2E2IK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2iK00
2Y0SL 4QJVA 5IYBK 2E2JC 5IYBC 3I4MK 4BY1K 4AYBL 2NVQK 3GTLK 1I6HK 2JA5K 2NVTK 3S1RK 4KMUA 4BY1C 2NVQC 2E2HK 3GTLC 4NOIA 1TWFK 3I4MC 5C44K 3I4NK 1I6HC 3S1RC 2E2HC 4LJZA 3RZOK 1TWFC 4MEXA 5C44C 3I4NC 4XLPA 4QIWL 4A3MK 3HOUK 3S1NC 2PA8L 4OIOA 1BDFA 3H0GK 4A3MC 3HOUC 4C3JK 4BBSK 2WAQL 3H0GC 4A93C 1XPPA 4A3FK 3S15K 4LK0A 3GTOK 3HOYK 5IP7C 3H3VL 4BXXK 2PMZD 3S15C 4A3FC 2VUMK 3GTOC 3HOYC 1TWGK 4OIPA 4BXXC 2A6EA 5D4DA 2O5IA 4G7OA 1WCMC 1TWGC 2B63K 4MQ9A 3GTJK 3S2DK 2R92K 3S16K 4Q5SA 5C4XK 2PPBA 3S2DC 4C2MK 3S16C 3PO3K 2WB1L 4XSZA 3GTPK 1YNNA 2R93K 1I3QK 3PO3C 4YFKA 3GTPC 1HQMA 3WODA 2E2IK 1IW7A 2R93C 1Y1WK 2JA5C 3EQLA 2NVTC 5IYCK 2E2IC 4A3EK 1Y1WC 5IYCC 4JK1A 1TWHK 4A3EC 3HOVK 3RZOC 5TMFA 4YFXA 3HKZL 1TWHC 3HOVC 2PMZL 1SFOK 5C4JK 4BBSC 4A3GK 4XLNA 3HOWK 1ZYRA 5C4JC 1SFOC 3S1MK 3HOWC 4A3GC 4LK1A 4A3LK 2JA6K 5FLMK 2VUMC 3S1MC 4LLGA 4A3LC 2YU9K 2JA6C 5FLMC 5M3FK 2B63C 4Q4ZA 3GTJC 1R9TK 5M3MK 2YU9C 1YNJA 3S2HK 4AYBD 4X6AK 1I6VA 4MEYA 4Y52C 4Y7NK 1R9TC 2R92C 4KN4A 5C4XC 4X6AC 2JA8K 1I50K 4Y7NC 4QJVB 4BY7K 3FKIK 5M5YK 2JA8C 1I50C 1I3QC 4A3IK 4QIWD 4OINA 3GTQK 4BY7C 2O5JA 3GTGK 3FKIC 3GTQC 5IP9K 5TMCA 3GTGC 3RZDK 1K83K 1TWAK 5IP9C 3GTKK 4YFNA 2WAQD 5FJ8K 2R7ZK 3S17C 2CW0A 3S1QK 4G7HA 1TWAC 1K83C 3RZDC 3GTKC 3H3VD 1SMYA 2R7ZC 4A3CK 3S1QC 4A3BK 1TWCK 4Y52K 5M5WK 3GTMK 2NVYK 4OIQA 3HOZK 4C3IK 4A3CC 3M4OK 4A3BC 1TWCC 4A3JK 4XSXA 2NVYC 3GTMC 3HOZC 4BBRK 3M4OC 4A3JC 2Y0SD 3S17K 5IYDK 2A69A 4BBRC 4YG2A 4ZH4A 2WB1D 4C3HK 5IYDC 5C3EK 3S2HC 5C3EC 3K7AK 3S1NK 3CQZK 4G7ZA 3DXJA 3M3YK 3K7AC 4A3KK 3CQZC 5M5XK 1Y1VK 3M3YC 2BE5A 4A3KC 2PA8D 2JA7K 4A93K 4A3IC 5IP7K 3HKZD 1Y1VC 2JA7C 2NVXK 3S14K 4A3DK 4OIRA 1WCMK 2NVXC 4GZYA 2A6HA 3S14C 4A3DC 2A68A 4KN7A 3HOXK 3PO2K 2E2JK 3HOXC 3PO2C
chains in the Genus database with same CATH superfamily
1IQ0A 4GTBA 3I4MK 4AYBL 1UV7A 2NVTK 3S1RK 4BY1C 3S17C 2E2HK 1TWFK 3I4NK 1B4BA 2PHCB 1F7UA 1PJ7A 3GTOK 1TWFA 5IP7C 3S15C 1WSRA 4OIPA 1HI9A 2CFAA 2O5IA 1ISEA 1KQ4A 1DD5A 1TWGC 2B63K 2JH3A 3GTJK 2PPBA 1SFOA 4KDDA 3LAPA 3S2DC 3GTOA 1BS2A 3PO3K 2D6FC 4XSZA 3GTPK 1I3QK 1HQMA 3WODA 3JSTA 4GTFA 2B63A 2NVTC 3EQLA 3GTJA 5IYCK 4A3EC 3HOVK 2GSNA 3GTPA 1L0WA 1I3QA 3CAGA 3HOWK 1ZYRA 1SFOC 1WSVA 2JA6K 1IE0A 1K83A 4ILDA 3GTKA 3OREA 2B63C 4BLBA 4Q4ZA 3GTJC 5M3MK 1AB4A 4KATA 4G0VA 4Y7NC 2JA6A 4BY7K 2JA8C 2O5JA 1I3QC 5IOTA 4G7HA 1K83C 3GTKC 4A3CK 1X31C 1TWCK 5M5WK 3GTMK 1GE9A 4OIQA 1WOOA 2RGRA 4A3JK 4BBRK 3M4OC 1JQWA 5IYDK 2A69A 2GAGC 4YG2A 2CFAB 4ZH4A 2WB1D 1WQFA 4AH6A 3GTMA 5C3EC 3K7AK 1RU0A 3M3YK 4A3KK 1WORA 1Y1VK 4G0WA 5JFEA 1DCHA 2NVXK 3S14K 4A3DK 3VA7A 3MMLB 1C0AA 3AD8C 1Y1VA 3HOXC 2Y0SL 4QJVA 3GDZA 1IS1A 5CHPA 2NVXA 5IYBC 4BY1K 5EGHA 2GSUA 2NVQC 1J6VA 4MEXA 1VH2A 5C44C 4QIWL 1EQRA 3A8KA 1J6WA 1EI6A 1XXAA 3H0GC 4GTCA 4C3JC 3S15K 4KMHA 4LK0A 5TJ3A 2PMZD 1O27A 1O26A 4A3FC 3T01A 3HOYC 1TWGK 2A6EA 5D4DA 4GTEA 4G7OA 4MQ9A 3S2DK 3N0BA 4KM9A 1TWGA 4LR2A 2YU9A 2E2IC 4A3EK 1O28A 4JK1A 3HKZL 3Q3QA 1TWHC 2Y3PA 3IPJA 4GTDA 1SFOK 2P5MA 3GTQA 2FQTA 5C4JC 4A3GC 4LK1A 1PJ6A 3S1MC 1WOPA 4FM9A 5M3FK 2YU9C 3S2HK 4KMDA 4AYBD 4MEYA 4Y7NK 2JA8K 1XXBA 4QJVB 1WQHA 3LAJA 4PABA 3AQPA 1EH1A 4OINA 3FKIC 3GTQC 1K83K 5IP9C 3GTKK 2CW0A 5EGEA 1TWAC 4KAWX 2V6UA 4C45A 3L4JA 1SMYA 3OEPA 4LQYA 4PAAA 3M4OK 4A3BC 2NVYC 3HOZC 4C3IC 1WQGA 3N0CA 4FZBA 5C3EK 3T00A 3S2HC 4C3HC 1V5VA 1EK8A 3AD7C 5M5XK 2PA8D 2FQOA 1O2FB 4GZYA 2A6HA 3N3YA 1XZQA 3HOXK 2P8TA 2ZUEA 1XXCA 5IYBK 4LOWA 2E2JC 2NVQK 1YCLA 2JA5K 1B4AA 1ZVUA 3GTLC 1I6HC 4P9SA 4NOIA 5C44K 3RZOK 4XLPA 1BDFA 3H0GK 1O2BA 1PJ5A 4C3JK 4A3MC 3HOUC 2R93A 2ZUFA 2JA5A 2WAQL 1XPPA 4A3FK 3HOYK 3H3VL 2VUMK 5CJ9A 4BXXC 4DDQA 3BP3A 3H0GA 4Q5SA 5C4XK 4G0UA 1IBAA 2KWAA 3S16C 4WJ4A 2W7VA 2VUMA 4C2MC 2E2IK 1WIHA 3AD9C 2R93C 2JA5C 1USOA 4KB2A 1Y1WC 1R9TA 4XCHA 1TWHK 3RZOC 1O24A 1EFWA 1VLOA 2PMZL 5C4JK 2E2IA 4A3GK 3S1MK 1YX2A 1O2AA 1TWHA 2VUMC 4P5AA 4LLGA 1O25A 2YU9K 4A3LC 1ZXOA 5FLMC 1BGWA 1YNJA 1XZQB 1J98A 1I6VA 2ZFZA 4Y52C 1R9TC 4P5BA 5C4XC 2V6TA 4X6AC 1INNA 3FKIK 3FOFA 1I50C 3GTQK 3GEIA 1DCOA 4QIWD 5IP9K 3QX3A 5TMCA 3GTGC 1TWAK 4YFNA 2RH6A 3RZDC 3SZYA 2R7ZC 1JOEA 1F93A 4GTAA 3S1QC 3FKIA 4A3BK 2NVYK 2GSOA 4C3IK 3HOZK 1TWAA 4J3NA 3TFHA 3GEEA 1XZPA 4KM8A 4C3HK 2NVYA 3TFIA 3LPXA 3S1NK 3DXJA 3CQZC 3AQOA 3HXAA 4A93K 3HKZD 2JA7C 2E2HA 3ERED 1WCMK 4KN7A 2E2JK 3PO2C 1F7VA 4WJ3M 1F9NA 1VRQC 1WCMA 3GTLK 1I6HK 5HL8A 3I4MC 4KMUA 3BP8C 3S1RC 2E2HC 4LJZA 1TWFC 3I4NC 4A3MK 3HOUK 3S1NC 2PA8L 3BUEA 4OIOA 3GSIA 3GTLA 4BBSK 4WILA 4A93C 4O2DA 4BXXK 3GTOC 5IORA 1WCMC 3AH5A 3TTGA 3G4AA 2R92K 3S16K 4KMAA 5L46A 4C2MK 2WB1L 1YNNA 2R93K 3PO3C 1ZBSA 4YFKA 3GTPC 1IW7A 1Y1WK 1XZPB 3GEHA 3A8IA 3V4GA 2R92A 5IYCC 2XCOA 4GT9A 1O29A 5TMFA 4YFXA 5IOSA 3HOVC 1JVIA 2EBBA 3GIRA 4BBSC 4XLNA 1Y1WA 3HOWC 4A3LK 3L4KA 5FLMK 1BJTA 2JA6C 3TFJA 1IL2A 1DCPA 4Y52K 4BLAA 5IOQA 1USMA 1R9TK 5JVOA 4X6AK 1G51A 2R92C 1TWCA 3G4CA 4KN4A 3SZZA 1I50K 3FOEA 5M5YK 4A3IK 4GFQA 4BY7C 3GTGK 3ADAC 1VJEA 2XCQA 3RZDK 4KASA 2WAQD 5FJ8K 2R7ZK 3S1QK 4M1XA 1I50A 3H3VD 4GTLA 2GAHC 4A3CC 1ZQ1C 3GTGA 4KARA 1TWCC 4KB4A 4XSXA 3GTMC 1WOSA 3FHZA 4A3JC 2Y0SD 2XCRB 3S17K 2R7ZA 4BBRC 5IYDC 3CQZK 4G7ZA 3K7AC 3T02A 3M3YC 2BE5A 4A3KC 2JA7K 4A3IC 5IP7K 1Y1VC 4KC6A 1J6XA 3NUHA 4OIRA 3OPFA 4BKWA 3S0XA 3CQZA 2NVXC 3S14C 4A3DC 2A68A 5E68A 3A8JA 3PO2K 1VGXA 4RMFA 2V6SA 2JA7A
chains in the Genus database with same CATH topology
2Y0SL 4QJVA 5IYBK 2E2JC 5IYBC 3I4MK 4BY1K 4AYBL 2NVQK 3GTLK 1I6HK 2JA5K 2NVTK 3S1RK 4KMUA 4BY1C 2NVQC 2E2HK 3GTLC 4NOIA 1TWFK 3I4MC 5C44K 3I4NK 1I6HC 3S1RC 2E2HC 4LJZA 3RZOK 1TWFC 4MEXA 5C44C 3I4NC 4XLPA 4QIWL 4A3MK 3HOUK 3S1NC 2PA8L 4OIOA 1BDFA 3H0GK 4A3MC 3HOUC 4C3JK 4BBSK 2WAQL 3H0GC 4A93C 1XPPA 4A3FK 3S15K 4LK0A 3GTOK 3HOYK 5IP7C 3H3VL 4BXXK 2PMZD 3S15C 4A3FC 2VUMK 3GTOC 3HOYC 1TWGK 4OIPA 4BXXC 2A6EA 5D4DA 2O5IA 4G7OA 1WCMC 1TWGC 2B63K 4MQ9A 3GTJK 3S2DK 2R92K 3S16K 4Q5SA 5C4XK 2PPBA 3S2DC 4C2MK 3S16C 3PO3K 2WB1L 4XSZA 3GTPK 1YNNA 2R93K 1I3QK 3PO3C 4YFKA 3GTPC 1HQMA 3WODA 2E2IK 1IW7A 2R93C 1Y1WK 2JA5C 3EQLA 2NVTC 5IYCK 2E2IC 4A3EK 1Y1WC 5IYCC 4JK1A 1TWHK 4A3EC 3HOVK 3RZOC 5TMFA 4YFXA 3HKZL 1TWHC 3HOVC 2PMZL 1SFOK 5C4JK 4BBSC 4A3GK 4XLNA 3HOWK 1ZYRA 5C4JC 1SFOC 3S1MK 3HOWC 4A3GC 4LK1A 4A3LK 2JA6K 5FLMK 2VUMC 3S1MC 4LLGA 4A3LC 2YU9K 2JA6C 5FLMC 5M3FK 2B63C 4Q4ZA 3GTJC 1R9TK 5M3MK 2YU9C 1YNJA 3S2HK 4AYBD 4X6AK 1I6VA 4MEYA 4Y52C 4Y7NK 1R9TC 2R92C 4KN4A 5C4XC 4X6AC 2JA8K 1I50K 4Y7NC 4QJVB 4BY7K 3FKIK 5M5YK 2JA8C 1I50C 1I3QC 4A3IK 4QIWD 4OINA 3GTQK 4BY7C 2O5JA 3GTGK 3FKIC 3GTQC 5IP9K 5TMCA 3GTGC 3RZDK 1K83K 1TWAK 5IP9C 3GTKK 4YFNA 2WAQD 5FJ8K 2R7ZK 3S17C 2CW0A 3S1QK 4G7HA 1TWAC 1K83C 3RZDC 3GTKC 3H3VD 1SMYA 2R7ZC 4A3CK 3S1QC 4A3BK 1TWCK 4Y52K 5M5WK 3GTMK 2NVYK 4OIQA 3HOZK 4C3IK 4A3CC 3M4OK 4A3BC 1TWCC 4A3JK 4XSXA 2NVYC 3GTMC 3HOZC 4BBRK 3M4OC 4A3JC 2Y0SD 3S17K 5IYDK 2A69A 4BBRC 4YG2A 4ZH4A 2WB1D 4C3HK 5IYDC 5C3EK 3S2HC 5C3EC 3K7AK 3S1NK 3CQZK 4G7ZA 3DXJA 3M3YK 3K7AC 4A3KK 3CQZC 5M5XK 1Y1VK 3M3YC 2BE5A 4A3KC 2PA8D 2JA7K 4A93K 4A3IC 5IP7K 3HKZD 1Y1VC 2JA7C 2NVXK 3S14K 4A3DK 4OIRA 1WCMK 2NVXC 4GZYA 2A6HA 3S14C 4A3DC 2A68A 4KN7A 3HOXK 3PO2K 2E2JK 3HOXC 3PO2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S L;  4QJV A;  5IYB K;  2E2J C;  5IYB C;  3I4M K;  4BY1 K;  4AYB L;  2NVQ K;  3GTL K;  1I6H K;  2JA5 K;  2NVT K;  3S1R K;  4KMU A;  4BY1 C;  2NVQ C;  2E2H K;  3GTL C;  4NOI A;  1TWF K;  3I4M C;  5C44 K;  3I4N K;  1I6H C;  3S1R C;  2E2H C;  4LJZ A;  3RZO K;  1TWF C;  4MEX A;  5C44 C;  3I4N C;  4XLP A;  4QIW L;  4A3M K;  3HOU K;  3S1N C;  2PA8 L;  4OIO A;  1BDF A;  3H0G K;  4A3M C;  3HOU C;  4C3J K;  4BBS K;  2WAQ L;  3H0G C;  4A93 C;  1XPP A;  4A3F K;  3S15 K;  4LK0 A;  3GTO K;  3HOY K;  5IP7 C;  3H3V L;  4BXX K;  2PMZ D;  3S15 C;  4A3F C;  2VUM K;  3GTO C;  3HOY C;  1TWG K;  4OIP A;  4BXX C;  2A6E A;  5D4D A;  2O5I A;  4G7O A;  1WCM C;  1TWG C;  2B63 K;  4MQ9 A;  3GTJ K;  3S2D K;  2R92 K;  3S16 K;  4Q5S A;  5C4X K;  2PPB A;  3S2D C;  4C2M K;  3S16 C;  3PO3 K;  2WB1 L;  4XSZ A;  3GTP K;  1YNN A;  2R93 K;  1I3Q K;  3PO3 C;  4YFK A;  3GTP C;  1HQM A;  3WOD A;  2E2I K;  1IW7 A;  2R93 C;  1Y1W K;  2JA5 C;  3EQL A;  2NVT C;  5IYC K;  2E2I C;  4A3E K;  1Y1W C;  5IYC C;  4JK1 A;  1TWH K;  4A3E C;  3HOV K;  3RZO C;  5TMF A;  4YFX A;  3HKZ L;  1TWH C;  3HOV C;  2PMZ L;  1SFO K;  5C4J K;  4BBS C;  4A3G K;  4XLN A;  3HOW K;  1ZYR A;  5C4J C;  1SFO C;  3S1M K;  3HOW C;  4A3G C;  4LK1 A;  4A3L K;  2JA6 K;  5FLM K;  2VUM C;  3S1M C;  4LLG A;  4A3L C;  2YU9 K;  2JA6 C;  5FLM C;  5M3F K;  2B63 C;  4Q4Z A;  3GTJ C;  1R9T K;  5M3M K;  2YU9 C;  1YNJ A;  3S2H K;  4AYB D;  4X6A K;  1I6V A;  4MEY A;  4Y52 C;  4Y7N K;  1R9T C;  2R92 C;  4KN4 A;  5C4X C;  4X6A C;  2JA8 K;  1I50 K;  4Y7N C;  4QJV B;  4BY7 K;  3FKI K;  5M5Y K;  2JA8 C;  1I50 C;  1I3Q C;  4A3I K;  4QIW D;  4OIN A;  3GTQ K;  4BY7 C;  2O5J A;  3GTG K;  3FKI C;  3GTQ C;  5IP9 K;  5TMC A;  3GTG C;  3RZD K;  1K83 K;  1TWA K;  5IP9 C;  3GTK K;  4YFN A;  2WAQ D;  5FJ8 K;  2R7Z K;  3S17 C;  2CW0 A;  3S1Q K;  4G7H A;  1TWA C;  1K83 C;  3RZD C;  3GTK C;  3H3V D;  1SMY A;  2R7Z C;  4A3C K;  3S1Q C;  4A3B K;  1TWC K;  4Y52 K;  5M5W K;  3GTM K;  2NVY K;  4OIQ A;  3HOZ K;  4C3I K;  4A3C C;  3M4O K;  4A3B C;  1TWC C;  4A3J K;  4XSX A;  2NVY C;  3GTM C;  3HOZ C;  4BBR K;  3M4O C;  4A3J C;  2Y0S D;  3S17 K;  5IYD K;  2A69 A;  4BBR C;  4YG2 A;  4ZH4 A;  2WB1 D;  4C3H K;  5IYD C;  5C3E K;  3S2H C;  5C3E C;  3K7A K;  3S1N K;  3CQZ K;  4G7Z A;  3DXJ A;  3M3Y K;  3K7A C;  4A3K K;  3CQZ C;  5M5X K;  1Y1V K;  3M3Y C;  2BE5 A;  4A3K C;  2PA8 D;  2JA7 K;  4A93 K;  4A3I C;  5IP7 K;  3HKZ D;  1Y1V C;  2JA7 C;  2NVX K;  3S14 K;  4A3D K;  4OIR A;  1WCM K;  2NVX C;  4GZY A;  2A6H A;  3S14 C;  4A3D C;  2A68 A;  4KN7 A;  3HOX K;  3PO2 K;  2E2J K;  3HOX C;  3PO2 C; 
#chains in the Genus database with same CATH topology
 1IQ0 A;  4GTB A;  3I4M K;  4AYB L;  1UV7 A;  2NVT K;  3S1R K;  4BY1 C;  3S17 C;  2E2H K;  1TWF K;  3I4N K;  1B4B A;  2PHC B;  1F7U A;  1PJ7 A;  3GTO K;  1TWF A;  5IP7 C;  3S15 C;  1WSR A;  4OIP A;  1HI9 A;  2CFA A;  2O5I A;  1ISE A;  1KQ4 A;  1DD5 A;  1TWG C;  2B63 K;  2JH3 A;  3GTJ K;  2PPB A;  1SFO A;  4KDD A;  3LAP A;  3S2D C;  3GTO A;  1BS2 A;  3PO3 K;  2D6F C;  4XSZ A;  3GTP K;  1I3Q K;  1HQM A;  3WOD A;  3JST A;  4GTF A;  2B63 A;  2NVT C;  3EQL A;  3GTJ A;  5IYC K;  4A3E C;  3HOV K;  2GSN A;  3GTP A;  1L0W A;  1I3Q A;  3CAG A;  3HOW K;  1ZYR A;  1SFO C;  1WSV A;  2JA6 K;  1IE0 A;  1K83 A;  4ILD A;  3GTK A;  3ORE A;  2B63 C;  4BLB A;  4Q4Z A;  3GTJ C;  5M3M K;  1AB4 A;  4KAT A;  4G0V A;  4Y7N C;  2JA6 A;  4BY7 K;  2JA8 C;  2O5J A;  1I3Q C;  5IOT A;  4G7H A;  1K83 C;  3GTK C;  4A3C K;  1X31 C;  1TWC K;  5M5W K;  3GTM K;  1GE9 A;  4OIQ A;  1WOO A;  2RGR A;  4A3J K;  4BBR K;  3M4O C;  1JQW A;  5IYD K;  2A69 A;  2GAG C;  4YG2 A;  2CFA B;  4ZH4 A;  2WB1 D;  1WQF A;  4AH6 A;  3GTM A;  5C3E C;  3K7A K;  1RU0 A;  3M3Y K;  4A3K K;  1WOR A;  1Y1V K;  4G0W A;  5JFE A;  1DCH A;  2NVX K;  3S14 K;  4A3D K;  3VA7 A;  3MML B;  1C0A A;  3AD8 C;  1Y1V A;  3HOX C;  2Y0S L;  4QJV A;  3GDZ A;  1IS1 A;  5CHP A;  2NVX A;  5IYB C;  4BY1 K;  5EGH A;  2GSU A;  2NVQ C;  1J6V A;  4MEX A;  1VH2 A;  5C44 C;  4QIW L;  1EQR A;  3A8K A;  1J6W A;  1EI6 A;  1XXA A;  3H0G C;  4GTC A;  4C3J C;  3S15 K;  4KMH A;  4LK0 A;  5TJ3 A;  2PMZ D;  1O27 A;  1O26 A;  4A3F C;  3T01 A;  3HOY C;  1TWG K;  2A6E A;  5D4D A;  4GTE A;  4G7O A;  4MQ9 A;  3S2D K;  3N0B A;  4KM9 A;  1TWG A;  4LR2 A;  2YU9 A;  2E2I C;  4A3E K;  1O28 A;  4JK1 A;  3HKZ L;  3Q3Q A;  1TWH C;  2Y3P A;  3IPJ A;  4GTD A;  1SFO K;  2P5M A;  3GTQ A;  2FQT A;  5C4J C;  4A3G C;  4LK1 A;  1PJ6 A;  3S1M C;  1WOP A;  4FM9 A;  5M3F K;  2YU9 C;  3S2H K;  4KMD A;  4AYB D;  4MEY A;  4Y7N K;  2JA8 K;  1XXB A;  4QJV B;  1WQH A;  3LAJ A;  4PAB A;  3AQP A;  1EH1 A;  4OIN A;  3FKI C;  3GTQ C;  1K83 K;  5IP9 C;  3GTK K;  2CW0 A;  5EGE A;  1TWA C;  4KAW X;  2V6U A;  4C45 A;  3L4J A;  1SMY A;  3OEP A;  4LQY A;  4PAA A;  3M4O K;  4A3B C;  2NVY C;  3HOZ C;  4C3I C;  1WQG A;  3N0C A;  4FZB A;  5C3E K;  3T00 A;  3S2H C;  4C3H C;  1V5V A;  1EK8 A;  3AD7 C;  5M5X K;  2PA8 D;  2FQO A;  1O2F B;  4GZY A;  2A6H A;  3N3Y A;  1XZQ A;  3HOX K;  2P8T A;  2ZUE A;  1XXC A;  5IYB K;  4LOW A;  2E2J C;  2NVQ K;  1YCL A;  2JA5 K;  1B4A A;  1ZVU A;  3GTL C;  1I6H C;  4P9S A;  4NOI A;  5C44 K;  3RZO K;  4XLP A;  1BDF A;  3H0G K;  1O2B A;  1PJ5 A;  4C3J K;  4A3M C;  3HOU C;  2R93 A;  2ZUF A;  2JA5 A;  2WAQ L;  1XPP A;  4A3F K;  3HOY K;  3H3V L;  2VUM K;  5CJ9 A;  4BXX C;  4DDQ A;  3BP3 A;  3H0G A;  4Q5S A;  5C4X K;  4G0U A;  1IBA A;  2KWA A;  3S16 C;  4WJ4 A;  2W7V A;  2VUM A;  4C2M C;  2E2I K;  1WIH A;  3AD9 C;  2R93 C;  2JA5 C;  1USO A;  4KB2 A;  1Y1W C;  1R9T A;  4XCH A;  1TWH K;  3RZO C;  1O24 A;  1EFW A;  1VLO A;  2PMZ L;  5C4J K;  2E2I A;  4A3G K;  3S1M K;  1YX2 A;  1O2A A;  1TWH A;  2VUM C;  4P5A A;  4LLG A;  1O25 A;  2YU9 K;  4A3L C;  1ZXO A;  5FLM C;  1BGW A;  1YNJ A;  1XZQ B;  1J98 A;  1I6V A;  2ZFZ A;  4Y52 C;  1R9T C;  4P5B A;  5C4X C;  2V6T A;  4X6A C;  1INN A;  3FKI K;  3FOF A;  1I50 C;  3GTQ K;  3GEI A;  1DCO A;  4QIW D;  5IP9 K;  3QX3 A;  5TMC A;  3GTG C;  1TWA K;  4YFN A;  2RH6 A;  3RZD C;  3SZY A;  2R7Z C;  1JOE A;  1F93 A;  4GTA A;  3S1Q C;  3FKI A;  4A3B K;  2NVY K;  2GSO A;  4C3I K;  3HOZ K;  1TWA A;  4J3N A;  3TFH A;  3GEE A;  1XZP A;  4KM8 A;  4C3H K;  2NVY A;  3TFI A;  3LPX A;  3S1N K;  3DXJ A;  3CQZ C;  3AQO A;  3HXA A;  4A93 K;  3HKZ D;  2JA7 C;  2E2H A;  3ERE D;  1WCM K;  4KN7 A;  2E2J K;  3PO2 C;  1F7V A;  4WJ3 M;  1F9N A;  1VRQ C;  1WCM A;  3GTL K;  1I6H K;  5HL8 A;  3I4M C;  4KMU A;  3BP8 C;  3S1R C;  2E2H C;  4LJZ A;  1TWF C;  3I4N C;  4A3M K;  3HOU K;  3S1N C;  2PA8 L;  3BUE A;  4OIO A;  3GSI A;  3GTL A;  4BBS K;  4WIL A;  4A93 C;  4O2D A;  4BXX K;  3GTO C;  5IOR A;  1WCM C;  3AH5 A;  3TTG A;  3G4A A;  2R92 K;  3S16 K;  4KMA A;  5L46 A;  4C2M K;  2WB1 L;  1YNN A;  2R93 K;  3PO3 C;  1ZBS A;  4YFK A;  3GTP C;  1IW7 A;  1Y1W K;  1XZP B;  3GEH A;  3A8I A;  3V4G A;  2R92 A;  5IYC C;  2XCO A;  4GT9 A;  1O29 A;  5TMF A;  4YFX A;  5IOS A;  3HOV C;  1JVI A;  2EBB A;  3GIR A;  4BBS C;  4XLN A;  1Y1W A;  3HOW C;  4A3L K;  3L4K A;  5FLM K;  1BJT A;  2JA6 C;  3TFJ A;  1IL2 A;  1DCP A;  4Y52 K;  4BLA A;  5IOQ A;  1USM A;  1R9T K;  5JVO A;  4X6A K;  1G51 A;  2R92 C;  1TWC A;  3G4C A;  4KN4 A;  3SZZ A;  1I50 K;  3FOE A;  5M5Y K;  4A3I K;  4GFQ A;  4BY7 C;  3GTG K;  3ADA C;  1VJE A;  2XCQ A;  3RZD K;  4KAS A;  2WAQ D;  5FJ8 K;  2R7Z K;  3S1Q K;  4M1X A;  1I50 A;  3H3V D;  4GTL A;  2GAH C;  4A3C C;  1ZQ1 C;  3GTG A;  4KAR A;  1TWC C;  4KB4 A;  4XSX A;  3GTM C;  1WOS A;  3FHZ A;  4A3J C;  2Y0S D;  2XCR B;  3S17 K;  2R7Z A;  4BBR C;  5IYD C;  3CQZ K;  4G7Z A;  3K7A C;  3T02 A;  3M3Y C;  2BE5 A;  4A3K C;  2JA7 K;  4A3I C;  5IP7 K;  1Y1V C;  4KC6 A;  1J6X A;  3NUH A;  4OIR A;  3OPF A;  4BKW A;  3S0X A;  3CQZ A;  2NVX C;  3S14 C;  4A3D C;  2A68 A;  5E68 A;  3A8J A;  3PO2 K;  1VGX A;  4RMF A;  2V6S A;  2JA7 A; 
#chains in the Genus database with same CATH homology
 2Y0S L;  4QJV A;  5IYB K;  2E2J C;  5IYB C;  3I4M K;  4BY1 K;  4AYB L;  2NVQ K;  3GTL K;  1I6H K;  2JA5 K;  2NVT K;  3S1R K;  4KMU A;  4BY1 C;  2NVQ C;  2E2H K;  3GTL C;  4NOI A;  1TWF K;  3I4M C;  5C44 K;  3I4N K;  1I6H C;  3S1R C;  2E2H C;  4LJZ A;  3RZO K;  1TWF C;  4MEX A;  5C44 C;  3I4N C;  4XLP A;  4QIW L;  4A3M K;  3HOU K;  3S1N C;  2PA8 L;  4OIO A;  1BDF A;  3H0G K;  4A3M C;  3HOU C;  4C3J K;  4BBS K;  2WAQ L;  3H0G C;  4A93 C;  1XPP A;  4A3F K;  3S15 K;  4LK0 A;  3GTO K;  3HOY K;  5IP7 C;  3H3V L;  4BXX K;  2PMZ D;  3S15 C;  4A3F C;  2VUM K;  3GTO C;  3HOY C;  1TWG K;  4OIP A;  4BXX C;  2A6E A;  5D4D A;  2O5I A;  4G7O A;  1WCM C;  1TWG C;  2B63 K;  4MQ9 A;  3GTJ K;  3S2D K;  2R92 K;  3S16 K;  4Q5S A;  5C4X K;  2PPB A;  3S2D C;  4C2M K;  3S16 C;  3PO3 K;  2WB1 L;  4XSZ A;  3GTP K;  1YNN A;  2R93 K;  1I3Q K;  3PO3 C;  4YFK A;  3GTP C;  1HQM A;  3WOD A;  2E2I K;  1IW7 A;  2R93 C;  1Y1W K;  2JA5 C;  3EQL A;  2NVT C;  5IYC K;  2E2I C;  4A3E K;  1Y1W C;  5IYC C;  4JK1 A;  1TWH K;  4A3E C;  3HOV K;  3RZO C;  5TMF A;  4YFX A;  3HKZ L;  1TWH C;  3HOV C;  2PMZ L;  1SFO K;  5C4J K;  4BBS C;  4A3G K;  4XLN A;  3HOW K;  1ZYR A;  5C4J C;  1SFO C;  3S1M K;  3HOW C;  4A3G C;  4LK1 A;  4A3L K;  2JA6 K;  5FLM K;  2VUM C;  3S1M C;  4LLG A;  4A3L C;  2YU9 K;  2JA6 C;  5FLM C;  5M3F K;  2B63 C;  4Q4Z A;  3GTJ C;  1R9T K;  5M3M K;  2YU9 C;  1YNJ A;  3S2H K;  4AYB D;  4X6A K;  1I6V A;  4MEY A;  4Y52 C;  4Y7N K;  1R9T C;  2R92 C;  4KN4 A;  5C4X C;  4X6A C;  2JA8 K;  1I50 K;  4Y7N C;  4QJV B;  4BY7 K;  3FKI K;  5M5Y K;  2JA8 C;  1I50 C;  1I3Q C;  4A3I K;  4QIW D;  4OIN A;  3GTQ K;  4BY7 C;  2O5J A;  3GTG K;  3FKI C;  3GTQ C;  5IP9 K;  5TMC A;  3GTG C;  3RZD K;  1K83 K;  1TWA K;  5IP9 C;  3GTK K;  4YFN A;  2WAQ D;  5FJ8 K;  2R7Z K;  3S17 C;  2CW0 A;  3S1Q K;  4G7H A;  1TWA C;  1K83 C;  3RZD C;  3GTK C;  3H3V D;  1SMY A;  2R7Z C;  4A3C K;  3S1Q C;  4A3B K;  1TWC K;  4Y52 K;  5M5W K;  3GTM K;  2NVY K;  4OIQ A;  3HOZ K;  4C3I K;  4A3C C;  3M4O K;  4A3B C;  1TWC C;  4A3J K;  4XSX A;  2NVY C;  3GTM C;  3HOZ C;  4BBR K;  3M4O C;  4A3J C;  2Y0S D;  3S17 K;  5IYD K;  2A69 A;  4BBR C;  4YG2 A;  4ZH4 A;  2WB1 D;  4C3H K;  5IYD C;  5C3E K;  3S2H C;  5C3E C;  3K7A K;  3S1N K;  3CQZ K;  4G7Z A;  3DXJ A;  3M3Y K;  3K7A C;  4A3K K;  3CQZ C;  5M5X K;  1Y1V K;  3M3Y C;  2BE5 A;  4A3K C;  2PA8 D;  2JA7 K;  4A93 K;  4A3I C;  5IP7 K;  3HKZ D;  1Y1V C;  2JA7 C;  2NVX K;  3S14 K;  4A3D K;  4OIR A;  1WCM K;  2NVX C;  4GZY A;  2A6H A;  3S14 C;  4A3D C;  2A68 A;  4KN7 A;  3HOX K;  3PO2 K;  2E2J K;  3HOX C;  3PO2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...