1O2FB

Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
b'EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PTS system, glucose-specific IIA component
publication title Solution Structure of the Phosphoryl Transfer Complex between the Signal-transducing Protein IIAGlucose and the Cytoplasmic Domain of the Glucose Transporter IICBGlucose of the Escherichia coli Glucose Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 20
structure length 77
sequence length 77
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1o2fB00
1O2FB 3BP8C 3IPJA 3BP3A 1IBAA
chains in the Genus database with same CATH superfamily
1WOOA 1ZVUA 1G51A 3S1RK 2XCQA 2R93C 1USOA 1SFOC 3HOVC 4KN4A 4LJZA 5L46A 2JA6A 3I4NC 1EI6A 1XXCA 2CFAB 4A3LC 4G7OA 2E2IA 3GTKC 5C3EK 3OPFA 4BKWA 3FHZA 4A3IK 2KWAA 1Y1WK 3BUEA 4JK1A 4A3DK 2R92K 4BXXK 2V6TA 1ISEA 4BLBA 1DCPA 4GTDA 2CW0A 4GTCA 2JA5K 3QX3A 3PO3C 3GTMA 1VJEA 1TWHK 4XLNA 5M3MK 4A3GK 3I4MK 1EQRA 5IP7C 1I3QK 4FM9A 2JA5A 3S15C 3S2DK 1F7UA 1BS2A 2WB1D 3HOYC 2NVQK 4OIPA 4LOWA 1ZYRA 4MQ9A 2JA8C 1YCLA 1TWFC 4AH6A 4Q5SA 1TWCK 1EK8A 5IOSA 1B4BA 2PMZL 4A93K 5C44K 2GAHC 1ZBSA 3L4KA 1PJ7A 4GTFA 1I3QA 4KASA 5IYCK 4BY1K 4A3FC 2E2HC 4LK0A 2R93K 1YNJA 3DXJA 2NVXC 3N3YA 1O27A 4GTLA 2EBBA 1TWCA 4C2MC 5TJ3A 1J6WA 1XXBA 3AD7C 1C0AA 3AQPA 4XCHA 3H0GA 3GTKK 4GTAA 3S1NK 5IYBC 3V4GA 2R93A 4GZYA 2RH6A 3HKZL 3T01A 3CQZC 4KMUA 5EGHA 4KN7A 4BY7K 4XSZA 4KATA 1TWAC 3K7AC 5E68A 2NVYC 4GFQA 3GTKA 1DCHA 3PO3K 4BBRK 4C3IK 3A8JA 1ZXOA 2JA7C 3IPJA 3CAGA 1O2AA 4O2DA 4KMAA 3RZDC 2XCOA 5IP7K 5D4DA 4QJVA 2RGRA 2P8TA 4C3HK 3M3YK 3S15K 1KQ4A 1O2FB 1WCMC 2B63C 3S0XA 4QJVB 2PMZD 4A3JK 1WQGA 4GTBA 2YU9C 4QIWL 4GT9A 2Y0SL 5M3FK 5IYDC 1EH1A 2A68A 5CHPA 2NVTC 2VUMC 3GTGC 3VA7A 3GTJK 3L4JA 4A3FK 2E2IK 3S1MK 2NVXK 3OEPA 4KC6A 4G0WA 1PJ5A 3GTOC 3JSTA 4BLAA 4MEYA 3S1QC 3HOXC 1Y1VC 3GTJA 3HKZD 4P5AA 2E2HA 3S2HK 2XCRB 3GTMK 2NVXA 2V6UA 2FQOA 3CQZK 4G0VA 1O25A 1VRQC 4BBSC 3GTQC 2P5MA 3NUHA 2PA8L 4A3MC 3RZOC 4G7ZA 4J3NA 3S14C 4ZH4A 4C3JK 3TFJA 4LQYA 3S16C 2ZUFA 3CQZA 1R9TC 1XPPA 3RZDK 1IBAA 4LR2A 4A3CK 3S17C 1TWAA 2A69A 1TWGC 1RU0A 5FLMK 2Y0SD 2B63K 1XXAA 1I50K 4G0UA 5C4XC 4WJ3M 5C4JC 3GTLC 3HOZK 1I6HC 1XZPA 5IYDK 1IE0A 2E2JK 4KMDA 3SZZA 3H0GK 2B63A 4Y7NC 1I50A 1HQMA 4A3BC 1PJ6A 1SFOK 2YU9A 4A3KC 3GTOK 3HOVK 5IORA 3PO2C 1VLOA 5IP9C 3FKIC 4XLPA 1WORA 3I4NK 5EGEA 3AQOA 3HOXK 1Y1VK 1O28A 2PHCB 4MEXA 4A3LK 4X6AC 2GSOA 3LAPA 4KM9A 2JA6C 3HOWC 2V6SA 2PA8D 3GEIA 1SFOA 3G4AA 3GTOA 1YX2A 2GAGC 3A8KA 2BE5A 3N0BA 4A3EC 1I6VA 3GTPC 1Y1VA 4PAAA 4A3MK 3S14K 4KB2A 1GE9A 3TTGA 4YFXA 3S16K 2GSNA 1R9TK 3M4OC 1V5VA 4OIRA 3A8IA 1J98A 3LAJA 4P9SA 2WAQL 5C3EC 3GTQA 4DDQA 1TWGK 3GEHA 4C45A 1WOPA 1Y1WC 4KARA 4A3DC 2R92C 4KB4A 4GTEA 4BXXC 5C4XK 3GIRA 1WQHA 1R9TA 3HOYK 3GTLK 1IS1A 4YFNA 2JA8K 4NOIA 2JA5C 1TWFK 1TWGA 4PABA 1TWHC 5IOQA 4Y52C 1J6VA 2E2HK 4A3BK 4OIQA 4A3GC 3I4MC 1UV7A 1WSVA 4A3KK 3GTLA 2JH3A 3N0CA 1BJTA 2R7ZC 5IP9K 1J6XA 1TWFA 5TMFA 1BDFA 4C2MK 2O5JA 1VGXA 3ADAC 2A6EA 4X6AK 4AYBL 2PPBA 5IYBK 4KDDA 3GDZA 1WQFA 5JFEA 5IYCC 1SMYA 1JOEA 4LK1A 4A3EK 1BGWA 3GTPK 1TWAK 3K7AK 1O2BA 2NVYK 4OIOA 4OINA 2O5IA 2WAQD 2CFAA 1WOSA 1VH2A 3MMLB 5M5WK 3M4OK 2JA7K 3HOUC 2W7VA 4ILDA 3S1NC 3GTPA 4G7HA 2NVYA 3ERED 1EFWA 3AD9C 3AH5A 4QIWD 1WCMK 1K83C 4BY7C 1F7VA 2JA7A 4LLGA 2YU9K 3FOFA 3H3VL 2A6HA 4BBRC 4C3IC 4FZBA 2ZUEA 2NVTK 2VUMK 3GTGK 1Y1WA 1XZPB 4Y52K 2R92A 1WCMA 3AD8C 1O26A 3SZYA 2R7ZK 5FJ8K 4AYBD 4C3HC 3M3YC 2ZFZA 3S1QK 4WILA 1TWHA 2VUMA 3GTGA 1WIHA 5JVOA 4A3JC 1DCOA 3TFHA 3GSIA 3Q3QA 3T00A 2R7ZA 1IQ0A 5M5YK 3GTJC 1YNNA 4BBSK 5M5XK 1AB4A 3OREA 2D6FC 2E2IC 3S1MC 3GTQK 1INNA 4KMHA 3T02A 3S1RC 3RZOK 1IL2A 5HL8A 4P5BA 3HOUK 4KM8A 1O29A 1IW7A 3S2HC 3GEEA 3S17K 3GTMC 4A3IC 1F9NA 1XZQA 4KAWX 1L0WA 4XSXA 5IOTA 1K83K 3H3VD 1XZQB 3FOEA 5C4JK 1I6HK 4YFKA 4C3JC 2FQTA 2GSUA 1O24A 4Q4ZA 3G4CA 1JQWA 2Y3PA 1X31C 1K83A 4Y7NK 4A3CC 3BP8C 1ZQ1C 3PO2K 5FLMC 1DD5A 1F93A 3FKIK 1I3QC 3TFIA 3LPXA 5TMCA 1WSRA 1HI9A 3HXAA 4WJ4A 1I50C 3S2DC 3WODA 4YG2A 2NVQC 3HOZC 2JA6K 3HOWK 3BP3A 1USMA 1B4AA 4M1XA 2WB1L 1JVIA 1TWCC 2E2JC 4A93C 3EQLA 5C44C 3FKIA 3H0GC 5CJ9A 4BY1C 4RMFA
chains in the Genus database with same CATH topology
1O2FB 3BP8C 3IPJA 3BP3A 1IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2F B;  3BP8 C;  3IPJ A;  3BP3 A;  1IBA A; 
#chains in the Genus database with same CATH topology
 1WOO A;  1ZVU A;  1G51 A;  3S1R K;  2XCQ A;  2R93 C;  1USO A;  1SFO C;  3HOV C;  4KN4 A;  4LJZ A;  5L46 A;  2JA6 A;  3I4N C;  1EI6 A;  1XXC A;  2CFA B;  4A3L C;  4G7O A;  2E2I A;  3GTK C;  5C3E K;  3OPF A;  4BKW A;  3FHZ A;  4A3I K;  2KWA A;  1Y1W K;  3BUE A;  4JK1 A;  4A3D K;  2R92 K;  4BXX K;  2V6T A;  1ISE A;  4BLB A;  1DCP A;  4GTD A;  2CW0 A;  4GTC A;  2JA5 K;  3QX3 A;  3PO3 C;  3GTM A;  1VJE A;  1TWH K;  4XLN A;  5M3M K;  4A3G K;  3I4M K;  1EQR A;  5IP7 C;  1I3Q K;  4FM9 A;  2JA5 A;  3S15 C;  3S2D K;  1F7U A;  1BS2 A;  2WB1 D;  3HOY C;  2NVQ K;  4OIP A;  4LOW A;  1ZYR A;  4MQ9 A;  2JA8 C;  1YCL A;  1TWF C;  4AH6 A;  4Q5S A;  1TWC K;  1EK8 A;  5IOS A;  1B4B A;  2PMZ L;  4A93 K;  5C44 K;  2GAH C;  1ZBS A;  3L4K A;  1PJ7 A;  4GTF A;  1I3Q A;  4KAS A;  5IYC K;  4BY1 K;  4A3F C;  2E2H C;  4LK0 A;  2R93 K;  1YNJ A;  3DXJ A;  2NVX C;  3N3Y A;  1O27 A;  4GTL A;  2EBB A;  1TWC A;  4C2M C;  5TJ3 A;  1J6W A;  1XXB A;  3AD7 C;  1C0A A;  3AQP A;  4XCH A;  3H0G A;  3GTK K;  4GTA A;  3S1N K;  5IYB C;  3V4G A;  2R93 A;  4GZY A;  2RH6 A;  3HKZ L;  3T01 A;  3CQZ C;  4KMU A;  5EGH A;  4KN7 A;  4BY7 K;  4XSZ A;  4KAT A;  1TWA C;  3K7A C;  5E68 A;  2NVY C;  4GFQ A;  3GTK A;  1DCH A;  3PO3 K;  4BBR K;  4C3I K;  3A8J A;  1ZXO A;  2JA7 C;  3IPJ A;  3CAG A;  1O2A A;  4O2D A;  4KMA A;  3RZD C;  2XCO A;  5IP7 K;  5D4D A;  4QJV A;  2RGR A;  2P8T A;  4C3H K;  3M3Y K;  3S15 K;  1KQ4 A;  1O2F B;  1WCM C;  2B63 C;  3S0X A;  4QJV B;  2PMZ D;  4A3J K;  1WQG A;  4GTB A;  2YU9 C;  4QIW L;  4GT9 A;  2Y0S L;  5M3F K;  5IYD C;  1EH1 A;  2A68 A;  5CHP A;  2NVT C;  2VUM C;  3GTG C;  3VA7 A;  3GTJ K;  3L4J A;  4A3F K;  2E2I K;  3S1M K;  2NVX K;  3OEP A;  4KC6 A;  4G0W A;  1PJ5 A;  3GTO C;  3JST A;  4BLA A;  4MEY A;  3S1Q C;  3HOX C;  1Y1V C;  3GTJ A;  3HKZ D;  4P5A A;  2E2H A;  3S2H K;  2XCR B;  3GTM K;  2NVX A;  2V6U A;  2FQO A;  3CQZ K;  4G0V A;  1O25 A;  1VRQ C;  4BBS C;  3GTQ C;  2P5M A;  3NUH A;  2PA8 L;  4A3M C;  3RZO C;  4G7Z A;  4J3N A;  3S14 C;  4ZH4 A;  4C3J K;  3TFJ A;  4LQY A;  3S16 C;  2ZUF A;  3CQZ A;  1R9T C;  1XPP A;  3RZD K;  1IBA A;  4LR2 A;  4A3C K;  3S17 C;  1TWA A;  2A69 A;  1TWG C;  1RU0 A;  5FLM K;  2Y0S D;  2B63 K;  1XXA A;  1I50 K;  4G0U A;  5C4X C;  4WJ3 M;  5C4J C;  3GTL C;  3HOZ K;  1I6H C;  1XZP A;  5IYD K;  1IE0 A;  2E2J K;  4KMD A;  3SZZ A;  3H0G K;  2B63 A;  4Y7N C;  1I50 A;  1HQM A;  4A3B C;  1PJ6 A;  1SFO K;  2YU9 A;  4A3K C;  3GTO K;  3HOV K;  5IOR A;  3PO2 C;  1VLO A;  5IP9 C;  3FKI C;  4XLP A;  1WOR A;  3I4N K;  5EGE A;  3AQO A;  3HOX K;  1Y1V K;  1O28 A;  2PHC B;  4MEX A;  4A3L K;  4X6A C;  2GSO A;  3LAP A;  4KM9 A;  2JA6 C;  3HOW C;  2V6S A;  2PA8 D;  3GEI A;  1SFO A;  3G4A A;  3GTO A;  1YX2 A;  2GAG C;  3A8K A;  2BE5 A;  3N0B A;  4A3E C;  1I6V A;  3GTP C;  1Y1V A;  4PAA A;  4A3M K;  3S14 K;  4KB2 A;  1GE9 A;  3TTG A;  4YFX A;  3S16 K;  2GSN A;  1R9T K;  3M4O C;  1V5V A;  4OIR A;  3A8I A;  1J98 A;  3LAJ A;  4P9S A;  2WAQ L;  5C3E C;  3GTQ A;  4DDQ A;  1TWG K;  3GEH A;  4C45 A;  1WOP A;  1Y1W C;  4KAR A;  4A3D C;  2R92 C;  4KB4 A;  4GTE A;  4BXX C;  5C4X K;  3GIR A;  1WQH A;  1R9T A;  3HOY K;  3GTL K;  1IS1 A;  4YFN A;  2JA8 K;  4NOI A;  2JA5 C;  1TWF K;  1TWG A;  4PAB A;  1TWH C;  5IOQ A;  4Y52 C;  1J6V A;  2E2H K;  4A3B K;  4OIQ A;  4A3G C;  3I4M C;  1UV7 A;  1WSV A;  4A3K K;  3GTL A;  2JH3 A;  3N0C A;  1BJT A;  2R7Z C;  5IP9 K;  1J6X A;  1TWF A;  5TMF A;  1BDF A;  4C2M K;  2O5J A;  1VGX A;  3ADA C;  2A6E A;  4X6A K;  4AYB L;  2PPB A;  5IYB K;  4KDD A;  3GDZ A;  1WQF A;  5JFE A;  5IYC C;  1SMY A;  1JOE A;  4LK1 A;  4A3E K;  1BGW A;  3GTP K;  1TWA K;  3K7A K;  1O2B A;  2NVY K;  4OIO A;  4OIN A;  2O5I A;  2WAQ D;  2CFA A;  1WOS A;  1VH2 A;  3MML B;  5M5W K;  3M4O K;  2JA7 K;  3HOU C;  2W7V A;  4ILD A;  3S1N C;  3GTP A;  4G7H A;  2NVY A;  3ERE D;  1EFW A;  3AD9 C;  3AH5 A;  4QIW D;  1WCM K;  1K83 C;  4BY7 C;  1F7V A;  2JA7 A;  4LLG A;  2YU9 K;  3FOF A;  3H3V L;  2A6H A;  4BBR C;  4C3I C;  4FZB A;  2ZUE A;  2NVT K;  2VUM K;  3GTG K;  1Y1W A;  1XZP B;  4Y52 K;  2R92 A;  1WCM A;  3AD8 C;  1O26 A;  3SZY A;  2R7Z K;  5FJ8 K;  4AYB D;  4C3H C;  3M3Y C;  2ZFZ A;  3S1Q K;  4WIL A;  1TWH A;  2VUM A;  3GTG A;  1WIH A;  5JVO A;  4A3J C;  1DCO A;  3TFH A;  3GSI A;  3Q3Q A;  3T00 A;  2R7Z A;  1IQ0 A;  5M5Y K;  3GTJ C;  1YNN A;  4BBS K;  5M5X K;  1AB4 A;  3ORE A;  2D6F C;  2E2I C;  3S1M C;  3GTQ K;  1INN A;  4KMH A;  3T02 A;  3S1R C;  3RZO K;  1IL2 A;  5HL8 A;  4P5B A;  3HOU K;  4KM8 A;  1O29 A;  1IW7 A;  3S2H C;  3GEE A;  3S17 K;  3GTM C;  4A3I C;  1F9N A;  1XZQ A;  4KAW X;  1L0W A;  4XSX A;  5IOT A;  1K83 K;  3H3V D;  1XZQ B;  3FOE A;  5C4J K;  1I6H K;  4YFK A;  4C3J C;  2FQT A;  2GSU A;  1O24 A;  4Q4Z A;  3G4C A;  1JQW A;  2Y3P A;  1X31 C;  1K83 A;  4Y7N K;  4A3C C;  3BP8 C;  1ZQ1 C;  3PO2 K;  5FLM C;  1DD5 A;  1F93 A;  3FKI K;  1I3Q C;  3TFI A;  3LPX A;  5TMC A;  1WSR A;  1HI9 A;  3HXA A;  4WJ4 A;  1I50 C;  3S2D C;  3WOD A;  4YG2 A;  2NVQ C;  3HOZ C;  2JA6 K;  3HOW K;  3BP3 A;  1USM A;  1B4A A;  4M1X A;  2WB1 L;  1JVI A;  1TWC C;  2E2J C;  4A93 C;  3EQL A;  5C44 C;  3FKI A;  3H0G C;  5CJ9 A;  4BY1 C;  4RMF A; 
#chains in the Genus database with same CATH homology
 1O2F B;  3BP8 C;  3IPJ A;  3BP3 A;  1IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...