2PMZL

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
total genus 20
structure length 92
sequence length 92
chains with identical sequence X
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pmzL00
5TMCA 4A93C 3PO3K 1I50K 3GTJC 2WB1D 3S14C 2NVXK 1ZYRA 1TWAK 5M5YK 3S2HK 3S1MK 4C2MK 4MEXA 1WCMK 3HOYK 5TMFA 4A3BK 4BY7K 4QJVB 4BBRK 3S16K 1SFOK 2A68A 3EQLA 5M5WK 3S1MC 4Q4ZA 3K7AK 2WAQD 5C3EK 3HOXC 2R92C 4OIRA 3PO3C 5D4DA 2A6EA 4C3IK 4X6AC 3PO2K 1YNJA 2NVTK 5C44C 3S1NC 3S15K 3S2HC 4A3JK 4BY1K 1I6HC 5C4XC 3GTMC 1TWGC 2NVYK 2CW0A 3RZDK 3M4OK 3M3YC 3CQZC 2E2HK 3HOXK 2R92K 2JA5K 5M5XK 3FKIK 4Y7NC 4A3EK 2E2IK 2PA8D 3GTOK 1R9TC 4G7HA 1TWCK 5FJ8K 4AYBL 1TWHC 1TWFK 4ZH4A 5C3EC 2JA8C 3S17K 2A6HA 3I4NC 2JA8K 1I3QC 5IYDC 1SFOC 3HKZD 3I4MC 5IYBK 2E2JC 4MQ9A 4A3GC 1WCMC 2Y0SL 3H0GK 1YNNA 4A3EC 2NVXC 3S1QK 3HOVC 1I50C 2BE5A 2JA7K 4QIWD 3S1RC 2A69A 3S1RK 3GTMK 1K83C 4A3DC 4XSXA 3H3VD 4A3IK 3HOZK 1I6VA 4A3LK 5C44K 2Y0SD 3GTQK 5IP9K 2E2JK 4YFNA 3HOWK 2PPBA 3HOUC 2R7ZK 4Y52C 4KN7A 4BXXC 3GTGK 5C4JK 5FLMK 5IP7K 2VUMK 3S2DK 1TWHK 5M3FK 4A3BC 4C3JK 3RZOC 3GTOC 4MEYA 4GZYA 3H3VL 1TWAC 4OIPA 4G7ZA 2PMZD 2JA6K 4G7OA 4YFKA 3HOUK 3M3YK 4A3MC 3HOWC 1TWGK 2B63C 2NVTC 3GTLK 3GTQC 3HOVK 2PA8L 4A3IC 4OIQA 3GTPK 3HOZC 4BBSC 5IYCC 3S15C 4XLPA 3GTPC 4BBSK 4LLGA 1K83K 2NVQK 4AYBD 2B63K 4QIWL 4X6AK 4A3CC 2YU9K 3K7AC 2R93C 2YU9C 2O5JA 4Y52K 3H0GC 4BBRC 1TWCC 4LK1A 3I4MK 4YFXA 5IP7C 4Y7NK 2E2IC 5IYCK 2VUMC 3S17C 3GTGC 4KN4A 4A3DK 4QJVA 3GTJK 2R7ZC 3S14K 4C3HK 2O5IA 1BDFA 2JA7C 2NVQC 4A93K 4A3LC 5C4XK 2JA6C 4Q5SA 3FKIC 4LJZA 4A3JC 4BY1C 4OIOA 3RZOK 3M4OC 3GTLC 2NVYC 3RZDC 4NOIA 5IYBC 1SMYA 4A3FC 4A3MK 3S2DC 4OINA 1I6HK 2WAQL 5M3MK 1IW7A 5FLMC 1XPPA 4LK0A 3GTKK 4BXXK 3S1NK 3S16C 4KMUA 3PO2C 1HQMA 1Y1VC 1Y1WK 4A3GK 5IP9C 1Y1VK 1Y1WC 1R9TK 3DXJA 1I3QK 2PMZL 4YG2A 5IYDK 3GTKC 3I4NK 5C4JC 4A3CK 2R93K 1TWFC 2WB1L 4XSZA 2E2HC 4A3FK 4BY7C 3HKZL 3HOYC 3S1QC 4A3KC 4XLNA 4A3KK 2JA5C 4JK1A 3CQZK 3WODA
chains in the Genus database with same CATH superfamily
1O24A 1IQ0A 3PO3K 4GTBA 1VLOA 5M5YK 3S1MK 5CHPA 1WQFA 1WCMK 3S16K 3GEIA 1R9TA 3EQLA 4Q4ZA 4GFQA 3HOXC 2JA7A 3N0BA 2V6TA 3GTLA 1ISEA 1I6HC 5C4XC 3GTMC 4LOWA 2NVYK 2XCQA 3M4OK 3CQZC 5M5XK 4Y7NC 1R9TC 2ZFZA 2XCRB 1TWCK 2E2HA 5C3EC 2JA8C 1XZQA 3I4NC 1EI6A 2JA8K 1I3QC 3HKZD 3I4MC 5IYBK 4A3GC 1WCMC 3GTMA 4G0WA 1TWCA 1XZPB 3N3YA 2BE5A 4P5AA 4QIWD 1F7VA 4KMHA 3H3VD 3A8JA 4A3IK 3HOZK 3LAJA 1EQRA 1RU0A 2E2JK 1I3QA 3HOUC 2R7ZK 3Q3QA 1DCHA 5FLMK 5C4JK 1O2AA 4LR2A 3RZOC 1IS1A 4MEYA 5E68A 4GZYA 1TWGA 2JA6K 4AH6A 3HOWC 2B63C 3GTLK 1PJ7A 1B4BA 3GTPC 4BBSK 4LLGA 1K83K 3A8KA 2JA5A 4A3CC 2YU9K 4C45A 2YU9C 3TFJA 2O5JA 3G4AA 4Y52K 1BGWA 1WORA 2NVXA 5IP7C 1Y1VA 5IYCK 2B63A 3GTGC 4KN4A 4QJVA 4G0UA 4C3HK 3GTPA 1BDFA 2NVQC 4A3LC 5C4XK 2JA6C 3FKIC 4LJZA 3GEEA 3RZOK 1XXAA 4GTDA 3RZDC 2YU9A 1IW7A 5FLMC 4LK0A 3GTKK 1G51A 4BXXK 3GTJA 4KMUA 4C3JC 1Y1VC 1Y1WC 4C3IC 3AH5A 3GTGA 1R9TK 5IYDK 1INNA 5IOTA 2JA6A 3HOYC 4BKWA 3T00A 4XLNA 2P5MA 1O28A 1I50K 3AQOA 3GTJC 3JSTA 3S14C 1TWAK 1IE0A 4MEXA 5TMFA 1YX2A 4A3BK 4QJVB 3ADAC 5TJ3A 1SFOK 2A68A 3IPJA 1YCLA 4LQYA 4C3IK 3LAPA 4X6AC 3S15K 3S2HC 4A3JK 5IORA 1F7UA 1ZXOA 3RZDK 1TWAA 3GDZA 1I50A 2R92K 1J6XA 2E2IK 1O29A 4KMAA 1DCOA 5FJ8K 4ZH4A 4GTEA 3FHZA 1WOPA 2Y0SL 3N0CA 4A3EC 1AB4A 1I50C 1C0AA 2A69A 3TFHA 4A3DC 3GEHA 4XSXA 4A3LK 1VRQC 3HOWK 1EK8A 4KN7A 1TWHK 4ILDA 4C3JK 3H0GA 2V6SA 1ZBSA 3H3VL 4G7OA 4XCHA 4A3MC 3HOVK 4A3IC 3HOZC 3GTPK 4BBSC 1TWHA 1XZPA 4GTAA 3BUEA 2NVQK 4WJ4A 4C3HC 1DCPA 2R93C 1J6WA 2XCOA 2GAHC 3H0GC 3V4GA 1WIHA 4A3DK 1V5VA 1K83A 2R7ZC 4A93K 2JA7C 2GSNA 3VA7A 4A3JC 5EGHA 3M4OC 3GTLC 3OEPA 4NOIA 3L4JA 4OINA 3CQZA 3S1NK 4FZBA 1F9NA 1Y1WK 4A3GK 5IP9C 1ZQ1C 3DXJA 1I3QK 2PMZL 4YG2A 4A3CK 2E2HC 3HKZL 3OREA 1WQHA 3HXAA 4A3KK 2ZUFA 3CQZK 3WODA 3T02A 4KASA 4KB2A 2NVXK 1ZYRA 2RH6A 4C2MK 4P5BA 4BY7K 3NUHA 5IOQA 3K7AK 4J3NA 3FOEA 5C3EK 2R92C 4KB4A 1PJ5A 2A6EA 4GT9A 2NVTK 3S1NC 3BP8C 1O2BA 3T01A 2NVYA 4BY1K 1TWGC 3MMLB 1F93A 1JOEA 3L4KA 4KATA 2PA8D 2CFAA 3BP3A 4KC6A 4G7HA 4AYBL 5JVOA 2E2JC 4MQ9A 1XZQB 3H0GK 2NVXC 1J6VA 3GTMK 2P8TA 2Y3PA 1I6VA 3GTQA 2Y0SD 2JH3A 1KQ4A 4Y52C 4BXXC 2VUMK 3S2DK 1X31C 3AQPA 5L46A 1XXBA 4G7ZA 2PMZD 1TWGK 3AD8C 3GTQC 2PA8L 4PAAA 5IYCC 4AYBD 1WSVA 4QIWL 3TTGA 3K7AC 1BS2A 1JVIA 4KAWX 1WCMA 2GSOA 1TWCC 1VGXA 4BLAA 4Y7NK 3S17C 2FQTA 4Q5SA 4BY1C 1XXCA 4WILA 1O25A 1USOA 5IYBC 4A3MK 1L0WA 1O26A 3S2DC 2WAQL 5M3MK 1XPPA 3ERED 1GE9A 3S16C 3PO2C 1HQMA 3LPXA 4DDQA 1JQWA 2R93K 1TWFC 2WB1L 4A3FK 3G4CA 1B4AA 4A3KC 2JA5C 2NVTC 5TMCA 4A93C 4KM9A 2WB1D 3S2HK 4KM8A 4O2DA 3HOYK 4WJ3M 3QX3A 4BBRK 1TWFA 2KWAA 5M5WK 3S1MC 2WAQD 4OIRA 3PO3C 5D4DA 1WOSA 3FKIA 3PO2K 1YNJA 1IL2A 5C44C 1SFOA 5JFEA 2FQOA 4GTCA 1WQGA 2CW0A 1ZVUA 3M3YC 2E2HK 3HOXK 2JA5K 2RGRA 4A3EK 3FKIK 1Y1WA 4KDDA 3GTOK 2W7VA 1TWHC 1TWFK 2EBBA 3S17K 3FOFA 2A6HA 4PABA 1O27A 5IYDC 1SFOC 2R93A 5HL8A 1YNNA 1PJ6A 3AD7C 3S1QK 4M1XA 3HOVC 3GTOA 2JA7K 1USMA 3S1RC 3S1RK 3A8IA 1K83C 2R7ZA 4FM9A 3CAGA 4G0VA 5C44K 2D6FC 3GTQK 5IP9K 4YFNA 1J98A 2PPBA 3OPFA 3GTGK 2ZUEA 5IP7K 5M3FK 4A3BC 1EFWA 3GTOC 3AD9C 3GIRA 1TWAC 4OIPA 1WOOA 4YFKA 3HOUK 3M3YK 5CJ9A 4RMFA 2CFAB 4GTLA 4OIQA 3S15C 4XLPA 1HI9A 4KMDA 1EH1A 4GTFA 2B63K 4X6AK 4P9SA 3TFIA 4BBRC 4LK1A 3I4MK 4BLBA 4YFXA 3SZYA 2VUMC 2E2IC 1BJTA 1VJEA 3GTJK 3S14K 3S0XA 3GTKA 3SZZA 2O5IA 2R92A 2PHCB 1UV7A 4OIOA 5IOSA 2NVYC 1SMYA 2GAGC 5EGEA 4A3FC 1I6HK 4KARA 2V6UA 1VH2A 2VUMA 2E2IA 1Y1VK 2GSUA 3GTKC 1WSRA 3I4NK 5C4JC 4XSZA 1DD5A 1IBAA 4BY7C 4C2MC 1O2FB 3GSIA 3S1QC 4JK1A
chains in the Genus database with same CATH topology
5TMCA 4A93C 3PO3K 1I50K 3GTJC 2WB1D 3S14C 2NVXK 1ZYRA 1TWAK 5M5YK 3S2HK 3S1MK 4C2MK 4MEXA 1WCMK 3HOYK 5TMFA 4A3BK 4BY7K 4QJVB 4BBRK 3S16K 1SFOK 2A68A 3EQLA 5M5WK 3S1MC 4Q4ZA 3K7AK 2WAQD 5C3EK 3HOXC 2R92C 4OIRA 3PO3C 5D4DA 2A6EA 4C3IK 4X6AC 3PO2K 1YNJA 2NVTK 5C44C 3S1NC 3S15K 3S2HC 4A3JK 4BY1K 1I6HC 5C4XC 3GTMC 1TWGC 2NVYK 2CW0A 3RZDK 3M4OK 3M3YC 3CQZC 2E2HK 3HOXK 2R92K 2JA5K 5M5XK 3FKIK 4Y7NC 4A3EK 2E2IK 2PA8D 3GTOK 1R9TC 4G7HA 1TWCK 5FJ8K 4AYBL 1TWHC 1TWFK 4ZH4A 5C3EC 2JA8C 3S17K 2A6HA 3I4NC 2JA8K 1I3QC 5IYDC 1SFOC 3HKZD 3I4MC 5IYBK 2E2JC 4MQ9A 4A3GC 1WCMC 2Y0SL 3H0GK 1YNNA 4A3EC 2NVXC 3S1QK 3HOVC 1I50C 2BE5A 2JA7K 4QIWD 3S1RC 2A69A 3S1RK 3GTMK 1K83C 4A3DC 4XSXA 3H3VD 4A3IK 3HOZK 1I6VA 4A3LK 5C44K 2Y0SD 3GTQK 5IP9K 2E2JK 4YFNA 3HOWK 2PPBA 3HOUC 2R7ZK 4Y52C 4KN7A 4BXXC 3GTGK 5C4JK 5FLMK 5IP7K 2VUMK 3S2DK 1TWHK 5M3FK 4A3BC 4C3JK 3RZOC 3GTOC 4MEYA 4GZYA 3H3VL 1TWAC 4OIPA 4G7ZA 2PMZD 2JA6K 4G7OA 4YFKA 3HOUK 3M3YK 4A3MC 3HOWC 1TWGK 2B63C 2NVTC 3GTLK 3GTQC 3HOVK 2PA8L 4A3IC 4OIQA 3GTPK 3HOZC 4BBSC 5IYCC 3S15C 4XLPA 3GTPC 4BBSK 4LLGA 1K83K 2NVQK 4AYBD 2B63K 4QIWL 4X6AK 4A3CC 2YU9K 3K7AC 2R93C 2YU9C 2O5JA 4Y52K 3H0GC 4BBRC 1TWCC 4LK1A 3I4MK 4YFXA 5IP7C 4Y7NK 2E2IC 5IYCK 2VUMC 3S17C 3GTGC 4KN4A 4A3DK 4QJVA 3GTJK 2R7ZC 3S14K 4C3HK 2O5IA 1BDFA 2JA7C 2NVQC 4A93K 4A3LC 5C4XK 2JA6C 4Q5SA 3FKIC 4LJZA 4A3JC 4BY1C 4OIOA 3RZOK 3M4OC 3GTLC 2NVYC 3RZDC 4NOIA 5IYBC 1SMYA 4A3FC 4A3MK 3S2DC 4OINA 1I6HK 2WAQL 5M3MK 1IW7A 5FLMC 1XPPA 4LK0A 3GTKK 4BXXK 3S1NK 3S16C 4KMUA 3PO2C 1HQMA 1Y1VC 1Y1WK 4A3GK 5IP9C 1Y1VK 1Y1WC 1R9TK 3DXJA 1I3QK 2PMZL 4YG2A 5IYDK 3GTKC 3I4NK 5C4JC 4A3CK 2R93K 1TWFC 2WB1L 4XSZA 2E2HC 4A3FK 4BY7C 3HKZL 3HOYC 3S1QC 4A3KC 4XLNA 4A3KK 2JA5C 4JK1A 3CQZK 3WODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TMC A;  4A93 C;  3PO3 K;  1I50 K;  3GTJ C;  2WB1 D;  3S14 C;  2NVX K;  1ZYR A;  1TWA K;  5M5Y K;  3S2H K;  3S1M K;  4C2M K;  4MEX A;  1WCM K;  3HOY K;  5TMF A;  4A3B K;  4BY7 K;  4QJV B;  4BBR K;  3S16 K;  1SFO K;  2A68 A;  3EQL A;  5M5W K;  3S1M C;  4Q4Z A;  3K7A K;  2WAQ D;  5C3E K;  3HOX C;  2R92 C;  4OIR A;  3PO3 C;  5D4D A;  2A6E A;  4C3I K;  4X6A C;  3PO2 K;  1YNJ A;  2NVT K;  5C44 C;  3S1N C;  3S15 K;  3S2H C;  4A3J K;  4BY1 K;  1I6H C;  5C4X C;  3GTM C;  1TWG C;  2NVY K;  2CW0 A;  3RZD K;  3M4O K;  3M3Y C;  3CQZ C;  2E2H K;  3HOX K;  2R92 K;  2JA5 K;  5M5X K;  3FKI K;  4Y7N C;  4A3E K;  2E2I K;  2PA8 D;  3GTO K;  1R9T C;  4G7H A;  1TWC K;  5FJ8 K;  4AYB L;  1TWH C;  1TWF K;  4ZH4 A;  5C3E C;  2JA8 C;  3S17 K;  2A6H A;  3I4N C;  2JA8 K;  1I3Q C;  5IYD C;  1SFO C;  3HKZ D;  3I4M C;  5IYB K;  2E2J C;  4MQ9 A;  4A3G C;  1WCM C;  2Y0S L;  3H0G K;  1YNN A;  4A3E C;  2NVX C;  3S1Q K;  3HOV C;  1I50 C;  2BE5 A;  2JA7 K;  4QIW D;  3S1R C;  2A69 A;  3S1R K;  3GTM K;  1K83 C;  4A3D C;  4XSX A;  3H3V D;  4A3I K;  3HOZ K;  1I6V A;  4A3L K;  5C44 K;  2Y0S D;  3GTQ K;  5IP9 K;  2E2J K;  4YFN A;  3HOW K;  2PPB A;  3HOU C;  2R7Z K;  4Y52 C;  4KN7 A;  4BXX C;  3GTG K;  5C4J K;  5FLM K;  5IP7 K;  2VUM K;  3S2D K;  1TWH K;  5M3F K;  4A3B C;  4C3J K;  3RZO C;  3GTO C;  4MEY A;  4GZY A;  3H3V L;  1TWA C;  4OIP A;  4G7Z A;  2PMZ D;  2JA6 K;  4G7O A;  4YFK A;  3HOU K;  3M3Y K;  4A3M C;  3HOW C;  1TWG K;  2B63 C;  2NVT C;  3GTL K;  3GTQ C;  3HOV K;  2PA8 L;  4A3I C;  4OIQ A;  3GTP K;  3HOZ C;  4BBS C;  5IYC C;  3S15 C;  4XLP A;  3GTP C;  4BBS K;  4LLG A;  1K83 K;  2NVQ K;  4AYB D;  2B63 K;  4QIW L;  4X6A K;  4A3C C;  2YU9 K;  3K7A C;  2R93 C;  2YU9 C;  2O5J A;  4Y52 K;  3H0G C;  4BBR C;  1TWC C;  4LK1 A;  3I4M K;  4YFX A;  5IP7 C;  4Y7N K;  2E2I C;  5IYC K;  2VUM C;  3S17 C;  3GTG C;  4KN4 A;  4A3D K;  4QJV A;  3GTJ K;  2R7Z C;  3S14 K;  4C3H K;  2O5I A;  1BDF A;  2JA7 C;  2NVQ C;  4A93 K;  4A3L C;  5C4X K;  2JA6 C;  4Q5S A;  3FKI C;  4LJZ A;  4A3J C;  4BY1 C;  4OIO A;  3RZO K;  3M4O C;  3GTL C;  2NVY C;  3RZD C;  4NOI A;  5IYB C;  1SMY A;  4A3F C;  4A3M K;  3S2D C;  4OIN A;  1I6H K;  2WAQ L;  5M3M K;  1IW7 A;  5FLM C;  1XPP A;  4LK0 A;  3GTK K;  4BXX K;  3S1N K;  3S16 C;  4KMU A;  3PO2 C;  1HQM A;  1Y1V C;  1Y1W K;  4A3G K;  5IP9 C;  1Y1V K;  1Y1W C;  1R9T K;  3DXJ A;  1I3Q K;  2PMZ L;  4YG2 A;  5IYD K;  3GTK C;  3I4N K;  5C4J C;  4A3C K;  2R93 K;  1TWF C;  2WB1 L;  4XSZ A;  2E2H C;  4A3F K;  4BY7 C;  3HKZ L;  3HOY C;  3S1Q C;  4A3K C;  4XLN A;  4A3K K;  2JA5 C;  4JK1 A;  3CQZ K;  3WOD A; 
#chains in the Genus database with same CATH topology
 1O24 A;  1IQ0 A;  3PO3 K;  4GTB A;  1VLO A;  5M5Y K;  3S1M K;  5CHP A;  1WQF A;  1WCM K;  3S16 K;  3GEI A;  1R9T A;  3EQL A;  4Q4Z A;  4GFQ A;  3HOX C;  2JA7 A;  3N0B A;  2V6T A;  3GTL A;  1ISE A;  1I6H C;  5C4X C;  3GTM C;  4LOW A;  2NVY K;  2XCQ A;  3M4O K;  3CQZ C;  5M5X K;  4Y7N C;  1R9T C;  2ZFZ A;  2XCR B;  1TWC K;  2E2H A;  5C3E C;  2JA8 C;  1XZQ A;  3I4N C;  1EI6 A;  2JA8 K;  1I3Q C;  3HKZ D;  3I4M C;  5IYB K;  4A3G C;  1WCM C;  3GTM A;  4G0W A;  1TWC A;  1XZP B;  3N3Y A;  2BE5 A;  4P5A A;  4QIW D;  1F7V A;  4KMH A;  3H3V D;  3A8J A;  4A3I K;  3HOZ K;  3LAJ A;  1EQR A;  1RU0 A;  2E2J K;  1I3Q A;  3HOU C;  2R7Z K;  3Q3Q A;  1DCH A;  5FLM K;  5C4J K;  1O2A A;  4LR2 A;  3RZO C;  1IS1 A;  4MEY A;  5E68 A;  4GZY A;  1TWG A;  2JA6 K;  4AH6 A;  3HOW C;  2B63 C;  3GTL K;  1PJ7 A;  1B4B A;  3GTP C;  4BBS K;  4LLG A;  1K83 K;  3A8K A;  2JA5 A;  4A3C C;  2YU9 K;  4C45 A;  2YU9 C;  3TFJ A;  2O5J A;  3G4A A;  4Y52 K;  1BGW A;  1WOR A;  2NVX A;  5IP7 C;  1Y1V A;  5IYC K;  2B63 A;  3GTG C;  4KN4 A;  4QJV A;  4G0U A;  4C3H K;  3GTP A;  1BDF A;  2NVQ C;  4A3L C;  5C4X K;  2JA6 C;  3FKI C;  4LJZ A;  3GEE A;  3RZO K;  1XXA A;  4GTD A;  3RZD C;  2YU9 A;  1IW7 A;  5FLM C;  4LK0 A;  3GTK K;  1G51 A;  4BXX K;  3GTJ A;  4KMU A;  4C3J C;  1Y1V C;  1Y1W C;  4C3I C;  3AH5 A;  3GTG A;  1R9T K;  5IYD K;  1INN A;  5IOT A;  2JA6 A;  3HOY C;  4BKW A;  3T00 A;  4XLN A;  2P5M A;  1O28 A;  1I50 K;  3AQO A;  3GTJ C;  3JST A;  3S14 C;  1TWA K;  1IE0 A;  4MEX A;  5TMF A;  1YX2 A;  4A3B K;  4QJV B;  3ADA C;  5TJ3 A;  1SFO K;  2A68 A;  3IPJ A;  1YCL A;  4LQY A;  4C3I K;  3LAP A;  4X6A C;  3S15 K;  3S2H C;  4A3J K;  5IOR A;  1F7U A;  1ZXO A;  3RZD K;  1TWA A;  3GDZ A;  1I50 A;  2R92 K;  1J6X A;  2E2I K;  1O29 A;  4KMA A;  1DCO A;  5FJ8 K;  4ZH4 A;  4GTE A;  3FHZ A;  1WOP A;  2Y0S L;  3N0C A;  4A3E C;  1AB4 A;  1I50 C;  1C0A A;  2A69 A;  3TFH A;  4A3D C;  3GEH A;  4XSX A;  4A3L K;  1VRQ C;  3HOW K;  1EK8 A;  4KN7 A;  1TWH K;  4ILD A;  4C3J K;  3H0G A;  2V6S A;  1ZBS A;  3H3V L;  4G7O A;  4XCH A;  4A3M C;  3HOV K;  4A3I C;  3HOZ C;  3GTP K;  4BBS C;  1TWH A;  1XZP A;  4GTA A;  3BUE A;  2NVQ K;  4WJ4 A;  4C3H C;  1DCP A;  2R93 C;  1J6W A;  2XCO A;  2GAH C;  3H0G C;  3V4G A;  1WIH A;  4A3D K;  1V5V A;  1K83 A;  2R7Z C;  4A93 K;  2JA7 C;  2GSN A;  3VA7 A;  4A3J C;  5EGH A;  3M4O C;  3GTL C;  3OEP A;  4NOI A;  3L4J A;  4OIN A;  3CQZ A;  3S1N K;  4FZB A;  1F9N A;  1Y1W K;  4A3G K;  5IP9 C;  1ZQ1 C;  3DXJ A;  1I3Q K;  2PMZ L;  4YG2 A;  4A3C K;  2E2H C;  3HKZ L;  3ORE A;  1WQH A;  3HXA A;  4A3K K;  2ZUF A;  3CQZ K;  3WOD A;  3T02 A;  4KAS A;  4KB2 A;  2NVX K;  1ZYR A;  2RH6 A;  4C2M K;  4P5B A;  4BY7 K;  3NUH A;  5IOQ A;  3K7A K;  4J3N A;  3FOE A;  5C3E K;  2R92 C;  4KB4 A;  1PJ5 A;  2A6E A;  4GT9 A;  2NVT K;  3S1N C;  3BP8 C;  1O2B A;  3T01 A;  2NVY A;  4BY1 K;  1TWG C;  3MML B;  1F93 A;  1JOE A;  3L4K A;  4KAT A;  2PA8 D;  2CFA A;  3BP3 A;  4KC6 A;  4G7H A;  4AYB L;  5JVO A;  2E2J C;  4MQ9 A;  1XZQ B;  3H0G K;  2NVX C;  1J6V A;  3GTM K;  2P8T A;  2Y3P A;  1I6V A;  3GTQ A;  2Y0S D;  2JH3 A;  1KQ4 A;  4Y52 C;  4BXX C;  2VUM K;  3S2D K;  1X31 C;  3AQP A;  5L46 A;  1XXB A;  4G7Z A;  2PMZ D;  1TWG K;  3AD8 C;  3GTQ C;  2PA8 L;  4PAA A;  5IYC C;  4AYB D;  1WSV A;  4QIW L;  3TTG A;  3K7A C;  1BS2 A;  1JVI A;  4KAW X;  1WCM A;  2GSO A;  1TWC C;  1VGX A;  4BLA A;  4Y7N K;  3S17 C;  2FQT A;  4Q5S A;  4BY1 C;  1XXC A;  4WIL A;  1O25 A;  1USO A;  5IYB C;  4A3M K;  1L0W A;  1O26 A;  3S2D C;  2WAQ L;  5M3M K;  1XPP A;  3ERE D;  1GE9 A;  3S16 C;  3PO2 C;  1HQM A;  3LPX A;  4DDQ A;  1JQW A;  2R93 K;  1TWF C;  2WB1 L;  4A3F K;  3G4C A;  1B4A A;  4A3K C;  2JA5 C;  2NVT C;  5TMC A;  4A93 C;  4KM9 A;  2WB1 D;  3S2H K;  4KM8 A;  4O2D A;  3HOY K;  4WJ3 M;  3QX3 A;  4BBR K;  1TWF A;  2KWA A;  5M5W K;  3S1M C;  2WAQ D;  4OIR A;  3PO3 C;  5D4D A;  1WOS A;  3FKI A;  3PO2 K;  1YNJ A;  1IL2 A;  5C44 C;  1SFO A;  5JFE A;  2FQO A;  4GTC A;  1WQG A;  2CW0 A;  1ZVU A;  3M3Y C;  2E2H K;  3HOX K;  2JA5 K;  2RGR A;  4A3E K;  3FKI K;  1Y1W A;  4KDD A;  3GTO K;  2W7V A;  1TWH C;  1TWF K;  2EBB A;  3S17 K;  3FOF A;  2A6H A;  4PAB A;  1O27 A;  5IYD C;  1SFO C;  2R93 A;  5HL8 A;  1YNN A;  1PJ6 A;  3AD7 C;  3S1Q K;  4M1X A;  3HOV C;  3GTO A;  2JA7 K;  1USM A;  3S1R C;  3S1R K;  3A8I A;  1K83 C;  2R7Z A;  4FM9 A;  3CAG A;  4G0V A;  5C44 K;  2D6F C;  3GTQ K;  5IP9 K;  4YFN A;  1J98 A;  2PPB A;  3OPF A;  3GTG K;  2ZUE A;  5IP7 K;  5M3F K;  4A3B C;  1EFW A;  3GTO C;  3AD9 C;  3GIR A;  1TWA C;  4OIP A;  1WOO A;  4YFK A;  3HOU K;  3M3Y K;  5CJ9 A;  4RMF A;  2CFA B;  4GTL A;  4OIQ A;  3S15 C;  4XLP A;  1HI9 A;  4KMD A;  1EH1 A;  4GTF A;  2B63 K;  4X6A K;  4P9S A;  3TFI A;  4BBR C;  4LK1 A;  3I4M K;  4BLB A;  4YFX A;  3SZY A;  2VUM C;  2E2I C;  1BJT A;  1VJE A;  3GTJ K;  3S14 K;  3S0X A;  3GTK A;  3SZZ A;  2O5I A;  2R92 A;  2PHC B;  1UV7 A;  4OIO A;  5IOS A;  2NVY C;  1SMY A;  2GAG C;  5EGE A;  4A3F C;  1I6H K;  4KAR A;  2V6U A;  1VH2 A;  2VUM A;  2E2I A;  1Y1V K;  2GSU A;  3GTK C;  1WSR A;  3I4N K;  5C4J C;  4XSZ A;  1DD5 A;  1IBA A;  4BY7 C;  4C2M C;  1O2F B;  3GSI A;  3S1Q C;  4JK1 A; 
#chains in the Genus database with same CATH homology
 5TMC A;  4A93 C;  3PO3 K;  1I50 K;  3GTJ C;  2WB1 D;  3S14 C;  2NVX K;  1ZYR A;  1TWA K;  5M5Y K;  3S2H K;  3S1M K;  4C2M K;  4MEX A;  1WCM K;  3HOY K;  5TMF A;  4A3B K;  4BY7 K;  4QJV B;  4BBR K;  3S16 K;  1SFO K;  2A68 A;  3EQL A;  5M5W K;  3S1M C;  4Q4Z A;  3K7A K;  2WAQ D;  5C3E K;  3HOX C;  2R92 C;  4OIR A;  3PO3 C;  5D4D A;  2A6E A;  4C3I K;  4X6A C;  3PO2 K;  1YNJ A;  2NVT K;  5C44 C;  3S1N C;  3S15 K;  3S2H C;  4A3J K;  4BY1 K;  1I6H C;  5C4X C;  3GTM C;  1TWG C;  2NVY K;  2CW0 A;  3RZD K;  3M4O K;  3M3Y C;  3CQZ C;  2E2H K;  3HOX K;  2R92 K;  2JA5 K;  5M5X K;  3FKI K;  4Y7N C;  4A3E K;  2E2I K;  2PA8 D;  3GTO K;  1R9T C;  4G7H A;  1TWC K;  5FJ8 K;  4AYB L;  1TWH C;  1TWF K;  4ZH4 A;  5C3E C;  2JA8 C;  3S17 K;  2A6H A;  3I4N C;  2JA8 K;  1I3Q C;  5IYD C;  1SFO C;  3HKZ D;  3I4M C;  5IYB K;  2E2J C;  4MQ9 A;  4A3G C;  1WCM C;  2Y0S L;  3H0G K;  1YNN A;  4A3E C;  2NVX C;  3S1Q K;  3HOV C;  1I50 C;  2BE5 A;  2JA7 K;  4QIW D;  3S1R C;  2A69 A;  3S1R K;  3GTM K;  1K83 C;  4A3D C;  4XSX A;  3H3V D;  4A3I K;  3HOZ K;  1I6V A;  4A3L K;  5C44 K;  2Y0S D;  3GTQ K;  5IP9 K;  2E2J K;  4YFN A;  3HOW K;  2PPB A;  3HOU C;  2R7Z K;  4Y52 C;  4KN7 A;  4BXX C;  3GTG K;  5C4J K;  5FLM K;  5IP7 K;  2VUM K;  3S2D K;  1TWH K;  5M3F K;  4A3B C;  4C3J K;  3RZO C;  3GTO C;  4MEY A;  4GZY A;  3H3V L;  1TWA C;  4OIP A;  4G7Z A;  2PMZ D;  2JA6 K;  4G7O A;  4YFK A;  3HOU K;  3M3Y K;  4A3M C;  3HOW C;  1TWG K;  2B63 C;  2NVT C;  3GTL K;  3GTQ C;  3HOV K;  2PA8 L;  4A3I C;  4OIQ A;  3GTP K;  3HOZ C;  4BBS C;  5IYC C;  3S15 C;  4XLP A;  3GTP C;  4BBS K;  4LLG A;  1K83 K;  2NVQ K;  4AYB D;  2B63 K;  4QIW L;  4X6A K;  4A3C C;  2YU9 K;  3K7A C;  2R93 C;  2YU9 C;  2O5J A;  4Y52 K;  3H0G C;  4BBR C;  1TWC C;  4LK1 A;  3I4M K;  4YFX A;  5IP7 C;  4Y7N K;  2E2I C;  5IYC K;  2VUM C;  3S17 C;  3GTG C;  4KN4 A;  4A3D K;  4QJV A;  3GTJ K;  2R7Z C;  3S14 K;  4C3H K;  2O5I A;  1BDF A;  2JA7 C;  2NVQ C;  4A93 K;  4A3L C;  5C4X K;  2JA6 C;  4Q5S A;  3FKI C;  4LJZ A;  4A3J C;  4BY1 C;  4OIO A;  3RZO K;  3M4O C;  3GTL C;  2NVY C;  3RZD C;  4NOI A;  5IYB C;  1SMY A;  4A3F C;  4A3M K;  3S2D C;  4OIN A;  1I6H K;  2WAQ L;  5M3M K;  1IW7 A;  5FLM C;  1XPP A;  4LK0 A;  3GTK K;  4BXX K;  3S1N K;  3S16 C;  4KMU A;  3PO2 C;  1HQM A;  1Y1V C;  1Y1W K;  4A3G K;  5IP9 C;  1Y1V K;  1Y1W C;  1R9T K;  3DXJ A;  1I3Q K;  2PMZ L;  4YG2 A;  5IYD K;  3GTK C;  3I4N K;  5C4J C;  4A3C K;  2R93 K;  1TWF C;  2WB1 L;  4XSZ A;  2E2H C;  4A3F K;  4BY7 C;  3HKZ L;  3HOY C;  3S1Q C;  4A3K C;  4XLN A;  4A3K K;  2JA5 C;  4JK1 A;  3CQZ K;  3WOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...