1O2FB

Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the Phosphoryl Transfer Complex between the Signal-transducing Protein IIAGlucose and the Cytoplasmic Domain of the Glucose Transporter IICBGlucose of the Escherichia coli Glucose Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS system, glucose-specific IIA component
total genus 20
structure length 77
sequence length 77
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1o2fB00
3IPJA 1O2FB 3BP8C 1IBAA 3BP3A
chains in the Genus database with same CATH superfamily
1I50C 3FOEA 1WIHA 4C2MC 4GTCA 1IW7A 5FLMK 1Y1WC 2A6HA 2GSOA 4C3JK 3S2HK 1HI9A 3GTMC 3GTKA 1L0WA 2R92C 1TWHC 3SZZA 2NVYA 1Y1VA 1XXAA 2R7ZK 2W7VA 4BXXK 3ADAC 4A3CK 5C44C 2O5JA 4QIWD 5TMCA 4A3BC 3T02A 5IP7C 2ZUFA 4FZBA 3S16K 4A3MC 4GTDA 1ISEA 4GTAA 3TFIA 3AD7C 5E68A 1Y1VC 1XPPA 2WB1L 5IP9K 4X6AC 1K83C 3GTPK 1ZYRA 3S1MK 1O28A 3HKZD 1IS1A 3GEEA 4GTEA 1K83K 3GTPC 4KAWX 1TWFC 1ZXOA 3ERED 2NVTC 2GAGC 3S1QK 1ZBSA 4FM9A 2WAQL 1VLOA 4LOWA 2JH3A 3N0CA 4Y52K 3PO2K 3H3VD 3S15C 3GTGC 1DD5A 3GTJK 4BLBA 3GEHA 5IOQA 5FJ8K 4WILA 2V6TA 1TWFK 4G0WA 4GTBA 4LQYA 3S1NK 2NVXA 4Y7NK 2JA6A 3PO3C 1O2BA 1PJ5A 4G0VA 4OIRA 3OREA 3RZOC 4YFKA 2E2IC 3GTMA 3GTPA 4YG2A 5C4JC 4BBSC 1IBAA 1SMYA 1Y1WK 4XLNA 3HOZK 1YNJA 3AD9C 2RH6A 3CQZK 2V6UA 4GZYA 5CJ9A 1I50A 4KN7A 3K7AK 1HQMA 4A3FK 3H3VL 1WQGA 1O25A 5IYDC 3TFJA 3S1RK 1TWCA 2JA7K 1Y1VK 3CQZA 4LR2A 5C3EK 2JA7A 1TWHA 4XCHA 3H0GC 4KN4A 3G4AA 2Y0SD 3AQOA 2R93A 1JOEA 2B63K 1O2FB 3OEPA 2E2JK 4BKWA 2P8TA 3Q3QA 1WOSA 3HOYC 4P5BA 3M4OK 4A3DK 1WCMC 3A8IA 5M5WK 2RGRA 4KM8A 4G0UA 1ZVUA 1I6HC 1Y1WA 2GSUA 4A3EK 1I3QK 5EGHA 3LAPA 1O27A 4C45A 1XZQB 4KMDA 4A3JC 4A3EC 1ZQ1C 4YFXA 4GTLA 4C2MK 4Q5SA 3I4MK 1BGWA 3TTGA 3I4NC 1UV7A 3V4GA 4NOIA 2R93C 3HOWC 4XSZA 4BY1K 2D6FC 1B4AA 1DCPA 2Y3PA 4AYBL 3QX3A 1VJEA 5M3MK 4MEXA 2E2IK 2VUMC 1VGXA 4JK1A 1TWAA 5JFEA 2XCQA 3EQLA 2YU9C 3GTQA 2E2HC 1I6VA 2NVYK 4C3IC 3WODA 1EH1A 2E2JC 2Y0SL 4Y52C 3HOXC 2A68A 4ZH4A 5IOSA 1IE0A 1I6HK 4XSXA 3S0XA 4LK0A 3L4JA 4G7HA 4KB4A 1G51A 4KMAA 1WORA 3GTGK 2ZFZA 2YU9A 4OIQA 4A3IC 1SFOC 5IYBC 3GTKC 5C3EC 3JSTA 2GAHC 1O24A 4A3CC 2CFAA 2JA8C 3GTOA 2P5MA 1TWHK 4Y7NC 1WQHA 1WSRA 2KWAA 3S1NC 1J6VA 1F93A 1WSVA 3HOYK 4A3DC 4WJ4A 3S2HC 5IYCC 2PA8L 1USOA 4C3JC 4BBRC 1TWCK 1K83A 3GTJC 1JQWA 1USMA 1C0AA 3GTLA 1INNA 1TWGC 1TWCC 5C4XC 1I50K 4A3JK 3HOVC 1AB4A 3S2DK 4MEYA 3HOUK 3M3YC 3PO3K 4A93C 1O2AA 4KATA 1KQ4A 1WCMK 3HOUC 1O29A 4OIOA 3HKZL 3S1MC 3S15K 3LAJA 3RZDC 2JA6K 2E2IA 4YFNA 2JA5C 3H0GK 2FQOA 3S1QC 3HOZC 2JA6C 3G4CA 2PMZL 1R9TC 4BBSK 4A3IK 5HL8A 5IP7K 4Q4ZA 4A3KK 2JA7C 4QIWL 2GSNA 1X31C 4KB2A 4A3BK 1F7UA 3AD8C 2E2HA 2FQTA 5IP9C 4X6AK 1J98A 3M3YK 4A93K 3CQZC 4LLGA 3L4KA 5IORA 1EFWA 3FKIA 1SFOK 3LPXA 4A3MK 2B63A 5C4JK 1I3QA 4O2DA 1TWGA 2PPBA 4BLAA 4BBRK 4OINA 4BXXC 1XZPA 2XCOA 3DXJA 1F7VA 2A69A 3HOVK 4A3GC 3N3YA 2V6SA 2JA8K 4RMFA 4OIPA 4C3IK 3FOFA 1VH2A 5IYBK 4DDQA 1XZQA 3GTKK 3AQPA 4KM9A 4PAAA 4GTFA 1B4BA 3BUEA 2PHCB 3RZDK 1EK8A 4BY7C 3S14C 3TFHA 2JA5A 4P5AA 2R7ZC 4KMUA 1TWFA 3NUHA 4A3KC 1J6XA 3BP8C 3GEIA 2BE5A 2NVQC 3GTMK 3IPJA 3S17C 4AH6A 1JVIA 4MQ9A 5M3FK 2PA8D 3S2DC 1J6WA 3S16C 2JA5K 4KARA 2NVXK 5EGEA 4A3LK 5L46A 5TJ3A 1BS2A 4PABA 4M1XA 1IQ0A 4C3HC 4G7OA 2EBBA 1EQRA 2VUMK 4KASA 3GTQC 1DCHA 3GTOK 1TWAC 1TWGK 5C4XK 4G7ZA 3T00A 4QJVB 3HOXK 5FLMC 2NVYC 3M4OC 5IYCK 3GIRA 1PJ6A 4KMHA 5D4DA 2PMZD 2R93K 4BY7K 2E2HK 3HXAA 2YU9K 1WOOA 3FKIK 1SFOA 2NVQK 5M5YK 4QJVA 3OPFA 3FHZA 3I4MC 2XCRB 1WQFA 2WB1D 3S1RC 4KC6A 4BY1C 1F9NA 1I3QC 4GT9A 4LK1A 4LJZA 4A3GK 4P9SA 2R7ZA 3GTLC 1YX2A 4KDDA 3I4NK 2CFAB 5IOTA 1WCMA 4XLPA 2NVXC 3H0GA 1BDFA 1XXBA 1XZPB 1IL2A 3PO2C 3T01A 4A3LC 1XXCA 4GFQA 3GTOC 5JVOA 2B63C 3GTQK 3GDZA 1TWAK 4WJ3M 3SZYA 1WOPA 5M5XK 1YCLA 4ILDA 4C3HK 2NVTK 1V5VA 3BP3A 3AH5A 3A8JA 2R92A 1DCOA 3GTJA 1R9TA 3GSIA 3S14K 2CW0A 2VUMA 3GTLK 1R9TK 3S17K 3VA7A 3A8KA 1PJ7A 5CHPA 5TMFA 1EI6A 2WAQD 3CAGA 3HOWK 5C44K 3FKIC 3MMLB 3RZOK 4A3FC 1BJTA 1RU0A 5IYDK 1O26A 2O5IA 2R92K 3GTGA 2ZUEA 3K7AC 1GE9A 1YNNA 2A6EA 3N0BA 4AYBD 1VRQC 4J3NA
chains in the Genus database with same CATH topology
3IPJA 1O2FB 3BP8C 1IBAA 3BP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPJ A;  1O2F B;  3BP8 C;  1IBA A;  3BP3 A; 
#chains in the Genus database with same CATH topology
 1I50 C;  3FOE A;  1WIH A;  4C2M C;  4GTC A;  1IW7 A;  5FLM K;  1Y1W C;  2A6H A;  2GSO A;  4C3J K;  3S2H K;  1HI9 A;  3GTM C;  3GTK A;  1L0W A;  2R92 C;  1TWH C;  3SZZ A;  2NVY A;  1Y1V A;  1XXA A;  2R7Z K;  2W7V A;  4BXX K;  3ADA C;  4A3C K;  5C44 C;  2O5J A;  4QIW D;  5TMC A;  4A3B C;  3T02 A;  5IP7 C;  2ZUF A;  4FZB A;  3S16 K;  4A3M C;  4GTD A;  1ISE A;  4GTA A;  3TFI A;  3AD7 C;  5E68 A;  1Y1V C;  1XPP A;  2WB1 L;  5IP9 K;  4X6A C;  1K83 C;  3GTP K;  1ZYR A;  3S1M K;  1O28 A;  3HKZ D;  1IS1 A;  3GEE A;  4GTE A;  1K83 K;  3GTP C;  4KAW X;  1TWF C;  1ZXO A;  3ERE D;  2NVT C;  2GAG C;  3S1Q K;  1ZBS A;  4FM9 A;  2WAQ L;  1VLO A;  4LOW A;  2JH3 A;  3N0C A;  4Y52 K;  3PO2 K;  3H3V D;  3S15 C;  3GTG C;  1DD5 A;  3GTJ K;  4BLB A;  3GEH A;  5IOQ A;  5FJ8 K;  4WIL A;  2V6T A;  1TWF K;  4G0W A;  4GTB A;  4LQY A;  3S1N K;  2NVX A;  4Y7N K;  2JA6 A;  3PO3 C;  1O2B A;  1PJ5 A;  4G0V A;  4OIR A;  3ORE A;  3RZO C;  4YFK A;  2E2I C;  3GTM A;  3GTP A;  4YG2 A;  5C4J C;  4BBS C;  1IBA A;  1SMY A;  1Y1W K;  4XLN A;  3HOZ K;  1YNJ A;  3AD9 C;  2RH6 A;  3CQZ K;  2V6U A;  4GZY A;  5CJ9 A;  1I50 A;  4KN7 A;  3K7A K;  1HQM A;  4A3F K;  3H3V L;  1WQG A;  1O25 A;  5IYD C;  3TFJ A;  3S1R K;  1TWC A;  2JA7 K;  1Y1V K;  3CQZ A;  4LR2 A;  5C3E K;  2JA7 A;  1TWH A;  4XCH A;  3H0G C;  4KN4 A;  3G4A A;  2Y0S D;  3AQO A;  2R93 A;  1JOE A;  2B63 K;  1O2F B;  3OEP A;  2E2J K;  4BKW A;  2P8T A;  3Q3Q A;  1WOS A;  3HOY C;  4P5B A;  3M4O K;  4A3D K;  1WCM C;  3A8I A;  5M5W K;  2RGR A;  4KM8 A;  4G0U A;  1ZVU A;  1I6H C;  1Y1W A;  2GSU A;  4A3E K;  1I3Q K;  5EGH A;  3LAP A;  1O27 A;  4C45 A;  1XZQ B;  4KMD A;  4A3J C;  4A3E C;  1ZQ1 C;  4YFX A;  4GTL A;  4C2M K;  4Q5S A;  3I4M K;  1BGW A;  3TTG A;  3I4N C;  1UV7 A;  3V4G A;  4NOI A;  2R93 C;  3HOW C;  4XSZ A;  4BY1 K;  2D6F C;  1B4A A;  1DCP A;  2Y3P A;  4AYB L;  3QX3 A;  1VJE A;  5M3M K;  4MEX A;  2E2I K;  2VUM C;  1VGX A;  4JK1 A;  1TWA A;  5JFE A;  2XCQ A;  3EQL A;  2YU9 C;  3GTQ A;  2E2H C;  1I6V A;  2NVY K;  4C3I C;  3WOD A;  1EH1 A;  2E2J C;  2Y0S L;  4Y52 C;  3HOX C;  2A68 A;  4ZH4 A;  5IOS A;  1IE0 A;  1I6H K;  4XSX A;  3S0X A;  4LK0 A;  3L4J A;  4G7H A;  4KB4 A;  1G51 A;  4KMA A;  1WOR A;  3GTG K;  2ZFZ A;  2YU9 A;  4OIQ A;  4A3I C;  1SFO C;  5IYB C;  3GTK C;  5C3E C;  3JST A;  2GAH C;  1O24 A;  4A3C C;  2CFA A;  2JA8 C;  3GTO A;  2P5M A;  1TWH K;  4Y7N C;  1WQH A;  1WSR A;  2KWA A;  3S1N C;  1J6V A;  1F93 A;  1WSV A;  3HOY K;  4A3D C;  4WJ4 A;  3S2H C;  5IYC C;  2PA8 L;  1USO A;  4C3J C;  4BBR C;  1TWC K;  1K83 A;  3GTJ C;  1JQW A;  1USM A;  1C0A A;  3GTL A;  1INN A;  1TWG C;  1TWC C;  5C4X C;  1I50 K;  4A3J K;  3HOV C;  1AB4 A;  3S2D K;  4MEY A;  3HOU K;  3M3Y C;  3PO3 K;  4A93 C;  1O2A A;  4KAT A;  1KQ4 A;  1WCM K;  3HOU C;  1O29 A;  4OIO A;  3HKZ L;  3S1M C;  3S15 K;  3LAJ A;  3RZD C;  2JA6 K;  2E2I A;  4YFN A;  2JA5 C;  3H0G K;  2FQO A;  3S1Q C;  3HOZ C;  2JA6 C;  3G4C A;  2PMZ L;  1R9T C;  4BBS K;  4A3I K;  5HL8 A;  5IP7 K;  4Q4Z A;  4A3K K;  2JA7 C;  4QIW L;  2GSN A;  1X31 C;  4KB2 A;  4A3B K;  1F7U A;  3AD8 C;  2E2H A;  2FQT A;  5IP9 C;  4X6A K;  1J98 A;  3M3Y K;  4A93 K;  3CQZ C;  4LLG A;  3L4K A;  5IOR A;  1EFW A;  3FKI A;  1SFO K;  3LPX A;  4A3M K;  2B63 A;  5C4J K;  1I3Q A;  4O2D A;  1TWG A;  2PPB A;  4BLA A;  4BBR K;  4OIN A;  4BXX C;  1XZP A;  2XCO A;  3DXJ A;  1F7V A;  2A69 A;  3HOV K;  4A3G C;  3N3Y A;  2V6S A;  2JA8 K;  4RMF A;  4OIP A;  4C3I K;  3FOF A;  1VH2 A;  5IYB K;  4DDQ A;  1XZQ A;  3GTK K;  3AQP A;  4KM9 A;  4PAA A;  4GTF A;  1B4B A;  3BUE A;  2PHC B;  3RZD K;  1EK8 A;  4BY7 C;  3S14 C;  3TFH A;  2JA5 A;  4P5A A;  2R7Z C;  4KMU A;  1TWF A;  3NUH A;  4A3K C;  1J6X A;  3BP8 C;  3GEI A;  2BE5 A;  2NVQ C;  3GTM K;  3IPJ A;  3S17 C;  4AH6 A;  1JVI A;  4MQ9 A;  5M3F K;  2PA8 D;  3S2D C;  1J6W A;  3S16 C;  2JA5 K;  4KAR A;  2NVX K;  5EGE A;  4A3L K;  5L46 A;  5TJ3 A;  1BS2 A;  4PAB A;  4M1X A;  1IQ0 A;  4C3H C;  4G7O A;  2EBB A;  1EQR A;  2VUM K;  4KAS A;  3GTQ C;  1DCH A;  3GTO K;  1TWA C;  1TWG K;  5C4X K;  4G7Z A;  3T00 A;  4QJV B;  3HOX K;  5FLM C;  2NVY C;  3M4O C;  5IYC K;  3GIR A;  1PJ6 A;  4KMH A;  5D4D A;  2PMZ D;  2R93 K;  4BY7 K;  2E2H K;  3HXA A;  2YU9 K;  1WOO A;  3FKI K;  1SFO A;  2NVQ K;  5M5Y K;  4QJV A;  3OPF A;  3FHZ A;  3I4M C;  2XCR B;  1WQF A;  2WB1 D;  3S1R C;  4KC6 A;  4BY1 C;  1F9N A;  1I3Q C;  4GT9 A;  4LK1 A;  4LJZ A;  4A3G K;  4P9S A;  2R7Z A;  3GTL C;  1YX2 A;  4KDD A;  3I4N K;  2CFA B;  5IOT A;  1WCM A;  4XLP A;  2NVX C;  3H0G A;  1BDF A;  1XXB A;  1XZP B;  1IL2 A;  3PO2 C;  3T01 A;  4A3L C;  1XXC A;  4GFQ A;  3GTO C;  5JVO A;  2B63 C;  3GTQ K;  3GDZ A;  1TWA K;  4WJ3 M;  3SZY A;  1WOP A;  5M5X K;  1YCL A;  4ILD A;  4C3H K;  2NVT K;  1V5V A;  3BP3 A;  3AH5 A;  3A8J A;  2R92 A;  1DCO A;  3GTJ A;  1R9T A;  3GSI A;  3S14 K;  2CW0 A;  2VUM A;  3GTL K;  1R9T K;  3S17 K;  3VA7 A;  3A8K A;  1PJ7 A;  5CHP A;  5TMF A;  1EI6 A;  2WAQ D;  3CAG A;  3HOW K;  5C44 K;  3FKI C;  3MML B;  3RZO K;  4A3F C;  1BJT A;  1RU0 A;  5IYD K;  1O26 A;  2O5I A;  2R92 K;  3GTG A;  2ZUE A;  3K7A C;  1GE9 A;  1YNN A;  2A6E A;  3N0B A;  4AYB D;  1VRQ C;  4J3N A; 
#chains in the Genus database with same CATH homology
 3IPJ A;  1O2F B;  3BP8 C;  1IBA A;  3BP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...