  4XLN A;  2NVX K;  3CQZ C;  3I4N C;  2WB1 L;  4C2M K;  3S1M K;  2JA5 C;  4AYB D;  3S1N C;  2O5J A;  1TWC K;  5IYC K;  4A3J K;  1Y1V K;  4YFN A;  5IYD C;  1R9T C;  4A3B K;  3M3Y C;  2R93 K;  5M3F K;  3S1R K;  2E2I K;  3HOZ C;  3H3V L;  1TWC C;  4A3M C;  3S1Q K;  2JA5 K;  4OIR A;  1WCM K;  3M4O K;  2O5I A;  1BDF A;  1I6H K;  4Y52 K;  4BY7 K;  3DXJ A;  3S1R C;  3S2H C;  5C4X K;  3HOW K;  3PO3 K;  4A3K K; 
#chains in the Genus database with same CATH topology
 1TWF A;  3MML B;  5M5W K;  1K83 K;  3GTL A;  4OIO A;  1BGW A;  5IOS A;  3S17 K;  5C4X C;  5C4J K;  3H0G K;  4LK1 A;  3AD8 C;  4QIW L;  3S16 K;  1O28 A;  1J98 A;  1TWH A;  1BS2 A;  4XLP A;  2JA8 K;  1JOE A;  3H3V D;  4KC6 A;  4A3G C;  3FHZ A;  1XZQ B;  1F93 A;  1PJ5 A;  2WAQ D;  3AQP A;  3WOD A;  3TFJ A;  4AYB L;  4Q4Z A;  4KM8 A;  1EFW A;  4G0U A;  2E2H C;  4G0W A;  3GTG C;  3A8J A;  1BJT A;  4BY1 K;  3I4M K;  4G7H A;  4C3I C;  3RZD C;  3S2D C;  1JQW A;  4YFX A;  1O29 A;  4KN4 A;  1WIH A;  2YU9 C;  5FJ8 K;  3A8K A;  4KMU A;  3CQZ A;  4A3C K;  4MEY A;  1I6V A;  4A3L C;  4LOW A;  3HOW C;  5CJ9 A;  4GTE A;  3GTK C;  4JK1 A;  4BBR K;  3GDZ A;  5IP9 K;  4LLG A;  3NUH A;  4DDQ A;  4WJ4 A;  3Q3Q A;  1Y1V A;  1DD5 A;  2VUM K;  4P5B A;  3N3Y A;  3HOV C;  1ZXO A;  4OIP A;  1TWF C;  1I50 K;  2PA8 D;  3GEH A;  1I3Q A;  3A8I A;  1SFO A;  3GTQ C;  2Y3P A;  3CQZ K;  1KQ4 A;  3K7A K;  2B63 C;  3V4G A;  4A3E K;  3GTG K;  1IS1 A;  1WOP A;  4BBS C;  2JH3 A;  2E2H A;  3L4J A;  4PAA A;  3I4N K;  5IP7 K;  4KMD A;  1C0A A;  5C44 K;  4KAW X;  1I3Q C;  4NOI A;  4RMF A;  4ILD A;  4MEX A;  4C3J K;  1XXC A;  2A68 A;  3S0X A;  3GSI A;  3FOE A;  4LR2 A;  4FM9 A;  2JA6 A;  1L0W A;  4A3C C;  3GEE A;  2NVT K;  1TWA C;  4A3K C;  1I50 C;  4C2M C;  1GE9 A;  5IOR A;  3CQZ C;  1USO A;  3S1M K;  1VH2 A;  1B4B A;  1WCM K;  3G4C A;  3LAP A;  3HOW K;  4A3K K;  1WCM C;  3PO3 C;  2PHC B;  3GIR A;  2NVX C;  2GAG C;  2E2I A;  4BBS K;  1VGX A;  3IPJ A;  1ZQ1 C;  5M5X K;  2XCQ A;  3HOZ K;  4QJV A;  4A3B C;  3M3Y K;  3ADA C;  3GTM K;  5IYB K;  5M5Y K;  5C3E K;  4KM9 A;  1Y1W A;  2Y0S L;  2GSU A;  5IP7 C;  1ZYR A;  3T01 A;  3EQL A;  3GTO A;  3JST A;  4A3E C;  5L46 A;  1TWH C;  1F9N A;  2PPB A;  1R9T A;  4KAR A;  4KB4 A;  2CFA A;  1Y1W C;  4BLA A;  1TWH K;  4X6A C;  1EH1 A;  4KMA A;  1TWA K;  5D4D A;  5FLM C;  2RGR A;  2GSO A;  4LJZ A;  4J3N A;  2B63 K;  4OIN A;  3FKI K;  1TWF K;  1PJ6 A;  2D6F C;  3S2D K;  3GTG A;  2R93 A;  2YU9 A;  4KDD A;  4BBR C;  4C3H C;  4BXX K;  4LQY A;  3K7A C;  1WQH A;  1VJE A;  3AH5 A;  5C44 C;  1DCH A;  3N0B A;  1IL2 A;  3M4O C;  3S2H K;  4Y52 C;  5E68 A;  1B4A A;  4WIL A;  2NVX A;  5M3M K;  3FOF A;  1O25 A;  1J6W A;  1PJ7 A;  3S14 C;  3GTQ K;  1YNN A;  3QX3 A;  1O2A A;  1YNJ A;  3HOX C;  4A3I C;  4GTD A;  2JA7 A;  4XSX A;  3GTK K;  3L4K A;  4WJ3 M;  4YFK A;  4GTF A;  3AD7 C;  2WB1 D;  3GTP A;  2GSN A;  5C3E C;  3BP3 A;  4X6A K;  2JA7 C;  1TWG K;  2PA8 L;  4GZY A;  5C4J C;  3HOY K;  4Y7N C;  1I3Q K;  1TWG C;  4GFQ A;  4C3H K;  2R93 C;  4A3I K;  2W7V A;  4XLN A;  2WB1 L;  1UV7 A;  4AYB D;  4A3J K;  3M3Y C;  2E2I K;  4OIR A;  3M4O K;  1BDF A;  3CAG A;  3GTJ A;  4Y52 K;  3DXJ A;  1XZP A;  3PO3 K;  2R93 K;  2V6U A;  3FKI A;  3GTJ K;  1RU0 A;  1XXA A;  4Y7N K;  2JA8 C;  1ZBS A;  3GTL C;  3S1Q C;  4XSZ A;  4BY1 C;  1X31 C;  5IYB C;  4M1X A;  3T00 A;  2NVY K;  3PO2 K;  4G7Z A;  1WOS A;  4C45 A;  3AD9 C;  3N0C A;  2R7Z A;  2WAQ L;  2XCR B;  3PO2 C;  3TTG A;  2FQT A;  1HI9 A;  1ZVU A;  1O2B A;  1WSR A;  4GTC A;  1TWG A;  1XXB A;  1EI6 A;  4KB2 A;  2E2J K;  2P5M A;  2CW0 A;  2KWA A;  1ISE A;  3HOX K;  5IOT A;  1YCL A;  4A93 K;  3GTM C;  4A3D C;  1Y1V C;  2JA5 A;  4GTB A;  4A93 C;  2JA6 C;  3S15 C;  1XZP B;  2PMZ D;  2ZUE A;  2A69 A;  4FZB A;  3HOV K;  1DCP A;  4KMH A;  1HQM A;  4G0V A;  3GTO C;  2R92 K;  1USM A;  3G4A A;  4P5A A;  4OIQ A;  1VRQ C;  2P8T A;  3S14 K;  3TFI A;  1SFO C;  5FLM K;  5TMF A;  2NVT C;  1J6X A;  3HOU K;  2B63 A;  2ZUF A;  2ZFZ A;  3VA7 A;  2R7Z C;  4AH6 A;  2E2J C;  3BP8 C;  3ERE D;  1R9T K;  5JVO A;  5EGH A;  1WSV A;  3AQO A;  3GTK A;  4GT9 A;  3H0G C;  1SFO K;  2JA7 K;  1I50 A;  3GTO K;  1F7U A;  3HOU C;  2XCO A;  2NVX K;  3I4N C;  3GTM A;  4C2M K;  2JA5 C;  3S1N C;  1F7V A;  2O5J A;  1IE0 A;  1R9T C;  4A3B K;  3S1R K;  3H0G A;  3H3V L;  4KAS A;  1TWC C;  4A3M C;  3OEP A;  2JA5 K;  4C3J C;  1JVI A;  1I6H K;  3GEI A;  3S1R C;  5C4X K;  3S17 C;  4A3D K;  3HKZ L;  3BUE A;  2VUM C;  2RH6 A;  5TMC A;  3HKZ D;  1WCM A;  2A6E A;  3S1N K;  3S1M C;  4YG2 A;  1TWC A;  2A6H A;  4C3I K;  3RZD K;  4A3L K;  1G51 A;  1XPP A;  4KN7 A;  4ZH4 A;  5HL8 A;  3SZZ A;  3FKI C;  1DCO A;  2CFA B;  2JA6 K;  2R7Z K;  4A3M K;  4G7O A;  4PAB A;  4GTL A;  1VLO A;  4KAT A;  1Y1W K;  4LK0 A;  4QIW D;  4MQ9 A;  3TFH A;  3LAJ A;  3S16 C;  1EQR A;  1WQG A;  1WQF A;  5IP9 C;  2BE5 A;  3SZY A;  1IW7 A;  3GTP K;  2GAH C;  3GTJ C;  1XZQ A;  2NVQ K;  3GTL K;  3S1Q K;  1SMY A;  1O2F B;  2R92 C;  3LPX A;  3OPF A;  3RZO K;  1INN A;  4A3G K;  1O24 A;  2Y0S D;  5JFE A;  2NVY C;  2E2I C;  4BKW A;  3S15 K;  1K83 C;  3GTQ A;  4BXX C;  1WOO A;  3RZO C;  3I4M C;  4P9S A;  2FQO A;  2VUM A;  5IYD K;  4O2D A;  2NVQ C;  1WOR A;  1I6H C;  4BY7 C;  1IQ0 A;  5IOQ A;  4Q5S A;  2YU9 K;  1V5V A;  4A3J C;  5TJ3 A;  1YX2 A;  4XCH A;  1EK8 A;  1TWA A;  4GTA A;  4BLB A;  3HXA A;  2E2H K;  5CHP A;  3GTP C;  5IYC C;  3HOY C;  4QJV B;  5EGE A;  3T02 A;  1AB4 A;  2R92 A;  2V6T A;  4A3F K;  3ORE A;  2PMZ L;  1J6V A;  2NVY A;  2V6S A;  2EBB A;  1TWC K;  5IYC K;  1Y1V K;  4YFN A;  5IYD C;  5M3F K;  1O26 A;  3HOZ C;  2O5I A;  1K83 A;  4BY7 K;  3S2H C;  1IBA A;  1O27 A;  4A3F C; 
#chains in the Genus database with same CATH homology
 1WCM C;  3HKZ L;  5M5W K;  1K83 K;  2VUM C;  4OIO A;  3GTJ K;  3PO3 C;  5TMC A;  3HKZ D;  3S17 K;  2A6E A;  4Y7N K;  2NVX C;  5C4X C;  2JA8 C;  5C4J K;  3GTL C;  3S1N K;  3H0G K;  4XSZ A;  4LK1 A;  4BY1 C;  4QIW L;  3S1M C;  3S16 K;  3S1Q C;  4YG2 A;  4BBS K;  2A6H A;  5IYB C;  4XLP A;  5M5X K;  2JA8 K;  3HOZ K;  4QJV A;  4A3B C;  3H3V D;  3M3Y K;  4C3I K;  3RZD K;  2NVY K;  3GTM K;  5IYB K;  5M5Y K;  5C3E K;  4A3L K;  4KN7 A;  1XPP A;  4ZH4 A;  2Y0S L;  3WOD A;  2WAQ D;  4Q4Z A;  4G7Z A;  3PO2 K;  4A3G C;  4AYB L;  5IP7 C;  3FKI C;  4A3L C;  1ZYR A;  2WAQ L;  3EQL A;  2JA6 K;  3PO2 C;  2E2H C;  2R7Z K;  4A3M K;  4G7O A;  4A3E C;  3GTG C;  1TWH C;  4A3F C;  1Y1W K;  4LK0 A;  4QIW D;  4MQ9 A;  2PPB A;  3S17 C;  4BY1 K;  3I4M K;  3S16 C;  5IP9 C;  1Y1W C;  4G7H A;  2BE5 A;  3RZD C;  1TWH K;  3S2D C;  4A3D K;  1IW7 A;  2E2J K;  3GTP K;  4X6A C;  3GTJ C;  1TWA K;  5D4D A;  2CW0 A;  4YFX A;  4KN4 A;  5FLM C;  2NVQ K;  4LJZ A;  2YU9 C;  2B63 K;  3GTL K;  1SMY A;  3FKI K;  1TWF K;  4OIN A;  2R92 C;  3S2D K;  5FJ8 K;  4KMU A;  3HOX K;  3RZO K;  4A93 K;  4A3G K;  4BBR C;  4A3C K;  2Y0S D;  1I6V A;  2NVY C;  4MEY A;  3GTM C;  3K7A C;  2E2I C;  3HOW C;  4BXX K;  1Y1V C;  4A3D C;  3GTK C;  4JK1 A;  4BBR K;  3S15 K;  1K83 C;  4BXX C;  5C44 C;  5IP9 K;  4LLG A;  3RZO C;  2JA6 C;  3I4M C;  4A93 C;  3M4O C;  3S15 C;  3S2H K;  2PMZ D;  4Y52 C;  2A69 A;  5IYD K;  3HOV K;  2NVQ C;  2VUM K;  5M3M K;  1HQM A;  3HOV C;  3GTO C;  3S14 C;  4OIP A;  1TWF C;  2R92 K;  1I6H C;  3GTQ K;  1YNN A;  4BY7 C;  1I50 K;  1YNJ A;  2PA8 D;  3HOX C;  4A3I C;  4OIQ A;  4Q5S A;  3GTQ C;  4XSX A;  3GTK K;  3CQZ K;  3S14 K;  3K7A K;  2YU9 K;  2B63 C;  1SFO C;  5FLM K;  4YFK A;  5TMF A;  4A3E K;  4A3J C;  3GTG K;  2NVT C;  3HOU K;  4BBS C;  3I4N K;  5IP7 K;  2WB1 D;  5C44 K;  2E2H K;  2R7Z C;  5C3E C;  2E2J C;  3GTP C;  4X6A K;  1I3Q C;  4NOI A;  2JA7 C;  1TWG K;  5IYC C;  1R9T K;  2PA8 L;  3HOY C;  4MEX A;  4GZY A;  4C3J K;  2A68 A;  5C4J C;  3H0G C;  3HOY K;  4Y7N C;  1SFO K;  1I3Q K;  2JA7 K;  1TWG C;  4QJV B;  3GTO K;  3HOU C;  4C3H K;  4A3C C;  2NVT K;  1TWA C;  4A3F K;  1I50 C;  4A3I K;  4A3K C;  2PMZ L;  2R93 C;  4XLN A;  2NVX K;  3CQZ C;  3I4N C;  2WB1 L;  4C2M K;  3S1M K;  2JA5 C;  4AYB D;  3S1N C;  2O5J A;  1TWC K;  5IYC K;  4A3J K;  1Y1V K;  4YFN A;  5IYD C;  1R9T C;  4A3B K;  3M3Y C;  2R93 K;  5M3F K;  3S1R K;  2E2I K;  3HOZ C;  3H3V L;  1TWC C;  4A3M C;  3S1Q K;  2JA5 K;  4OIR A;  1WCM K;  3M4O K;  2O5I A;  1BDF A;  1I6H K;  4Y52 K;  4BY7 K;  3DXJ A;  3S1R C;  3S2H C;  5C4X K;  3HOW K;  3PO3 K;  4A3K K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...