2PMZL

Archaeal rna polymerase from sulfolobus solfataricus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A
publication title The X-ray crystal structure of RNA polymerase from Archaea
pubmed doi rcsb
molecule tags Translation, transferase
total genus 20
structure length 92
sequence length 92
chains with identical sequence X
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2pmzL00
4LK1A 2JA6C 4A3IK 2NVXC 4Y52K 1IW7A 4QIWL 1TWAK 4Q4ZA 4A3CK 1TWCK 5TMFA 3M3YK 5C4JK 3S1NC 2E2JK 4YFNA 2R92C 4QIWD 3GTOC 5D4DA 4A3LC 5C4XC 3GTGK 3S15C 4X6AC 2JA7C 3S1QC 3H0GK 2PMZD 4A3FK 3I4NC 3S1RK 3I4MC 4A3DC 4C3HK 5IYBK 2JA5C 5C44K 3HOVK 4AYBD 1I6HK 3GTQC 4MEYA 3HOUC 4LJZA 2WB1L 3HOXC 1TWHK 5M5WK 3K7AK 4XSXA 3CQZK 1YNJA 2NVXK 2A6HA 1ZYRA 2WB1D 3M4OC 2YU9K 1TWFC 4A3JK 2O5IA 2WAQL 4KN4A 3RZDC 1TWGK 1SFOC 5TMCA 4G7OA 3GTPC 3PO2C 2R92K 3GTOK 2WAQD 5C3EK 2E2HK 3GTMC 3S14C 2R93C 1WCMC 1Y1WC 2R7ZC 3S15K 4A93C 4G7HA 3HOYC 3RZOC 5IP9K 3HKZL 3GTKC 4C2MK 2A69A 4BY7C 4NOIA 3I4MK 2NVYC 2VUMC 4C3JK 3HKZD 3S1MC 4BXXC 4A3GC 4A3EC 5IYDC 3GTJC 2NVTC 3S17C 2E2IC 4A3KK 4MQ9A 5FLMK 3HOUK 1R9TC 4OINA 3S16C 2O5JA 3HOXK 1I50C 3HOZC 5IP7C 2B63C 1Y1VK 1I3QC 4A3MK 2BE5A 2A68A 2NVQK 3S2DC 4YG2A 4BY1C 3S1QK 3RZDK 1SFOK 2JA8C 2JA6K 4YFXA 1XPPA 3GTLC 4JK1A 3HOWC 5IYCC 3PO3C 3GTPK 3PO2K 4A3BC 4YFKA 3S14K 2R93K 4A3IC 3S1NK 1WCMK 2R7ZK 3H3VL 4A93K 4Y52C 4BBSC 1SMYA 4LK0A 3RZOK 4QJVB 4A3LK 1TWAC 5M5XK 4BY7K 1TWCC 4OIOA 2PA8L 5C4XK 4Y7NC 5C4JC 3H3VD 3M3YC 3DXJA 4BBRC 5FJ8K 4KMUA 2JA7K 4X6AK 3S1MK 4BXXK 4Q5SA 4C3IK 5M3FK 3I4NK 3GTGC 2NVTK 5IYDK 3H0GC 1R9TK 4A3FC 4A3DK 1K83C 5IP7K 3S1RC 3HOZK 1I3QK 2JA5K 3GTQK 4LLGA 3WODA 3S2HC 4XLPA 5IYBC 3HOVC 4ZH4A 4GZYA 3GTLK 3FKIC 3PO3K 3M4OK 2A6EA 3K7AC 1TWFK 3CQZC 5M5YK 3EQLA 4BBSK 2YU9C 4A3JC 5M3MK 4OIQA 1TWGC 4Y7NK 3GTMK 1BDFA 1Y1WK 4BBRK 3HOYK 2PMZL 2E2HC 2Y0SL 5C3EC 4OIPA 3GTKK 4A3CC 4XSZA 2NVYK 2E2JC 2VUMK 5IP9C 4XLNA 4G7ZA 4A3GK 2Y0SD 1K83K 4A3EK 4OIRA 3GTJK 2PA8D 4AYBL 2E2IK 3S17K 3S16K 3S2HK 4MEXA 1YNNA 1I50K 1HQMA 2PPBA 4A3KC 2B63K 4QJVA 5FLMC 3S2DK 3FKIK 4BY1K 1Y1VC 4A3MC 5C44C 1I6HC 2NVQC 2JA8K 1I6VA 3HOWK 2CW0A 4KN7A 5IYCK 4A3BK 1TWHC
chains in the Genus database with same CATH superfamily
3G4CA 2ZUFA 3GEIA 2NVXC 3T02A 3HXAA 2W7VA 2V6TA 3FOFA 2E2JK 4YFNA 3S15C 1WOOA 1JVIA 3H0GK 4KM9A 2PMZD 1PJ5A 3I4NC 3S1RK 1XXBA 1PJ7A 4KMHA 4A3DC 1O25A 4LOWA 1EI6A 3HOVK 4GFQA 4GTBA 1DD5A 1F7UA 5L46A 1WQFA 1ZYRA 2EBBA 2O5IA 3RZDC 5TMCA 4KASA 3GTPC 5C3EK 2PHCB 3S14C 1DCPA 4G7HA 1USMA 4NOIA 3LAPA 3I4MK 1IE0A 2VUMC 1O27A 1INNA 3HKZD 3S1MC 4A3EC 5IYDC 2NVTC 2E2IC 4A3KK 2R92A 3GTOA 1JQWA 4OINA 3HOZC 4A3MK 5IOSA 4YG2A 3A8KA 5HL8A 3FOEA 1XPPA 3GTLC 4YFKA 4A3IC 3GSIA 3BP3A 3H3VL 4BBSC 1SMYA 1TWAC 1TWCC 5C4XK 3LAJA 3M3YC 3SZZA 1IL2A 3MMLB 1R9TK 2R7ZA 1IQ0A 4A3FC 1K83C 5EGHA 1I3QK 2JA5K 1J6WA 3TFIA 1DCHA 3M4OK 2A6EA 4FZBA 5TJ3A 2RGRA 3GTQA 1GE9A 4OIQA 1BDFA 2XCQA 4O2DA 2PMZL 4KATA 4XSZA 3T01A 5IP9C 4C2MC 3L4KA 2Y0SD 4A3GK 2PA8D 4C3JC 3GTMA 4KAWX 1Y1WA 1HQMA 3T00A 5FLMC 3FKIK 4BY1K 2ZFZA 1I6HC 1BS2A 2NVQC 1I6VA 4KN7A 4A3BK 3S1QC 3ERED 4LK1A 2CFAA 4KC6A 4QIWL 4Q4ZA 4A3CK 2XCOA 4WILA 3S1NC 3L4JA 5C4JK 2Y3PA 2YU9A 4X6AC 2JA7C 3A8IA 4C3IC 1J98A 1G51A 4KMDA 4KB2A 3GTQC 4MEYA 4LJZA 2GSUA 2WB1L 1TWHK 1UV7A 3K7AK 5M5WK 1EFWA 1YNJA 2NVXK 4GT9A 1B4AA 2YU9K 2WAQL 3AH5A 1SFOC 4G7OA 1C0AA 2R93C 3GTMC 1WCMC 1Y1WC 3AQPA 1O24A 4J3NA 3S15K 4A93C 3OEPA 3HOYC 2JA6A 3GTKC 4KDDA 4BY7C 4KMAA 3S17C 2FQOA 5JFEA 4GTLA 5IP7C 2B63C 2D6FC 4GTEA 2A68A 1HI9A 4GTAA 3RZDK 2JA8C 2JA6K 4JK1A 3PO3C 3GTPK 2FQTA 3OREA 3S14K 2RH6A 1O29A 5JVOA 4A3LK 1XZPB 4OIOA 4Y7NC 1EH1A 2PA8L 1VJEA 3S1MK 3N3YA 3BP8C 5M3FK 5IYDK 2NVTK 3H0GC 4G0UA 4BKWA 4FM9A 3S1RC 3HOZK 4LLGA 3S2HC 3HOVC 4ZH4A 3GTLK 3GTJA 1ISEA 5CJ9A 1TWFK 1O2AA 1R9TA 3S0XA 5M5YK 3EQLA 4BBSK 1I3QA 2JA5A 5IORA 5M3MK 3VA7A 3GEHA 5C3EC 4OIPA 2NVYK 4GTCA 1K83K 3GTJK 1ZBSA 3S16K 1O2FB 1VH2A 1I50K 1YNNA 1L0WA 4A3KC 3S2DK 4A3MC 2GSNA 5C44C 3HOWK 2CW0A 1VRQC 5IYCK 1WQGA 3BUEA 4Y52K 3FKIA 1O28A 5TMFA 3CQZA 2R92C 3GTOC 5D4DA 4DDQA 5C4XC 3GTGK 1TWGA 1J6VA 4C3HK 5IYBK 2JA5C 4AYBD 1I6HK 3HOUC 3JSTA 1WORA 3HOXC 3FHZA 2XCRB 3CQZK 4AH6A 4KM8A 1ZQ1C 3M4OC 1WSVA 4LQYA 4A3JK 1TWGK 3Q3QA 1Y1VA 3PO2C 1IBAA 1ZXOA 2E2HK 3V4GA 1TWHA 2R7ZC 3RZOC 2NVXA 3HKZL 3GEEA 1IS1A 3GIRA 4BLAA 1XZQB 2GAGC 4BXXC 4A3GC 2GAHC 2V6UA 4WJ3M 2O5JA 1Y1VK 3LPXA 4BY1C 1SFOK 2P5MA 1EK8A 4A3BC 3N0BA 2R93K 4PABA 1WCMK 4A93K 3TTGA 4LK0A 4QJVB 2JH3A 5M5XK 4BY7K 5C4JC 3H3VD 1XXCA 3DXJA 4BBRC 1PJ6A 4Q5SA 3I4NK 3GTPA 2GSOA 3QX3A 4A3DK 1XXAA 5IP7K 1VGXA 1O2BA 4XLPA 2ZUEA 3GDZA 3TFHA 4GZYA 2E2IA 1YX2A 3PO3K 3CAGA 3K7AC 3TFJA 1JOEA 1V5VA 2YU9C 4KB4A 4Y7NK 1J6XA 3GTLA 2Y0SL 1TWFA 2E2JC 2VUMK 4G7ZA 1WOPA 4A3EK 1F93A 4OIRA 4AYBL 2E2IK 1TWAA 1TWCA 3S2HK 4MEXA 1EQRA 1WOSA 2PPBA 1F9NA 1XZPA 3G4AA 1KQ4A 2NVYA 3AQOA 1K83A 1RU0A 1AB4A 4WJ4A 4P5AA 1B4BA 1BGWA 3AD8C 4A3IK 2KWAA 1I50A 2JA6C 1IW7A 3N0CA 5E68A 1TWAK 1TWCK 3M3YK 4BLBA 4A3LC 4QIWD 4G0WA 4A3FK 3I4MC 3AD9C 5EGEA 4GTDA 5C44K 4LR2A 1WSRA 3GTGA 1DCOA 1WIHA 5CHPA 4XSXA 2A6HA 2WB1D 1TWFC 4KN4A 2V6SA 2R92K 3GTOK 2WAQD 4RMFA 4C45A 4KARA 1VLOA 5IP9K 4C2MK 2A69A 3NUHA 1YCLA 1ZVUA 4XCHA 2NVYC 4C3JK 3GTJC 4P5BA 4MQ9A 2E2HA 5FLMK 3HOUK 1R9TC 3S16C 3HOXK 1I50C 2JA7A 1I3QC 2BE5A 3S2DC 2NVQK 3ADAC 3S1QK 4YFXA 3HOWC 4M1XA 5IYCC 3AD7C 3PO2K 1WQHA 3S1NK 2R7ZK 4Y52C 3RZOK 4PAAA 4X6AK 1X31C 2P8TA 5FJ8K 2JA7K 4KMUA 1SFOA 4BXXK 4C3IK 3GTGC 1USOA 2R93A 1WCMA 5IOQA 2CFAB 3GTKA 3GTQK 1O26A 3WODA 4C3HC 5IYBC 3FKIC 1F7VA 3SZYA 1XZQA 3CQZC 1BJTA 2B63A 4A3JC 1TWGC 3GTMK 1Y1WK 4BBRK 3HOYK 4P9SA 2E2HC 3GTKK 4A3CC 3A8JA 5IOTA 4XLNA 3OPFA 3S17K 3IPJA 2B63K 4QJVA 4G0VA 2VUMA 1Y1VC 3H0GA 4ILDA 2JA8K 1TWHC 4GTFA
chains in the Genus database with same CATH topology
4LK1A 2JA6C 4A3IK 2NVXC 4Y52K 1IW7A 4QIWL 1TWAK 4Q4ZA 4A3CK 1TWCK 5TMFA 3M3YK 5C4JK 3S1NC 2E2JK 4YFNA 2R92C 4QIWD 3GTOC 5D4DA 4A3LC 5C4XC 3GTGK 3S15C 4X6AC 2JA7C 3S1QC 3H0GK 2PMZD 4A3FK 3I4NC 3S1RK 3I4MC 4A3DC 4C3HK 5IYBK 2JA5C 5C44K 3HOVK 4AYBD 1I6HK 3GTQC 4MEYA 3HOUC 4LJZA 2WB1L 3HOXC 1TWHK 5M5WK 3K7AK 4XSXA 3CQZK 1YNJA 2NVXK 2A6HA 1ZYRA 2WB1D 3M4OC 2YU9K 1TWFC 4A3JK 2O5IA 2WAQL 4KN4A 3RZDC 1TWGK 1SFOC 5TMCA 4G7OA 3GTPC 3PO2C 2R92K 3GTOK 2WAQD 5C3EK 2E2HK 3GTMC 3S14C 2R93C 1WCMC 1Y1WC 2R7ZC 3S15K 4A93C 4G7HA 3HOYC 3RZOC 5IP9K 3HKZL 3GTKC 4C2MK 2A69A 4BY7C 4NOIA 3I4MK 2NVYC 2VUMC 4C3JK 3HKZD 3S1MC 4BXXC 4A3GC 4A3EC 5IYDC 3GTJC 2NVTC 3S17C 2E2IC 4A3KK 4MQ9A 5FLMK 3HOUK 1R9TC 4OINA 3S16C 2O5JA 3HOXK 1I50C 3HOZC 5IP7C 2B63C 1Y1VK 1I3QC 4A3MK 2BE5A 2A68A 2NVQK 3S2DC 4YG2A 4BY1C 3S1QK 3RZDK 1SFOK 2JA8C 2JA6K 4YFXA 1XPPA 3GTLC 4JK1A 3HOWC 5IYCC 3PO3C 3GTPK 3PO2K 4A3BC 4YFKA 3S14K 2R93K 4A3IC 3S1NK 1WCMK 2R7ZK 3H3VL 4A93K 4Y52C 4BBSC 1SMYA 4LK0A 3RZOK 4QJVB 4A3LK 1TWAC 5M5XK 4BY7K 1TWCC 4OIOA 2PA8L 5C4XK 4Y7NC 5C4JC 3H3VD 3M3YC 3DXJA 4BBRC 5FJ8K 4KMUA 2JA7K 4X6AK 3S1MK 4BXXK 4Q5SA 4C3IK 5M3FK 3I4NK 3GTGC 2NVTK 5IYDK 3H0GC 1R9TK 4A3FC 4A3DK 1K83C 5IP7K 3S1RC 3HOZK 1I3QK 2JA5K 3GTQK 4LLGA 3WODA 3S2HC 4XLPA 5IYBC 3HOVC 4ZH4A 4GZYA 3GTLK 3FKIC 3PO3K 3M4OK 2A6EA 3K7AC 1TWFK 3CQZC 5M5YK 3EQLA 4BBSK 2YU9C 4A3JC 5M3MK 4OIQA 1TWGC 4Y7NK 3GTMK 1BDFA 1Y1WK 4BBRK 3HOYK 2PMZL 2E2HC 2Y0SL 5C3EC 4OIPA 3GTKK 4A3CC 4XSZA 2NVYK 2E2JC 2VUMK 5IP9C 4XLNA 4G7ZA 4A3GK 2Y0SD 1K83K 4A3EK 4OIRA 3GTJK 2PA8D 4AYBL 2E2IK 3S17K 3S16K 3S2HK 4MEXA 1YNNA 1I50K 1HQMA 2PPBA 4A3KC 2B63K 4QJVA 5FLMC 3S2DK 3FKIK 4BY1K 1Y1VC 4A3MC 5C44C 1I6HC 2NVQC 2JA8K 1I6VA 3HOWK 2CW0A 4KN7A 5IYCK 4A3BK 1TWHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK1 A;  2JA6 C;  4A3I K;  2NVX C;  4Y52 K;  1IW7 A;  4QIW L;  1TWA K;  4Q4Z A;  4A3C K;  1TWC K;  5TMF A;  3M3Y K;  5C4J K;  3S1N C;  2E2J K;  4YFN A;  2R92 C;  4QIW D;  3GTO C;  5D4D A;  4A3L C;  5C4X C;  3GTG K;  3S15 C;  4X6A C;  2JA7 C;  3S1Q C;  3H0G K;  2PMZ D;  4A3F K;  3I4N C;  3S1R K;  3I4M C;  4A3D C;  4C3H K;  5IYB K;  2JA5 C;  5C44 K;  3HOV K;  4AYB D;  1I6H K;  3GTQ C;  4MEY A;  3HOU C;  4LJZ A;  2WB1 L;  3HOX C;  1TWH K;  5M5W K;  3K7A K;  4XSX A;  3CQZ K;  1YNJ A;  2NVX K;  2A6H A;  1ZYR A;  2WB1 D;  3M4O C;  2YU9 K;  1TWF C;  4A3J K;  2O5I A;  2WAQ L;  4KN4 A;  3RZD C;  1TWG K;  1SFO C;  5TMC A;  4G7O A;  3GTP C;  3PO2 C;  2R92 K;  3GTO K;  2WAQ D;  5C3E K;  2E2H K;  3GTM C;  3S14 C;  2R93 C;  1WCM C;  1Y1W C;  2R7Z C;  3S15 K;  4A93 C;  4G7H A;  3HOY C;  3RZO C;  5IP9 K;  3HKZ L;  3GTK C;  4C2M K;  2A69 A;  4BY7 C;  4NOI A;  3I4M K;  2NVY C;  2VUM C;  4C3J K;  3HKZ D;  3S1M C;  4BXX C;  4A3G C;  4A3E C;  5IYD C;  3GTJ C;  2NVT C;  3S17 C;  2E2I C;  4A3K K;  4MQ9 A;  5FLM K;  3HOU K;  1R9T C;  4OIN A;  3S16 C;  2O5J A;  3HOX K;  1I50 C;  3HOZ C;  5IP7 C;  2B63 C;  1Y1V K;  1I3Q C;  4A3M K;  2BE5 A;  2A68 A;  2NVQ K;  3S2D C;  4YG2 A;  4BY1 C;  3S1Q K;  3RZD K;  1SFO K;  2JA8 C;  2JA6 K;  4YFX A;  1XPP A;  3GTL C;  4JK1 A;  3HOW C;  5IYC C;  3PO3 C;  3GTP K;  3PO2 K;  4A3B C;  4YFK A;  3S14 K;  2R93 K;  4A3I C;  3S1N K;  1WCM K;  2R7Z K;  3H3V L;  4A93 K;  4Y52 C;  4BBS C;  1SMY A;  4LK0 A;  3RZO K;  4QJV B;  4A3L K;  1TWA C;  5M5X K;  4BY7 K;  1TWC C;  4OIO A;  2PA8 L;  5C4X K;  4Y7N C;  5C4J C;  3H3V D;  3M3Y C;  3DXJ A;  4BBR C;  5FJ8 K;  4KMU A;  2JA7 K;  4X6A K;  3S1M K;  4BXX K;  4Q5S A;  4C3I K;  5M3F K;  3I4N K;  3GTG C;  2NVT K;  5IYD K;  3H0G C;  1R9T K;  4A3F C;  4A3D K;  1K83 C;  5IP7 K;  3S1R C;  3HOZ K;  1I3Q K;  2JA5 K;  3GTQ K;  4LLG A;  3WOD A;  3S2H C;  4XLP A;  5IYB C;  3HOV C;  4ZH4 A;  4GZY A;  3GTL K;  3FKI C;  3PO3 K;  3M4O K;  2A6E A;  3K7A C;  1TWF K;  3CQZ C;  5M5Y K;  3EQL A;  4BBS K;  2YU9 C;  4A3J C;  5M3M K;  4OIQ A;  1TWG C;  4Y7N K;  3GTM K;  1BDF A;  1Y1W K;  4BBR K;  3HOY K;  2PMZ L;  2E2H C;  2Y0S L;  5C3E C;  4OIP A;  3GTK K;  4A3C C;  4XSZ A;  2NVY K;  2E2J C;  2VUM K;  5IP9 C;  4XLN A;  4G7Z A;  4A3G K;  2Y0S D;  1K83 K;  4A3E K;  4OIR A;  3GTJ K;  2PA8 D;  4AYB L;  2E2I K;  3S17 K;  3S16 K;  3S2H K;  4MEX A;  1YNN A;  1I50 K;  1HQM A;  2PPB A;  4A3K C;  2B63 K;  4QJV A;  5FLM C;  3S2D K;  3FKI K;  4BY1 K;  1Y1V C;  4A3M C;  5C44 C;  1I6H C;  2NVQ C;  2JA8 K;  1I6V A;  3HOW K;  2CW0 A;  4KN7 A;  5IYC K;  4A3B K;  1TWH C; 
#chains in the Genus database with same CATH topology
 3G4C A;  2ZUF A;  3GEI A;  2NVX C;  3T02 A;  3HXA A;  2W7V A;  2V6T A;  3FOF A;  2E2J K;  4YFN A;  3S15 C;  1WOO A;  1JVI A;  3H0G K;  4KM9 A;  2PMZ D;  1PJ5 A;  3I4N C;  3S1R K;  1XXB A;  1PJ7 A;  4KMH A;  4A3D C;  1O25 A;  4LOW A;  1EI6 A;  3HOV K;  4GFQ A;  4GTB A;  1DD5 A;  1F7U A;  5L46 A;  1WQF A;  1ZYR A;  2EBB A;  2O5I A;  3RZD C;  5TMC A;  4KAS A;  3GTP C;  5C3E K;  2PHC B;  3S14 C;  1DCP A;  4G7H A;  1USM A;  4NOI A;  3LAP A;  3I4M K;  1IE0 A;  2VUM C;  1O27 A;  1INN A;  3HKZ D;  3S1M C;  4A3E C;  5IYD C;  2NVT C;  2E2I C;  4A3K K;  2R92 A;  3GTO A;  1JQW A;  4OIN A;  3HOZ C;  4A3M K;  5IOS A;  4YG2 A;  3A8K A;  5HL8 A;  3FOE A;  1XPP A;  3GTL C;  4YFK A;  4A3I C;  3GSI A;  3BP3 A;  3H3V L;  4BBS C;  1SMY A;  1TWA C;  1TWC C;  5C4X K;  3LAJ A;  3M3Y C;  3SZZ A;  1IL2 A;  3MML B;  1R9T K;  2R7Z A;  1IQ0 A;  4A3F C;  1K83 C;  5EGH A;  1I3Q K;  2JA5 K;  1J6W A;  3TFI A;  1DCH A;  3M4O K;  2A6E A;  4FZB A;  5TJ3 A;  2RGR A;  3GTQ A;  1GE9 A;  4OIQ A;  1BDF A;  2XCQ A;  4O2D A;  2PMZ L;  4KAT A;  4XSZ A;  3T01 A;  5IP9 C;  4C2M C;  3L4K A;  2Y0S D;  4A3G K;  2PA8 D;  4C3J C;  3GTM A;  4KAW X;  1Y1W A;  1HQM A;  3T00 A;  5FLM C;  3FKI K;  4BY1 K;  2ZFZ A;  1I6H C;  1BS2 A;  2NVQ C;  1I6V A;  4KN7 A;  4A3B K;  3S1Q C;  3ERE D;  4LK1 A;  2CFA A;  4KC6 A;  4QIW L;  4Q4Z A;  4A3C K;  2XCO A;  4WIL A;  3S1N C;  3L4J A;  5C4J K;  2Y3P A;  2YU9 A;  4X6A C;  2JA7 C;  3A8I A;  4C3I C;  1J98 A;  1G51 A;  4KMD A;  4KB2 A;  3GTQ C;  4MEY A;  4LJZ A;  2GSU A;  2WB1 L;  1TWH K;  1UV7 A;  3K7A K;  5M5W K;  1EFW A;  1YNJ A;  2NVX K;  4GT9 A;  1B4A A;  2YU9 K;  2WAQ L;  3AH5 A;  1SFO C;  4G7O A;  1C0A A;  2R93 C;  3GTM C;  1WCM C;  1Y1W C;  3AQP A;  1O24 A;  4J3N A;  3S15 K;  4A93 C;  3OEP A;  3HOY C;  2JA6 A;  3GTK C;  4KDD A;  4BY7 C;  4KMA A;  3S17 C;  2FQO A;  5JFE A;  4GTL A;  5IP7 C;  2B63 C;  2D6F C;  4GTE A;  2A68 A;  1HI9 A;  4GTA A;  3RZD K;  2JA8 C;  2JA6 K;  4JK1 A;  3PO3 C;  3GTP K;  2FQT A;  3ORE A;  3S14 K;  2RH6 A;  1O29 A;  5JVO A;  4A3L K;  1XZP B;  4OIO A;  4Y7N C;  1EH1 A;  2PA8 L;  1VJE A;  3S1M K;  3N3Y A;  3BP8 C;  5M3F K;  5IYD K;  2NVT K;  3H0G C;  4G0U A;  4BKW A;  4FM9 A;  3S1R C;  3HOZ K;  4LLG A;  3S2H C;  3HOV C;  4ZH4 A;  3GTL K;  3GTJ A;  1ISE A;  5CJ9 A;  1TWF K;  1O2A A;  1R9T A;  3S0X A;  5M5Y K;  3EQL A;  4BBS K;  1I3Q A;  2JA5 A;  5IOR A;  5M3M K;  3VA7 A;  3GEH A;  5C3E C;  4OIP A;  2NVY K;  4GTC A;  1K83 K;  3GTJ K;  1ZBS A;  3S16 K;  1O2F B;  1VH2 A;  1I50 K;  1YNN A;  1L0W A;  4A3K C;  3S2D K;  4A3M C;  2GSN A;  5C44 C;  3HOW K;  2CW0 A;  1VRQ C;  5IYC K;  1WQG A;  3BUE A;  4Y52 K;  3FKI A;  1O28 A;  5TMF A;  3CQZ A;  2R92 C;  3GTO C;  5D4D A;  4DDQ A;  5C4X C;  3GTG K;  1TWG A;  1J6V A;  4C3H K;  5IYB K;  2JA5 C;  4AYB D;  1I6H K;  3HOU C;  3JST A;  1WOR A;  3HOX C;  3FHZ A;  2XCR B;  3CQZ K;  4AH6 A;  4KM8 A;  1ZQ1 C;  3M4O C;  1WSV A;  4LQY A;  4A3J K;  1TWG K;  3Q3Q A;  1Y1V A;  3PO2 C;  1IBA A;  1ZXO A;  2E2H K;  3V4G A;  1TWH A;  2R7Z C;  3RZO C;  2NVX A;  3HKZ L;  3GEE A;  1IS1 A;  3GIR A;  4BLA A;  1XZQ B;  2GAG C;  4BXX C;  4A3G C;  2GAH C;  2V6U A;  4WJ3 M;  2O5J A;  1Y1V K;  3LPX A;  4BY1 C;  1SFO K;  2P5M A;  1EK8 A;  4A3B C;  3N0B A;  2R93 K;  4PAB A;  1WCM K;  4A93 K;  3TTG A;  4LK0 A;  4QJV B;  2JH3 A;  5M5X K;  4BY7 K;  5C4J C;  3H3V D;  1XXC A;  3DXJ A;  4BBR C;  1PJ6 A;  4Q5S A;  3I4N K;  3GTP A;  2GSO A;  3QX3 A;  4A3D K;  1XXA A;  5IP7 K;  1VGX A;  1O2B A;  4XLP A;  2ZUE A;  3GDZ A;  3TFH A;  4GZY A;  2E2I A;  1YX2 A;  3PO3 K;  3CAG A;  3K7A C;  3TFJ A;  1JOE A;  1V5V A;  2YU9 C;  4KB4 A;  4Y7N K;  1J6X A;  3GTL A;  2Y0S L;  1TWF A;  2E2J C;  2VUM K;  4G7Z A;  1WOP A;  4A3E K;  1F93 A;  4OIR A;  4AYB L;  2E2I K;  1TWA A;  1TWC A;  3S2H K;  4MEX A;  1EQR A;  1WOS A;  2PPB A;  1F9N A;  1XZP A;  3G4A A;  1KQ4 A;  2NVY A;  3AQO A;  1K83 A;  1RU0 A;  1AB4 A;  4WJ4 A;  4P5A A;  1B4B A;  1BGW A;  3AD8 C;  4A3I K;  2KWA A;  1I50 A;  2JA6 C;  1IW7 A;  3N0C A;  5E68 A;  1TWA K;  1TWC K;  3M3Y K;  4BLB A;  4A3L C;  4QIW D;  4G0W A;  4A3F K;  3I4M C;  3AD9 C;  5EGE A;  4GTD A;  5C44 K;  4LR2 A;  1WSR A;  3GTG A;  1DCO A;  1WIH A;  5CHP A;  4XSX A;  2A6H A;  2WB1 D;  1TWF C;  4KN4 A;  2V6S A;  2R92 K;  3GTO K;  2WAQ D;  4RMF A;  4C45 A;  4KAR A;  1VLO A;  5IP9 K;  4C2M K;  2A69 A;  3NUH A;  1YCL A;  1ZVU A;  4XCH A;  2NVY C;  4C3J K;  3GTJ C;  4P5B A;  4MQ9 A;  2E2H A;  5FLM K;  3HOU K;  1R9T C;  3S16 C;  3HOX K;  1I50 C;  2JA7 A;  1I3Q C;  2BE5 A;  3S2D C;  2NVQ K;  3ADA C;  3S1Q K;  4YFX A;  3HOW C;  4M1X A;  5IYC C;  3AD7 C;  3PO2 K;  1WQH A;  3S1N K;  2R7Z K;  4Y52 C;  3RZO K;  4PAA A;  4X6A K;  1X31 C;  2P8T A;  5FJ8 K;  2JA7 K;  4KMU A;  1SFO A;  4BXX K;  4C3I K;  3GTG C;  1USO A;  2R93 A;  1WCM A;  5IOQ A;  2CFA B;  3GTK A;  3GTQ K;  1O26 A;  3WOD A;  4C3H C;  5IYB C;  3FKI C;  1F7V A;  3SZY A;  1XZQ A;  3CQZ C;  1BJT A;  2B63 A;  4A3J C;  1TWG C;  3GTM K;  1Y1W K;  4BBR K;  3HOY K;  4P9S A;  2E2H C;  3GTK K;  4A3C C;  3A8J A;  5IOT A;  4XLN A;  3OPF A;  3S17 K;  3IPJ A;  2B63 K;  4QJV A;  4G0V A;  2VUM A;  1Y1V C;  3H0G A;  4ILD A;  2JA8 K;  1TWH C;  4GTF A; 
#chains in the Genus database with same CATH homology
 4LK1 A;  2JA6 C;  4A3I K;  2NVX C;  4Y52 K;  1IW7 A;  4QIW L;  1TWA K;  4Q4Z A;  4A3C K;  1TWC K;  5TMF A;  3M3Y K;  5C4J K;  3S1N C;  2E2J K;  4YFN A;  2R92 C;  4QIW D;  3GTO C;  5D4D A;  4A3L C;  5C4X C;  3GTG K;  3S15 C;  4X6A C;  2JA7 C;  3S1Q C;  3H0G K;  2PMZ D;  4A3F K;  3I4N C;  3S1R K;  3I4M C;  4A3D C;  4C3H K;  5IYB K;  2JA5 C;  5C44 K;  3HOV K;  4AYB D;  1I6H K;  3GTQ C;  4MEY A;  3HOU C;  4LJZ A;  2WB1 L;  3HOX C;  1TWH K;  5M5W K;  3K7A K;  4XSX A;  3CQZ K;  1YNJ A;  2NVX K;  2A6H A;  1ZYR A;  2WB1 D;  3M4O C;  2YU9 K;  1TWF C;  4A3J K;  2O5I A;  2WAQ L;  4KN4 A;  3RZD C;  1TWG K;  1SFO C;  5TMC A;  4G7O A;  3GTP C;  3PO2 C;  2R92 K;  3GTO K;  2WAQ D;  5C3E K;  2E2H K;  3GTM C;  3S14 C;  2R93 C;  1WCM C;  1Y1W C;  2R7Z C;  3S15 K;  4A93 C;  4G7H A;  3HOY C;  3RZO C;  5IP9 K;  3HKZ L;  3GTK C;  4C2M K;  2A69 A;  4BY7 C;  4NOI A;  3I4M K;  2NVY C;  2VUM C;  4C3J K;  3HKZ D;  3S1M C;  4BXX C;  4A3G C;  4A3E C;  5IYD C;  3GTJ C;  2NVT C;  3S17 C;  2E2I C;  4A3K K;  4MQ9 A;  5FLM K;  3HOU K;  1R9T C;  4OIN A;  3S16 C;  2O5J A;  3HOX K;  1I50 C;  3HOZ C;  5IP7 C;  2B63 C;  1Y1V K;  1I3Q C;  4A3M K;  2BE5 A;  2A68 A;  2NVQ K;  3S2D C;  4YG2 A;  4BY1 C;  3S1Q K;  3RZD K;  1SFO K;  2JA8 C;  2JA6 K;  4YFX A;  1XPP A;  3GTL C;  4JK1 A;  3HOW C;  5IYC C;  3PO3 C;  3GTP K;  3PO2 K;  4A3B C;  4YFK A;  3S14 K;  2R93 K;  4A3I C;  3S1N K;  1WCM K;  2R7Z K;  3H3V L;  4A93 K;  4Y52 C;  4BBS C;  1SMY A;  4LK0 A;  3RZO K;  4QJV B;  4A3L K;  1TWA C;  5M5X K;  4BY7 K;  1TWC C;  4OIO A;  2PA8 L;  5C4X K;  4Y7N C;  5C4J C;  3H3V D;  3M3Y C;  3DXJ A;  4BBR C;  5FJ8 K;  4KMU A;  2JA7 K;  4X6A K;  3S1M K;  4BXX K;  4Q5S A;  4C3I K;  5M3F K;  3I4N K;  3GTG C;  2NVT K;  5IYD K;  3H0G C;  1R9T K;  4A3F C;  4A3D K;  1K83 C;  5IP7 K;  3S1R C;  3HOZ K;  1I3Q K;  2JA5 K;  3GTQ K;  4LLG A;  3WOD A;  3S2H C;  4XLP A;  5IYB C;  3HOV C;  4ZH4 A;  4GZY A;  3GTL K;  3FKI C;  3PO3 K;  3M4O K;  2A6E A;  3K7A C;  1TWF K;  3CQZ C;  5M5Y K;  3EQL A;  4BBS K;  2YU9 C;  4A3J C;  5M3M K;  4OIQ A;  1TWG C;  4Y7N K;  3GTM K;  1BDF A;  1Y1W K;  4BBR K;  3HOY K;  2PMZ L;  2E2H C;  2Y0S L;  5C3E C;  4OIP A;  3GTK K;  4A3C C;  4XSZ A;  2NVY K;  2E2J C;  2VUM K;  5IP9 C;  4XLN A;  4G7Z A;  4A3G K;  2Y0S D;  1K83 K;  4A3E K;  4OIR A;  3GTJ K;  2PA8 D;  4AYB L;  2E2I K;  3S17 K;  3S16 K;  3S2H K;  4MEX A;  1YNN A;  1I50 K;  1HQM A;  2PPB A;  4A3K C;  2B63 K;  4QJV A;  5FLM C;  3S2D K;  3FKI K;  4BY1 K;  1Y1V C;  4A3M C;  5C44 C;  1I6H C;  2NVQ C;  2JA8 K;  1I6V A;  3HOW K;  2CW0 A;  4KN7 A;  5IYC K;  4A3B K;  1TWH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...