2PMZL

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
b'MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 20
structure length 92
sequence length 92
chains with identical sequence X
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pmzL00
4QIWD 4XLPA 4GZYA 5IYBC 4A3EC 4A3JC 2NVQK 2R7ZC 1TWHC 4Y7NK 4A3CK 4QJVA 3GTOC 3S2HK 1TWAK 4LK0A 3S2DK 5M5YK 4LK1A 3GTKK 2E2JK 3GTPC 5C4XC 3S14C 2A68A 1TWFK 1HQMA 4A3KC 4OIRA 5IP7C 3HOYC 3I4MC 4XSZA 1IW7A 1R9TC 4Y52K 1I50K 2NVTK 4XSXA 2JA7C 4BBRC 4YG2A 2E2HC 1WCMC 3HKZD 3GTJK 3RZDK 4OINA 2WAQL 4G7ZA 4MQ9A 2O5IA 3HOWK 2NVYK 2WB1L 2VUMC 4QIWL 4C2MK 5M5XK 3GTGC 4KN4A 5C44K 1TWCC 2PPBA 1Y1VK 2O5JA 3S1QK 1TWGC 3S15K 3HOUC 1I6HC 3K7AK 2WAQD 3HOXK 3HOVC 3H0GC 2JA6C 2R92K 3S16C 3S1NC 4A93C 4A3BK 3WODA 3PO3K 3HOZC 3I4NK 3M3YC 4A3IC 3HKZL 4A3LC 5FJ8K 2B63K 4BBSC 2YU9C 5IYCK 4MEYA 2JA5K 2R93K 5TMCA 5C3EC 4A3CC 3S1MK 1Y1WK 3PO2K 5C4JK 5M3FK 1I3QK 3FKIK 4A3MK 2NVQC 4OIOA 3CQZK 4BY1K 4Y7NC 4A3DK 3S2HC 5IP9K 1TWAC 1SMYA 3S2DC 3GTKC 2E2JC 4A3GK 1TWFC 3S1RK 2BE5A 1SFOC 4Y52C 3GTLK 1I50C 5IYDC 2NVTC 3H3VD 4Q5SA 4LJZA 4QJVB 3GTJC 3HOWC 3GTQK 4C3IK 3RZOK 2NVYC 2E2IK 1K83K 2NVXK 5C44C 4Q4ZA 4BY7K 3M4OK 1Y1VC 3S17K 3S1QC 4X6AK 3S15C 4BXXK 2JA8K 3K7AC 5TMFA 3HOXC 4YFKA 2R92C 4A3BC 5FLMK 3GTMK 3GTGK 4C3JK 4A3FK 1SFOK 4LLGA 3H3VL 2Y0SD 3PO3C 3I4NC 5IYBK 2B63C 4A3EK 4A3JK 4A93K 4OIPA 2R7ZK 5IYCC 1TWHK 2JA5C 4G7OA 4G7HA 3GTOK 2R93C 2A69A 2PMZD 4AYBD 2PA8D 5C4XK 3S1MC 3GTPK 1Y1WC 3S14K 3PO2C 5C4JC 4A3KK 3I4MK 1YNJA 5IP7K 3HOYK 3FKIC 1I3QC 4A3MC 1R9TK 3RZDC 2JA7K 3CQZC 4KMUA 1ZYRA 1WCMK 4BBRK 2E2HK 4BY1C 4A3DC 5IP9C 4YFNA 4JK1A 4A3GC 2Y0SL 2VUMK 3S1RC 4XLNA 1TWCK 3GTLC 1YNNA 1BDFA 1TWGK 2A6HA 4YFXA 4NOIA 3GTQC 3HOUK 2PMZL 4AYBL 3RZOC 2PA8L 1I6HK 3HOVK 1XPPA 4C3HK 2E2IC 1K83C 3H0GK 2NVXC 5M3MK 2JA6K 3S16K 3S1NK 3EQLA 4OIQA 4ZH4A 3M4OC 3HOZK 3S17C 4BY7C 3M3YK 4A3IK 4A3LK 2A6EA 4X6AC 4BXXC 5D4DA 1I6VA 4BBSK 2JA8C 2CW0A 4KN7A 5M5WK 2YU9K 5IYDK 4MEXA 5FLMC 3GTMC 3DXJA 4A3FC 5C3EK 2WB1D
chains in the Genus database with same CATH superfamily
3N3YA 1J6XA 1ZVUA 4A3JC 2NVQK 1B4AA 1TWHC 4Y7NK 1UV7A 3S2DK 4KMAA 4J3NA 5C4XC 4A3KC 1HQMA 4XSZA 1IW7A 1R9TC 4Y52K 3AD7C 3N0BA 5IYDK 3CQZA 3GTJK 3ADAC 4DDQA 3AD9C 2WB1L 2VUMC 2GAHC 5C44K 3LAPA 3TFHA 3TFJA 1JVIA 1WCMA 1O2AA 3HOXK 2P5MA 1K83A 4GTLA 4P9SA 3WODA 3PO3K 3HOZC 5FJ8K 4RMFA 1EK8A 2RH6A 4MEYA 4KMHA 5C3EC 1B4BA 3PO2K 5M3FK 2NVQC 4Y7NC 3GTOA 3S2DC 4A3GK 4Y52C 5IYDC 3H3VD 4QJVB 3GTJC 1USMA 5C44C 4BKWA 3TTGA 1RU0A 4BXXK 3SZZA 3HOXC 4YFKA 4BLBA 3PO3C 1EI6A 3H3VL 2Y0SD 3Q3QA 4OIPA 1VH2A 4G0VA 3BP3A 3PO2C 3RZDC 2JA7K 5E68A 4JK1A 3V4GA 1BS2A 4A3GC 2Y0SL 1TWFA 1TWCK 1BDFA 1TWGK 4YFXA 1I6HK 3CAGA 3S16K 3H0GK 1XZPA 5M3MK 3FOEA 3EQLA 4ZH4A 3OPFA 3M3YK 4A3LK 1EQRA 4BXXC 1ISEA 1YCLA 4KN7A 2YU9K 1VRQC 1HI9A 4OINA 4KB2A 3A8IA 4QIWD 4XLPA 1WIHA 4KARA 3BP8C 1TWAK 5M5YK 4LK1A 4C45A 3FOFA 3GTKK 4GTCA 1Y1WA 1SFOA 2A68A 3FKIA 1I50K 3GEEA 2NVTK 2JA7C 4YG2A 4GTEA 3AH5A 2WAQL 1TWHA 4PAAA 4GTFA 4QIWL 1TWCC 1Y1VK 2FQOA 1TWGC 2GSOA 1I6HC 3S16C 3H0GC 2R92K 2VUMA 4XCHA 3T02A 3M3YC 4WJ4A 4A3LC 1WOOA 2YU9C 5HL8A 3GTGA 3GIRA 5CJ9A 2R7ZA 3CQZK 5IORA 5IP9K 1TWAC 3G4AA 3GTKC 3GTPA 2BE5A 1I50C 2NVTC 2JH3A 2E2HA 1G51A 3GTQK 4C3IK 3GEIA 3A8KA 5EGEA 2E2IK 1K83K 2NVXK 4Q4ZA 5TJ3A 1VGXA 1Y1VC 4FM9A 1BGWA 4X6AK 1JOEA 3GTJA 1O2BA 2JA8K 2R92C 2JA6A 2KWAA 4A3EK 1IBAA 1F7VA 4KMDA 4GTAA 4G7HA 3GTOK 3IPJA 2PMZD 3S0XA 3GSIA 5IP7K 3CQZC 2XCQA 5IP9C 4YFNA 4KATA 2P8TA 4KM9A 4NOIA 4C3IC 3GTQC 2PMZL 2NVYA 3HOUK 3FHZA 3HOVK 2E2IC 1K83C 2NVXC 4A93K 2O5JA 1ZQ1C 4P5BA 3SZYA 4GFQA 4X6AC 1I6VA 2JA8C 5M5WK 1XZQB 3N0CA 5C3EK 3DXJA 4A3CK 4BLAA 1DCHA 1O29A 4GZYA 4A3EC 2XCRB 2B63A 2JA5A 5EGHA 4QJVA 1X31C 3GTOC 5IOQA 5IOTA 1TWFK 4OIRA 5IP7C 1I3QA 2PHCB 3HKZD 4LQYA 3HOWK 4G7ZA 4C2MK 2FQTA 3TFIA 2CFAB 4KDDA 3GTLA 1DCPA 4FZBA 4O2DA 3S15K 3HOUC 2WAQD 2Y3PA 3K7AK 3HOVC 4A93C 1F9NA 4A3BK 3I4NK 1AB4A 1JQWA 1WQGA 3HKZL 5JVOA 1V5VA 1WSRA 2V6UA 2R93K 1PJ6A 3GTMA 4A3CC 3S1MK 2GSUA 1WOSA 1Y1WK 5CHPA 3FKIK 4BY1K 2ZUEA 4A3DK 1WORA 1J98A 1ZBSA 1TWFC 1J6WA 5L46A 3S1RK 1EH1A 1R9TA 3HOWC 3RZOK 4C2MC 3GTKA 3M4OK 1F93A 1WQHA 3S17K 1O28A 3VA7A 3S15C 3K7AC 4KAWX 4A3BC 3GTGK 4LLGA 4AH6A 3JSTA 3I4NC 1Y1VA 1WOPA 4P5AA 5IYBK 2R7ZK 3G4CA 4G0WA 4KASA 2R93C 1WSVA 4AYBD 3S1MC 3GTPK 1Y1WC 3S14K 3I4MK 1YNJA 3HOYK 3FKIC 3GDZA 4BBRK 4KMUA 1ZYRA 1WCMK 2E2HK 4BY1C 4A3DC 3S1RC 1DD5A 4XLNA 4WJ3M 3BUEA 3GEHA 2XCOA 3A8JA 3HXAA 3RZOC 1XXBA 4AYBL 1XPPA 4C3HK 2JA6K 3S1NK 3M4OC 2W7VA 3S17C 4A3IK 2A6EA 4BBSK 3GTQA 2O5IA 3L4KA 3GTGC 2E2IA 2NVXA 1INNA 5IYBC 1L0WA 2V6SA 2R7ZC 3S2HK 3AD8C 4LK0A 2E2JK 3GTPC 1J6VA 2ZUFA 2D6FC 3S14C 3I4MC 3HOYC 1PJ7A 4XSXA 4BBRC 2E2HC 1WCMC 1XXCA 3RZDK 3LAJA 3OREA 4MQ9A 2NVYK 4G0UA 3ERED 5M5XK 1IL2A 1O27A 4KN4A 2PPBA 3T01A 3S1QK 1IS1A 1WQFA 4M1XA 1YX2A 4C3HC 4WILA 2JA6C 3S1NC 3T00A 4GT9A 1O26A 4A3IC 1PJ5A 2B63K 3NUHA 4BBSC 1XZPB 5IYCK 2JA5K 5TMCA 5C4JK 4KM8A 1I3QK 4A3MK 4OIOA 1BJTA 1O24A 5JFEA 3S2HC 3MMLB 3OEPA 1IQ0A 1SMYA 2E2JC 2V6TA 1EFWA 4ILDA 1SFOC 3GTLK 4Q5SA 4LJZA 2JA7A 1KQ4A 1XXAA 2NVYC 3AQPA 4GTDA 1USOA 3AQOA 1XZQA 4BY7K 1TWCA 4KB4A 4LOWA 4LR2A 3S1QC 1TWGA 1ZXOA 3LPXA 2ZFZA 5TMFA 1O25A 3H0GA 3L4JA 1O2FB 5FLMK 3GTMK 4C3JK 4A3FK 1SFOK 1VJEA 2B63C 4A3JK 2YU9A 5IYCC 1TWHK 2JA5C 4G7OA 2EBBA 2A69A 1F7UA 2PA8D 5C4XK 1VLOA 1IE0A 5C4JC 4A3KK 1DCOA 1I3QC 4A3MC 1R9TK 2CFAA 5IOSA 1TWAA 3QX3A 2R93A 2RGRA 2VUMK 2GSNA 1C0AA 3GTLC 1YNNA 1I50A 2A6HA 4GTBA 2PA8L 2GAGC 4BY7C 4OIQA 3HOZK 1GE9A 4PABA 5D4DA 2CW0A 2R92A 4MEXA 5FLMC 3GTMC 4C3JC 4A3FC 4KC6A 2WB1D
chains in the Genus database with same CATH topology
4QIWD 4XLPA 4GZYA 5IYBC 4A3EC 4A3JC 2NVQK 2R7ZC 1TWHC 4Y7NK 4A3CK 4QJVA 3GTOC 3S2HK 1TWAK 4LK0A 3S2DK 5M5YK 4LK1A 3GTKK 2E2JK 3GTPC 5C4XC 3S14C 2A68A 1TWFK 1HQMA 4A3KC 4OIRA 5IP7C 3HOYC 3I4MC 4XSZA 1IW7A 1R9TC 4Y52K 1I50K 2NVTK 4XSXA 2JA7C 4BBRC 4YG2A 2E2HC 1WCMC 3HKZD 3GTJK 3RZDK 4OINA 2WAQL 4G7ZA 4MQ9A 2O5IA 3HOWK 2NVYK 2WB1L 2VUMC 4QIWL 4C2MK 5M5XK 3GTGC 4KN4A 5C44K 1TWCC 2PPBA 1Y1VK 2O5JA 3S1QK 1TWGC 3S15K 3HOUC 1I6HC 3K7AK 2WAQD 3HOXK 3HOVC 3H0GC 2JA6C 2R92K 3S16C 3S1NC 4A93C 4A3BK 3WODA 3PO3K 3HOZC 3I4NK 3M3YC 4A3IC 3HKZL 4A3LC 5FJ8K 2B63K 4BBSC 2YU9C 5IYCK 4MEYA 2JA5K 2R93K 5TMCA 5C3EC 4A3CC 3S1MK 1Y1WK 3PO2K 5C4JK 5M3FK 1I3QK 3FKIK 4A3MK 2NVQC 4OIOA 3CQZK 4BY1K 4Y7NC 4A3DK 3S2HC 5IP9K 1TWAC 1SMYA 3S2DC 3GTKC 2E2JC 4A3GK 1TWFC 3S1RK 2BE5A 1SFOC 4Y52C 3GTLK 1I50C 5IYDC 2NVTC 3H3VD 4Q5SA 4LJZA 4QJVB 3GTJC 3HOWC 3GTQK 4C3IK 3RZOK 2NVYC 2E2IK 1K83K 2NVXK 5C44C 4Q4ZA 4BY7K 3M4OK 1Y1VC 3S17K 3S1QC 4X6AK 3S15C 4BXXK 2JA8K 3K7AC 5TMFA 3HOXC 4YFKA 2R92C 4A3BC 5FLMK 3GTMK 3GTGK 4C3JK 4A3FK 1SFOK 4LLGA 3H3VL 2Y0SD 3PO3C 3I4NC 5IYBK 2B63C 4A3EK 4A3JK 4A93K 4OIPA 2R7ZK 5IYCC 1TWHK 2JA5C 4G7OA 4G7HA 3GTOK 2R93C 2A69A 2PMZD 4AYBD 2PA8D 5C4XK 3S1MC 3GTPK 1Y1WC 3S14K 3PO2C 5C4JC 4A3KK 3I4MK 1YNJA 5IP7K 3HOYK 3FKIC 1I3QC 4A3MC 1R9TK 3RZDC 2JA7K 3CQZC 4KMUA 1ZYRA 1WCMK 4BBRK 2E2HK 4BY1C 4A3DC 5IP9C 4YFNA 4JK1A 4A3GC 2Y0SL 2VUMK 3S1RC 4XLNA 1TWCK 3GTLC 1YNNA 1BDFA 1TWGK 2A6HA 4YFXA 4NOIA 3GTQC 3HOUK 2PMZL 4AYBL 3RZOC 2PA8L 1I6HK 3HOVK 1XPPA 4C3HK 2E2IC 1K83C 3H0GK 2NVXC 5M3MK 2JA6K 3S16K 3S1NK 3EQLA 4OIQA 4ZH4A 3M4OC 3HOZK 3S17C 4BY7C 3M3YK 4A3IK 4A3LK 2A6EA 4X6AC 4BXXC 5D4DA 1I6VA 4BBSK 2JA8C 2CW0A 4KN7A 5M5WK 2YU9K 5IYDK 4MEXA 5FLMC 3GTMC 3DXJA 4A3FC 5C3EK 2WB1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW D;  4XLP A;  4GZY A;  5IYB C;  4A3E C;  4A3J C;  2NVQ K;  2R7Z C;  1TWH C;  4Y7N K;  4A3C K;  4QJV A;  3GTO C;  3S2H K;  1TWA K;  4LK0 A;  3S2D K;  5M5Y K;  4LK1 A;  3GTK K;  2E2J K;  3GTP C;  5C4X C;  3S14 C;  2A68 A;  1TWF K;  1HQM A;  4A3K C;  4OIR A;  5IP7 C;  3HOY C;  3I4M C;  4XSZ A;  1IW7 A;  1R9T C;  4Y52 K;  1I50 K;  2NVT K;  4XSX A;  2JA7 C;  4BBR C;  4YG2 A;  2E2H C;  1WCM C;  3HKZ D;  3GTJ K;  3RZD K;  4OIN A;  2WAQ L;  4G7Z A;  4MQ9 A;  2O5I A;  3HOW K;  2NVY K;  2WB1 L;  2VUM C;  4QIW L;  4C2M K;  5M5X K;  3GTG C;  4KN4 A;  5C44 K;  1TWC C;  2PPB A;  1Y1V K;  2O5J A;  3S1Q K;  1TWG C;  3S15 K;  3HOU C;  1I6H C;  3K7A K;  2WAQ D;  3HOX K;  3HOV C;  3H0G C;  2JA6 C;  2R92 K;  3S16 C;  3S1N C;  4A93 C;  4A3B K;  3WOD A;  3PO3 K;  3HOZ C;  3I4N K;  3M3Y C;  4A3I C;  3HKZ L;  4A3L C;  5FJ8 K;  2B63 K;  4BBS C;  2YU9 C;  5IYC K;  4MEY A;  2JA5 K;  2R93 K;  5TMC A;  5C3E C;  4A3C C;  3S1M K;  1Y1W K;  3PO2 K;  5C4J K;  5M3F K;  1I3Q K;  3FKI K;  4A3M K;  2NVQ C;  4OIO A;  3CQZ K;  4BY1 K;  4Y7N C;  4A3D K;  3S2H C;  5IP9 K;  1TWA C;  1SMY A;  3S2D C;  3GTK C;  2E2J C;  4A3G K;  1TWF C;  3S1R K;  2BE5 A;  1SFO C;  4Y52 C;  3GTL K;  1I50 C;  5IYD C;  2NVT C;  3H3V D;  4Q5S A;  4LJZ A;  4QJV B;  3GTJ C;  3HOW C;  3GTQ K;  4C3I K;  3RZO K;  2NVY C;  2E2I K;  1K83 K;  2NVX K;  5C44 C;  4Q4Z A;  4BY7 K;  3M4O K;  1Y1V C;  3S17 K;  3S1Q C;  4X6A K;  3S15 C;  4BXX K;  2JA8 K;  3K7A C;  5TMF A;  3HOX C;  4YFK A;  2R92 C;  4A3B C;  5FLM K;  3GTM K;  3GTG K;  4C3J K;  4A3F K;  1SFO K;  4LLG A;  3H3V L;  2Y0S D;  3PO3 C;  3I4N C;  5IYB K;  2B63 C;  4A3E K;  4A3J K;  4A93 K;  4OIP A;  2R7Z K;  5IYC C;  1TWH K;  2JA5 C;  4G7O A;  4G7H A;  3GTO K;  2R93 C;  2A69 A;  2PMZ D;  4AYB D;  2PA8 D;  5C4X K;  3S1M C;  3GTP K;  1Y1W C;  3S14 K;  3PO2 C;  5C4J C;  4A3K K;  3I4M K;  1YNJ A;  5IP7 K;  3HOY K;  3FKI C;  1I3Q C;  4A3M C;  1R9T K;  3RZD C;  2JA7 K;  3CQZ C;  4KMU A;  1ZYR A;  1WCM K;  4BBR K;  2E2H K;  4BY1 C;  4A3D C;  5IP9 C;  4YFN A;  4JK1 A;  4A3G C;  2Y0S L;  2VUM K;  3S1R C;  4XLN A;  1TWC K;  3GTL C;  1YNN A;  1BDF A;  1TWG K;  2A6H A;  4YFX A;  4NOI A;  3GTQ C;  3HOU K;  2PMZ L;  4AYB L;  3RZO C;  2PA8 L;  1I6H K;  3HOV K;  1XPP A;  4C3H K;  2E2I C;  1K83 C;  3H0G K;  2NVX C;  5M3M K;  2JA6 K;  3S16 K;  3S1N K;  3EQL A;  4OIQ A;  4ZH4 A;  3M4O C;  3HOZ K;  3S17 C;  4BY7 C;  3M3Y K;  4A3I K;  4A3L K;  2A6E A;  4X6A C;  4BXX C;  5D4D A;  1I6V A;  4BBS K;  2JA8 C;  2CW0 A;  4KN7 A;  5M5W K;  2YU9 K;  5IYD K;  4MEX A;  5FLM C;  3GTM C;  3DXJ A;  4A3F C;  5C3E K;  2WB1 D; 
#chains in the Genus database with same CATH topology
 3N3Y A;  1J6X A;  1ZVU A;  4A3J C;  2NVQ K;  1B4A A;  1TWH C;  4Y7N K;  1UV7 A;  3S2D K;  4KMA A;  4J3N A;  5C4X C;  4A3K C;  1HQM A;  4XSZ A;  1IW7 A;  1R9T C;  4Y52 K;  3AD7 C;  3N0B A;  5IYD K;  3CQZ A;  3GTJ K;  3ADA C;  4DDQ A;  3AD9 C;  2WB1 L;  2VUM C;  2GAH C;  5C44 K;  3LAP A;  3TFH A;  3TFJ A;  1JVI A;  1WCM A;  1O2A A;  3HOX K;  2P5M A;  1K83 A;  4GTL A;  4P9S A;  3WOD A;  3PO3 K;  3HOZ C;  5FJ8 K;  4RMF A;  1EK8 A;  2RH6 A;  4MEY A;  4KMH A;  5C3E C;  1B4B A;  3PO2 K;  5M3F K;  2NVQ C;  4Y7N C;  3GTO A;  3S2D C;  4A3G K;  4Y52 C;  5IYD C;  3H3V D;  4QJV B;  3GTJ C;  1USM A;  5C44 C;  4BKW A;  3TTG A;  1RU0 A;  4BXX K;  3SZZ A;  3HOX C;  4YFK A;  4BLB A;  3PO3 C;  1EI6 A;  3H3V L;  2Y0S D;  3Q3Q A;  4OIP A;  1VH2 A;  4G0V A;  3BP3 A;  3PO2 C;  3RZD C;  2JA7 K;  5E68 A;  4JK1 A;  3V4G A;  1BS2 A;  4A3G C;  2Y0S L;  1TWF A;  1TWC K;  1BDF A;  1TWG K;  4YFX A;  1I6H K;  3CAG A;  3S16 K;  3H0G K;  1XZP A;  5M3M K;  3FOE A;  3EQL A;  4ZH4 A;  3OPF A;  3M3Y K;  4A3L K;  1EQR A;  4BXX C;  1ISE A;  1YCL A;  4KN7 A;  2YU9 K;  1VRQ C;  1HI9 A;  4OIN A;  4KB2 A;  3A8I A;  4QIW D;  4XLP A;  1WIH A;  4KAR A;  3BP8 C;  1TWA K;  5M5Y K;  4LK1 A;  4C45 A;  3FOF A;  3GTK K;  4GTC A;  1Y1W A;  1SFO A;  2A68 A;  3FKI A;  1I50 K;  3GEE A;  2NVT K;  2JA7 C;  4YG2 A;  4GTE A;  3AH5 A;  2WAQ L;  1TWH A;  4PAA A;  4GTF A;  4QIW L;  1TWC C;  1Y1V K;  2FQO A;  1TWG C;  2GSO A;  1I6H C;  3S16 C;  3H0G C;  2R92 K;  2VUM A;  4XCH A;  3T02 A;  3M3Y C;  4WJ4 A;  4A3L C;  1WOO A;  2YU9 C;  5HL8 A;  3GTG A;  3GIR A;  5CJ9 A;  2R7Z A;  3CQZ K;  5IOR A;  5IP9 K;  1TWA C;  3G4A A;  3GTK C;  3GTP A;  2BE5 A;  1I50 C;  2NVT C;  2JH3 A;  2E2H A;  1G51 A;  3GTQ K;  4C3I K;  3GEI A;  3A8K A;  5EGE A;  2E2I K;  1K83 K;  2NVX K;  4Q4Z A;  5TJ3 A;  1VGX A;  1Y1V C;  4FM9 A;  1BGW A;  4X6A K;  1JOE A;  3GTJ A;  1O2B A;  2JA8 K;  2R92 C;  2JA6 A;  2KWA A;  4A3E K;  1IBA A;  1F7V A;  4KMD A;  4GTA A;  4G7H A;  3GTO K;  3IPJ A;  2PMZ D;  3S0X A;  3GSI A;  5IP7 K;  3CQZ C;  2XCQ A;  5IP9 C;  4YFN A;  4KAT A;  2P8T A;  4KM9 A;  4NOI A;  4C3I C;  3GTQ C;  2PMZ L;  2NVY A;  3HOU K;  3FHZ A;  3HOV K;  2E2I C;  1K83 C;  2NVX C;  4A93 K;  2O5J A;  1ZQ1 C;  4P5B A;  3SZY A;  4GFQ A;  4X6A C;  1I6V A;  2JA8 C;  5M5W K;  1XZQ B;  3N0C A;  5C3E K;  3DXJ A;  4A3C K;  4BLA A;  1DCH A;  1O29 A;  4GZY A;  4A3E C;  2XCR B;  2B63 A;  2JA5 A;  5EGH A;  4QJV A;  1X31 C;  3GTO C;  5IOQ A;  5IOT A;  1TWF K;  4OIR A;  5IP7 C;  1I3Q A;  2PHC B;  3HKZ D;  4LQY A;  3HOW K;  4G7Z A;  4C2M K;  2FQT A;  3TFI A;  2CFA B;  4KDD A;  3GTL A;  1DCP A;  4FZB A;  4O2D A;  3S15 K;  3HOU C;  2WAQ D;  2Y3P A;  3K7A K;  3HOV C;  4A93 C;  1F9N A;  4A3B K;  3I4N K;  1AB4 A;  1JQW A;  1WQG A;  3HKZ L;  5JVO A;  1V5V A;  1WSR A;  2V6U A;  2R93 K;  1PJ6 A;  3GTM A;  4A3C C;  3S1M K;  2GSU A;  1WOS A;  1Y1W K;  5CHP A;  3FKI K;  4BY1 K;  2ZUE A;  4A3D K;  1WOR A;  1J98 A;  1ZBS A;  1TWF C;  1J6W A;  5L46 A;  3S1R K;  1EH1 A;  1R9T A;  3HOW C;  3RZO K;  4C2M C;  3GTK A;  3M4O K;  1F93 A;  1WQH A;  3S17 K;  1O28 A;  3VA7 A;  3S15 C;  3K7A C;  4KAW X;  4A3B C;  3GTG K;  4LLG A;  4AH6 A;  3JST A;  3I4N C;  1Y1V A;  1WOP A;  4P5A A;  5IYB K;  2R7Z K;  3G4C A;  4G0W A;  4KAS A;  2R93 C;  1WSV A;  4AYB D;  3S1M C;  3GTP K;  1Y1W C;  3S14 K;  3I4M K;  1YNJ A;  3HOY K;  3FKI C;  3GDZ A;  4BBR K;  4KMU A;  1ZYR A;  1WCM K;  2E2H K;  4BY1 C;  4A3D C;  3S1R C;  1DD5 A;  4XLN A;  4WJ3 M;  3BUE A;  3GEH A;  2XCO A;  3A8J A;  3HXA A;  3RZO C;  1XXB A;  4AYB L;  1XPP A;  4C3H K;  2JA6 K;  3S1N K;  3M4O C;  2W7V A;  3S17 C;  4A3I K;  2A6E A;  4BBS K;  3GTQ A;  2O5I A;  3L4K A;  3GTG C;  2E2I A;  2NVX A;  1INN A;  5IYB C;  1L0W A;  2V6S A;  2R7Z C;  3S2H K;  3AD8 C;  4LK0 A;  2E2J K;  3GTP C;  1J6V A;  2ZUF A;  2D6F C;  3S14 C;  3I4M C;  3HOY C;  1PJ7 A;  4XSX A;  4BBR C;  2E2H C;  1WCM C;  1XXC A;  3RZD K;  3LAJ A;  3ORE A;  4MQ9 A;  2NVY K;  4G0U A;  3ERE D;  5M5X K;  1IL2 A;  1O27 A;  4KN4 A;  2PPB A;  3T01 A;  3S1Q K;  1IS1 A;  1WQF A;  4M1X A;  1YX2 A;  4C3H C;  4WIL A;  2JA6 C;  3S1N C;  3T00 A;  4GT9 A;  1O26 A;  4A3I C;  1PJ5 A;  2B63 K;  3NUH A;  4BBS C;  1XZP B;  5IYC K;  2JA5 K;  5TMC A;  5C4J K;  4KM8 A;  1I3Q K;  4A3M K;  4OIO A;  1BJT A;  1O24 A;  5JFE A;  3S2H C;  3MML B;  3OEP A;  1IQ0 A;  1SMY A;  2E2J C;  2V6T A;  1EFW A;  4ILD A;  1SFO C;  3GTL K;  4Q5S A;  4LJZ A;  2JA7 A;  1KQ4 A;  1XXA A;  2NVY C;  3AQP A;  4GTD A;  1USO A;  3AQO A;  1XZQ A;  4BY7 K;  1TWC A;  4KB4 A;  4LOW A;  4LR2 A;  3S1Q C;  1TWG A;  1ZXO A;  3LPX A;  2ZFZ A;  5TMF A;  1O25 A;  3H0G A;  3L4J A;  1O2F B;  5FLM K;  3GTM K;  4C3J K;  4A3F K;  1SFO K;  1VJE A;  2B63 C;  4A3J K;  2YU9 A;  5IYC C;  1TWH K;  2JA5 C;  4G7O A;  2EBB A;  2A69 A;  1F7U A;  2PA8 D;  5C4X K;  1VLO A;  1IE0 A;  5C4J C;  4A3K K;  1DCO A;  1I3Q C;  4A3M C;  1R9T K;  2CFA A;  5IOS A;  1TWA A;  3QX3 A;  2R93 A;  2RGR A;  2VUM K;  2GSN A;  1C0A A;  3GTL C;  1YNN A;  1I50 A;  2A6H A;  4GTB A;  2PA8 L;  2GAG C;  4BY7 C;  4OIQ A;  3HOZ K;  1GE9 A;  4PAB A;  5D4D A;  2CW0 A;  2R92 A;  4MEX A;  5FLM C;  3GTM C;  4C3J C;  4A3F C;  4KC6 A;  2WB1 D; 
#chains in the Genus database with same CATH homology
 4QIW D;  4XLP A;  4GZY A;  5IYB C;  4A3E C;  4A3J C;  2NVQ K;  2R7Z C;  1TWH C;  4Y7N K;  4A3C K;  4QJV A;  3GTO C;  3S2H K;  1TWA K;  4LK0 A;  3S2D K;  5M5Y K;  4LK1 A;  3GTK K;  2E2J K;  3GTP C;  5C4X C;  3S14 C;  2A68 A;  1TWF K;  1HQM A;  4A3K C;  4OIR A;  5IP7 C;  3HOY C;  3I4M C;  4XSZ A;  1IW7 A;  1R9T C;  4Y52 K;  1I50 K;  2NVT K;  4XSX A;  2JA7 C;  4BBR C;  4YG2 A;  2E2H C;  1WCM C;  3HKZ D;  3GTJ K;  3RZD K;  4OIN A;  2WAQ L;  4G7Z A;  4MQ9 A;  2O5I A;  3HOW K;  2NVY K;  2WB1 L;  2VUM C;  4QIW L;  4C2M K;  5M5X K;  3GTG C;  4KN4 A;  5C44 K;  1TWC C;  2PPB A;  1Y1V K;  2O5J A;  3S1Q K;  1TWG C;  3S15 K;  3HOU C;  1I6H C;  3K7A K;  2WAQ D;  3HOX K;  3HOV C;  3H0G C;  2JA6 C;  2R92 K;  3S16 C;  3S1N C;  4A93 C;  4A3B K;  3WOD A;  3PO3 K;  3HOZ C;  3I4N K;  3M3Y C;  4A3I C;  3HKZ L;  4A3L C;  5FJ8 K;  2B63 K;  4BBS C;  2YU9 C;  5IYC K;  4MEY A;  2JA5 K;  2R93 K;  5TMC A;  5C3E C;  4A3C C;  3S1M K;  1Y1W K;  3PO2 K;  5C4J K;  5M3F K;  1I3Q K;  3FKI K;  4A3M K;  2NVQ C;  4OIO A;  3CQZ K;  4BY1 K;  4Y7N C;  4A3D K;  3S2H C;  5IP9 K;  1TWA C;  1SMY A;  3S2D C;  3GTK C;  2E2J C;  4A3G K;  1TWF C;  3S1R K;  2BE5 A;  1SFO C;  4Y52 C;  3GTL K;  1I50 C;  5IYD C;  2NVT C;  3H3V D;  4Q5S A;  4LJZ A;  4QJV B;  3GTJ C;  3HOW C;  3GTQ K;  4C3I K;  3RZO K;  2NVY C;  2E2I K;  1K83 K;  2NVX K;  5C44 C;  4Q4Z A;  4BY7 K;  3M4O K;  1Y1V C;  3S17 K;  3S1Q C;  4X6A K;  3S15 C;  4BXX K;  2JA8 K;  3K7A C;  5TMF A;  3HOX C;  4YFK A;  2R92 C;  4A3B C;  5FLM K;  3GTM K;  3GTG K;  4C3J K;  4A3F K;  1SFO K;  4LLG A;  3H3V L;  2Y0S D;  3PO3 C;  3I4N C;  5IYB K;  2B63 C;  4A3E K;  4A3J K;  4A93 K;  4OIP A;  2R7Z K;  5IYC C;  1TWH K;  2JA5 C;  4G7O A;  4G7H A;  3GTO K;  2R93 C;  2A69 A;  2PMZ D;  4AYB D;  2PA8 D;  5C4X K;  3S1M C;  3GTP K;  1Y1W C;  3S14 K;  3PO2 C;  5C4J C;  4A3K K;  3I4M K;  1YNJ A;  5IP7 K;  3HOY K;  3FKI C;  1I3Q C;  4A3M C;  1R9T K;  3RZD C;  2JA7 K;  3CQZ C;  4KMU A;  1ZYR A;  1WCM K;  4BBR K;  2E2H K;  4BY1 C;  4A3D C;  5IP9 C;  4YFN A;  4JK1 A;  4A3G C;  2Y0S L;  2VUM K;  3S1R C;  4XLN A;  1TWC K;  3GTL C;  1YNN A;  1BDF A;  1TWG K;  2A6H A;  4YFX A;  4NOI A;  3GTQ C;  3HOU K;  2PMZ L;  4AYB L;  3RZO C;  2PA8 L;  1I6H K;  3HOV K;  1XPP A;  4C3H K;  2E2I C;  1K83 C;  3H0G K;  2NVX C;  5M3M K;  2JA6 K;  3S16 K;  3S1N K;  3EQL A;  4OIQ A;  4ZH4 A;  3M4O C;  3HOZ K;  3S17 C;  4BY7 C;  3M3Y K;  4A3I K;  4A3L K;  2A6E A;  4X6A C;  4BXX C;  5D4D A;  1I6V A;  4BBS K;  2JA8 C;  2CW0 A;  4KN7 A;  5M5W K;  2YU9 K;  5IYD K;  4MEX A;  5FLM C;  3GTM C;  3DXJ A;  4A3F C;  5C3E K;  2WB1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...