2PMZL

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
total genus 20
structure length 92
sequence length 92
chains with identical sequence X
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pmzL00
5IYDK 2B63K 4LK1A 1TWAK 2JA8K 5TMCA 5M3MK 4Y7NC 4A3JC 2NVTK 4A3FK 4A3LC 3I4MK 3S15C 2E2IC 1TWHK 3HOYC 3S2HK 2R93C 4A3GC 4XSXA 4OIPA 4A3KK 4A3MC 5C3EC 2JA6K 4BXXC 3GTLK 3EQLA 5IP7K 3DXJA 4C2MK 1TWFC 4C3HK 1TWGK 3HOVK 3PO3C 5C4XC 4BY7K 3CQZK 5IYDC 4GZYA 4BY1K 2B63C 2JA8C 1TWAC 4XLPA 2A69A 3HOUK 2NVTC 3RZDK 4MEYA 5IP9K 4A3FC 3RZOK 3I4MC 3GTGK 3S16K 1SFOK 1TWHC 5TMFA 3S2HC 4A93K 4LJZA 4A3KC 3S14K 5IYBK 2JA6C 3GTLC 5IP7C 5C4JK 1BDFA 5IYCK 4A3IK 2JA5K 2NVXK 5D4DA 3HOVC 1TWGC 3S2DK 1YNNA 1Y1VK 4XSZA 4BY7C 2A6EA 3CQZC 4QIWD 4Q4ZA 1HQMA 4BY1C 2R92K 3I4NK 3HOUC 4AYBD 3RZDC 3GTQK 1I50K 4KN7A 5IP9C 4C3JK 3GTMK 3HOZK 3RZOC 3GTGC 3S16C 2PA8D 4A3EK 1SFOC 1TWCK 4A3CK 3S1MK 1XPPA 4OIQA 2E2JK 3GTKK 3S14C 2WB1D 5IYBC 2YU9K 3HKZD 1R9TK 3S1NK 1ZYRA 5C4JC 5IYCC 4A3IC 2JA5C 2NVXC 3S2DC 3FKIK 3GTOK 1Y1VC 5FJ8K 4KMUA 3S1RK 4QJVA 2R92C 3I4NC 2JA7K 4BBRK 3GTQC 1I50C 3HOXK 3GTMC 3HOZC 2PMZD 4A3EC 4A3CC 1TWCC 3S1MC 4NOIA 3GTJK 2E2JC 4G7ZA 3S1QK 1I3QK 2A68A 3GTKC 2Y0SD 4G7OA 1K83K 2YU9C 4Q5SA 4QIWL 1R9TC 3S1NC 1I6HK 3HOWK 4MQ9A 2WAQD 2R7ZK 3FKIC 3GTOC 4AYBL 1WCMK 5FLMK 3M3YK 4YFKA 1I6VA 3S1RC 2PA8L 3GTPK 2JA7C 3H3VD 4BBRC 5M5YK 4A93C 4A3DK 2E2HK 4A3BK 3HOXC 4OINA 4YG2A 3K7AK 2WB1L 4LK0A 4LLGA 4KN4A 4YFNA 3PO2K 3HKZL 4MEXA 2NVQK 2O5IA 4BBSK 3GTJC 5C44K 5M3FK 3S1QC 1I3QC 3M4OK 1K83C 2VUMK 2NVYK 1I6HC 3HOWC 3H0GK 4YFXA 4XLNA 2PPBA 1Y1WK 4OIRA 2R7ZC 4Y52K 1WCMC 2A6HA 5FLMC 3M3YC 4C3IK 4QJVB 2PMZL 3GTPC 4A3DC 4G7HA 4X6AK 2E2HC 4A3BC 3K7AC 3PO2C 3S17K 2Y0SL 5M5WK 4OIOA 3WODA 2NVQC 1IW7A 4BBSC 5C44C 2BE5A 2WAQL 4Y7NK 4A3JK 2CW0A 4A3LK 1SMYA 3M4OC 3S15K 2VUMC 2NVYC 2E2IK 3HOYK 2O5JA 3H0GC 2R93K 4A3GK 1Y1WC 4JK1A 3H3VL 4ZH4A 4Y52C 4A3MK 1YNJA 5C3EK 4BXXK 5M5XK 1TWFK 5C4XK 4X6AC 3PO3K 3S17C
chains in the Genus database with same CATH superfamily
2ZUFA 5TMCA 4A3JC 3N0BA 3GTPA 4A3LC 1IQ0A 3I4MK 1O2BA 1TWHK 3AH5A 3S2HK 4A3MC 4G0VA 5C4XC 4XCHA 1O28A 3A8KA 4KB2A 2JA8C 2A69A 2NVTC 5IP9K 4A3FC 3S16K 1SFOK 5TMFA 3LAPA 4GTFA 2JA6C 1EK8A 1WCMA 5IP7C 1XZPA 4C2MC 1AB4A 1TWGC 3HOVC 4BY7C 4QIWD 1YX2A 4Q4ZA 4GTAA 2P8TA 1XZQA 3GTMK 3HOZK 1TWCK 2GSNA 1XPPA 2VUMA 1WQGA 1XXCA 3GDZA 2WB1D 4BKWA 1Y1WA 2YU9K 3HKZD 1B4AA 2JA5C 3G4AA 3FKIK 1VLOA 1XXAA 4KMUA 4QJVA 4PAAA 3V4GA 2R92C 3I4NC 3GTQC 3HOXK 4C3JC 4KMHA 4P5BA 4A3EC 4NOIA 2E2JC 1I3QK 2PHCB 4G0UA 1YCLA 2P5MA 4Q5SA 4QIWL 1R9TC 3ERED 3T01A 2R7ZK 3GTOC 5IORA 1ISEA 3M3YK 2RH6A 4A93C 3H3VD 4BBRC 3SZZA 4OINA 4LLGA 2WB1L 1O2FB 3HKZL 2O5IA 2GSOA 5C44K 1BGWA 3LAJA 3S1QC 2NVYK 3HOWC 3H0GK 4XLNA 2JA6A 5FLMC 1GE9A 3OREA 4C3IK 1TWGA 4QJVB 3GTPC 3GSIA 1O25A 2ZFZA 5M5WK 1EFWA 4GTEA 2NVQC 4BBSC 2JH3A 2BE5A 3TTGA 1SMYA 3M4OC 3S15K 3H3VL 4Y52C 1J6XA 2JA5A 2V6UA 1TWFK 2R92A 4X6AC 4KASA 1O24A 3PO3K 1WOOA 5IYDK 1C0AA 3GTQA 4KM9A 1TWAK 3LPXA 1HI9A 1JVIA 1IS1A 2E2HA 2E2IC 3HOYC 2R93C 4A3GC 4XSXA 2D6FC 3GTOA 1USMA 4BXXC 3GTLK 1WSVA 3EQLA 4AH6A 4C3HK 2B63C 4XLPA 3RZDK 4LQYA 3NUHA 1WSRA 4KM8A 3OPFA 4A93K 4A3KC 5IYBK 3CAGA 4KMDA 2V6SA 1BDFA 3T02A 5C4JK 2NVXK 1XXBA 1F7VA 3GEHA 1Y1VK 4XSZA 3CQZC 4BY1C 3JSTA 3HOUC 4WILA 4KN7A 3RZOC 3GTGC 5JFEA 4OIQA 4GFQA 3S14C 4P5AA 4G0WA 1ZYRA 5IYCC 4A3IC 3S2DC 1EQRA 1KQ4A 3S1RK 1I50C 4A3CC 3S1MC 2E2IA 1PJ7A 3GTKC 1RU0A 2R93A 2Y0SD 4G7OA 3S1NC 1I6HK 4MQ9A 1WCMK 4YFKA 5JVOA 1EH1A 1I6VA 5IOQA 2JA7C 2FQOA 4A3DK 5M5YK 2B63A 3K7AK 3PO2K 4KN4A 4MEXA 1PJ6A 3GTJC 1K83C 2VUMK 3G4CA 4WJ4A 1VJEA 1Y1WK 4OIRA 1TWCA 2A6HA 3AD7C 1J6VA 1JQWA 3CQZA 1DCPA 1O26A 2E2HC 3MMLB 3SZYA 4A3BC 5HL8A 3FKIA 2Y0SL 1WORA 3WODA 1IW7A 3AQPA 3GTGA 4A3JK 3ADAC 3GEIA 2CW0A 4A3LK 2XCRB 2Y3PA 4JK1A 4ZH4A 2GAHC 5CJ9A 4A3MK 5M5XK 5C4XK 3FHZA 3S17C 2R7ZA 1I50A 4LK1A 4KATA 2JA8K 5M3MK 4Y7NC 2NVTK 2FQTA 5IOSA 4A3FK 3GTKA 1ZVUA 1WQHA 1ZXOA 1DCHA 4OIPA 4ILDA 5C3EC 2JA6K 5IP7K 3DXJA 4C2MK 3HOVK 1TWGK 2KWAA 2JA7A 4BY7K 3HXAA 1IL2A 3GTJA 1UV7A 3I4MC 1TWHC 3S2HC 1K83A 4KAWX 1ZQ1C 4FZBA 1JOEA 2JA5K 5D4DA 1YNNA 1HQMA 2R92K 3I4NK 3VA7A 3GTQK 5IP9C 4C3JK 3S16C 2PA8D 4A3EK 1SFOC 2E2JK 1L0WA 1R9TK 1WOPA 3GTOK 1F93A 1PJ5A 4BBRK 3BP3A 3GTMC 5CHPA 3HOZC 5EGHA 2PMZD 1TWCC 4GTDA 4WJ3M 4GTLA 4PABA 3S1QK 2YU9C 5L46A 3HOWK 2XCOA 2WAQD 3FKIC 5FLMK 4P9SA 2PA8L 3GTPK 1BS2A 4LOWA 1VRQC 3HOXC 4DDQA 4LK0A 2NVQK 4BBSK 5EGEA 5M3FK 1I3QC 1TWHA 3TFHA 3M4OK 3AD9C 4YFXA 2PPBA 2R7ZC 4Y52K 3M3YC 1DD5A 2PMZL 4J3NA 4X6AK 1SFOA 5C44C 2WAQL 3Q3QA 1DCOA 4M1XA 1WQFA 2NVYC 2E2IK 3HOYK 3H0GC 2R93K 2RGRA 4A3GK 2CFAB 3TFJA 1YNJA 4C3IC 4BXXK 3AD8C 4LR2A 2B63K 1BJTA 4C45A 4RMFA 3GTMA 3N0CA 4KDDA 3S15C 1O27A 2YU9A 4A3KK 5TJ3A 1EI6A 1VH2A 4O2DA 4GTCA 5E68A 4KMAA 1TWFC 2GSUA 3PO3C 2GAGC 3CQZK 5IYDC 4GZYA 3L4KA 4BY1K 1TWAC 3FOFA 3HOUK 4MEYA 3RZOK 1I3QA 1F7UA 3GTGK 4LJZA 4KC6A 2ZUEA 3S14K 3S0XA 1WIHA 3N3YA 3GIRA 3GTLC 5IOTA 1VGXA 2W7VA 5IYCK 4A3IK 3S2DK 4C3HC 2A6EA 1XZPB 3GEEA 4AYBD 3RZDC 1I50K 4A3CK 3S1MK 2NVYA 1USOA 3GTKK 3H0GA 1XZQB 5IYBC 2V6TA 3S1NK 1ZBSA 3TFIA 5C4JC 2NVXC 1J6WA 1Y1VC 5FJ8K 1J98A 4KARA 2JA7K 1G51A 1O2AA 4BLBA 3GTJK 4G7ZA 2A68A 1F9NA 1K83K 1IBAA 3L4JA 3BUEA 4AYBL 3T00A 1TWFA 3A8IA 3S1RC 3FOEA 3AQOA 2E2HK 1TWAA 4A3BK 4YG2A 3A8JA 1V5VA 4YFNA 3QX3A 1I6HC 4KB4A 4BLAA 3GTLA 1WCMC 3BP8C 4A3DC 1R9TA 4G7HA 1X31C 2XCQA 3K7AC 3OEPA 3PO2C 3S17K 4OIOA 4GTBA 2CFAA 4Y7NK 3IPJA 4FM9A 4GT9A 2VUMC 2O5JA 1O29A 2EBBA 1Y1WC 2NVXA 1WOSA 5C3EK 1Y1VA 1INNA 1B4BA 1IE0A
chains in the Genus database with same CATH topology
5IYDK 2B63K 4LK1A 1TWAK 2JA8K 5TMCA 5M3MK 4Y7NC 4A3JC 2NVTK 4A3FK 4A3LC 3I4MK 3S15C 2E2IC 1TWHK 3HOYC 3S2HK 2R93C 4A3GC 4XSXA 4OIPA 4A3KK 4A3MC 5C3EC 2JA6K 4BXXC 3GTLK 3EQLA 5IP7K 3DXJA 4C2MK 1TWFC 4C3HK 1TWGK 3HOVK 3PO3C 5C4XC 4BY7K 3CQZK 5IYDC 4GZYA 4BY1K 2B63C 2JA8C 1TWAC 4XLPA 2A69A 3HOUK 2NVTC 3RZDK 4MEYA 5IP9K 4A3FC 3RZOK 3I4MC 3GTGK 3S16K 1SFOK 1TWHC 5TMFA 3S2HC 4A93K 4LJZA 4A3KC 3S14K 5IYBK 2JA6C 3GTLC 5IP7C 5C4JK 1BDFA 5IYCK 4A3IK 2JA5K 2NVXK 5D4DA 3HOVC 1TWGC 3S2DK 1YNNA 1Y1VK 4XSZA 4BY7C 2A6EA 3CQZC 4QIWD 4Q4ZA 1HQMA 4BY1C 2R92K 3I4NK 3HOUC 4AYBD 3RZDC 3GTQK 1I50K 4KN7A 5IP9C 4C3JK 3GTMK 3HOZK 3RZOC 3GTGC 3S16C 2PA8D 4A3EK 1SFOC 1TWCK 4A3CK 3S1MK 1XPPA 4OIQA 2E2JK 3GTKK 3S14C 2WB1D 5IYBC 2YU9K 3HKZD 1R9TK 3S1NK 1ZYRA 5C4JC 5IYCC 4A3IC 2JA5C 2NVXC 3S2DC 3FKIK 3GTOK 1Y1VC 5FJ8K 4KMUA 3S1RK 4QJVA 2R92C 3I4NC 2JA7K 4BBRK 3GTQC 1I50C 3HOXK 3GTMC 3HOZC 2PMZD 4A3EC 4A3CC 1TWCC 3S1MC 4NOIA 3GTJK 2E2JC 4G7ZA 3S1QK 1I3QK 2A68A 3GTKC 2Y0SD 4G7OA 1K83K 2YU9C 4Q5SA 4QIWL 1R9TC 3S1NC 1I6HK 3HOWK 4MQ9A 2WAQD 2R7ZK 3FKIC 3GTOC 4AYBL 1WCMK 5FLMK 3M3YK 4YFKA 1I6VA 3S1RC 2PA8L 3GTPK 2JA7C 3H3VD 4BBRC 5M5YK 4A93C 4A3DK 2E2HK 4A3BK 3HOXC 4OINA 4YG2A 3K7AK 2WB1L 4LK0A 4LLGA 4KN4A 4YFNA 3PO2K 3HKZL 4MEXA 2NVQK 2O5IA 4BBSK 3GTJC 5C44K 5M3FK 3S1QC 1I3QC 3M4OK 1K83C 2VUMK 2NVYK 1I6HC 3HOWC 3H0GK 4YFXA 4XLNA 2PPBA 1Y1WK 4OIRA 2R7ZC 4Y52K 1WCMC 2A6HA 5FLMC 3M3YC 4C3IK 4QJVB 2PMZL 3GTPC 4A3DC 4G7HA 4X6AK 2E2HC 4A3BC 3K7AC 3PO2C 3S17K 2Y0SL 5M5WK 4OIOA 3WODA 2NVQC 1IW7A 4BBSC 5C44C 2BE5A 2WAQL 4Y7NK 4A3JK 2CW0A 4A3LK 1SMYA 3M4OC 3S15K 2VUMC 2NVYC 2E2IK 3HOYK 2O5JA 3H0GC 2R93K 4A3GK 1Y1WC 4JK1A 3H3VL 4ZH4A 4Y52C 4A3MK 1YNJA 5C3EK 4BXXK 5M5XK 1TWFK 5C4XK 4X6AC 3PO3K 3S17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD K;  2B63 K;  4LK1 A;  1TWA K;  2JA8 K;  5TMC A;  5M3M K;  4Y7N C;  4A3J C;  2NVT K;  4A3F K;  4A3L C;  3I4M K;  3S15 C;  2E2I C;  1TWH K;  3HOY C;  3S2H K;  2R93 C;  4A3G C;  4XSX A;  4OIP A;  4A3K K;  4A3M C;  5C3E C;  2JA6 K;  4BXX C;  3GTL K;  3EQL A;  5IP7 K;  3DXJ A;  4C2M K;  1TWF C;  4C3H K;  1TWG K;  3HOV K;  3PO3 C;  5C4X C;  4BY7 K;  3CQZ K;  5IYD C;  4GZY A;  4BY1 K;  2B63 C;  2JA8 C;  1TWA C;  4XLP A;  2A69 A;  3HOU K;  2NVT C;  3RZD K;  4MEY A;  5IP9 K;  4A3F C;  3RZO K;  3I4M C;  3GTG K;  3S16 K;  1SFO K;  1TWH C;  5TMF A;  3S2H C;  4A93 K;  4LJZ A;  4A3K C;  3S14 K;  5IYB K;  2JA6 C;  3GTL C;  5IP7 C;  5C4J K;  1BDF A;  5IYC K;  4A3I K;  2JA5 K;  2NVX K;  5D4D A;  3HOV C;  1TWG C;  3S2D K;  1YNN A;  1Y1V K;  4XSZ A;  4BY7 C;  2A6E A;  3CQZ C;  4QIW D;  4Q4Z A;  1HQM A;  4BY1 C;  2R92 K;  3I4N K;  3HOU C;  4AYB D;  3RZD C;  3GTQ K;  1I50 K;  4KN7 A;  5IP9 C;  4C3J K;  3GTM K;  3HOZ K;  3RZO C;  3GTG C;  3S16 C;  2PA8 D;  4A3E K;  1SFO C;  1TWC K;  4A3C K;  3S1M K;  1XPP A;  4OIQ A;  2E2J K;  3GTK K;  3S14 C;  2WB1 D;  5IYB C;  2YU9 K;  3HKZ D;  1R9T K;  3S1N K;  1ZYR A;  5C4J C;  5IYC C;  4A3I C;  2JA5 C;  2NVX C;  3S2D C;  3FKI K;  3GTO K;  1Y1V C;  5FJ8 K;  4KMU A;  3S1R K;  4QJV A;  2R92 C;  3I4N C;  2JA7 K;  4BBR K;  3GTQ C;  1I50 C;  3HOX K;  3GTM C;  3HOZ C;  2PMZ D;  4A3E C;  4A3C C;  1TWC C;  3S1M C;  4NOI A;  3GTJ K;  2E2J C;  4G7Z A;  3S1Q K;  1I3Q K;  2A68 A;  3GTK C;  2Y0S D;  4G7O A;  1K83 K;  2YU9 C;  4Q5S A;  4QIW L;  1R9T C;  3S1N C;  1I6H K;  3HOW K;  4MQ9 A;  2WAQ D;  2R7Z K;  3FKI C;  3GTO C;  4AYB L;  1WCM K;  5FLM K;  3M3Y K;  4YFK A;  1I6V A;  3S1R C;  2PA8 L;  3GTP K;  2JA7 C;  3H3V D;  4BBR C;  5M5Y K;  4A93 C;  4A3D K;  2E2H K;  4A3B K;  3HOX C;  4OIN A;  4YG2 A;  3K7A K;  2WB1 L;  4LK0 A;  4LLG A;  4KN4 A;  4YFN A;  3PO2 K;  3HKZ L;  4MEX A;  2NVQ K;  2O5I A;  4BBS K;  3GTJ C;  5C44 K;  5M3F K;  3S1Q C;  1I3Q C;  3M4O K;  1K83 C;  2VUM K;  2NVY K;  1I6H C;  3HOW C;  3H0G K;  4YFX A;  4XLN A;  2PPB A;  1Y1W K;  4OIR A;  2R7Z C;  4Y52 K;  1WCM C;  2A6H A;  5FLM C;  3M3Y C;  4C3I K;  4QJV B;  2PMZ L;  3GTP C;  4A3D C;  4G7H A;  4X6A K;  2E2H C;  4A3B C;  3K7A C;  3PO2 C;  3S17 K;  2Y0S L;  5M5W K;  4OIO A;  3WOD A;  2NVQ C;  1IW7 A;  4BBS C;  5C44 C;  2BE5 A;  2WAQ L;  4Y7N K;  4A3J K;  2CW0 A;  4A3L K;  1SMY A;  3M4O C;  3S15 K;  2VUM C;  2NVY C;  2E2I K;  3HOY K;  2O5J A;  3H0G C;  2R93 K;  4A3G K;  1Y1W C;  4JK1 A;  3H3V L;  4ZH4 A;  4Y52 C;  4A3M K;  1YNJ A;  5C3E K;  4BXX K;  5M5X K;  1TWF K;  5C4X K;  4X6A C;  3PO3 K;  3S17 C; 
#chains in the Genus database with same CATH topology
 2ZUF A;  5TMC A;  4A3J C;  3N0B A;  3GTP A;  4A3L C;  1IQ0 A;  3I4M K;  1O2B A;  1TWH K;  3AH5 A;  3S2H K;  4A3M C;  4G0V A;  5C4X C;  4XCH A;  1O28 A;  3A8K A;  4KB2 A;  2JA8 C;  2A69 A;  2NVT C;  5IP9 K;  4A3F C;  3S16 K;  1SFO K;  5TMF A;  3LAP A;  4GTF A;  2JA6 C;  1EK8 A;  1WCM A;  5IP7 C;  1XZP A;  4C2M C;  1AB4 A;  1TWG C;  3HOV C;  4BY7 C;  4QIW D;  1YX2 A;  4Q4Z A;  4GTA A;  2P8T A;  1XZQ A;  3GTM K;  3HOZ K;  1TWC K;  2GSN A;  1XPP A;  2VUM A;  1WQG A;  1XXC A;  3GDZ A;  2WB1 D;  4BKW A;  1Y1W A;  2YU9 K;  3HKZ D;  1B4A A;  2JA5 C;  3G4A A;  3FKI K;  1VLO A;  1XXA A;  4KMU A;  4QJV A;  4PAA A;  3V4G A;  2R92 C;  3I4N C;  3GTQ C;  3HOX K;  4C3J C;  4KMH A;  4P5B A;  4A3E C;  4NOI A;  2E2J C;  1I3Q K;  2PHC B;  4G0U A;  1YCL A;  2P5M A;  4Q5S A;  4QIW L;  1R9T C;  3ERE D;  3T01 A;  2R7Z K;  3GTO C;  5IOR A;  1ISE A;  3M3Y K;  2RH6 A;  4A93 C;  3H3V D;  4BBR C;  3SZZ A;  4OIN A;  4LLG A;  2WB1 L;  1O2F B;  3HKZ L;  2O5I A;  2GSO A;  5C44 K;  1BGW A;  3LAJ A;  3S1Q C;  2NVY K;  3HOW C;  3H0G K;  4XLN A;  2JA6 A;  5FLM C;  1GE9 A;  3ORE A;  4C3I K;  1TWG A;  4QJV B;  3GTP C;  3GSI A;  1O25 A;  2ZFZ A;  5M5W K;  1EFW A;  4GTE A;  2NVQ C;  4BBS C;  2JH3 A;  2BE5 A;  3TTG A;  1SMY A;  3M4O C;  3S15 K;  3H3V L;  4Y52 C;  1J6X A;  2JA5 A;  2V6U A;  1TWF K;  2R92 A;  4X6A C;  4KAS A;  1O24 A;  3PO3 K;  1WOO A;  5IYD K;  1C0A A;  3GTQ A;  4KM9 A;  1TWA K;  3LPX A;  1HI9 A;  1JVI A;  1IS1 A;  2E2H A;  2E2I C;  3HOY C;  2R93 C;  4A3G C;  4XSX A;  2D6F C;  3GTO A;  1USM A;  4BXX C;  3GTL K;  1WSV A;  3EQL A;  4AH6 A;  4C3H K;  2B63 C;  4XLP A;  3RZD K;  4LQY A;  3NUH A;  1WSR A;  4KM8 A;  3OPF A;  4A93 K;  4A3K C;  5IYB K;  3CAG A;  4KMD A;  2V6S A;  1BDF A;  3T02 A;  5C4J K;  2NVX K;  1XXB A;  1F7V A;  3GEH A;  1Y1V K;  4XSZ A;  3CQZ C;  4BY1 C;  3JST A;  3HOU C;  4WIL A;  4KN7 A;  3RZO C;  3GTG C;  5JFE A;  4OIQ A;  4GFQ A;  3S14 C;  4P5A A;  4G0W A;  1ZYR A;  5IYC C;  4A3I C;  3S2D C;  1EQR A;  1KQ4 A;  3S1R K;  1I50 C;  4A3C C;  3S1M C;  2E2I A;  1PJ7 A;  3GTK C;  1RU0 A;  2R93 A;  2Y0S D;  4G7O A;  3S1N C;  1I6H K;  4MQ9 A;  1WCM K;  4YFK A;  5JVO A;  1EH1 A;  1I6V A;  5IOQ A;  2JA7 C;  2FQO A;  4A3D K;  5M5Y K;  2B63 A;  3K7A K;  3PO2 K;  4KN4 A;  4MEX A;  1PJ6 A;  3GTJ C;  1K83 C;  2VUM K;  3G4C A;  4WJ4 A;  1VJE A;  1Y1W K;  4OIR A;  1TWC A;  2A6H A;  3AD7 C;  1J6V A;  1JQW A;  3CQZ A;  1DCP A;  1O26 A;  2E2H C;  3MML B;  3SZY A;  4A3B C;  5HL8 A;  3FKI A;  2Y0S L;  1WOR A;  3WOD A;  1IW7 A;  3AQP A;  3GTG A;  4A3J K;  3ADA C;  3GEI A;  2CW0 A;  4A3L K;  2XCR B;  2Y3P A;  4JK1 A;  4ZH4 A;  2GAH C;  5CJ9 A;  4A3M K;  5M5X K;  5C4X K;  3FHZ A;  3S17 C;  2R7Z A;  1I50 A;  4LK1 A;  4KAT A;  2JA8 K;  5M3M K;  4Y7N C;  2NVT K;  2FQT A;  5IOS A;  4A3F K;  3GTK A;  1ZVU A;  1WQH A;  1ZXO A;  1DCH A;  4OIP A;  4ILD A;  5C3E C;  2JA6 K;  5IP7 K;  3DXJ A;  4C2M K;  3HOV K;  1TWG K;  2KWA A;  2JA7 A;  4BY7 K;  3HXA A;  1IL2 A;  3GTJ A;  1UV7 A;  3I4M C;  1TWH C;  3S2H C;  1K83 A;  4KAW X;  1ZQ1 C;  4FZB A;  1JOE A;  2JA5 K;  5D4D A;  1YNN A;  1HQM A;  2R92 K;  3I4N K;  3VA7 A;  3GTQ K;  5IP9 C;  4C3J K;  3S16 C;  2PA8 D;  4A3E K;  1SFO C;  2E2J K;  1L0W A;  1R9T K;  1WOP A;  3GTO K;  1F93 A;  1PJ5 A;  4BBR K;  3BP3 A;  3GTM C;  5CHP A;  3HOZ C;  5EGH A;  2PMZ D;  1TWC C;  4GTD A;  4WJ3 M;  4GTL A;  4PAB A;  3S1Q K;  2YU9 C;  5L46 A;  3HOW K;  2XCO A;  2WAQ D;  3FKI C;  5FLM K;  4P9S A;  2PA8 L;  3GTP K;  1BS2 A;  4LOW A;  1VRQ C;  3HOX C;  4DDQ A;  4LK0 A;  2NVQ K;  4BBS K;  5EGE A;  5M3F K;  1I3Q C;  1TWH A;  3TFH A;  3M4O K;  3AD9 C;  4YFX A;  2PPB A;  2R7Z C;  4Y52 K;  3M3Y C;  1DD5 A;  2PMZ L;  4J3N A;  4X6A K;  1SFO A;  5C44 C;  2WAQ L;  3Q3Q A;  1DCO A;  4M1X A;  1WQF A;  2NVY C;  2E2I K;  3HOY K;  3H0G C;  2R93 K;  2RGR A;  4A3G K;  2CFA B;  3TFJ A;  1YNJ A;  4C3I C;  4BXX K;  3AD8 C;  4LR2 A;  2B63 K;  1BJT A;  4C45 A;  4RMF A;  3GTM A;  3N0C A;  4KDD A;  3S15 C;  1O27 A;  2YU9 A;  4A3K K;  5TJ3 A;  1EI6 A;  1VH2 A;  4O2D A;  4GTC A;  5E68 A;  4KMA A;  1TWF C;  2GSU A;  3PO3 C;  2GAG C;  3CQZ K;  5IYD C;  4GZY A;  3L4K A;  4BY1 K;  1TWA C;  3FOF A;  3HOU K;  4MEY A;  3RZO K;  1I3Q A;  1F7U A;  3GTG K;  4LJZ A;  4KC6 A;  2ZUE A;  3S14 K;  3S0X A;  1WIH A;  3N3Y A;  3GIR A;  3GTL C;  5IOT A;  1VGX A;  2W7V A;  5IYC K;  4A3I K;  3S2D K;  4C3H C;  2A6E A;  1XZP B;  3GEE A;  4AYB D;  3RZD C;  1I50 K;  4A3C K;  3S1M K;  2NVY A;  1USO A;  3GTK K;  3H0G A;  1XZQ B;  5IYB C;  2V6T A;  3S1N K;  1ZBS A;  3TFI A;  5C4J C;  2NVX C;  1J6W A;  1Y1V C;  5FJ8 K;  1J98 A;  4KAR A;  2JA7 K;  1G51 A;  1O2A A;  4BLB A;  3GTJ K;  4G7Z A;  2A68 A;  1F9N A;  1K83 K;  1IBA A;  3L4J A;  3BUE A;  4AYB L;  3T00 A;  1TWF A;  3A8I A;  3S1R C;  3FOE A;  3AQO A;  2E2H K;  1TWA A;  4A3B K;  4YG2 A;  3A8J A;  1V5V A;  4YFN A;  3QX3 A;  1I6H C;  4KB4 A;  4BLA A;  3GTL A;  1WCM C;  3BP8 C;  4A3D C;  1R9T A;  4G7H A;  1X31 C;  2XCQ A;  3K7A C;  3OEP A;  3PO2 C;  3S17 K;  4OIO A;  4GTB A;  2CFA A;  4Y7N K;  3IPJ A;  4FM9 A;  4GT9 A;  2VUM C;  2O5J A;  1O29 A;  2EBB A;  1Y1W C;  2NVX A;  1WOS A;  5C3E K;  1Y1V A;  1INN A;  1B4B A;  1IE0 A; 
#chains in the Genus database with same CATH homology
 5IYD K;  2B63 K;  4LK1 A;  1TWA K;  2JA8 K;  5TMC A;  5M3M K;  4Y7N C;  4A3J C;  2NVT K;  4A3F K;  4A3L C;  3I4M K;  3S15 C;  2E2I C;  1TWH K;  3HOY C;  3S2H K;  2R93 C;  4A3G C;  4XSX A;  4OIP A;  4A3K K;  4A3M C;  5C3E C;  2JA6 K;  4BXX C;  3GTL K;  3EQL A;  5IP7 K;  3DXJ A;  4C2M K;  1TWF C;  4C3H K;  1TWG K;  3HOV K;  3PO3 C;  5C4X C;  4BY7 K;  3CQZ K;  5IYD C;  4GZY A;  4BY1 K;  2B63 C;  2JA8 C;  1TWA C;  4XLP A;  2A69 A;  3HOU K;  2NVT C;  3RZD K;  4MEY A;  5IP9 K;  4A3F C;  3RZO K;  3I4M C;  3GTG K;  3S16 K;  1SFO K;  1TWH C;  5TMF A;  3S2H C;  4A93 K;  4LJZ A;  4A3K C;  3S14 K;  5IYB K;  2JA6 C;  3GTL C;  5IP7 C;  5C4J K;  1BDF A;  5IYC K;  4A3I K;  2JA5 K;  2NVX K;  5D4D A;  3HOV C;  1TWG C;  3S2D K;  1YNN A;  1Y1V K;  4XSZ A;  4BY7 C;  2A6E A;  3CQZ C;  4QIW D;  4Q4Z A;  1HQM A;  4BY1 C;  2R92 K;  3I4N K;  3HOU C;  4AYB D;  3RZD C;  3GTQ K;  1I50 K;  4KN7 A;  5IP9 C;  4C3J K;  3GTM K;  3HOZ K;  3RZO C;  3GTG C;  3S16 C;  2PA8 D;  4A3E K;  1SFO C;  1TWC K;  4A3C K;  3S1M K;  1XPP A;  4OIQ A;  2E2J K;  3GTK K;  3S14 C;  2WB1 D;  5IYB C;  2YU9 K;  3HKZ D;  1R9T K;  3S1N K;  1ZYR A;  5C4J C;  5IYC C;  4A3I C;  2JA5 C;  2NVX C;  3S2D C;  3FKI K;  3GTO K;  1Y1V C;  5FJ8 K;  4KMU A;  3S1R K;  4QJV A;  2R92 C;  3I4N C;  2JA7 K;  4BBR K;  3GTQ C;  1I50 C;  3HOX K;  3GTM C;  3HOZ C;  2PMZ D;  4A3E C;  4A3C C;  1TWC C;  3S1M C;  4NOI A;  3GTJ K;  2E2J C;  4G7Z A;  3S1Q K;  1I3Q K;  2A68 A;  3GTK C;  2Y0S D;  4G7O A;  1K83 K;  2YU9 C;  4Q5S A;  4QIW L;  1R9T C;  3S1N C;  1I6H K;  3HOW K;  4MQ9 A;  2WAQ D;  2R7Z K;  3FKI C;  3GTO C;  4AYB L;  1WCM K;  5FLM K;  3M3Y K;  4YFK A;  1I6V A;  3S1R C;  2PA8 L;  3GTP K;  2JA7 C;  3H3V D;  4BBR C;  5M5Y K;  4A93 C;  4A3D K;  2E2H K;  4A3B K;  3HOX C;  4OIN A;  4YG2 A;  3K7A K;  2WB1 L;  4LK0 A;  4LLG A;  4KN4 A;  4YFN A;  3PO2 K;  3HKZ L;  4MEX A;  2NVQ K;  2O5I A;  4BBS K;  3GTJ C;  5C44 K;  5M3F K;  3S1Q C;  1I3Q C;  3M4O K;  1K83 C;  2VUM K;  2NVY K;  1I6H C;  3HOW C;  3H0G K;  4YFX A;  4XLN A;  2PPB A;  1Y1W K;  4OIR A;  2R7Z C;  4Y52 K;  1WCM C;  2A6H A;  5FLM C;  3M3Y C;  4C3I K;  4QJV B;  2PMZ L;  3GTP C;  4A3D C;  4G7H A;  4X6A K;  2E2H C;  4A3B C;  3K7A C;  3PO2 C;  3S17 K;  2Y0S L;  5M5W K;  4OIO A;  3WOD A;  2NVQ C;  1IW7 A;  4BBS C;  5C44 C;  2BE5 A;  2WAQ L;  4Y7N K;  4A3J K;  2CW0 A;  4A3L K;  1SMY A;  3M4O C;  3S15 K;  2VUM C;  2NVY C;  2E2I K;  3HOY K;  2O5J A;  3H0G C;  2R93 K;  4A3G K;  1Y1W C;  4JK1 A;  3H3V L;  4ZH4 A;  4Y52 C;  4A3M K;  1YNJ A;  5C3E K;  4BXX K;  5M5X K;  1TWF K;  5C4X K;  4X6A C;  3PO3 K;  3S17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...