2PMZL

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
molecule keywords DNA-directed RNA polymerase subunit A
total genus 20
structure length 92
sequence length 92
chains with identical sequence X
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pmzL00
1I6HC 4YFNA 2B63K 3GTPC 3GTJC 3HOZC 4A3JK 2NVXK 4XSXA 2JA6K 3S14C 2A6EA 5TMCA 5M5WK 2NVYC 3HOXK 5IYBC 2JA6C 3HOVK 3HOVC 2R7ZC 1HQMA 3H0GK 3CQZK 3S14K 3FKIC 1I50K 3GTJK 1SMYA 4MEYA 4G7ZA 5M3MK 4JK1A 4QIWD 1I6VA 3GTKK 2Y0SD 4A3BC 4BY1C 4BBSK 4A3DC 5C3EK 4ZH4A 2R7ZK 2NVTK 5IYBK 2NVYK 4KN4A 3GTGK 4GZYA 3I4NC 4MQ9A 5IYCK 3RZOC 3S1MC 4A3LC 3HOUK 2NVQK 5C44C 2VUMC 4OINA 3GTPK 2R92C 4A3MC 2B63C 4Q5SA 4A3IK 1I6HK 1TWHK 1TWFK 2E2HC 3K7AK 4Y52K 5C4XC 5IP9C 4A3KK 4LK0A 2JA8C 5FJ8K 2R93K 5IYDK 3HOYC 5D4DA 2PMZL 4G7OA 1ZYRA 3GTOK 3S15C 4YFKA 4BY7K 1K83C 3DXJA 3S1RK 3S15K 1YNNA 4A3CC 4OIRA 3GTLK 1TWAC 1XPPA 2YU9K 4XLNA 3S16K 4XSZA 2JA5C 4X6AC 2E2HK 2JA5K 3S16C 1TWHC 4OIPA 4AYBL 2E2JK 1TWAK 2R92K 2CW0A 4C3HK 3PO2C 5C44K 2VUMK 2NVQC 2JA7K 4BY7C 3HOUC 3GTOC 4A93C 3WODA 3RZOK 4Y7NK 2WB1D 5IYDC 3GTGC 1BDFA 5M5YK 5IP9K 3M3YC 2O5IA 4A3GK 3S17C 4C2MK 4A3IC 3S1QK 3S2DC 4A3GC 1WCMK 4Q4ZA 3CQZC 1Y1VC 1IW7A 3GTKC 3I4MC 3HOXC 5IYCC 1TWCK 1I3QK 1TWCC 3HKZL 4LLGA 4C3IK 5M5XK 2E2IK 4YG2A 4YFXA 3H3VD 3GTQC 2Y0SL 5C3EC 4BBRC 1WCMC 4NOIA 3HOZK 3H3VL 3GTMK 4A3BK 3S2DK 5TMFA 3S1QC 4BBSC 4QJVB 1TWGC 2A6HA 1TWGK 5C4JK 5C4JC 4QJVA 3GTMC 3S17K 1I50C 3FKIK 2A68A 4BBRK 3M3YK 3H0GC 4KN7A 3GTQK 3S1NK 2E2IC 1I3QC 4Y7NC 2PA8D 3I4MK 2BE5A 1Y1VK 4A3JC 2NVXC 3HKZD 3HOWK 2WB1L 4A3FK 3PO3C 5FLMK 1R9TK 4C3JK 4X6AK 2YU9C 1SFOK 1Y1WK 2A69A 4A93K 4BXXK 2PPBA 3S1RC 2JA7C 4A3CK 2WAQL 3PO2K 4A3EK 3M4OC 1Y1WC 2E2JC 3HOYK 3S2HC 2JA8K 2R93C 4MEXA 3RZDC 5C4XK 5IP7C 1R9TC 4AYBD 3K7AC 4Y52C 5IP7K 3RZDK 2PMZD 3PO3K 1TWFC 4LK1A 4XLPA 4KMUA 3S2HK 2O5JA 2WAQD 4A3MK 3GTLC 4OIQA 4LJZA 5M3FK 1K83K 4A3EC 3HOWC 3M4OK 4BXXC 3EQLA 3S1MK 1SFOC 3I4NK 4A3LK 2PA8L 4OIOA 4QIWL 1YNJA 4A3KC 2NVTC 3S1NC 4A3DK 5FLMC 4BY1K 4G7HA 4A3FC
chains in the Genus database with same CATH superfamily
3AQPA 2XCRB 3HOZC 4KMAA 4M1XA 1X31C 3N0CA 5TMCA 5M5WK 4PABA 2JA6C 4KMDA 1HQMA 3FKIC 1I50K 3GTJK 1XZQB 4KAWX 5IYBK 3GTQA 3JSTA 4GFQA 4DDQA 2R92C 2B63C 5JFEA 1F9NA 3N3YA 1I3QA 5C4XC 2GAHC 2Y3PA 2R93K 2KWAA 4G0VA 3HOYC 2V6TA 1ZYRA 3S15C 3LPXA 4YFKA 5TJ3A 4KATA 1HI9A 1WQFA 1YNNA 3GTLK 1TWAC 2YU9K 2XCOA 1ISEA 1EFWA 3S16K 1VH2A 2CFAA 1Y1WA 1AB4A 2E2HK 2JA7A 3A8JA 3S0XA 3HOUC 4P5AA 4GT9A 3S17C 2R93A 1JVIA 1XZPA 1UV7A 1TWCK 3TFIA 4YG2A 4WILA 3GTMK 3S2DK 5TMFA 4QJVB 1K83A 1TWCA 1I50C 1KQ4A 3M3YK 3H0GC 3ERED 4KB4A 2E2IC 4A3JC 3HOWK 4C3HC 5IOSA 4KDDA 3GTGA 2R92A 1PJ6A 2PPBA 4A3CK 4A3EK 3M4OC 3S2HC 1F93A 2JA8K 4XCHA 5IP7K 4Y52C 3RZDK 1IQ0A 1TWFC 1G51A 3GTLC 2E2HA 4G0WA 4AH6A 3GDZA 1XXAA 3EQLA 3Q3QA 3I4NK 4OIOA 4QIWL 1YNJA 1I50A 4A3DK 5FLMC 4A3FC 3GEIA 2B63K 2NVXK 1TWFA 4XSXA 2A6EA 1ZQ1C 3HOXK 3HOVC 5IYBC 4G0UA 3S14K 2R7ZC 3CQZK 1IE0A 4G7ZA 1BS2A 3MMLB 1XXCA 4QIWD 3GTKK 4A3BC 4BBSK 1ZVUA 2GSOA 4A3DC 2FQTA 3L4KA 1INNA 4MQ9A 5EGEA 5C44C 2VUMC 4OINA 4Q5SA 4KC6A 1BJTA 4A3IK 1TWHK 4BLAA 4Y52K 4LK0A 2JA8C 5IYDK 3AH5A 2PMZL 1K83C 3DXJA 4LR2A 2JA5C 4X6AC 3SZZA 1WCMA 1TWHC 5CHPA 3PO2C 5C44K 2VUMK 2NVQC 2JA7K 1USMA 3GTOC 5E68A 2WB1D 4Y7NK 5IYDC 3GTGC 5M5YK 1VLOA 1B4AA 1VGXA 2O5IA 1BGWA 4C2MK 1IS1A 3AD7C 1EH1A 1V5VA 3S2DC 2FQOA 3FKIA 5IOTA 1O2FB 1Y1VC 1TWGA 3I4MC 3HOXC 3HOVK 1I3QK 1TWCC 5M5XK 1JOEA 3GEEA 3H3VL 4A3BK 4BBSC 3S1QC 1TWGC 1O25A 1TWGK 2A6HA 5EGHA 4KN7A 3GTQK 1I3QC 2PA8D 2BE5A 3BP8C 1Y1VK 3GTJA 3LAPA 3A8IA 4A3FK 3TFJA 1J6VA 3LAJA 4A93K 2GSNA 2JA7C 3T00A 3IPJA 1EI6A 1WSRA 3L4JA 1Y1WC 2RGRA 3HOYK 2JA6A 5C4XK 4J3NA 4O2DA 4XLPA 3S2HK 3OPFA 2NVYA 4A3MK 1J6WA 5M3FK 4BLBA 3HOWC 2JH3A 4BXXC 3GTPA 2PA8L 3BUEA 3N0BA 4BY1K 3GTOA 1O2AA 1I6HC 4YFNA 5HL8A 3GTJC 3GSIA 1SFOA 4A3JK 1F7UA 2JA6K 1R9TA 2JA5A 3CQZA 2ZUFA 3H0GK 1XZQA 1SMYA 4MEYA 5M3MK 1I6VA 4BY1C 3AQOA 5C3EK 2R7ZK 2NVTK 2NVYK 4KN4A 4A3LC 5IYCK 3RZOC 3S1MC 3HOUK 2XCQA 3GTPK 4A3MC 3T01A 1WQGA 4PAAA 2E2HC 5IOQA 2P5MA 1O28A 5FJ8K 4P9SA 5D4DA 1VRQC 3S1RK 3S15K 3NUHA 4OIRA 1XPPA 1WOSA 4C3JC 3GIRA 3OREA 4FM9A 3S16C 4OIPA 1TWAK 2R92K 3RZOK 4GTLA 1ZBSA 1BDFA 1ZXOA 2E2IA 2NVXA 3S1QK 1WCMK 4Q4ZA 5IORA 4GTEA 5IYCC 4C3IK 2E2IK 3H3VD 1RU0A 2W7VA 2Y0SL 5C3EC 4BBRC 4WJ4A 3HOZK 4KM8A 4A3GK 5C4JK 1DCPA 5C4JC 4QJVA 1WQHA 3GTMC 3FKIK 2A68A 3TTGA 4BBRK 3S1NK 2R7ZA 4Y7NC 3VA7A 2WB1L 3PO3C 2CFAB 1R9TK 2ZUEA 4X6AK 1Y1WK 4BXXK 1J6XA 2WAQL 2EBBA 3GTLA 4KARA 1Y1VA 4MEXA 2ZFZA 4LQYA 3K7AC 2PMZD 4LK1A 1DCOA 2O5JA 2WAQD 4OIQA 2GSUA 3GTKA 1SFOC 1F7VA 1WORA 3CAGA 3GEHA 3G4AA 3GTKC 1DCHA 3SZYA 3GTPC 4KB2A 3S14C 1JQWA 1EK8A 2NVYC 1WSVA 3AD9C 1PJ7A 1O2BA 4JK1A 1XXBA 2Y0SD 4ZH4A 3GTGK 3FOFA 4GZYA 3I4NC 4ILDA 2NVQK 1IBAA 4C45A 1I6HK 1TWFK 1WOOA 3K7AK 5IP9C 4A3KK 1O24A 1VJEA 2P8TA 4G7OA 3GTOK 4BY7K 4GTBA 4BKWA 4A3CC 1USOA 4XLNA 2PHCB 2V6SA 4XSZA 3QX3A 1GE9A 2D6FC 2JA5K 1O26A 4AYBL 4KMHA 2E2JK 2CW0A 3A8KA 1YCLA 1TWAA 4GTFA 4C3HK 4BY7C 4A93C 3WODA 4WJ3M 1PJ5A 3AD8C 1B4BA 4KASA 3ADAC 5IP9K 3M3YC 4P5BA 4RMFA 3FOEA 4A3IC 4A3GC 2B63A 3CQZC 1IW7A 3HKZL 4LLGA 4C3IC 3GTMA 1WOPA 4YFXA 3GTQC 1TWHA 1WCMC 4NOIA 1WIHA 5L46A 3BP3A 5JVOA 3T02A 1J98A 3S17K 5CJ9A 4KM9A 1C0AA 3I4MK 2RH6A 1O29A 2NVXC 3HKZD 1EQRA 3H0GA 4C2MC 1IL2A 1YX2A 5FLMK 4C3JK 2VUMA 2YU9C 1SFOK 2A69A 3S1RC 1L0WA 3PO2K 2GAGC 2E2JC 2R93C 3TFHA 4GTCA 3RZDC 3HXAA 5IP7C 1R9TC 4AYBD 3PO3K 2V6UA 1XZPB 4KMUA 1O27A 4GTDA 4GTAA 4LJZA 1K83K 4A3EC 3M4OK 3S1MK 3G4CA 4A3LK 2YU9A 2NVTC 4A3KC 4FZBA 3OEPA 4LOWA 3FHZA 3S1NC 4G7HA 3V4GA 1DD5A
chains in the Genus database with same CATH topology
1I6HC 4YFNA 2B63K 3GTPC 3GTJC 3HOZC 4A3JK 2NVXK 4XSXA 2JA6K 3S14C 2A6EA 5TMCA 5M5WK 2NVYC 3HOXK 5IYBC 2JA6C 3HOVK 3HOVC 2R7ZC 1HQMA 3H0GK 3CQZK 3S14K 3FKIC 1I50K 3GTJK 1SMYA 4MEYA 4G7ZA 5M3MK 4JK1A 4QIWD 1I6VA 3GTKK 2Y0SD 4A3BC 4BY1C 4BBSK 4A3DC 5C3EK 4ZH4A 2R7ZK 2NVTK 5IYBK 2NVYK 4KN4A 3GTGK 4GZYA 3I4NC 4MQ9A 5IYCK 3RZOC 3S1MC 4A3LC 3HOUK 2NVQK 5C44C 2VUMC 4OINA 3GTPK 2R92C 4A3MC 2B63C 4Q5SA 4A3IK 1I6HK 1TWHK 1TWFK 2E2HC 3K7AK 4Y52K 5C4XC 5IP9C 4A3KK 4LK0A 2JA8C 5FJ8K 2R93K 5IYDK 3HOYC 5D4DA 2PMZL 4G7OA 1ZYRA 3GTOK 3S15C 4YFKA 4BY7K 1K83C 3DXJA 3S1RK 3S15K 1YNNA 4A3CC 4OIRA 3GTLK 1TWAC 1XPPA 2YU9K 4XLNA 3S16K 4XSZA 2JA5C 4X6AC 2E2HK 2JA5K 3S16C 1TWHC 4OIPA 4AYBL 2E2JK 1TWAK 2R92K 2CW0A 4C3HK 3PO2C 5C44K 2VUMK 2NVQC 2JA7K 4BY7C 3HOUC 3GTOC 4A93C 3WODA 3RZOK 4Y7NK 2WB1D 5IYDC 3GTGC 1BDFA 5M5YK 5IP9K 3M3YC 2O5IA 4A3GK 3S17C 4C2MK 4A3IC 3S1QK 3S2DC 4A3GC 1WCMK 4Q4ZA 3CQZC 1Y1VC 1IW7A 3GTKC 3I4MC 3HOXC 5IYCC 1TWCK 1I3QK 1TWCC 3HKZL 4LLGA 4C3IK 5M5XK 2E2IK 4YG2A 4YFXA 3H3VD 3GTQC 2Y0SL 5C3EC 4BBRC 1WCMC 4NOIA 3HOZK 3H3VL 3GTMK 4A3BK 3S2DK 5TMFA 3S1QC 4BBSC 4QJVB 1TWGC 2A6HA 1TWGK 5C4JK 5C4JC 4QJVA 3GTMC 3S17K 1I50C 3FKIK 2A68A 4BBRK 3M3YK 3H0GC 4KN7A 3GTQK 3S1NK 2E2IC 1I3QC 4Y7NC 2PA8D 3I4MK 2BE5A 1Y1VK 4A3JC 2NVXC 3HKZD 3HOWK 2WB1L 4A3FK 3PO3C 5FLMK 1R9TK 4C3JK 4X6AK 2YU9C 1SFOK 1Y1WK 2A69A 4A93K 4BXXK 2PPBA 3S1RC 2JA7C 4A3CK 2WAQL 3PO2K 4A3EK 3M4OC 1Y1WC 2E2JC 3HOYK 3S2HC 2JA8K 2R93C 4MEXA 3RZDC 5C4XK 5IP7C 1R9TC 4AYBD 3K7AC 4Y52C 5IP7K 3RZDK 2PMZD 3PO3K 1TWFC 4LK1A 4XLPA 4KMUA 3S2HK 2O5JA 2WAQD 4A3MK 3GTLC 4OIQA 4LJZA 5M3FK 1K83K 4A3EC 3HOWC 3M4OK 4BXXC 3EQLA 3S1MK 1SFOC 3I4NK 4A3LK 2PA8L 4OIOA 4QIWL 1YNJA 4A3KC 2NVTC 3S1NC 4A3DK 5FLMC 4BY1K 4G7HA 4A3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6H C;  4YFN A;  2B63 K;  3GTP C;  3GTJ C;  3HOZ C;  4A3J K;  2NVX K;  4XSX A;  2JA6 K;  3S14 C;  2A6E A;  5TMC A;  5M5W K;  2NVY C;  3HOX K;  5IYB C;  2JA6 C;  3HOV K;  3HOV C;  2R7Z C;  1HQM A;  3H0G K;  3CQZ K;  3S14 K;  3FKI C;  1I50 K;  3GTJ K;  1SMY A;  4MEY A;  4G7Z A;  5M3M K;  4JK1 A;  4QIW D;  1I6V A;  3GTK K;  2Y0S D;  4A3B C;  4BY1 C;  4BBS K;  4A3D C;  5C3E K;  4ZH4 A;  2R7Z K;  2NVT K;  5IYB K;  2NVY K;  4KN4 A;  3GTG K;  4GZY A;  3I4N C;  4MQ9 A;  5IYC K;  3RZO C;  3S1M C;  4A3L C;  3HOU K;  2NVQ K;  5C44 C;  2VUM C;  4OIN A;  3GTP K;  2R92 C;  4A3M C;  2B63 C;  4Q5S A;  4A3I K;  1I6H K;  1TWH K;  1TWF K;  2E2H C;  3K7A K;  4Y52 K;  5C4X C;  5IP9 C;  4A3K K;  4LK0 A;  2JA8 C;  5FJ8 K;  2R93 K;  5IYD K;  3HOY C;  5D4D A;  2PMZ L;  4G7O A;  1ZYR A;  3GTO K;  3S15 C;  4YFK A;  4BY7 K;  1K83 C;  3DXJ A;  3S1R K;  3S15 K;  1YNN A;  4A3C C;  4OIR A;  3GTL K;  1TWA C;  1XPP A;  2YU9 K;  4XLN A;  3S16 K;  4XSZ A;  2JA5 C;  4X6A C;  2E2H K;  2JA5 K;  3S16 C;  1TWH C;  4OIP A;  4AYB L;  2E2J K;  1TWA K;  2R92 K;  2CW0 A;  4C3H K;  3PO2 C;  5C44 K;  2VUM K;  2NVQ C;  2JA7 K;  4BY7 C;  3HOU C;  3GTO C;  4A93 C;  3WOD A;  3RZO K;  4Y7N K;  2WB1 D;  5IYD C;  3GTG C;  1BDF A;  5M5Y K;  5IP9 K;  3M3Y C;  2O5I A;  4A3G K;  3S17 C;  4C2M K;  4A3I C;  3S1Q K;  3S2D C;  4A3G C;  1WCM K;  4Q4Z A;  3CQZ C;  1Y1V C;  1IW7 A;  3GTK C;  3I4M C;  3HOX C;  5IYC C;  1TWC K;  1I3Q K;  1TWC C;  3HKZ L;  4LLG A;  4C3I K;  5M5X K;  2E2I K;  4YG2 A;  4YFX A;  3H3V D;  3GTQ C;  2Y0S L;  5C3E C;  4BBR C;  1WCM C;  4NOI A;  3HOZ K;  3H3V L;  3GTM K;  4A3B K;  3S2D K;  5TMF A;  3S1Q C;  4BBS C;  4QJV B;  1TWG C;  2A6H A;  1TWG K;  5C4J K;  5C4J C;  4QJV A;  3GTM C;  3S17 K;  1I50 C;  3FKI K;  2A68 A;  4BBR K;  3M3Y K;  3H0G C;  4KN7 A;  3GTQ K;  3S1N K;  2E2I C;  1I3Q C;  4Y7N C;  2PA8 D;  3I4M K;  2BE5 A;  1Y1V K;  4A3J C;  2NVX C;  3HKZ D;  3HOW K;  2WB1 L;  4A3F K;  3PO3 C;  5FLM K;  1R9T K;  4C3J K;  4X6A K;  2YU9 C;  1SFO K;  1Y1W K;  2A69 A;  4A93 K;  4BXX K;  2PPB A;  3S1R C;  2JA7 C;  4A3C K;  2WAQ L;  3PO2 K;  4A3E K;  3M4O C;  1Y1W C;  2E2J C;  3HOY K;  3S2H C;  2JA8 K;  2R93 C;  4MEX A;  3RZD C;  5C4X K;  5IP7 C;  1R9T C;  4AYB D;  3K7A C;  4Y52 C;  5IP7 K;  3RZD K;  2PMZ D;  3PO3 K;  1TWF C;  4LK1 A;  4XLP A;  4KMU A;  3S2H K;  2O5J A;  2WAQ D;  4A3M K;  3GTL C;  4OIQ A;  4LJZ A;  5M3F K;  1K83 K;  4A3E C;  3HOW C;  3M4O K;  4BXX C;  3EQL A;  3S1M K;  1SFO C;  3I4N K;  4A3L K;  2PA8 L;  4OIO A;  4QIW L;  1YNJ A;  4A3K C;  2NVT C;  3S1N C;  4A3D K;  5FLM C;  4BY1 K;  4G7H A;  4A3F C; 
#chains in the Genus database with same CATH topology
 3AQP A;  2XCR B;  3HOZ C;  4KMA A;  4M1X A;  1X31 C;  3N0C A;  5TMC A;  5M5W K;  4PAB A;  2JA6 C;  4KMD A;  1HQM A;  3FKI C;  1I50 K;  3GTJ K;  1XZQ B;  4KAW X;  5IYB K;  3GTQ A;  3JST A;  4GFQ A;  4DDQ A;  2R92 C;  2B63 C;  5JFE A;  1F9N A;  3N3Y A;  1I3Q A;  5C4X C;  2GAH C;  2Y3P A;  2R93 K;  2KWA A;  4G0V A;  3HOY C;  2V6T A;  1ZYR A;  3S15 C;  3LPX A;  4YFK A;  5TJ3 A;  4KAT A;  1HI9 A;  1WQF A;  1YNN A;  3GTL K;  1TWA C;  2YU9 K;  2XCO A;  1ISE A;  1EFW A;  3S16 K;  1VH2 A;  2CFA A;  1Y1W A;  1AB4 A;  2E2H K;  2JA7 A;  3A8J A;  3S0X A;  3HOU C;  4P5A A;  4GT9 A;  3S17 C;  2R93 A;  1JVI A;  1XZP A;  1UV7 A;  1TWC K;  3TFI A;  4YG2 A;  4WIL A;  3GTM K;  3S2D K;  5TMF A;  4QJV B;  1K83 A;  1TWC A;  1I50 C;  1KQ4 A;  3M3Y K;  3H0G C;  3ERE D;  4KB4 A;  2E2I C;  4A3J C;  3HOW K;  4C3H C;  5IOS A;  4KDD A;  3GTG A;  2R92 A;  1PJ6 A;  2PPB A;  4A3C K;  4A3E K;  3M4O C;  3S2H C;  1F93 A;  2JA8 K;  4XCH A;  5IP7 K;  4Y52 C;  3RZD K;  1IQ0 A;  1TWF C;  1G51 A;  3GTL C;  2E2H A;  4G0W A;  4AH6 A;  3GDZ A;  1XXA A;  3EQL A;  3Q3Q A;  3I4N K;  4OIO A;  4QIW L;  1YNJ A;  1I50 A;  4A3D K;  5FLM C;  4A3F C;  3GEI A;  2B63 K;  2NVX K;  1TWF A;  4XSX A;  2A6E A;  1ZQ1 C;  3HOX K;  3HOV C;  5IYB C;  4G0U A;  3S14 K;  2R7Z C;  3CQZ K;  1IE0 A;  4G7Z A;  1BS2 A;  3MML B;  1XXC A;  4QIW D;  3GTK K;  4A3B C;  4BBS K;  1ZVU A;  2GSO A;  4A3D C;  2FQT A;  3L4K A;  1INN A;  4MQ9 A;  5EGE A;  5C44 C;  2VUM C;  4OIN A;  4Q5S A;  4KC6 A;  1BJT A;  4A3I K;  1TWH K;  4BLA A;  4Y52 K;  4LK0 A;  2JA8 C;  5IYD K;  3AH5 A;  2PMZ L;  1K83 C;  3DXJ A;  4LR2 A;  2JA5 C;  4X6A C;  3SZZ A;  1WCM A;  1TWH C;  5CHP A;  3PO2 C;  5C44 K;  2VUM K;  2NVQ C;  2JA7 K;  1USM A;  3GTO C;  5E68 A;  2WB1 D;  4Y7N K;  5IYD C;  3GTG C;  5M5Y K;  1VLO A;  1B4A A;  1VGX A;  2O5I A;  1BGW A;  4C2M K;  1IS1 A;  3AD7 C;  1EH1 A;  1V5V A;  3S2D C;  2FQO A;  3FKI A;  5IOT A;  1O2F B;  1Y1V C;  1TWG A;  3I4M C;  3HOX C;  3HOV K;  1I3Q K;  1TWC C;  5M5X K;  1JOE A;  3GEE A;  3H3V L;  4A3B K;  4BBS C;  3S1Q C;  1TWG C;  1O25 A;  1TWG K;  2A6H A;  5EGH A;  4KN7 A;  3GTQ K;  1I3Q C;  2PA8 D;  2BE5 A;  3BP8 C;  1Y1V K;  3GTJ A;  3LAP A;  3A8I A;  4A3F K;  3TFJ A;  1J6V A;  3LAJ A;  4A93 K;  2GSN A;  2JA7 C;  3T00 A;  3IPJ A;  1EI6 A;  1WSR A;  3L4J A;  1Y1W C;  2RGR A;  3HOY K;  2JA6 A;  5C4X K;  4J3N A;  4O2D A;  4XLP A;  3S2H K;  3OPF A;  2NVY A;  4A3M K;  1J6W A;  5M3F K;  4BLB A;  3HOW C;  2JH3 A;  4BXX C;  3GTP A;  2PA8 L;  3BUE A;  3N0B A;  4BY1 K;  3GTO A;  1O2A A;  1I6H C;  4YFN A;  5HL8 A;  3GTJ C;  3GSI A;  1SFO A;  4A3J K;  1F7U A;  2JA6 K;  1R9T A;  2JA5 A;  3CQZ A;  2ZUF A;  3H0G K;  1XZQ A;  1SMY A;  4MEY A;  5M3M K;  1I6V A;  4BY1 C;  3AQO A;  5C3E K;  2R7Z K;  2NVT K;  2NVY K;  4KN4 A;  4A3L C;  5IYC K;  3RZO C;  3S1M C;  3HOU K;  2XCQ A;  3GTP K;  4A3M C;  3T01 A;  1WQG A;  4PAA A;  2E2H C;  5IOQ A;  2P5M A;  1O28 A;  5FJ8 K;  4P9S A;  5D4D A;  1VRQ C;  3S1R K;  3S15 K;  3NUH A;  4OIR A;  1XPP A;  1WOS A;  4C3J C;  3GIR A;  3ORE A;  4FM9 A;  3S16 C;  4OIP A;  1TWA K;  2R92 K;  3RZO K;  4GTL A;  1ZBS A;  1BDF A;  1ZXO A;  2E2I A;  2NVX A;  3S1Q K;  1WCM K;  4Q4Z A;  5IOR A;  4GTE A;  5IYC C;  4C3I K;  2E2I K;  3H3V D;  1RU0 A;  2W7V A;  2Y0S L;  5C3E C;  4BBR C;  4WJ4 A;  3HOZ K;  4KM8 A;  4A3G K;  5C4J K;  1DCP A;  5C4J C;  4QJV A;  1WQH A;  3GTM C;  3FKI K;  2A68 A;  3TTG A;  4BBR K;  3S1N K;  2R7Z A;  4Y7N C;  3VA7 A;  2WB1 L;  3PO3 C;  2CFA B;  1R9T K;  2ZUE A;  4X6A K;  1Y1W K;  4BXX K;  1J6X A;  2WAQ L;  2EBB A;  3GTL A;  4KAR A;  1Y1V A;  4MEX A;  2ZFZ A;  4LQY A;  3K7A C;  2PMZ D;  4LK1 A;  1DCO A;  2O5J A;  2WAQ D;  4OIQ A;  2GSU A;  3GTK A;  1SFO C;  1F7V A;  1WOR A;  3CAG A;  3GEH A;  3G4A A;  3GTK C;  1DCH A;  3SZY A;  3GTP C;  4KB2 A;  3S14 C;  1JQW A;  1EK8 A;  2NVY C;  1WSV A;  3AD9 C;  1PJ7 A;  1O2B A;  4JK1 A;  1XXB A;  2Y0S D;  4ZH4 A;  3GTG K;  3FOF A;  4GZY A;  3I4N C;  4ILD A;  2NVQ K;  1IBA A;  4C45 A;  1I6H K;  1TWF K;  1WOO A;  3K7A K;  5IP9 C;  4A3K K;  1O24 A;  1VJE A;  2P8T A;  4G7O A;  3GTO K;  4BY7 K;  4GTB A;  4BKW A;  4A3C C;  1USO A;  4XLN A;  2PHC B;  2V6S A;  4XSZ A;  3QX3 A;  1GE9 A;  2D6F C;  2JA5 K;  1O26 A;  4AYB L;  4KMH A;  2E2J K;  2CW0 A;  3A8K A;  1YCL A;  1TWA A;  4GTF A;  4C3H K;  4BY7 C;  4A93 C;  3WOD A;  4WJ3 M;  1PJ5 A;  3AD8 C;  1B4B A;  4KAS A;  3ADA C;  5IP9 K;  3M3Y C;  4P5B A;  4RMF A;  3FOE A;  4A3I C;  4A3G C;  2B63 A;  3CQZ C;  1IW7 A;  3HKZ L;  4LLG A;  4C3I C;  3GTM A;  1WOP A;  4YFX A;  3GTQ C;  1TWH A;  1WCM C;  4NOI A;  1WIH A;  5L46 A;  3BP3 A;  5JVO A;  3T02 A;  1J98 A;  3S17 K;  5CJ9 A;  4KM9 A;  1C0A A;  3I4M K;  2RH6 A;  1O29 A;  2NVX C;  3HKZ D;  1EQR A;  3H0G A;  4C2M C;  1IL2 A;  1YX2 A;  5FLM K;  4C3J K;  2VUM A;  2YU9 C;  1SFO K;  2A69 A;  3S1R C;  1L0W A;  3PO2 K;  2GAG C;  2E2J C;  2R93 C;  3TFH A;  4GTC A;  3RZD C;  3HXA A;  5IP7 C;  1R9T C;  4AYB D;  3PO3 K;  2V6U A;  1XZP B;  4KMU A;  1O27 A;  4GTD A;  4GTA A;  4LJZ A;  1K83 K;  4A3E C;  3M4O K;  3S1M K;  3G4C A;  4A3L K;  2YU9 A;  2NVT C;  4A3K C;  4FZB A;  3OEP A;  4LOW A;  3FHZ A;  3S1N C;  4G7H A;  3V4G A;  1DD5 A; 
#chains in the Genus database with same CATH homology
 1I6H C;  4YFN A;  2B63 K;  3GTP C;  3GTJ C;  3HOZ C;  4A3J K;  2NVX K;  4XSX A;  2JA6 K;  3S14 C;  2A6E A;  5TMC A;  5M5W K;  2NVY C;  3HOX K;  5IYB C;  2JA6 C;  3HOV K;  3HOV C;  2R7Z C;  1HQM A;  3H0G K;  3CQZ K;  3S14 K;  3FKI C;  1I50 K;  3GTJ K;  1SMY A;  4MEY A;  4G7Z A;  5M3M K;  4JK1 A;  4QIW D;  1I6V A;  3GTK K;  2Y0S D;  4A3B C;  4BY1 C;  4BBS K;  4A3D C;  5C3E K;  4ZH4 A;  2R7Z K;  2NVT K;  5IYB K;  2NVY K;  4KN4 A;  3GTG K;  4GZY A;  3I4N C;  4MQ9 A;  5IYC K;  3RZO C;  3S1M C;  4A3L C;  3HOU K;  2NVQ K;  5C44 C;  2VUM C;  4OIN A;  3GTP K;  2R92 C;  4A3M C;  2B63 C;  4Q5S A;  4A3I K;  1I6H K;  1TWH K;  1TWF K;  2E2H C;  3K7A K;  4Y52 K;  5C4X C;  5IP9 C;  4A3K K;  4LK0 A;  2JA8 C;  5FJ8 K;  2R93 K;  5IYD K;  3HOY C;  5D4D A;  2PMZ L;  4G7O A;  1ZYR A;  3GTO K;  3S15 C;  4YFK A;  4BY7 K;  1K83 C;  3DXJ A;  3S1R K;  3S15 K;  1YNN A;  4A3C C;  4OIR A;  3GTL K;  1TWA C;  1XPP A;  2YU9 K;  4XLN A;  3S16 K;  4XSZ A;  2JA5 C;  4X6A C;  2E2H K;  2JA5 K;  3S16 C;  1TWH C;  4OIP A;  4AYB L;  2E2J K;  1TWA K;  2R92 K;  2CW0 A;  4C3H K;  3PO2 C;  5C44 K;  2VUM K;  2NVQ C;  2JA7 K;  4BY7 C;  3HOU C;  3GTO C;  4A93 C;  3WOD A;  3RZO K;  4Y7N K;  2WB1 D;  5IYD C;  3GTG C;  1BDF A;  5M5Y K;  5IP9 K;  3M3Y C;  2O5I A;  4A3G K;  3S17 C;  4C2M K;  4A3I C;  3S1Q K;  3S2D C;  4A3G C;  1WCM K;  4Q4Z A;  3CQZ C;  1Y1V C;  1IW7 A;  3GTK C;  3I4M C;  3HOX C;  5IYC C;  1TWC K;  1I3Q K;  1TWC C;  3HKZ L;  4LLG A;  4C3I K;  5M5X K;  2E2I K;  4YG2 A;  4YFX A;  3H3V D;  3GTQ C;  2Y0S L;  5C3E C;  4BBR C;  1WCM C;  4NOI A;  3HOZ K;  3H3V L;  3GTM K;  4A3B K;  3S2D K;  5TMF A;  3S1Q C;  4BBS C;  4QJV B;  1TWG C;  2A6H A;  1TWG K;  5C4J K;  5C4J C;  4QJV A;  3GTM C;  3S17 K;  1I50 C;  3FKI K;  2A68 A;  4BBR K;  3M3Y K;  3H0G C;  4KN7 A;  3GTQ K;  3S1N K;  2E2I C;  1I3Q C;  4Y7N C;  2PA8 D;  3I4M K;  2BE5 A;  1Y1V K;  4A3J C;  2NVX C;  3HKZ D;  3HOW K;  2WB1 L;  4A3F K;  3PO3 C;  5FLM K;  1R9T K;  4C3J K;  4X6A K;  2YU9 C;  1SFO K;  1Y1W K;  2A69 A;  4A93 K;  4BXX K;  2PPB A;  3S1R C;  2JA7 C;  4A3C K;  2WAQ L;  3PO2 K;  4A3E K;  3M4O C;  1Y1W C;  2E2J C;  3HOY K;  3S2H C;  2JA8 K;  2R93 C;  4MEX A;  3RZD C;  5C4X K;  5IP7 C;  1R9T C;  4AYB D;  3K7A C;  4Y52 C;  5IP7 K;  3RZD K;  2PMZ D;  3PO3 K;  1TWF C;  4LK1 A;  4XLP A;  4KMU A;  3S2H K;  2O5J A;  2WAQ D;  4A3M K;  3GTL C;  4OIQ A;  4LJZ A;  5M3F K;  1K83 K;  4A3E C;  3HOW C;  3M4O K;  4BXX C;  3EQL A;  3S1M K;  1SFO C;  3I4N K;  4A3L K;  2PA8 L;  4OIO A;  4QIW L;  1YNJ A;  4A3K C;  2NVT C;  3S1N C;  4A3D K;  5FLM C;  4BY1 K;  4G7H A;  4A3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...