1O2FB

Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the Phosphoryl Transfer Complex between the Signal-transducing Protein IIAGlucose and the Cytoplasmic Domain of the Glucose Transporter IICBGlucose of the Escherichia coli Glucose Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS system, glucose-specific IIA component
total genus 20
structure length 77
sequence length 77
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1o2fB00
3BP3A 1IBAA 3BP8C 3IPJA 1O2FB
chains in the Genus database with same CATH superfamily
4YFXA 5IOTA 5C4XC 4GT9A 2E2HK 4XSZA 5IYCC 3H0GC 1RU0A 1WQHA 2ZUEA 4Y52C 2E2JK 4PAAA 5IYBK 3GTLA 3GTPA 3FKIC 1JVIA 1ZXOA 3GIRA 1TWAK 4C3HC 2NVTK 3AD9C 4AYBD 1O2AA 1JOEA 4BBSK 2R92A 2R92K 1J6XA 3FHZA 3GTQC 4KAWX 5IORA 1Y1VA 3CQZK 2JA6C 2A6EA 2FQTA 2E2JC 3HKZL 2D6FC 4GTDA 3A8IA 5IYDC 3FOFA 1VJEA 4G7HA 3I4NK 3AQOA 3HOXK 3S16C 1HQMA 4KATA 3HOWK 1I50C 4LOWA 3S1QK 3S15K 3HOXC 4KB2A 1DD5A 2NVXK 4A3BK 4QIWD 1EFWA 5IP9C 3GTGA 2VUMA 1WOOA 1WORA 3DXJA 4A3GC 1I6HK 3AH5A 1WIHA 1VGXA 4LK1A 3PO3C 4Q4ZA 3TFIA 1PJ6A 4KMUA 4OIOA 1X31C 1XXBA 4BXXC 4AH6A 4JK1A 2PA8L 5EGHA 1BDFA 2B63A 3S1RC 3GTMA 4KASA 3S14K 4GTEA 4A93K 4NOIA 3S1RK 1XZQA 3I4MK 4FM9A 3S0XA 2B63C 3S17C 4QJVB 1ZVUA 1USOA 2V6SA 2JA6A 5D4DA 3M4OC 3GTLK 5FJ8K 3NUHA 5EGEA 3GSIA 2R93K 5IP7K 3H3VD 4WJ4A 3HOVK 2YU9A 1WSRA 1TWFC 3AD7C 5E68A 3AD8C 4LK0A 3GTQK 5IP7C 4G0VA 1XXCA 1I50K 3GTOA 4GTBA 3S1QC 3GTKA 4OINA 4C3JC 5FLMK 4BLAA 2GSNA 5IYDK 2GSOA 1O28A 4A3GK 1I6HC 1I3QC 3FKIA 4Y7NK 1IQ0A 4ZH4A 3SZZA 2JA5C 1TWHA 3WODA 2Y3PA 3HOVC 1SFOA 2NVYK 4QIWL 4XSXA 3GTJA 1C0AA 2FQOA 4BY7C 1J6WA 3RZDC 3S1NC 1SMYA 2NVQK 3M3YK 3PO2C 2O5JA 3BP8C 2Y0SD 5JVOA 2Y0SL 3PO3K 3BP3A 1VH2A 3GTOC 4G0WA 2W7VA 1EQRA 4C45A 1J98A 2P5MA 3LAJA 3VA7A 1SFOK 4DDQA 3AQPA 1TWHK 2BE5A 1VLOA 3S16K 4AYBL 1EH1A 4A3DK 3OREA 4X6AC 4GTLA 4C3HK 4A93C 5IOQA 1I6VA 1O26A 3A8JA 3TFHA 1TWFA 3GTOK 3CAGA 4Y52K 4MEXA 1TWGC 3M4OK 1K83C 1O25A 1YNNA 2GAHC 1I3QK 3HOUK 4A3LK 3IPJA 2E2IK 1K83A 4RMFA 1IS1A 1O2BA 2O5IA 5TMCA 4OIQA 1XZPB 1AB4A 1JQWA 3CQZC 4LJZA 3PO2K 4GTAA 5M3MK 2JH3A 2B63K 4A3JK 4OIRA 2JA8C 2NVYA 1INNA 1IBAA 2A6HA 3L4JA 1XXAA 1EK8A 4PABA 4C2MC 3L4KA 5IYBC 4A3IC 1F7VA 1XZQB 5IP9K 1DCHA 1BGWA 2R7ZK 4A3FC 3T01A 4KDDA 4C2MK 4X6AK 2JA7A 2JA7C 3RZOK 1ZBSA 4BBRK 1WQFA 4OIPA 4P5AA 1WSVA 4BKWA 3JSTA 2PPBA 3QX3A 4LR2A 3LAPA 1R9TK 4KARA 3N3YA 1TWHC 1WQGA 1O29A 2YU9K 2GAGC 1XPPA 2R93A 1F93A 1TWCK 2CFAA 2NVYC 3G4CA 3GEEA 1WCMK 4ILDA 1HI9A 2JA6K 4A3IK 1YX2A 3GTLC 2E2IC 4KMAA 3M3YC 4WILA 4XCHA 1B4AA 3I4NC 4C3IC 4KN7A 3TFJA 4G0UA 1TWGK 3GTMK 4C3IK 3FOEA 2ZFZA 4G7ZA 4Q5SA 1VRQC 2XCOA 3GTPC 3N0BA 4G7OA 2R93C 4KB4A 4WJ3M 4Y7NC 3S2DK 3GTPK 4A3EC 1WCMA 5M5YK 4GFQA 3BUEA 3GDZA 4A3EK 4BBSC 4A3MK 3N0CA 2E2HA 1IW7A 5C3EC 3K7AC 1Y1WK 5TMFA 2A69A 4BY7K 5M5WK 1WOPA 2PA8D 4KM8A 3T00A 2JA7K 3GEHA 1Y1WA 3GTKC 4GZYA 4A3CK 3T02A 1IE0A 4A3KC 1YCLA 5C4JK 1V5VA 3S1MC 3G4AA 2CFAB 4XLNA 2XCRB 2V6UA 4A3KK 4A3FK 5C4JC 5M3FK 1WOSA 1Y1VK 3CQZA 4MQ9A 1EI6A 2WAQD 2P8TA 4P9SA 4YFKA 1F9NA 4BLBA 1Y1VC 1TWGA 4KC6A 5C4XK 1BS2A 4A3JC 2JA8K 5L46A 3GTMC 2R92C 4M1XA 4BXXK 1TWAA 5FLMC 1K83K 4LLGA 4YFNA 1I3QA 1TWCA 2R7ZC 3V4GA 3H3VL 3HOYK 1R9TA 3S2HC 1G51A 4A3MC 5M5XK 5CHPA 3HOWC 5C44K 1R9TC 2GSUA 2NVQC 2R7ZA 1F7UA 4BY1C 3S17K 1YNJA 1ZYRA 2PHCB 3S2DC 4A3LC 3ADAC 2WB1D 4A3CC 3GTJC 4QJVA 2PMZL 3H0GA 3OEPA 3K7AK 1GE9A 3HOZC 3TTGA 1B4BA 2JA5A 4C3JK 4YG2A 1DCOA 5C44C 2NVTC 2WAQL 3GEIA 3RZOC 2JA5K 3S14C 4P5BA 1PJ7A 5TJ3A 3GTJK 4KM9A 4MEYA 2EBBA 2YU9C 1IL2A 5HL8A 2E2IA 3H0GK 5IYCK 1TWCC 1L0WA 3RZDK 3S1NK 2PMZD 5C3EK 1KQ4A 1Y1WC 3HOUC 4BBRC 5IOSA 2WB1L 1O24A 1USMA 3ERED 1TWAC 3HXAA 3LPXA 3HOYC 1TWFK 3HKZD 3GTKK 1I50A 2NVXC 4A3BC 3SZYA 5JFEA 4J3NA 4LQYA 3OPFA 2V6TA 4GTCA 4XLPA 3Q3QA 4A3DC 1XZPA 3A8KA 5CJ9A 4FZBA 2ZUFA 4KMDA 2RH6A 2CW0A 3S15C 1UV7A 4GTFA 1PJ5A 1BJTA 2A68A 3I4MC 2KWAA 3HOZK 1DCPA 4KMHA 2RGRA 3S1MK 2VUMC 1SFOC 3GTGC 3FKIK 3S2HK 1WCMC 1O27A 2XCQA 2VUMK 1J6VA 3GTGK 1ZQ1C 1ISEA 2E2HC 4BY1K 3MMLB 4KN4A 2NVXA 1O2FB 4O2DA 3EQLA 3GTQA
chains in the Genus database with same CATH topology
3BP3A 1IBAA 3BP8C 3IPJA 1O2FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP3 A;  1IBA A;  3BP8 C;  3IPJ A;  1O2F B; 
#chains in the Genus database with same CATH topology
 4YFX A;  5IOT A;  5C4X C;  4GT9 A;  2E2H K;  4XSZ A;  5IYC C;  3H0G C;  1RU0 A;  1WQH A;  2ZUE A;  4Y52 C;  2E2J K;  4PAA A;  5IYB K;  3GTL A;  3GTP A;  3FKI C;  1JVI A;  1ZXO A;  3GIR A;  1TWA K;  4C3H C;  2NVT K;  3AD9 C;  4AYB D;  1O2A A;  1JOE A;  4BBS K;  2R92 A;  2R92 K;  1J6X A;  3FHZ A;  3GTQ C;  4KAW X;  5IOR A;  1Y1V A;  3CQZ K;  2JA6 C;  2A6E A;  2FQT A;  2E2J C;  3HKZ L;  2D6F C;  4GTD A;  3A8I A;  5IYD C;  3FOF A;  1VJE A;  4G7H A;  3I4N K;  3AQO A;  3HOX K;  3S16 C;  1HQM A;  4KAT A;  3HOW K;  1I50 C;  4LOW A;  3S1Q K;  3S15 K;  3HOX C;  4KB2 A;  1DD5 A;  2NVX K;  4A3B K;  4QIW D;  1EFW A;  5IP9 C;  3GTG A;  2VUM A;  1WOO A;  1WOR A;  3DXJ A;  4A3G C;  1I6H K;  3AH5 A;  1WIH A;  1VGX A;  4LK1 A;  3PO3 C;  4Q4Z A;  3TFI A;  1PJ6 A;  4KMU A;  4OIO A;  1X31 C;  1XXB A;  4BXX C;  4AH6 A;  4JK1 A;  2PA8 L;  5EGH A;  1BDF A;  2B63 A;  3S1R C;  3GTM A;  4KAS A;  3S14 K;  4GTE A;  4A93 K;  4NOI A;  3S1R K;  1XZQ A;  3I4M K;  4FM9 A;  3S0X A;  2B63 C;  3S17 C;  4QJV B;  1ZVU A;  1USO A;  2V6S A;  2JA6 A;  5D4D A;  3M4O C;  3GTL K;  5FJ8 K;  3NUH A;  5EGE A;  3GSI A;  2R93 K;  5IP7 K;  3H3V D;  4WJ4 A;  3HOV K;  2YU9 A;  1WSR A;  1TWF C;  3AD7 C;  5E68 A;  3AD8 C;  4LK0 A;  3GTQ K;  5IP7 C;  4G0V A;  1XXC A;  1I50 K;  3GTO A;  4GTB A;  3S1Q C;  3GTK A;  4OIN A;  4C3J C;  5FLM K;  4BLA A;  2GSN A;  5IYD K;  2GSO A;  1O28 A;  4A3G K;  1I6H C;  1I3Q C;  3FKI A;  4Y7N K;  1IQ0 A;  4ZH4 A;  3SZZ A;  2JA5 C;  1TWH A;  3WOD A;  2Y3P A;  3HOV C;  1SFO A;  2NVY K;  4QIW L;  4XSX A;  3GTJ A;  1C0A A;  2FQO A;  4BY7 C;  1J6W A;  3RZD C;  3S1N C;  1SMY A;  2NVQ K;  3M3Y K;  3PO2 C;  2O5J A;  3BP8 C;  2Y0S D;  5JVO A;  2Y0S L;  3PO3 K;  3BP3 A;  1VH2 A;  3GTO C;  4G0W A;  2W7V A;  1EQR A;  4C45 A;  1J98 A;  2P5M A;  3LAJ A;  3VA7 A;  1SFO K;  4DDQ A;  3AQP A;  1TWH K;  2BE5 A;  1VLO A;  3S16 K;  4AYB L;  1EH1 A;  4A3D K;  3ORE A;  4X6A C;  4GTL A;  4C3H K;  4A93 C;  5IOQ A;  1I6V A;  1O26 A;  3A8J A;  3TFH A;  1TWF A;  3GTO K;  3CAG A;  4Y52 K;  4MEX A;  1TWG C;  3M4O K;  1K83 C;  1O25 A;  1YNN A;  2GAH C;  1I3Q K;  3HOU K;  4A3L K;  3IPJ A;  2E2I K;  1K83 A;  4RMF A;  1IS1 A;  1O2B A;  2O5I A;  5TMC A;  4OIQ A;  1XZP B;  1AB4 A;  1JQW A;  3CQZ C;  4LJZ A;  3PO2 K;  4GTA A;  5M3M K;  2JH3 A;  2B63 K;  4A3J K;  4OIR A;  2JA8 C;  2NVY A;  1INN A;  1IBA A;  2A6H A;  3L4J A;  1XXA A;  1EK8 A;  4PAB A;  4C2M C;  3L4K A;  5IYB C;  4A3I C;  1F7V A;  1XZQ B;  5IP9 K;  1DCH A;  1BGW A;  2R7Z K;  4A3F C;  3T01 A;  4KDD A;  4C2M K;  4X6A K;  2JA7 A;  2JA7 C;  3RZO K;  1ZBS A;  4BBR K;  1WQF A;  4OIP A;  4P5A A;  1WSV A;  4BKW A;  3JST A;  2PPB A;  3QX3 A;  4LR2 A;  3LAP A;  1R9T K;  4KAR A;  3N3Y A;  1TWH C;  1WQG A;  1O29 A;  2YU9 K;  2GAG C;  1XPP A;  2R93 A;  1F93 A;  1TWC K;  2CFA A;  2NVY C;  3G4C A;  3GEE A;  1WCM K;  4ILD A;  1HI9 A;  2JA6 K;  4A3I K;  1YX2 A;  3GTL C;  2E2I C;  4KMA A;  3M3Y C;  4WIL A;  4XCH A;  1B4A A;  3I4N C;  4C3I C;  4KN7 A;  3TFJ A;  4G0U A;  1TWG K;  3GTM K;  4C3I K;  3FOE A;  2ZFZ A;  4G7Z A;  4Q5S A;  1VRQ C;  2XCO A;  3GTP C;  3N0B A;  4G7O A;  2R93 C;  4KB4 A;  4WJ3 M;  4Y7N C;  3S2D K;  3GTP K;  4A3E C;  1WCM A;  5M5Y K;  4GFQ A;  3BUE A;  3GDZ A;  4A3E K;  4BBS C;  4A3M K;  3N0C A;  2E2H A;  1IW7 A;  5C3E C;  3K7A C;  1Y1W K;  5TMF A;  2A69 A;  4BY7 K;  5M5W K;  1WOP A;  2PA8 D;  4KM8 A;  3T00 A;  2JA7 K;  3GEH A;  1Y1W A;  3GTK C;  4GZY A;  4A3C K;  3T02 A;  1IE0 A;  4A3K C;  1YCL A;  5C4J K;  1V5V A;  3S1M C;  3G4A A;  2CFA B;  4XLN A;  2XCR B;  2V6U A;  4A3K K;  4A3F K;  5C4J C;  5M3F K;  1WOS A;  1Y1V K;  3CQZ A;  4MQ9 A;  1EI6 A;  2WAQ D;  2P8T A;  4P9S A;  4YFK A;  1F9N A;  4BLB A;  1Y1V C;  1TWG A;  4KC6 A;  5C4X K;  1BS2 A;  4A3J C;  2JA8 K;  5L46 A;  3GTM C;  2R92 C;  4M1X A;  4BXX K;  1TWA A;  5FLM C;  1K83 K;  4LLG A;  4YFN A;  1I3Q A;  1TWC A;  2R7Z C;  3V4G A;  3H3V L;  3HOY K;  1R9T A;  3S2H C;  1G51 A;  4A3M C;  5M5X K;  5CHP A;  3HOW C;  5C44 K;  1R9T C;  2GSU A;  2NVQ C;  2R7Z A;  1F7U A;  4BY1 C;  3S17 K;  1YNJ A;  1ZYR A;  2PHC B;  3S2D C;  4A3L C;  3ADA C;  2WB1 D;  4A3C C;  3GTJ C;  4QJV A;  2PMZ L;  3H0G A;  3OEP A;  3K7A K;  1GE9 A;  3HOZ C;  3TTG A;  1B4B A;  2JA5 A;  4C3J K;  4YG2 A;  1DCO A;  5C44 C;  2NVT C;  2WAQ L;  3GEI A;  3RZO C;  2JA5 K;  3S14 C;  4P5B A;  1PJ7 A;  5TJ3 A;  3GTJ K;  4KM9 A;  4MEY A;  2EBB A;  2YU9 C;  1IL2 A;  5HL8 A;  2E2I A;  3H0G K;  5IYC K;  1TWC C;  1L0W A;  3RZD K;  3S1N K;  2PMZ D;  5C3E K;  1KQ4 A;  1Y1W C;  3HOU C;  4BBR C;  5IOS A;  2WB1 L;  1O24 A;  1USM A;  3ERE D;  1TWA C;  3HXA A;  3LPX A;  3HOY C;  1TWF K;  3HKZ D;  3GTK K;  1I50 A;  2NVX C;  4A3B C;  3SZY A;  5JFE A;  4J3N A;  4LQY A;  3OPF A;  2V6T A;  4GTC A;  4XLP A;  3Q3Q A;  4A3D C;  1XZP A;  3A8K A;  5CJ9 A;  4FZB A;  2ZUF A;  4KMD A;  2RH6 A;  2CW0 A;  3S15 C;  1UV7 A;  4GTF A;  1PJ5 A;  1BJT A;  2A68 A;  3I4M C;  2KWA A;  3HOZ K;  1DCP A;  4KMH A;  2RGR A;  3S1M K;  2VUM C;  1SFO C;  3GTG C;  3FKI K;  3S2H K;  1WCM C;  1O27 A;  2XCQ A;  2VUM K;  1J6V A;  3GTG K;  1ZQ1 C;  1ISE A;  2E2H C;  4BY1 K;  3MML B;  4KN4 A;  2NVX A;  1O2F B;  4O2D A;  3EQL A;  3GTQ A; 
#chains in the Genus database with same CATH homology
 3BP3 A;  1IBA A;  3BP8 C;  3IPJ A;  1O2F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...