2E2IK

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2iK00
2Y0SL 3GTOC 3HOXC 1TWGC 1TWFC 3HOWC 3GTPC 4BXXC 2E2JK 2R93K 4YFKA 2NVYK 3GTJC 1IW7A 3S2HK 2VUMC 4OINA 2WB1D 4A3MK 3S17K 4XSZA 3S2HC 1R9TC 2R93C 3S15K 2O5JA 4A3EK 1Y1WC 4A3IC 4A3MC 4QJVA 2R92K 4MQ9A 4XLPA 4BY1K 2YU9C 5FJ8K 1BDFA 4GZYA 4XSXA 1ZYRA 5IYDK 3H0GC 1I6HK 1Y1VK 2A6HA 3HOVK 3M4OC 3PO3K 1I6HC 3HKZL 1I3QK 4LK0A 4C2MK 4Y7NC 3HOVC 3GTMK 5M5YK 2WB1L 4Y52C 3GTGK 3GTOK 4KN7A 3M3YC 1I3QC 1TWGK 1TWFK 3HOWK 1SMYA 2A6EA 3GTPK 3GTMC 4NOIA 3GTJK 1I50K 3S2DK 3DXJA 4A3KC 2VUMK 2WAQD 4A3CC 4LK1A 4AYBD 3S2DC 3EQLA 1I50C 4G7OA 1R9TK 3RZDC 3CQZC 2O5IA 1Y1WK 1XPPA 4A3IK 2JA7C 4LJZA 2PPBA 1I6VA 5M5WK 4BBSC 5C44K 2E2IK 2YU9K 3RZOC 5IP7C 1YNJA 5C44C 2E2IC 2JA6C 4QJVB 3H0GK 4OIQA 2PA8D 3H3VL 2R7ZK 4A93C 3M4OK 4Q4ZA 4C3IK 4C3HK 1K83C 4LLGA 4YFXA 5M3MK 2WAQL 4Y7NK 4MEXA 2R7ZC 4ZH4A 4Y52K 3M3YK 3HOZK 2B63K 1TWHK 2PMZD 4A3BC 5C4XC 4A3KK 4A3CK 5IYCC 5M5XK 5M3FK 3HOZC 2B63C 2A69A 1TWHC 1WCMK 3K7AC 5IP9K 5TMCA 4OIRA 3RZDK 4XLNA 2NVXC 3I4NK 3CQZK 3S1QC 4BY7C 3S14C 2JA7K 1WCMC 5IP9C 3I4NC 4KMUA 4BBSK 2A68A 4A3JC 3RZOK 3FKIC 5IP7K 4BBRK 4Q5SA 4A3LK 2JA6K 4A3FC 4BBRC 1TWCC 3S1RC 4A93K 1HQMA 5C3EC 3S16C 4A3LC 5IYBK 1K83K 3GTLC 3WODA 2JA8C 5IYBC 3S1MC 4MEYA 3HOYK 3I4MK 5D4DA 3GTQC 4A3BK 4AYBL 5C4XK 4G7HA 3HOYC 5IYCK 2BE5A 2JA5C 3GTKC 1SFOK 3I4MC 4A3GK 3K7AK 3S1NK 3S1QK 2NVTC 3HKZD 4BY7K 2NVXK 1SFOC 3S14K 4A3GC 3S1NC 4QIWD 2E2JC 2NVYC 4G7ZA 4A3JK 1TWAK 3FKIK 4KN4A 2Y0SD 3S17C 2PA8L 3S15C 4A3DK 1TWAC 4A3EC 4A3FK 3PO2K 1TWCK 1YNNA 3S1RK 2E2HK 5C3EK 2R92C 4BY1C 3S16K 4A3DC 4YG2A 4OIOA 3HOUK 4X6AK 3PO2C 3GTLK 4YFNA 2E2HC 2JA8K 2NVTK 3HOUC 3S1MK 2PMZL 5IYDC 5TMFA 4X6AC 1Y1VC 3GTQK 4C3JK 5C4JK 5FLMK 2NVQK 4OIPA 3PO3C 3H3VD 2CW0A 4QIWL 2JA5K 3HOXK 3GTKK 4JK1A 5C4JC 4BXXK 5FLMC 2NVQC 3GTGC
chains in the Genus database with same CATH superfamily
3GTOC 3GTJC 1IW7A 1ZXOA 2GSOA 2R93C 3S2HC 4A3EK 1ZBSA 2FQTA 1DCPA 4MQ9A 4KM9A 5E68A 3GTMA 1AB4A 3GTGA 3HOVK 3GTOA 1I6HC 3HKZL 1F7VA 4C3HC 3L4JA 3GTJA 5EGEA 3GTMK 3GTGK 3GTOK 4KN7A 1SMYA 2A6EA 5TJ3A 3S2DK 3GTJK 1BS2A 3DXJA 4A3CC 4AYBD 1IL2A 3EQLA 1I50C 4G7OA 1BJTA 4P5BA 4LQYA 5C44K 1WQHA 1J98A 4QJVB 2PA8D 2R7ZK 1WOSA 4C3HK 1K83C 3LAPA 4YFXA 1V5VA 1I50A 2V6UA 2XCOA 4G0WA 1WOOA 4A3CK 3HOZC 2B63C 5IP9K 4OIRA 2NVXC 3QX3A 4A3JC 3FKIC 3L4KA 4KB4A 4Q5SA 1B4BA 2GSNA 1K83A 1C0AA 5C3EC 2GAHC 1K83K 3GTLC 1VLOA 3MMLB 2JA8C 2RGRA 2P8TA 2B63A 3I4MK 3GTQC 2NVXA 5EGHA 3T02A 3HKZD 1RU0A 2NVXK 3FKIA 5IOQA 1O2AA 2NVYC 4G7ZA 4A3JK 3FKIK 2Y0SD 3S17C 3S15C 2RH6A 4A3DK 3GTLA 3ADAC 3FOFA 5C3EK 4BY1C 3N0CA 4YG2A 4X6AK 3GTQA 3GTLK 2JA8K 3HOUC 1VH2A 3GTQK 2NVQK 5CJ9A 2CW0A 3HOXK 2NVYA 5C4JC 4BXXK 4XLPA 1TWGC 3HOWC 1USOA 2V6TA 4YFKA 2NVYK 4OINA 1F9NA 3S17K 1R9TC 3S15K 4BY1K 1DCHA 2YU9C 1XZPA 4LOWA 1ZQ1C 4XSXA 2P5MA 3LAJA 1WQFA 2GSUA 5IOSA 3IPJA 1TWGA 1I3QK 4O2DA 3HOVC 4G0VA 2WB1L 1EI6A 1TWGK 3HOWK 4WILA 4PABA 1R9TA 3GTMC 4NOIA 4A3KC 1EFWA 4LK1A 2ZFZA 3S2DC 1R9TK 2YU9A 3RZDC 3CQZC 2O5IA 2JA7C 2XCQA 4RMFA 4BLAA 5IORA 2YU9K 3RZOC 1YNJA 5C44C 2JA6C 4OIQA 4P5AA 4C3IK 2R7ZC 1TWHA 4MEXA 2CFAB 2WAQL 1J6VA 4ZH4A 1IBAA 1B4AA 3HXAA 4G0UA 3A8KA 1TWHK 3CQZA 4A3KK 2JA7A 5M3FK 3K7AC 3S1QC 1DCOA 3RZDK 3CQZK 3A8JA 4KMAA 2JA7K 5IP9C 1XZQA 2JA6A 1EH1A 2A68A 3RZOK 3FOEA 4GTDA 4J3NA 2XCRB 4A3LK 2JA6K 4LR2A 2R7ZA 3N0BA 1HQMA 1XXCA 3S16C 1JQWA 4WJ3M 3WODA 3S1MC 1SFOA 3HOYK 3SZZA 4PAAA 5D4DA 2JA5C 3I4MC 1SFOK 3K7AK 3S1QK 5IOTA 1TWAA 3ERED 3GEEA 5L46A 2ZUEA 3A8IA 1TWAK 1USMA 2D6FC 1WOPA 4GTCA 3S16K 4A3DC 4BKWA 4OIOA 5JVOA 2JA5A 3S1MK 2PMZL 4X6AC 3PO3C 3AH5A 2JA5K 4QIWL 4DDQA 4JK1A 2NVQC 2ZUFA 1ISEA 3HOXC 4BXXC 4WJ4A 4AH6A 4A3MK 1DD5A 4XSZA 3BP3A 3TFHA 4A3IC 4QJVA 1IE0A 5FJ8K 4BLBA 4GZYA 1VRQC 4KC6A 2PHCB 1PJ6A 1O25A 3M4OC 3PO3K 5CHPA 4LK0A 5M5YK 3JSTA 4Y52C 1I3QC 3NUHA 2KWAA 1GE9A 1YX2A 4KM8A 3N3YA 3TTGA 3LPXA 1XPPA 3FHZA 1L0WA 4A3IK 2PPBA 3OREA 5M5WK 2E2IK 4GTFA 5IP7C 1J6WA 1F93A 3H3VL 1G51A 3M4OK 1PJ7A 4KB2A 1I3QA 5M3MK 4LLGA 1WQGA 4KAWX 4Y52K 1BGWA 4KDDA 4C3IC 1WCMA 1X31C 2PMZD 4A3BC 5C4XC 4GFQA 1TWHC 1WCMK 3I4NK 4BY7C 3S14C 4KMUA 3AD7C 4KARA 1WIHA 5IP7K 4GTAA 4ILDA 4BBRK 3GIRA 4XCHA 1UV7A 4FZBA 3OPFA 1TWCC 3TFJA 4A3LC 4GTLA 3TFIA 5IYBK 4MEYA 4C3JC 4A3BK 5C4XK 4G7HA 3HOYC 2BE5A 4A3GK 3S1NK 2NVTC 4BY7K 1SFOC 3S14K 3G4AA 2E2JC 1F7UA 1KQ4A 4KN4A 1TWCA 2E2HA 1JVIA 3GEIA 3T01A 1TWAC 2FQOA 3PO2K 1TWCK 1O2FB 2R92C 2E2HK 3GSIA 4YFNA 1IS1A 1YCLA 1WSVA 5IYDC 3OEPA 1Y1VC 4C3JK 5FLMK 4OIPA 3H3VD 4C2MC 2R93A 2NVTK 1EQRA 2Y0SL 2EBBA 3AD9C 1TWFC 3GTPC 1VGXA 2E2JK 1IQ0A 3S2HK 2R93K 2VUMC 3AQPA 2R92A 2WB1D 2O5JA 1Y1WC 4A3MC 4GTEA 2R92K 1O26A 1Y1VA 2Y3PA 3GDZA 1BDFA 4P9SA 1PJ5A 1ZYRA 2CFAA 1O2BA 5IYDK 2GAGC 3H0GC 1I6HK 1Y1VK 2A6HA 3G4CA 4KMDA 1TWFA 3GTPA 4C2MK 4Y7NC 2VUMA 3M3YC 3BUEA 1TWFK 3GTPK 1I50K 4M1XA 1Y1WA 2VUMK 2WAQD 3AQOA 1O28A 1Y1WK 4LJZA 1I6VA 4BBSC 3H0GA 1WSRA 2E2IC 1XXBA 3H0GK 4A93C 1JOEA 1XZPB 4Q4ZA 1ZVUA 4Y7NK 3M3YK 3HOZK 1O24A 2B63K 5IYCC 5M5XK 2A69A 5TMCA 4XLNA 1WCMC 3I4NC 1O29A 3Q3QA 2E2IA 3BP8C 4BBSK 3AD8C 4A3FC 3VA7A 4BBRC 3S1RC 4A93K 3GEHA 4KMHA 2V6SA 5JFEA 5IYBC 4GTBA 3T00A 1WORA 1EK8A 4AYBL 3CAGA 5IYCK 3GTKC 3V4GA 1INNA 4FM9A 4KASA 4KATA 4A3GC 2W7VA 3S1NC 4QIWD 3SZYA 5HL8A 1XXAA 2PA8L 2JH3A 4A3EC 4A3FK 1XZQB 1YNNA 3S1RK 3S0XA 3HOUK 3PO2C 2E2HC 3GTKA 4GT9A 1J6XA 5TMFA 1VJEA 5C4JK 4C45A 3GTKK 1O27A 5FLMC 1HI9A 3GTGC
chains in the Genus database with same CATH topology
2Y0SL 3GTOC 3HOXC 1TWGC 1TWFC 3HOWC 3GTPC 4BXXC 2E2JK 2R93K 4YFKA 2NVYK 3GTJC 1IW7A 3S2HK 2VUMC 4OINA 2WB1D 4A3MK 3S17K 4XSZA 3S2HC 1R9TC 2R93C 3S15K 2O5JA 4A3EK 1Y1WC 4A3IC 4A3MC 4QJVA 2R92K 4MQ9A 4XLPA 4BY1K 2YU9C 5FJ8K 1BDFA 4GZYA 4XSXA 1ZYRA 5IYDK 3H0GC 1I6HK 1Y1VK 2A6HA 3HOVK 3M4OC 3PO3K 1I6HC 3HKZL 1I3QK 4LK0A 4C2MK 4Y7NC 3HOVC 3GTMK 5M5YK 2WB1L 4Y52C 3GTGK 3GTOK 4KN7A 3M3YC 1I3QC 1TWGK 1TWFK 3HOWK 1SMYA 2A6EA 3GTPK 3GTMC 4NOIA 3GTJK 1I50K 3S2DK 3DXJA 4A3KC 2VUMK 2WAQD 4A3CC 4LK1A 4AYBD 3S2DC 3EQLA 1I50C 4G7OA 1R9TK 3RZDC 3CQZC 2O5IA 1Y1WK 1XPPA 4A3IK 2JA7C 4LJZA 2PPBA 1I6VA 5M5WK 4BBSC 5C44K 2E2IK 2YU9K 3RZOC 5IP7C 1YNJA 5C44C 2E2IC 2JA6C 4QJVB 3H0GK 4OIQA 2PA8D 3H3VL 2R7ZK 4A93C 3M4OK 4Q4ZA 4C3IK 4C3HK 1K83C 4LLGA 4YFXA 5M3MK 2WAQL 4Y7NK 4MEXA 2R7ZC 4ZH4A 4Y52K 3M3YK 3HOZK 2B63K 1TWHK 2PMZD 4A3BC 5C4XC 4A3KK 4A3CK 5IYCC 5M5XK 5M3FK 3HOZC 2B63C 2A69A 1TWHC 1WCMK 3K7AC 5IP9K 5TMCA 4OIRA 3RZDK 4XLNA 2NVXC 3I4NK 3CQZK 3S1QC 4BY7C 3S14C 2JA7K 1WCMC 5IP9C 3I4NC 4KMUA 4BBSK 2A68A 4A3JC 3RZOK 3FKIC 5IP7K 4BBRK 4Q5SA 4A3LK 2JA6K 4A3FC 4BBRC 1TWCC 3S1RC 4A93K 1HQMA 5C3EC 3S16C 4A3LC 5IYBK 1K83K 3GTLC 3WODA 2JA8C 5IYBC 3S1MC 4MEYA 3HOYK 3I4MK 5D4DA 3GTQC 4A3BK 4AYBL 5C4XK 4G7HA 3HOYC 5IYCK 2BE5A 2JA5C 3GTKC 1SFOK 3I4MC 4A3GK 3K7AK 3S1NK 3S1QK 2NVTC 3HKZD 4BY7K 2NVXK 1SFOC 3S14K 4A3GC 3S1NC 4QIWD 2E2JC 2NVYC 4G7ZA 4A3JK 1TWAK 3FKIK 4KN4A 2Y0SD 3S17C 2PA8L 3S15C 4A3DK 1TWAC 4A3EC 4A3FK 3PO2K 1TWCK 1YNNA 3S1RK 2E2HK 5C3EK 2R92C 4BY1C 3S16K 4A3DC 4YG2A 4OIOA 3HOUK 4X6AK 3PO2C 3GTLK 4YFNA 2E2HC 2JA8K 2NVTK 3HOUC 3S1MK 2PMZL 5IYDC 5TMFA 4X6AC 1Y1VC 3GTQK 4C3JK 5C4JK 5FLMK 2NVQK 4OIPA 3PO3C 3H3VD 2CW0A 4QIWL 2JA5K 3HOXK 3GTKK 4JK1A 5C4JC 4BXXK 5FLMC 2NVQC 3GTGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S L;  3GTO C;  3HOX C;  1TWG C;  1TWF C;  3HOW C;  3GTP C;  4BXX C;  2E2J K;  2R93 K;  4YFK A;  2NVY K;  3GTJ C;  1IW7 A;  3S2H K;  2VUM C;  4OIN A;  2WB1 D;  4A3M K;  3S17 K;  4XSZ A;  3S2H C;  1R9T C;  2R93 C;  3S15 K;  2O5J A;  4A3E K;  1Y1W C;  4A3I C;  4A3M C;  4QJV A;  2R92 K;  4MQ9 A;  4XLP A;  4BY1 K;  2YU9 C;  5FJ8 K;  1BDF A;  4GZY A;  4XSX A;  1ZYR A;  5IYD K;  3H0G C;  1I6H K;  1Y1V K;  2A6H A;  3HOV K;  3M4O C;  3PO3 K;  1I6H C;  3HKZ L;  1I3Q K;  4LK0 A;  4C2M K;  4Y7N C;  3HOV C;  3GTM K;  5M5Y K;  2WB1 L;  4Y52 C;  3GTG K;  3GTO K;  4KN7 A;  3M3Y C;  1I3Q C;  1TWG K;  1TWF K;  3HOW K;  1SMY A;  2A6E A;  3GTP K;  3GTM C;  4NOI A;  3GTJ K;  1I50 K;  3S2D K;  3DXJ A;  4A3K C;  2VUM K;  2WAQ D;  4A3C C;  4LK1 A;  4AYB D;  3S2D C;  3EQL A;  1I50 C;  4G7O A;  1R9T K;  3RZD C;  3CQZ C;  2O5I A;  1Y1W K;  1XPP A;  4A3I K;  2JA7 C;  4LJZ A;  2PPB A;  1I6V A;  5M5W K;  4BBS C;  5C44 K;  2E2I K;  2YU9 K;  3RZO C;  5IP7 C;  1YNJ A;  5C44 C;  2E2I C;  2JA6 C;  4QJV B;  3H0G K;  4OIQ A;  2PA8 D;  3H3V L;  2R7Z K;  4A93 C;  3M4O K;  4Q4Z A;  4C3I K;  4C3H K;  1K83 C;  4LLG A;  4YFX A;  5M3M K;  2WAQ L;  4Y7N K;  4MEX A;  2R7Z C;  4ZH4 A;  4Y52 K;  3M3Y K;  3HOZ K;  2B63 K;  1TWH K;  2PMZ D;  4A3B C;  5C4X C;  4A3K K;  4A3C K;  5IYC C;  5M5X K;  5M3F K;  3HOZ C;  2B63 C;  2A69 A;  1TWH C;  1WCM K;  3K7A C;  5IP9 K;  5TMC A;  4OIR A;  3RZD K;  4XLN A;  2NVX C;  3I4N K;  3CQZ K;  3S1Q C;  4BY7 C;  3S14 C;  2JA7 K;  1WCM C;  5IP9 C;  3I4N C;  4KMU A;  4BBS K;  2A68 A;  4A3J C;  3RZO K;  3FKI C;  5IP7 K;  4BBR K;  4Q5S A;  4A3L K;  2JA6 K;  4A3F C;  4BBR C;  1TWC C;  3S1R C;  4A93 K;  1HQM A;  5C3E C;  3S16 C;  4A3L C;  5IYB K;  1K83 K;  3GTL C;  3WOD A;  2JA8 C;  5IYB C;  3S1M C;  4MEY A;  3HOY K;  3I4M K;  5D4D A;  3GTQ C;  4A3B K;  4AYB L;  5C4X K;  4G7H A;  3HOY C;  5IYC K;  2BE5 A;  2JA5 C;  3GTK C;  1SFO K;  3I4M C;  4A3G K;  3K7A K;  3S1N K;  3S1Q K;  2NVT C;  3HKZ D;  4BY7 K;  2NVX K;  1SFO C;  3S14 K;  4A3G C;  3S1N C;  4QIW D;  2E2J C;  2NVY C;  4G7Z A;  4A3J K;  1TWA K;  3FKI K;  4KN4 A;  2Y0S D;  3S17 C;  2PA8 L;  3S15 C;  4A3D K;  1TWA C;  4A3E C;  4A3F K;  3PO2 K;  1TWC K;  1YNN A;  3S1R K;  2E2H K;  5C3E K;  2R92 C;  4BY1 C;  3S16 K;  4A3D C;  4YG2 A;  4OIO A;  3HOU K;  4X6A K;  3PO2 C;  3GTL K;  4YFN A;  2E2H C;  2JA8 K;  2NVT K;  3HOU C;  3S1M K;  2PMZ L;  5IYD C;  5TMF A;  4X6A C;  1Y1V C;  3GTQ K;  4C3J K;  5C4J K;  5FLM K;  2NVQ K;  4OIP A;  3PO3 C;  3H3V D;  2CW0 A;  4QIW L;  2JA5 K;  3HOX K;  3GTK K;  4JK1 A;  5C4J C;  4BXX K;  5FLM C;  2NVQ C;  3GTG C; 
#chains in the Genus database with same CATH topology
 3GTO C;  3GTJ C;  1IW7 A;  1ZXO A;  2GSO A;  2R93 C;  3S2H C;  4A3E K;  1ZBS A;  2FQT A;  1DCP A;  4MQ9 A;  4KM9 A;  5E68 A;  3GTM A;  1AB4 A;  3GTG A;  3HOV K;  3GTO A;  1I6H C;  3HKZ L;  1F7V A;  4C3H C;  3L4J A;  3GTJ A;  5EGE A;  3GTM K;  3GTG K;  3GTO K;  4KN7 A;  1SMY A;  2A6E A;  5TJ3 A;  3S2D K;  3GTJ K;  1BS2 A;  3DXJ A;  4A3C C;  4AYB D;  1IL2 A;  3EQL A;  1I50 C;  4G7O A;  1BJT A;  4P5B A;  4LQY A;  5C44 K;  1WQH A;  1J98 A;  4QJV B;  2PA8 D;  2R7Z K;  1WOS A;  4C3H K;  1K83 C;  3LAP A;  4YFX A;  1V5V A;  1I50 A;  2V6U A;  2XCO A;  4G0W A;  1WOO A;  4A3C K;  3HOZ C;  2B63 C;  5IP9 K;  4OIR A;  2NVX C;  3QX3 A;  4A3J C;  3FKI C;  3L4K A;  4KB4 A;  4Q5S A;  1B4B A;  2GSN A;  1K83 A;  1C0A A;  5C3E C;  2GAH C;  1K83 K;  3GTL C;  1VLO A;  3MML B;  2JA8 C;  2RGR A;  2P8T A;  2B63 A;  3I4M K;  3GTQ C;  2NVX A;  5EGH A;  3T02 A;  3HKZ D;  1RU0 A;  2NVX K;  3FKI A;  5IOQ A;  1O2A A;  2NVY C;  4G7Z A;  4A3J K;  3FKI K;  2Y0S D;  3S17 C;  3S15 C;  2RH6 A;  4A3D K;  3GTL A;  3ADA C;  3FOF A;  5C3E K;  4BY1 C;  3N0C A;  4YG2 A;  4X6A K;  3GTQ A;  3GTL K;  2JA8 K;  3HOU C;  1VH2 A;  3GTQ K;  2NVQ K;  5CJ9 A;  2CW0 A;  3HOX K;  2NVY A;  5C4J C;  4BXX K;  4XLP A;  1TWG C;  3HOW C;  1USO A;  2V6T A;  4YFK A;  2NVY K;  4OIN A;  1F9N A;  3S17 K;  1R9T C;  3S15 K;  4BY1 K;  1DCH A;  2YU9 C;  1XZP A;  4LOW A;  1ZQ1 C;  4XSX A;  2P5M A;  3LAJ A;  1WQF A;  2GSU A;  5IOS A;  3IPJ A;  1TWG A;  1I3Q K;  4O2D A;  3HOV C;  4G0V A;  2WB1 L;  1EI6 A;  1TWG K;  3HOW K;  4WIL A;  4PAB A;  1R9T A;  3GTM C;  4NOI A;  4A3K C;  1EFW A;  4LK1 A;  2ZFZ A;  3S2D C;  1R9T K;  2YU9 A;  3RZD C;  3CQZ C;  2O5I A;  2JA7 C;  2XCQ A;  4RMF A;  4BLA A;  5IOR A;  2YU9 K;  3RZO C;  1YNJ A;  5C44 C;  2JA6 C;  4OIQ A;  4P5A A;  4C3I K;  2R7Z C;  1TWH A;  4MEX A;  2CFA B;  2WAQ L;  1J6V A;  4ZH4 A;  1IBA A;  1B4A A;  3HXA A;  4G0U A;  3A8K A;  1TWH K;  3CQZ A;  4A3K K;  2JA7 A;  5M3F K;  3K7A C;  3S1Q C;  1DCO A;  3RZD K;  3CQZ K;  3A8J A;  4KMA A;  2JA7 K;  5IP9 C;  1XZQ A;  2JA6 A;  1EH1 A;  2A68 A;  3RZO K;  3FOE A;  4GTD A;  4J3N A;  2XCR B;  4A3L K;  2JA6 K;  4LR2 A;  2R7Z A;  3N0B A;  1HQM A;  1XXC A;  3S16 C;  1JQW A;  4WJ3 M;  3WOD A;  3S1M C;  1SFO A;  3HOY K;  3SZZ A;  4PAA A;  5D4D A;  2JA5 C;  3I4M C;  1SFO K;  3K7A K;  3S1Q K;  5IOT A;  1TWA A;  3ERE D;  3GEE A;  5L46 A;  2ZUE A;  3A8I A;  1TWA K;  1USM A;  2D6F C;  1WOP A;  4GTC A;  3S16 K;  4A3D C;  4BKW A;  4OIO A;  5JVO A;  2JA5 A;  3S1M K;  2PMZ L;  4X6A C;  3PO3 C;  3AH5 A;  2JA5 K;  4QIW L;  4DDQ A;  4JK1 A;  2NVQ C;  2ZUF A;  1ISE A;  3HOX C;  4BXX C;  4WJ4 A;  4AH6 A;  4A3M K;  1DD5 A;  4XSZ A;  3BP3 A;  3TFH A;  4A3I C;  4QJV A;  1IE0 A;  5FJ8 K;  4BLB A;  4GZY A;  1VRQ C;  4KC6 A;  2PHC B;  1PJ6 A;  1O25 A;  3M4O C;  3PO3 K;  5CHP A;  4LK0 A;  5M5Y K;  3JST A;  4Y52 C;  1I3Q C;  3NUH A;  2KWA A;  1GE9 A;  1YX2 A;  4KM8 A;  3N3Y A;  3TTG A;  3LPX A;  1XPP A;  3FHZ A;  1L0W A;  4A3I K;  2PPB A;  3ORE A;  5M5W K;  2E2I K;  4GTF A;  5IP7 C;  1J6W A;  1F93 A;  3H3V L;  1G51 A;  3M4O K;  1PJ7 A;  4KB2 A;  1I3Q A;  5M3M K;  4LLG A;  1WQG A;  4KAW X;  4Y52 K;  1BGW A;  4KDD A;  4C3I C;  1WCM A;  1X31 C;  2PMZ D;  4A3B C;  5C4X C;  4GFQ A;  1TWH C;  1WCM K;  3I4N K;  4BY7 C;  3S14 C;  4KMU A;  3AD7 C;  4KAR A;  1WIH A;  5IP7 K;  4GTA A;  4ILD A;  4BBR K;  3GIR A;  4XCH A;  1UV7 A;  4FZB A;  3OPF A;  1TWC C;  3TFJ A;  4A3L C;  4GTL A;  3TFI A;  5IYB K;  4MEY A;  4C3J C;  4A3B K;  5C4X K;  4G7H A;  3HOY C;  2BE5 A;  4A3G K;  3S1N K;  2NVT C;  4BY7 K;  1SFO C;  3S14 K;  3G4A A;  2E2J C;  1F7U A;  1KQ4 A;  4KN4 A;  1TWC A;  2E2H A;  1JVI A;  3GEI A;  3T01 A;  1TWA C;  2FQO A;  3PO2 K;  1TWC K;  1O2F B;  2R92 C;  2E2H K;  3GSI A;  4YFN A;  1IS1 A;  1YCL A;  1WSV A;  5IYD C;  3OEP A;  1Y1V C;  4C3J K;  5FLM K;  4OIP A;  3H3V D;  4C2M C;  2R93 A;  2NVT K;  1EQR A;  2Y0S L;  2EBB A;  3AD9 C;  1TWF C;  3GTP C;  1VGX A;  2E2J K;  1IQ0 A;  3S2H K;  2R93 K;  2VUM C;  3AQP A;  2R92 A;  2WB1 D;  2O5J A;  1Y1W C;  4A3M C;  4GTE A;  2R92 K;  1O26 A;  1Y1V A;  2Y3P A;  3GDZ A;  1BDF A;  4P9S A;  1PJ5 A;  1ZYR A;  2CFA A;  1O2B A;  5IYD K;  2GAG C;  3H0G C;  1I6H K;  1Y1V K;  2A6H A;  3G4C A;  4KMD A;  1TWF A;  3GTP A;  4C2M K;  4Y7N C;  2VUM A;  3M3Y C;  3BUE A;  1TWF K;  3GTP K;  1I50 K;  4M1X A;  1Y1W A;  2VUM K;  2WAQ D;  3AQO A;  1O28 A;  1Y1W K;  4LJZ A;  1I6V A;  4BBS C;  3H0G A;  1WSR A;  2E2I C;  1XXB A;  3H0G K;  4A93 C;  1JOE A;  1XZP B;  4Q4Z A;  1ZVU A;  4Y7N K;  3M3Y K;  3HOZ K;  1O24 A;  2B63 K;  5IYC C;  5M5X K;  2A69 A;  5TMC A;  4XLN A;  1WCM C;  3I4N C;  1O29 A;  3Q3Q A;  2E2I A;  3BP8 C;  4BBS K;  3AD8 C;  4A3F C;  3VA7 A;  4BBR C;  3S1R C;  4A93 K;  3GEH A;  4KMH A;  2V6S A;  5JFE A;  5IYB C;  4GTB A;  3T00 A;  1WOR A;  1EK8 A;  4AYB L;  3CAG A;  5IYC K;  3GTK C;  3V4G A;  1INN A;  4FM9 A;  4KAS A;  4KAT A;  4A3G C;  2W7V A;  3S1N C;  4QIW D;  3SZY A;  5HL8 A;  1XXA A;  2PA8 L;  2JH3 A;  4A3E C;  4A3F K;  1XZQ B;  1YNN A;  3S1R K;  3S0X A;  3HOU K;  3PO2 C;  2E2H C;  3GTK A;  4GT9 A;  1J6X A;  5TMF A;  1VJE A;  5C4J K;  4C45 A;  3GTK K;  1O27 A;  5FLM C;  1HI9 A;  3GTG C; 
#chains in the Genus database with same CATH homology
 2Y0S L;  3GTO C;  3HOX C;  1TWG C;  1TWF C;  3HOW C;  3GTP C;  4BXX C;  2E2J K;  2R93 K;  4YFK A;  2NVY K;  3GTJ C;  1IW7 A;  3S2H K;  2VUM C;  4OIN A;  2WB1 D;  4A3M K;  3S17 K;  4XSZ A;  3S2H C;  1R9T C;  2R93 C;  3S15 K;  2O5J A;  4A3E K;  1Y1W C;  4A3I C;  4A3M C;  4QJV A;  2R92 K;  4MQ9 A;  4XLP A;  4BY1 K;  2YU9 C;  5FJ8 K;  1BDF A;  4GZY A;  4XSX A;  1ZYR A;  5IYD K;  3H0G C;  1I6H K;  1Y1V K;  2A6H A;  3HOV K;  3M4O C;  3PO3 K;  1I6H C;  3HKZ L;  1I3Q K;  4LK0 A;  4C2M K;  4Y7N C;  3HOV C;  3GTM K;  5M5Y K;  2WB1 L;  4Y52 C;  3GTG K;  3GTO K;  4KN7 A;  3M3Y C;  1I3Q C;  1TWG K;  1TWF K;  3HOW K;  1SMY A;  2A6E A;  3GTP K;  3GTM C;  4NOI A;  3GTJ K;  1I50 K;  3S2D K;  3DXJ A;  4A3K C;  2VUM K;  2WAQ D;  4A3C C;  4LK1 A;  4AYB D;  3S2D C;  3EQL A;  1I50 C;  4G7O A;  1R9T K;  3RZD C;  3CQZ C;  2O5I A;  1Y1W K;  1XPP A;  4A3I K;  2JA7 C;  4LJZ A;  2PPB A;  1I6V A;  5M5W K;  4BBS C;  5C44 K;  2E2I K;  2YU9 K;  3RZO C;  5IP7 C;  1YNJ A;  5C44 C;  2E2I C;  2JA6 C;  4QJV B;  3H0G K;  4OIQ A;  2PA8 D;  3H3V L;  2R7Z K;  4A93 C;  3M4O K;  4Q4Z A;  4C3I K;  4C3H K;  1K83 C;  4LLG A;  4YFX A;  5M3M K;  2WAQ L;  4Y7N K;  4MEX A;  2R7Z C;  4ZH4 A;  4Y52 K;  3M3Y K;  3HOZ K;  2B63 K;  1TWH K;  2PMZ D;  4A3B C;  5C4X C;  4A3K K;  4A3C K;  5IYC C;  5M5X K;  5M3F K;  3HOZ C;  2B63 C;  2A69 A;  1TWH C;  1WCM K;  3K7A C;  5IP9 K;  5TMC A;  4OIR A;  3RZD K;  4XLN A;  2NVX C;  3I4N K;  3CQZ K;  3S1Q C;  4BY7 C;  3S14 C;  2JA7 K;  1WCM C;  5IP9 C;  3I4N C;  4KMU A;  4BBS K;  2A68 A;  4A3J C;  3RZO K;  3FKI C;  5IP7 K;  4BBR K;  4Q5S A;  4A3L K;  2JA6 K;  4A3F C;  4BBR C;  1TWC C;  3S1R C;  4A93 K;  1HQM A;  5C3E C;  3S16 C;  4A3L C;  5IYB K;  1K83 K;  3GTL C;  3WOD A;  2JA8 C;  5IYB C;  3S1M C;  4MEY A;  3HOY K;  3I4M K;  5D4D A;  3GTQ C;  4A3B K;  4AYB L;  5C4X K;  4G7H A;  3HOY C;  5IYC K;  2BE5 A;  2JA5 C;  3GTK C;  1SFO K;  3I4M C;  4A3G K;  3K7A K;  3S1N K;  3S1Q K;  2NVT C;  3HKZ D;  4BY7 K;  2NVX K;  1SFO C;  3S14 K;  4A3G C;  3S1N C;  4QIW D;  2E2J C;  2NVY C;  4G7Z A;  4A3J K;  1TWA K;  3FKI K;  4KN4 A;  2Y0S D;  3S17 C;  2PA8 L;  3S15 C;  4A3D K;  1TWA C;  4A3E C;  4A3F K;  3PO2 K;  1TWC K;  1YNN A;  3S1R K;  2E2H K;  5C3E K;  2R92 C;  4BY1 C;  3S16 K;  4A3D C;  4YG2 A;  4OIO A;  3HOU K;  4X6A K;  3PO2 C;  3GTL K;  4YFN A;  2E2H C;  2JA8 K;  2NVT K;  3HOU C;  3S1M K;  2PMZ L;  5IYD C;  5TMF A;  4X6A C;  1Y1V C;  3GTQ K;  4C3J K;  5C4J K;  5FLM K;  2NVQ K;  4OIP A;  3PO3 C;  3H3V D;  2CW0 A;  4QIW L;  2JA5 K;  3HOX K;  3GTK K;  4JK1 A;  5C4J C;  4BXX K;  5FLM C;  2NVQ C;  3GTG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...