2E2IK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2iK00
1TWCK 2A69A 2WAQL 3GTKK 3S2HC 3S2DK 4OIOA 3GTJC 2YU9K 4QIWD 4A3DC 4BBSK 3GTPK 3HOYC 2CW0A 5IYBC 4Y7NC 2PMZD 2R7ZK 3S17K 1I50K 5M3FK 4YFNA 5IYDK 2B63C 4KMUA 4A3MC 4XLPA 1I6HC 4A3IC 4QJVA 3M3YK 2NVQK 4Y52K 5C4XK 2JA5K 4OINA 1YNNA 5M5YK 3S1QC 2NVTK 4LK1A 3HOVC 4OIRA 4A3KC 4GZYA 4OIPA 1TWAC 1I50C 2WAQD 4C3JK 3M4OC 1TWGK 4MQ9A 4A3CK 5TMFA 4BBSC 4A3LK 5M5WK 2NVQC 3S1NK 1TWCC 3S2HK 4ZH4A 2JA8C 3I4NC 3M4OK 1I6VA 2JA6K 2R92K 3HOXK 4A3BK 4C3HK 1TWHK 2A68A 4MEYA 3RZOC 1Y1WK 2Y0SD 2NVYK 4XLNA 3FKIK 4JK1A 3GTJK 4MEXA 2O5JA 4BBRK 3S16K 4A3FC 3I4MC 3GTOK 3GTMC 4C3IK 5M5XK 3I4NK 3RZDK 3H0GC 1WCMC 3CQZC 5C4JK 4Q5SA 3HOVK 4BY1C 2R93C 3S15K 4A3IK 3H3VL 5IP9C 4XSZA 2JA5C 4A3EC 2NVYC 2PPBA 5C4XC 3GTKC 3H0GK 5C3EK 1TWFK 4A3JK 4BXXK 4X6AC 1YNJA 4A93K 3S17C 4A3EK 3HKZD 1I3QC 2YU9C 5C44K 1TWFC 4A3JC 4BXXC 2R93K 3EQLA 3HKZL 1TWHC 4NOIA 4BY7K 1Y1WC 3WODA 2BE5A 4QJVB 5IYCC 4A3GK 5M3MK 4Q4ZA 3CQZK 5C4JC 2E2JK 4BBRC 3HOXC 3H3VD 3S1NC 4A3KK 2PA8D 4Y52C 5IP9K 1BDFA 5C44C 5IP7K 2VUMK 1TWGC 3HOZC 3FKIC 3HOUC 3S14C 1IW7A 4LJZA 3HOWK 3RZOK 4A93C 3GTOC 4A3GC 3GTGC 5C3EC 4X6AK 2JA7K 3GTPC 2WB1L 4XSXA 4OIQA 1XPPA 4A3LC 4Y7NK 5FJ8K 3GTQK 3S15C 2WB1D 2E2IK 1I3QK 3PO2K 2B63K 3S2DC 1WCMK 5TMCA 2JA7C 1R9TK 2R92C 1I6HK 2E2JC 4C2MK 2A6EA 3HOWC 5IYBK 3S1MC 3DXJA 1TWAK 4YFKA 3PO3C 4AYBD 3S16C 3S1QK 3PO2C 2VUMC 5FLMK 3HOYK 4BY1K 2O5IA 3I4MK 3M3YC 1HQMA 3RZDC 2JA6C 1Y1VC 4QIWL 4LLGA 1SFOC 2NVXC 3S1RC 3GTQC 4BY7C 2R7ZC 5D4DA 2E2IC 3K7AK 4KN7A 4G7HA 4A3CC 4LK0A 4A3DK 1Y1VK 4A3MK 3S1RK 2Y0SL 3S1MK 1K83K 3GTMK 2PMZL 2JA8K 5IP7C 3HOZK 2NVTC 3GTLK 5FLMC 4YG2A 1SMYA 1ZYRA 4AYBL 3K7AC 4KN4A 2E2HK 3GTGK 3PO3K 2PA8L 5IYCK 2E2HC 5IYDC 3GTLC 4A3BC 1R9TC 1SFOK 4YFXA 2NVXK 3HOUK 3S14K 4G7ZA 4G7OA 1K83C 4A3FK 2A6HA
chains in the Genus database with same CATH superfamily
3GTKK 3S2DK 1WQHA 4BBSK 3HOYC 5IYBC 2JA5A 1BJTA 4GTEA 5M3FK 1X31C 1YNNA 4KMHA 1I50A 2GSUA 2NVTK 1VH2A 5TJ3A 3HOVC 4C2MC 4OIRA 3GTPA 4C3HC 4OIPA 3VA7A 1TWCA 4C3JK 1KQ4A 2GAGC 1BS2A 3S2HK 2JA8C 3M4OK 2JA6K 3N3YA 4MEYA 1Y1WK 2Y0SD 3GTMA 2FQOA 2NVYK 4PAAA 1Y1VA 4ILDA 3I4MC 3I4NK 3H0GC 3TTGA 3HOVK 1IE0A 1V5VA 5EGHA 4XSZA 5C4XC 4A3EC 2NVYC 4BXXK 2ZFZA 3ADAC 3N0BA 1TWAA 3L4KA 1TWHC 3HKZL 2JH3A 3QX3A 5EGEA 2PA8D 5IP9K 3T01A 5IP7K 2VUMK 4P5BA 3HOUC 2P5MA 5JFEA 3LAPA 2JA7K 4XSXA 4OIQA 4BKWA 2WB1D 2E2IK 1WCMK 5TMCA 2R92C 1I6HK 2R93A 2A6EA 4KB4A 4AH6A 3FOFA 3S1MC 3PO3C 2W7VA 5FLMK 3GDZA 1TWFA 3H0GA 4GFQA 2O5IA 3RZDC 1Y1VC 4LLGA 3GTQC 4BY7C 1J6XA 1F93A 1XZQB 2ZUEA 4A3CC 1VGXA 4A3MK 1ZVUA 4GTLA 3S1MK 4G0WA 2NVTC 4BLBA 1YCLA 1O25A 1SMYA 1ZYRA 2E2HK 4KN4A 5IYDC 3GTLC 3GSIA 3HOUK 4G7ZA 3Q3QA 1K83C 1TWGA 2A6HA 3S2HC 4OIOA 3GTJC 2YU9K 4A3DC 4J3NA 3OREA 3T00A 4Y7NC 1WOPA 4G0UA 4KMUA 4A3MC 2FQTA 1I6HC 4A3IC 2Y3PA 4Y52K 3LPXA 4A3KC 3TFJA 4LOWA 1EFWA 1TWGK 5TMFA 1SFOA 2NVXA 1O24A 3SZZA 4ZH4A 3GTGA 2E2HA 1I6VA 2D6FC 3JSTA 4A3BK 4C3HK 1TWHK 2A68A 4XLNA 3FKIK 2O5JA 4BBRK 4KMAA 3S16K 1IQ0A 4A3FC 4BY1C 2R93C 4KB2A 4P5AA 5IP9C 2JA5C 5HL8A 2PPBA 3BUEA 3H0GK 1WIHA 3GTKC 1TWFK 3AD9C 5E68A 4X6AC 4A93K 3AD8C 3GEHA 2YU9C 4A3JC 1WORA 3SZYA 4WJ3M 2R93K 3EQLA 2EBBA 1XZPB 1B4BA 4NOIA 2B63A 1RU0A 3N0CA 4QJVB 4A3GK 3TFHA 3GTQA 4C45A 4BBRC 3HOXC 4A3KK 4Y52C 1L0WA 1BDFA 2RH6A 3HOZC 1IS1A 1EH1A 4A93C 3RZOK 3HOWK 1O2FB 4X6AK 3GTPC 2WB1L 1WSRA 1XPPA 5FJ8K 3GTQK 5CJ9A 3S15C 5JVOA 2B63K 1BGWA 3OPFA 2JA7C 2V6TA 2GSNA 5IYBK 3DXJA 1TWAK 3S16C 4AYBD 3S1QK 3PO2C 1C0AA 3HOYK 4WJ4A 1WOSA 3M3YC 1XXCA 1AB4A 1XZPA 4QIWL 1SFOC 2NVXC 3S1RC 4KARA 3K7AK 5IOQA 4A3DK 1Y1VK 3FKIA 2Y0SL 3FOEA 2RGRA 3GTMK 4KDDA 2JA8K 5IP7C 1O2AA 1TWHA 1PJ6A 4AYBL 3K7AC 3GTGK 4A3BC 1R9TC 1SFOK 2NVXK 4G7OA 3I4MK 4GZYA 1DD5A 2V6SA 3GIRA 1ISEA 4QIWD 2CW0A 1USOA 3AQPA 1I50K 3AQOA 2GSOA 4YFNA 5IYDK 2B63C 4QJVA 2NVQK 5C4XK 4OINA 5IORA 1DCOA 1J6VA 4LK1A 2YU9A 3GTKA 3CAGA 4A3CK 1IBAA 1O28A 5CHPA 3V4GA 4A3LK 2NVQC 3S1NK 1TWCC 1O27A 3GEEA 4C3IC 3HOXK 1XXAA 4KM9A 1K83A 4MEXA 3T02A 1VJEA 5M5XK 1WCMC 1WQFA 5C4JK 1VLOA 2KWAA 5C3EK 3LAJA 4A3EK 3HKZD 4BXXC 3L4JA 1ZBSA 1WCMA 4KATA 4LQYA 1DCHA 2E2IA 1G51A 5IYCC 4G0VA 4Q4ZA 3AH5A 3BP3A 5C4JC 3A8KA 3IPJA 2JA7A 1TWGC 4RMFA 1PJ5A 1IW7A 2VUMA 3GTOC 4A3GC 4GTAA 5C3EC 2XCOA 4A3LC 2XCRB 1I3QK 3S2DC 2GAHC 1R9TK 4C2MK 3HOWC 2PHCB 4YFKA 1EQRA 4BY1K 1WSVA 1YX2A 1HQMA 3AD7C 1WOOA 1O26A 2JA6C 1JVIA 4FM9A 1EI6A 3GTOA 4KN7A 4G7HA 4LK0A 3G4CA 3S1RK 3GTJA 2NVYA 1Y1WA 1O2BA 3HOZK 3BP8C 1XZQA 5IOTA 2R92A 2JA6A 1HI9A 4BLAA 2PA8L 1F9NA 1O29A 4KAWX 4YFXA 3FHZA 4A3FK 2E2HC 1TWCK 2A69A 2WAQL 1XXBA 3GTPK 2PMZD 2R7ZK 3S17K 1DCPA 1EK8A 4XLPA 3M3YK 2JA5K 5M5YK 5IOSA 3S1QC 2R7ZA 1B4AA 1TWAC 1I50C 2WAQD 3M4OC 4MQ9A 4BBSC 5M5WK 3NUHA 3I4NC 3A8IA 4GT9A 2R92K 3GTLA 2CFAB 4FZBA 3RZOC 1VRQC 4JK1A 3GTJK 3GTOK 3GTMC 4C3IK 3RZDK 4DDQA 3CQZC 4LR2A 4Q5SA 3S15K 4A3IK 3H3VL 4C3JC 4A3JK 1YNJA 3TFIA 4GTDA 1PJ7A 1J98A 3S17C 1I3QC 3S0XA 3MMLB 5C44K 1TWFC 1GE9A 1R9TA 4BY7K 1Y1WC 1I3QA 3WODA 2BE5A 5M3MK 3CQZK 2E2JK 3H3VD 3S1NC 5C44C 3FKIC 3S14C 2CFAA 1WQGA 4KM8A 4GTCA 4LJZA 3GTGC 2P8TA 1IL2A 4KASA 4Y7NK 3CQZA 1F7VA 1UV7A 3PO2K 2ZUFA 3A8JA 3GEIA 2E2JC 2XCQA 3ERED 1USMA 2VUMC 5L46A 4WILA 4GTFA 4KMDA 3OEPA 2R7ZC 5D4DA 2E2IC 4KC6A 1F7UA 1ZXOA 1K83K 2PMZL 1INNA 1JOEA 3HXAA 1JQWA 4GTBA 5FLMC 3GTLK 4PABA 4YG2A 3PO3K 4XCHA 1ZQ1C 5IYCK 1J6WA 3G4AA 2V6UA 4P9SA 4M1XA 3S14K 4O2DA
chains in the Genus database with same CATH topology
1TWCK 2A69A 2WAQL 3GTKK 3S2HC 3S2DK 4OIOA 3GTJC 2YU9K 4QIWD 4A3DC 4BBSK 3GTPK 3HOYC 2CW0A 5IYBC 4Y7NC 2PMZD 2R7ZK 3S17K 1I50K 5M3FK 4YFNA 5IYDK 2B63C 4KMUA 4A3MC 4XLPA 1I6HC 4A3IC 4QJVA 3M3YK 2NVQK 4Y52K 5C4XK 2JA5K 4OINA 1YNNA 5M5YK 3S1QC 2NVTK 4LK1A 3HOVC 4OIRA 4A3KC 4GZYA 4OIPA 1TWAC 1I50C 2WAQD 4C3JK 3M4OC 1TWGK 4MQ9A 4A3CK 5TMFA 4BBSC 4A3LK 5M5WK 2NVQC 3S1NK 1TWCC 3S2HK 4ZH4A 2JA8C 3I4NC 3M4OK 1I6VA 2JA6K 2R92K 3HOXK 4A3BK 4C3HK 1TWHK 2A68A 4MEYA 3RZOC 1Y1WK 2Y0SD 2NVYK 4XLNA 3FKIK 4JK1A 3GTJK 4MEXA 2O5JA 4BBRK 3S16K 4A3FC 3I4MC 3GTOK 3GTMC 4C3IK 5M5XK 3I4NK 3RZDK 3H0GC 1WCMC 3CQZC 5C4JK 4Q5SA 3HOVK 4BY1C 2R93C 3S15K 4A3IK 3H3VL 5IP9C 4XSZA 2JA5C 4A3EC 2NVYC 2PPBA 5C4XC 3GTKC 3H0GK 5C3EK 1TWFK 4A3JK 4BXXK 4X6AC 1YNJA 4A93K 3S17C 4A3EK 3HKZD 1I3QC 2YU9C 5C44K 1TWFC 4A3JC 4BXXC 2R93K 3EQLA 3HKZL 1TWHC 4NOIA 4BY7K 1Y1WC 3WODA 2BE5A 4QJVB 5IYCC 4A3GK 5M3MK 4Q4ZA 3CQZK 5C4JC 2E2JK 4BBRC 3HOXC 3H3VD 3S1NC 4A3KK 2PA8D 4Y52C 5IP9K 1BDFA 5C44C 5IP7K 2VUMK 1TWGC 3HOZC 3FKIC 3HOUC 3S14C 1IW7A 4LJZA 3HOWK 3RZOK 4A93C 3GTOC 4A3GC 3GTGC 5C3EC 4X6AK 2JA7K 3GTPC 2WB1L 4XSXA 4OIQA 1XPPA 4A3LC 4Y7NK 5FJ8K 3GTQK 3S15C 2WB1D 2E2IK 1I3QK 3PO2K 2B63K 3S2DC 1WCMK 5TMCA 2JA7C 1R9TK 2R92C 1I6HK 2E2JC 4C2MK 2A6EA 3HOWC 5IYBK 3S1MC 3DXJA 1TWAK 4YFKA 3PO3C 4AYBD 3S16C 3S1QK 3PO2C 2VUMC 5FLMK 3HOYK 4BY1K 2O5IA 3I4MK 3M3YC 1HQMA 3RZDC 2JA6C 1Y1VC 4QIWL 4LLGA 1SFOC 2NVXC 3S1RC 3GTQC 4BY7C 2R7ZC 5D4DA 2E2IC 3K7AK 4KN7A 4G7HA 4A3CC 4LK0A 4A3DK 1Y1VK 4A3MK 3S1RK 2Y0SL 3S1MK 1K83K 3GTMK 2PMZL 2JA8K 5IP7C 3HOZK 2NVTC 3GTLK 5FLMC 4YG2A 1SMYA 1ZYRA 4AYBL 3K7AC 4KN4A 2E2HK 3GTGK 3PO3K 2PA8L 5IYCK 2E2HC 5IYDC 3GTLC 4A3BC 1R9TC 1SFOK 4YFXA 2NVXK 3HOUK 3S14K 4G7ZA 4G7OA 1K83C 4A3FK 2A6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC K;  2A69 A;  2WAQ L;  3GTK K;  3S2H C;  3S2D K;  4OIO A;  3GTJ C;  2YU9 K;  4QIW D;  4A3D C;  4BBS K;  3GTP K;  3HOY C;  2CW0 A;  5IYB C;  4Y7N C;  2PMZ D;  2R7Z K;  3S17 K;  1I50 K;  5M3F K;  4YFN A;  5IYD K;  2B63 C;  4KMU A;  4A3M C;  4XLP A;  1I6H C;  4A3I C;  4QJV A;  3M3Y K;  2NVQ K;  4Y52 K;  5C4X K;  2JA5 K;  4OIN A;  1YNN A;  5M5Y K;  3S1Q C;  2NVT K;  4LK1 A;  3HOV C;  4OIR A;  4A3K C;  4GZY A;  4OIP A;  1TWA C;  1I50 C;  2WAQ D;  4C3J K;  3M4O C;  1TWG K;  4MQ9 A;  4A3C K;  5TMF A;  4BBS C;  4A3L K;  5M5W K;  2NVQ C;  3S1N K;  1TWC C;  3S2H K;  4ZH4 A;  2JA8 C;  3I4N C;  3M4O K;  1I6V A;  2JA6 K;  2R92 K;  3HOX K;  4A3B K;  4C3H K;  1TWH K;  2A68 A;  4MEY A;  3RZO C;  1Y1W K;  2Y0S D;  2NVY K;  4XLN A;  3FKI K;  4JK1 A;  3GTJ K;  4MEX A;  2O5J A;  4BBR K;  3S16 K;  4A3F C;  3I4M C;  3GTO K;  3GTM C;  4C3I K;  5M5X K;  3I4N K;  3RZD K;  3H0G C;  1WCM C;  3CQZ C;  5C4J K;  4Q5S A;  3HOV K;  4BY1 C;  2R93 C;  3S15 K;  4A3I K;  3H3V L;  5IP9 C;  4XSZ A;  2JA5 C;  4A3E C;  2NVY C;  2PPB A;  5C4X C;  3GTK C;  3H0G K;  5C3E K;  1TWF K;  4A3J K;  4BXX K;  4X6A C;  1YNJ A;  4A93 K;  3S17 C;  4A3E K;  3HKZ D;  1I3Q C;  2YU9 C;  5C44 K;  1TWF C;  4A3J C;  4BXX C;  2R93 K;  3EQL A;  3HKZ L;  1TWH C;  4NOI A;  4BY7 K;  1Y1W C;  3WOD A;  2BE5 A;  4QJV B;  5IYC C;  4A3G K;  5M3M K;  4Q4Z A;  3CQZ K;  5C4J C;  2E2J K;  4BBR C;  3HOX C;  3H3V D;  3S1N C;  4A3K K;  2PA8 D;  4Y52 C;  5IP9 K;  1BDF A;  5C44 C;  5IP7 K;  2VUM K;  1TWG C;  3HOZ C;  3FKI C;  3HOU C;  3S14 C;  1IW7 A;  4LJZ A;  3HOW K;  3RZO K;  4A93 C;  3GTO C;  4A3G C;  3GTG C;  5C3E C;  4X6A K;  2JA7 K;  3GTP C;  2WB1 L;  4XSX A;  4OIQ A;  1XPP A;  4A3L C;  4Y7N K;  5FJ8 K;  3GTQ K;  3S15 C;  2WB1 D;  2E2I K;  1I3Q K;  3PO2 K;  2B63 K;  3S2D C;  1WCM K;  5TMC A;  2JA7 C;  1R9T K;  2R92 C;  1I6H K;  2E2J C;  4C2M K;  2A6E A;  3HOW C;  5IYB K;  3S1M C;  3DXJ A;  1TWA K;  4YFK A;  3PO3 C;  4AYB D;  3S16 C;  3S1Q K;  3PO2 C;  2VUM C;  5FLM K;  3HOY K;  4BY1 K;  2O5I A;  3I4M K;  3M3Y C;  1HQM A;  3RZD C;  2JA6 C;  1Y1V C;  4QIW L;  4LLG A;  1SFO C;  2NVX C;  3S1R C;  3GTQ C;  4BY7 C;  2R7Z C;  5D4D A;  2E2I C;  3K7A K;  4KN7 A;  4G7H A;  4A3C C;  4LK0 A;  4A3D K;  1Y1V K;  4A3M K;  3S1R K;  2Y0S L;  3S1M K;  1K83 K;  3GTM K;  2PMZ L;  2JA8 K;  5IP7 C;  3HOZ K;  2NVT C;  3GTL K;  5FLM C;  4YG2 A;  1SMY A;  1ZYR A;  4AYB L;  3K7A C;  4KN4 A;  2E2H K;  3GTG K;  3PO3 K;  2PA8 L;  5IYC K;  2E2H C;  5IYD C;  3GTL C;  4A3B C;  1R9T C;  1SFO K;  4YFX A;  2NVX K;  3HOU K;  3S14 K;  4G7Z A;  4G7O A;  1K83 C;  4A3F K;  2A6H A; 
#chains in the Genus database with same CATH topology
 3GTK K;  3S2D K;  1WQH A;  4BBS K;  3HOY C;  5IYB C;  2JA5 A;  1BJT A;  4GTE A;  5M3F K;  1X31 C;  1YNN A;  4KMH A;  1I50 A;  2GSU A;  2NVT K;  1VH2 A;  5TJ3 A;  3HOV C;  4C2M C;  4OIR A;  3GTP A;  4C3H C;  4OIP A;  3VA7 A;  1TWC A;  4C3J K;  1KQ4 A;  2GAG C;  1BS2 A;  3S2H K;  2JA8 C;  3M4O K;  2JA6 K;  3N3Y A;  4MEY A;  1Y1W K;  2Y0S D;  3GTM A;  2FQO A;  2NVY K;  4PAA A;  1Y1V A;  4ILD A;  3I4M C;  3I4N K;  3H0G C;  3TTG A;  3HOV K;  1IE0 A;  1V5V A;  5EGH A;  4XSZ A;  5C4X C;  4A3E C;  2NVY C;  4BXX K;  2ZFZ A;  3ADA C;  3N0B A;  1TWA A;  3L4K A;  1TWH C;  3HKZ L;  2JH3 A;  3QX3 A;  5EGE A;  2PA8 D;  5IP9 K;  3T01 A;  5IP7 K;  2VUM K;  4P5B A;  3HOU C;  2P5M A;  5JFE A;  3LAP A;  2JA7 K;  4XSX A;  4OIQ A;  4BKW A;  2WB1 D;  2E2I K;  1WCM K;  5TMC A;  2R92 C;  1I6H K;  2R93 A;  2A6E A;  4KB4 A;  4AH6 A;  3FOF A;  3S1M C;  3PO3 C;  2W7V A;  5FLM K;  3GDZ A;  1TWF A;  3H0G A;  4GFQ A;  2O5I A;  3RZD C;  1Y1V C;  4LLG A;  3GTQ C;  4BY7 C;  1J6X A;  1F93 A;  1XZQ B;  2ZUE A;  4A3C C;  1VGX A;  4A3M K;  1ZVU A;  4GTL A;  3S1M K;  4G0W A;  2NVT C;  4BLB A;  1YCL A;  1O25 A;  1SMY A;  1ZYR A;  2E2H K;  4KN4 A;  5IYD C;  3GTL C;  3GSI A;  3HOU K;  4G7Z A;  3Q3Q A;  1K83 C;  1TWG A;  2A6H A;  3S2H C;  4OIO A;  3GTJ C;  2YU9 K;  4A3D C;  4J3N A;  3ORE A;  3T00 A;  4Y7N C;  1WOP A;  4G0U A;  4KMU A;  4A3M C;  2FQT A;  1I6H C;  4A3I C;  2Y3P A;  4Y52 K;  3LPX A;  4A3K C;  3TFJ A;  4LOW A;  1EFW A;  1TWG K;  5TMF A;  1SFO A;  2NVX A;  1O24 A;  3SZZ A;  4ZH4 A;  3GTG A;  2E2H A;  1I6V A;  2D6F C;  3JST A;  4A3B K;  4C3H K;  1TWH K;  2A68 A;  4XLN A;  3FKI K;  2O5J A;  4BBR K;  4KMA A;  3S16 K;  1IQ0 A;  4A3F C;  4BY1 C;  2R93 C;  4KB2 A;  4P5A A;  5IP9 C;  2JA5 C;  5HL8 A;  2PPB A;  3BUE A;  3H0G K;  1WIH A;  3GTK C;  1TWF K;  3AD9 C;  5E68 A;  4X6A C;  4A93 K;  3AD8 C;  3GEH A;  2YU9 C;  4A3J C;  1WOR A;  3SZY A;  4WJ3 M;  2R93 K;  3EQL A;  2EBB A;  1XZP B;  1B4B A;  4NOI A;  2B63 A;  1RU0 A;  3N0C A;  4QJV B;  4A3G K;  3TFH A;  3GTQ A;  4C45 A;  4BBR C;  3HOX C;  4A3K K;  4Y52 C;  1L0W A;  1BDF A;  2RH6 A;  3HOZ C;  1IS1 A;  1EH1 A;  4A93 C;  3RZO K;  3HOW K;  1O2F B;  4X6A K;  3GTP C;  2WB1 L;  1WSR A;  1XPP A;  5FJ8 K;  3GTQ K;  5CJ9 A;  3S15 C;  5JVO A;  2B63 K;  1BGW A;  3OPF A;  2JA7 C;  2V6T A;  2GSN A;  5IYB K;  3DXJ A;  1TWA K;  3S16 C;  4AYB D;  3S1Q K;  3PO2 C;  1C0A A;  3HOY K;  4WJ4 A;  1WOS A;  3M3Y C;  1XXC A;  1AB4 A;  1XZP A;  4QIW L;  1SFO C;  2NVX C;  3S1R C;  4KAR A;  3K7A K;  5IOQ A;  4A3D K;  1Y1V K;  3FKI A;  2Y0S L;  3FOE A;  2RGR A;  3GTM K;  4KDD A;  2JA8 K;  5IP7 C;  1O2A A;  1TWH A;  1PJ6 A;  4AYB L;  3K7A C;  3GTG K;  4A3B C;  1R9T C;  1SFO K;  2NVX K;  4G7O A;  3I4M K;  4GZY A;  1DD5 A;  2V6S A;  3GIR A;  1ISE A;  4QIW D;  2CW0 A;  1USO A;  3AQP A;  1I50 K;  3AQO A;  2GSO A;  4YFN A;  5IYD K;  2B63 C;  4QJV A;  2NVQ K;  5C4X K;  4OIN A;  5IOR A;  1DCO A;  1J6V A;  4LK1 A;  2YU9 A;  3GTK A;  3CAG A;  4A3C K;  1IBA A;  1O28 A;  5CHP A;  3V4G A;  4A3L K;  2NVQ C;  3S1N K;  1TWC C;  1O27 A;  3GEE A;  4C3I C;  3HOX K;  1XXA A;  4KM9 A;  1K83 A;  4MEX A;  3T02 A;  1VJE A;  5M5X K;  1WCM C;  1WQF A;  5C4J K;  1VLO A;  2KWA A;  5C3E K;  3LAJ A;  4A3E K;  3HKZ D;  4BXX C;  3L4J A;  1ZBS A;  1WCM A;  4KAT A;  4LQY A;  1DCH A;  2E2I A;  1G51 A;  5IYC C;  4G0V A;  4Q4Z A;  3AH5 A;  3BP3 A;  5C4J C;  3A8K A;  3IPJ A;  2JA7 A;  1TWG C;  4RMF A;  1PJ5 A;  1IW7 A;  2VUM A;  3GTO C;  4A3G C;  4GTA A;  5C3E C;  2XCO A;  4A3L C;  2XCR B;  1I3Q K;  3S2D C;  2GAH C;  1R9T K;  4C2M K;  3HOW C;  2PHC B;  4YFK A;  1EQR A;  4BY1 K;  1WSV A;  1YX2 A;  1HQM A;  3AD7 C;  1WOO A;  1O26 A;  2JA6 C;  1JVI A;  4FM9 A;  1EI6 A;  3GTO A;  4KN7 A;  4G7H A;  4LK0 A;  3G4C A;  3S1R K;  3GTJ A;  2NVY A;  1Y1W A;  1O2B A;  3HOZ K;  3BP8 C;  1XZQ A;  5IOT A;  2R92 A;  2JA6 A;  1HI9 A;  4BLA A;  2PA8 L;  1F9N A;  1O29 A;  4KAW X;  4YFX A;  3FHZ A;  4A3F K;  2E2H C;  1TWC K;  2A69 A;  2WAQ L;  1XXB A;  3GTP K;  2PMZ D;  2R7Z K;  3S17 K;  1DCP A;  1EK8 A;  4XLP A;  3M3Y K;  2JA5 K;  5M5Y K;  5IOS A;  3S1Q C;  2R7Z A;  1B4A A;  1TWA C;  1I50 C;  2WAQ D;  3M4O C;  4MQ9 A;  4BBS C;  5M5W K;  3NUH A;  3I4N C;  3A8I A;  4GT9 A;  2R92 K;  3GTL A;  2CFA B;  4FZB A;  3RZO C;  1VRQ C;  4JK1 A;  3GTJ K;  3GTO K;  3GTM C;  4C3I K;  3RZD K;  4DDQ A;  3CQZ C;  4LR2 A;  4Q5S A;  3S15 K;  4A3I K;  3H3V L;  4C3J C;  4A3J K;  1YNJ A;  3TFI A;  4GTD A;  1PJ7 A;  1J98 A;  3S17 C;  1I3Q C;  3S0X A;  3MML B;  5C44 K;  1TWF C;  1GE9 A;  1R9T A;  4BY7 K;  1Y1W C;  1I3Q A;  3WOD A;  2BE5 A;  5M3M K;  3CQZ K;  2E2J K;  3H3V D;  3S1N C;  5C44 C;  3FKI C;  3S14 C;  2CFA A;  1WQG A;  4KM8 A;  4GTC A;  4LJZ A;  3GTG C;  2P8T A;  1IL2 A;  4KAS A;  4Y7N K;  3CQZ A;  1F7V A;  1UV7 A;  3PO2 K;  2ZUF A;  3A8J A;  3GEI A;  2E2J C;  2XCQ A;  3ERE D;  1USM A;  2VUM C;  5L46 A;  4WIL A;  4GTF A;  4KMD A;  3OEP A;  2R7Z C;  5D4D A;  2E2I C;  4KC6 A;  1F7U A;  1ZXO A;  1K83 K;  2PMZ L;  1INN A;  1JOE A;  3HXA A;  1JQW A;  4GTB A;  5FLM C;  3GTL K;  4PAB A;  4YG2 A;  3PO3 K;  4XCH A;  1ZQ1 C;  5IYC K;  1J6W A;  3G4A A;  2V6U A;  4P9S A;  4M1X A;  3S14 K;  4O2D A; 
#chains in the Genus database with same CATH homology
 1TWC K;  2A69 A;  2WAQ L;  3GTK K;  3S2H C;  3S2D K;  4OIO A;  3GTJ C;  2YU9 K;  4QIW D;  4A3D C;  4BBS K;  3GTP K;  3HOY C;  2CW0 A;  5IYB C;  4Y7N C;  2PMZ D;  2R7Z K;  3S17 K;  1I50 K;  5M3F K;  4YFN A;  5IYD K;  2B63 C;  4KMU A;  4A3M C;  4XLP A;  1I6H C;  4A3I C;  4QJV A;  3M3Y K;  2NVQ K;  4Y52 K;  5C4X K;  2JA5 K;  4OIN A;  1YNN A;  5M5Y K;  3S1Q C;  2NVT K;  4LK1 A;  3HOV C;  4OIR A;  4A3K C;  4GZY A;  4OIP A;  1TWA C;  1I50 C;  2WAQ D;  4C3J K;  3M4O C;  1TWG K;  4MQ9 A;  4A3C K;  5TMF A;  4BBS C;  4A3L K;  5M5W K;  2NVQ C;  3S1N K;  1TWC C;  3S2H K;  4ZH4 A;  2JA8 C;  3I4N C;  3M4O K;  1I6V A;  2JA6 K;  2R92 K;  3HOX K;  4A3B K;  4C3H K;  1TWH K;  2A68 A;  4MEY A;  3RZO C;  1Y1W K;  2Y0S D;  2NVY K;  4XLN A;  3FKI K;  4JK1 A;  3GTJ K;  4MEX A;  2O5J A;  4BBR K;  3S16 K;  4A3F C;  3I4M C;  3GTO K;  3GTM C;  4C3I K;  5M5X K;  3I4N K;  3RZD K;  3H0G C;  1WCM C;  3CQZ C;  5C4J K;  4Q5S A;  3HOV K;  4BY1 C;  2R93 C;  3S15 K;  4A3I K;  3H3V L;  5IP9 C;  4XSZ A;  2JA5 C;  4A3E C;  2NVY C;  2PPB A;  5C4X C;  3GTK C;  3H0G K;  5C3E K;  1TWF K;  4A3J K;  4BXX K;  4X6A C;  1YNJ A;  4A93 K;  3S17 C;  4A3E K;  3HKZ D;  1I3Q C;  2YU9 C;  5C44 K;  1TWF C;  4A3J C;  4BXX C;  2R93 K;  3EQL A;  3HKZ L;  1TWH C;  4NOI A;  4BY7 K;  1Y1W C;  3WOD A;  2BE5 A;  4QJV B;  5IYC C;  4A3G K;  5M3M K;  4Q4Z A;  3CQZ K;  5C4J C;  2E2J K;  4BBR C;  3HOX C;  3H3V D;  3S1N C;  4A3K K;  2PA8 D;  4Y52 C;  5IP9 K;  1BDF A;  5C44 C;  5IP7 K;  2VUM K;  1TWG C;  3HOZ C;  3FKI C;  3HOU C;  3S14 C;  1IW7 A;  4LJZ A;  3HOW K;  3RZO K;  4A93 C;  3GTO C;  4A3G C;  3GTG C;  5C3E C;  4X6A K;  2JA7 K;  3GTP C;  2WB1 L;  4XSX A;  4OIQ A;  1XPP A;  4A3L C;  4Y7N K;  5FJ8 K;  3GTQ K;  3S15 C;  2WB1 D;  2E2I K;  1I3Q K;  3PO2 K;  2B63 K;  3S2D C;  1WCM K;  5TMC A;  2JA7 C;  1R9T K;  2R92 C;  1I6H K;  2E2J C;  4C2M K;  2A6E A;  3HOW C;  5IYB K;  3S1M C;  3DXJ A;  1TWA K;  4YFK A;  3PO3 C;  4AYB D;  3S16 C;  3S1Q K;  3PO2 C;  2VUM C;  5FLM K;  3HOY K;  4BY1 K;  2O5I A;  3I4M K;  3M3Y C;  1HQM A;  3RZD C;  2JA6 C;  1Y1V C;  4QIW L;  4LLG A;  1SFO C;  2NVX C;  3S1R C;  3GTQ C;  4BY7 C;  2R7Z C;  5D4D A;  2E2I C;  3K7A K;  4KN7 A;  4G7H A;  4A3C C;  4LK0 A;  4A3D K;  1Y1V K;  4A3M K;  3S1R K;  2Y0S L;  3S1M K;  1K83 K;  3GTM K;  2PMZ L;  2JA8 K;  5IP7 C;  3HOZ K;  2NVT C;  3GTL K;  5FLM C;  4YG2 A;  1SMY A;  1ZYR A;  4AYB L;  3K7A C;  4KN4 A;  2E2H K;  3GTG K;  3PO3 K;  2PA8 L;  5IYC K;  2E2H C;  5IYD C;  3GTL C;  4A3B C;  1R9T C;  1SFO K;  4YFX A;  2NVX K;  3HOU K;  3S14 K;  4G7Z A;  4G7O A;  1K83 C;  4A3F K;  2A6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...