1O2FB

Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PTS system, glucose-specific IIA component
publication title Solution Structure of the Phosphoryl Transfer Complex between the Signal-transducing Protein IIAGlucose and the Cytoplasmic Domain of the Glucose Transporter IICBGlucose of the Escherichia coli Glucose Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 77
sequence length 77
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1o2fB00
3BP3A 1O2FB 1IBAA 3BP8C 3IPJA
chains in the Genus database with same CATH superfamily
1Y1VA 4LK1A 1WOPA 3S1MC 4A3KK 1TWHA 1I6VA 4BY7K 2PHCB 1INNA 4XSXA 4KM9A 5M5XK 2B63K 1ZQ1C 1O29A 1TWCA 3FOEA 1YCLA 1USMA 1K83A 3HKZD 4GFQA 4AH6A 3TFJA 1EI6A 3M4OC 4Y52C 2JA7K 4BBRC 4QIWL 4QJVA 3VA7A 3PO3C 2WAQD 1TWGC 3RZOC 5C3EK 3I4NC 2E2HA 1WOOA 1XZPA 5CJ9A 2R92C 1VJEA 2A6EA 3CQZK 3GTQC 4A3JC 4GTCA 1O2AA 1Y1WC 4A3DK 2JA6A 2WB1L 1I50C 2CFAA 1WOSA 1O2FB 1J6WA 2JA8K 3SZZA 4KDDA 5E68A 5IP7K 3HOXK 4MEYA 4A3IK 4WJ3M 1IBAA 3GTMA 3OREA 4X6AK 3S16C 1Y1VC 1TWFC 4KMAA 1SFOA 4A3BK 5TMFA 4ZH4A 1R9TA 2E2JC 1B4BA 2R93K 2GSNA 4O2DA 2GSOA 2JA5A 1XZQA 4KM8A 4FM9A 4P5AA 3S1RC 1K83C 4OIQA 1VGXA 4KMDA 5FLMK 3S1NC 1X31C 5C4JK 2XCOA 3A8KA 3PO2C 2NVQC 1IQ0A 2E2IC 2KWAA 4NOIA 3FHZA 2NVYK 2YU9K 1V5VA 4BXXK 5IYBK 4GTEA 3GTOK 2R7ZC 3H0GK 3SZYA 3JSTA 4YFNA 1TWGA 4PAAA 2NVXK 2JA6C 3GTLC 4A3CC 4C45A 3GTJK 4GT9A 1IW7A 5EGEA 3FKIK 4BY1C 5IYDC 3HOZK 4XLNA 3FOFA 1DD5A 2NVTC 4GZYA 2FQTA 1VRQC 4BBSK 2R92A 1O2BA 3OEPA 3S17K 4Q5SA 3S2HK 4M1XA 5C44C 1HQMA 3HOUK 1TWHK 1XXAA 3G4AA 1TWAC 1R9TC 3A8JA 4XLPA 1WCMA 3A8IA 1RU0A 1BGWA 5TJ3A 1YNJA 4A3MC 3T00A 4OIPA 4C3HC 1TWCK 5M3MK 2V6SA 4QIWD 1TWFA 3NUHA 4BLBA 3DXJA 3HOVK 1KQ4A 1O26A 4A93C 1BJTA 3S1QK 3S2DK 3GTKC 5CHPA 3GTPK 4LLGA 1DCHA 5IORA 1WQHA 2E2HK 2WB1D 4G7HA 5M5WK 2VUMA 3T02A 4C3JC 2E2IA 3K7AK 2XCQA 5IP9C 4A3FK 2XCRB 1C0AA 4OINA 5IOQA 2D6FC 3GTGK 4YG2A 3TFHA 4A3GK 1XZPB 2R7ZA 2EBBA 3GTMK 3HOWC 2CW0A 2JH3A 3QX3A 3RZDK 3GTLA 2A69A 4C3IK 1SFOK 4KB4A 1O24A 2ZUEA 1WCMC 3S14C 3I4MK 3WODA 3M3YK 2JA5K 4KN4A 2V6UA 4A3EK 1F7UA 1JQWA 1AB4A 1B4AA 3S1MK 4A3LC 5IYCC 1TWAA 1ZXOA 3H3VL 3HOYC 2W7VA 2Y3PA 3GEEA 3GSIA 3ADAC 4JK1A 2PPBA 1O28A 4Y7NC 4GTAA 1I3QC 1XZQB 5C4XC 1I6HC 2O5JA 3CQZA 1JOEA 3M4OK 5JFEA 2GSUA 4MQ9A 2VUMC 4Y52K 4WILA 1WIHA 3IPJA 4BBRK 4GTDA 2Y0SL 3PO3K 3LPXA 3BUEA 3GTKA 1TWGK 3RZOK 3S15C 4C2MC 1ISEA 3I4NK 3AQOA 3BP3A 1PJ5A 3HXAA 5TMCA 4KB2A 2R92K 4FZBA 4OIRA 1WQFA 4J3NA 4A3KC 3GTQK 4KARA 4RMFA 4A3JK 2R93A 1Y1WK 4BY7C 1I50K 1O25A 2B63C 1XPPA 3GDZA 1USOA 4PABA 1F7VA 4AYBL 3BP8C 3S16K 1Y1VK 1TWFK 1EQRA 2JA7C 2E2JK 4XCHA 3GEIA 3MMLB 2NVYA 1EK8A 2PMZL 3N0CA 4LK0A 2GAGC 1F9NA 3ERED 3S1RK 1VH2A 1F93A 1K83K 3TTGA 3CQZC 2FQOA 4YFKA 3GIRA 3S1NK 1O27A 3AH5A 1WQGA 4P5BA 2RGRA 4A3DC 4KMUA 2NVXA 3N3YA 3PO2K 1WORA 5D4DA 2NVQK 2E2IK 3FKIA 4GTFA 1I3QA 4LR2A 2JA8C 1BDFA 5IOSA 5IP7C 3HOXC 4A3IC 3AD7C 4X6AC 2ZUFA 4A3BC 2R7ZK 1ZBSA 4G0VA 5IOTA 4QJVB 4LQYA 2R93C 2A68A 2JA6K 3GTLK 4A3CK 4KASA 1JVIA 1EH1A 4BY1K 2PA8L 5IYDK 2NVTK 3H3VD 3AQPA 3N0BA 4KATA 5FLMC 4G0UA 5C44K 1BS2A 4KAWX 3T01A 5C4JC 2V6TA 3OPFA 1PJ6A 1YNNA 3G4CA 1TWAK 3LAJA 1R9TK 2B63A 2CFAB 4G7ZA 4G7OA 3S0XA 3L4KA 3GEHA 2NVYC 2YU9C 3GTPA 2ZFZA 4A3MK 3AD8C 4BXXC 4C3HK 5IYBC 1ZYRA 3LAPA 2Y0SD 2JA7A 3L4JA 3GTOC 1WSRA 3HKZL 1J98A 3H0GC 1SMYA 2NVXC 4A93K 3GTJC 4KC6A 1IL2A 3FKIC 3GTKK 3GTGA 3HOZC 1G51A 5FJ8K 1XXCA 2WAQL 4BBSC 1WSVA 3S17C 4BKWA 3S2HC 1GE9A 4G0WA 4GTBA 4C3JK 3HOUC 1TWHC 1DCPA 5IP9K 1YX2A 4AYBD 1DCOA 1VLOA 1IS1A 2A6HA 1XXBA 4LOWA 4P9SA 1TWCC 5M3FK 1PJ7A 3HOVC 3HOWK 3Q3QA 2PMZD 1UV7A 2GAHC 3S1QC 3S2DC 1WCMK 3S14K 1HI9A 3GTPC 2E2HC 4YFXA 2P8TA 4MEXA 5JVOA 1J6VA 4A3LK 5M5YK 5IYCK 3K7AC 3CAGA 4A3FC 3HOYK 5C3EC 4KN7A 2YU9A 1L0WA 1J6XA 4Y7NK 1IE0A 1I3QK 3V4GA 3GTGC 5C4XK 1I6HK 4A3GC 4KMHA 3GTOA 5L46A 3GTQA 3H0GA 4Q4ZA 4ILDA 4BLAA 3TFIA 1EFWA 2O5IA 3GTMC 1Y1WA 4LJZA 3RZDC 2VUMK 4C3IC 1SFOC 2RH6A 3GTJA 2PA8D 4DDQA 3AD9C 1I50A 4WJ4A 1ZVUA 3S15K 4C2MK 2BE5A 3EQLA 5HL8A 3I4MC 4XSZA 5EGHA 3M3YC 2JA5C 4GTLA 4OIOA 4A3EC 2P5MA
chains in the Genus database with same CATH topology
3BP3A 1O2FB 1IBAA 3BP8C 3IPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP3 A;  1O2F B;  1IBA A;  3BP8 C;  3IPJ A; 
#chains in the Genus database with same CATH topology
 1Y1V A;  4LK1 A;  1WOP A;  3S1M C;  4A3K K;  1TWH A;  1I6V A;  4BY7 K;  2PHC B;  1INN A;  4XSX A;  4KM9 A;  5M5X K;  2B63 K;  1ZQ1 C;  1O29 A;  1TWC A;  3FOE A;  1YCL A;  1USM A;  1K83 A;  3HKZ D;  4GFQ A;  4AH6 A;  3TFJ A;  1EI6 A;  3M4O C;  4Y52 C;  2JA7 K;  4BBR C;  4QIW L;  4QJV A;  3VA7 A;  3PO3 C;  2WAQ D;  1TWG C;  3RZO C;  5C3E K;  3I4N C;  2E2H A;  1WOO A;  1XZP A;  5CJ9 A;  2R92 C;  1VJE A;  2A6E A;  3CQZ K;  3GTQ C;  4A3J C;  4GTC A;  1O2A A;  1Y1W C;  4A3D K;  2JA6 A;  2WB1 L;  1I50 C;  2CFA A;  1WOS A;  1O2F B;  1J6W A;  2JA8 K;  3SZZ A;  4KDD A;  5E68 A;  5IP7 K;  3HOX K;  4MEY A;  4A3I K;  4WJ3 M;  1IBA A;  3GTM A;  3ORE A;  4X6A K;  3S16 C;  1Y1V C;  1TWF C;  4KMA A;  1SFO A;  4A3B K;  5TMF A;  4ZH4 A;  1R9T A;  2E2J C;  1B4B A;  2R93 K;  2GSN A;  4O2D A;  2GSO A;  2JA5 A;  1XZQ A;  4KM8 A;  4FM9 A;  4P5A A;  3S1R C;  1K83 C;  4OIQ A;  1VGX A;  4KMD A;  5FLM K;  3S1N C;  1X31 C;  5C4J K;  2XCO A;  3A8K A;  3PO2 C;  2NVQ C;  1IQ0 A;  2E2I C;  2KWA A;  4NOI A;  3FHZ A;  2NVY K;  2YU9 K;  1V5V A;  4BXX K;  5IYB K;  4GTE A;  3GTO K;  2R7Z C;  3H0G K;  3SZY A;  3JST A;  4YFN A;  1TWG A;  4PAA A;  2NVX K;  2JA6 C;  3GTL C;  4A3C C;  4C45 A;  3GTJ K;  4GT9 A;  1IW7 A;  5EGE A;  3FKI K;  4BY1 C;  5IYD C;  3HOZ K;  4XLN A;  3FOF A;  1DD5 A;  2NVT C;  4GZY A;  2FQT A;  1VRQ C;  4BBS K;  2R92 A;  1O2B A;  3OEP A;  3S17 K;  4Q5S A;  3S2H K;  4M1X A;  5C44 C;  1HQM A;  3HOU K;  1TWH K;  1XXA A;  3G4A A;  1TWA C;  1R9T C;  3A8J A;  4XLP A;  1WCM A;  3A8I A;  1RU0 A;  1BGW A;  5TJ3 A;  1YNJ A;  4A3M C;  3T00 A;  4OIP A;  4C3H C;  1TWC K;  5M3M K;  2V6S A;  4QIW D;  1TWF A;  3NUH A;  4BLB A;  3DXJ A;  3HOV K;  1KQ4 A;  1O26 A;  4A93 C;  1BJT A;  3S1Q K;  3S2D K;  3GTK C;  5CHP A;  3GTP K;  4LLG A;  1DCH A;  5IOR A;  1WQH A;  2E2H K;  2WB1 D;  4G7H A;  5M5W K;  2VUM A;  3T02 A;  4C3J C;  2E2I A;  3K7A K;  2XCQ A;  5IP9 C;  4A3F K;  2XCR B;  1C0A A;  4OIN A;  5IOQ A;  2D6F C;  3GTG K;  4YG2 A;  3TFH A;  4A3G K;  1XZP B;  2R7Z A;  2EBB A;  3GTM K;  3HOW C;  2CW0 A;  2JH3 A;  3QX3 A;  3RZD K;  3GTL A;  2A69 A;  4C3I K;  1SFO K;  4KB4 A;  1O24 A;  2ZUE A;  1WCM C;  3S14 C;  3I4M K;  3WOD A;  3M3Y K;  2JA5 K;  4KN4 A;  2V6U A;  4A3E K;  1F7U A;  1JQW A;  1AB4 A;  1B4A A;  3S1M K;  4A3L C;  5IYC C;  1TWA A;  1ZXO A;  3H3V L;  3HOY C;  2W7V A;  2Y3P A;  3GEE A;  3GSI A;  3ADA C;  4JK1 A;  2PPB A;  1O28 A;  4Y7N C;  4GTA A;  1I3Q C;  1XZQ B;  5C4X C;  1I6H C;  2O5J A;  3CQZ A;  1JOE A;  3M4O K;  5JFE A;  2GSU A;  4MQ9 A;  2VUM C;  4Y52 K;  4WIL A;  1WIH A;  3IPJ A;  4BBR K;  4GTD A;  2Y0S L;  3PO3 K;  3LPX A;  3BUE A;  3GTK A;  1TWG K;  3RZO K;  3S15 C;  4C2M C;  1ISE A;  3I4N K;  3AQO A;  3BP3 A;  1PJ5 A;  3HXA A;  5TMC A;  4KB2 A;  2R92 K;  4FZB A;  4OIR A;  1WQF A;  4J3N A;  4A3K C;  3GTQ K;  4KAR A;  4RMF A;  4A3J K;  2R93 A;  1Y1W K;  4BY7 C;  1I50 K;  1O25 A;  2B63 C;  1XPP A;  3GDZ A;  1USO A;  4PAB A;  1F7V A;  4AYB L;  3BP8 C;  3S16 K;  1Y1V K;  1TWF K;  1EQR A;  2JA7 C;  2E2J K;  4XCH A;  3GEI A;  3MML B;  2NVY A;  1EK8 A;  2PMZ L;  3N0C A;  4LK0 A;  2GAG C;  1F9N A;  3ERE D;  3S1R K;  1VH2 A;  1F93 A;  1K83 K;  3TTG A;  3CQZ C;  2FQO A;  4YFK A;  3GIR A;  3S1N K;  1O27 A;  3AH5 A;  1WQG A;  4P5B A;  2RGR A;  4A3D C;  4KMU A;  2NVX A;  3N3Y A;  3PO2 K;  1WOR A;  5D4D A;  2NVQ K;  2E2I K;  3FKI A;  4GTF A;  1I3Q A;  4LR2 A;  2JA8 C;  1BDF A;  5IOS A;  5IP7 C;  3HOX C;  4A3I C;  3AD7 C;  4X6A C;  2ZUF A;  4A3B C;  2R7Z K;  1ZBS A;  4G0V A;  5IOT A;  4QJV B;  4LQY A;  2R93 C;  2A68 A;  2JA6 K;  3GTL K;  4A3C K;  4KAS A;  1JVI A;  1EH1 A;  4BY1 K;  2PA8 L;  5IYD K;  2NVT K;  3H3V D;  3AQP A;  3N0B A;  4KAT A;  5FLM C;  4G0U A;  5C44 K;  1BS2 A;  4KAW X;  3T01 A;  5C4J C;  2V6T A;  3OPF A;  1PJ6 A;  1YNN A;  3G4C A;  1TWA K;  3LAJ A;  1R9T K;  2B63 A;  2CFA B;  4G7Z A;  4G7O A;  3S0X A;  3L4K A;  3GEH A;  2NVY C;  2YU9 C;  3GTP A;  2ZFZ A;  4A3M K;  3AD8 C;  4BXX C;  4C3H K;  5IYB C;  1ZYR A;  3LAP A;  2Y0S D;  2JA7 A;  3L4J A;  3GTO C;  1WSR A;  3HKZ L;  1J98 A;  3H0G C;  1SMY A;  2NVX C;  4A93 K;  3GTJ C;  4KC6 A;  1IL2 A;  3FKI C;  3GTK K;  3GTG A;  3HOZ C;  1G51 A;  5FJ8 K;  1XXC A;  2WAQ L;  4BBS C;  1WSV A;  3S17 C;  4BKW A;  3S2H C;  1GE9 A;  4G0W A;  4GTB A;  4C3J K;  3HOU C;  1TWH C;  1DCP A;  5IP9 K;  1YX2 A;  4AYB D;  1DCO A;  1VLO A;  1IS1 A;  2A6H A;  1XXB A;  4LOW A;  4P9S A;  1TWC C;  5M3F K;  1PJ7 A;  3HOV C;  3HOW K;  3Q3Q A;  2PMZ D;  1UV7 A;  2GAH C;  3S1Q C;  3S2D C;  1WCM K;  3S14 K;  1HI9 A;  3GTP C;  2E2H C;  4YFX A;  2P8T A;  4MEX A;  5JVO A;  1J6V A;  4A3L K;  5M5Y K;  5IYC K;  3K7A C;  3CAG A;  4A3F C;  3HOY K;  5C3E C;  4KN7 A;  2YU9 A;  1L0W A;  1J6X A;  4Y7N K;  1IE0 A;  1I3Q K;  3V4G A;  3GTG C;  5C4X K;  1I6H K;  4A3G C;  4KMH A;  3GTO A;  5L46 A;  3GTQ A;  3H0G A;  4Q4Z A;  4ILD A;  4BLA A;  3TFI A;  1EFW A;  2O5I A;  3GTM C;  1Y1W A;  4LJZ A;  3RZD C;  2VUM K;  4C3I C;  1SFO C;  2RH6 A;  3GTJ A;  2PA8 D;  4DDQ A;  3AD9 C;  1I50 A;  4WJ4 A;  1ZVU A;  3S15 K;  4C2M K;  2BE5 A;  3EQL A;  5HL8 A;  3I4M C;  4XSZ A;  5EGH A;  3M3Y C;  2JA5 C;  4GTL A;  4OIO A;  4A3E C;  2P5M A; 
#chains in the Genus database with same CATH homology
 3BP3 A;  1O2F B;  1IBA A;  3BP8 C;  3IPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...