1O2FB

Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PTS system, glucose-specific IIA component
publication title Solution Structure of the Phosphoryl Transfer Complex between the Signal-transducing Protein IIAGlucose and the Cytoplasmic Domain of the Glucose Transporter IICBGlucose of the Escherichia coli Glucose Phosphotransferase System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 20
structure length 77
sequence length 77
ec nomenclature ec 2.7.1.199: Protein-N(pi)-phosphohistidine--D-glucose phosphotransferase.
pdb deposition date 2003-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 1o2fB00
3BP8C 1O2FB 3IPJA 3BP3A 1IBAA
chains in the Genus database with same CATH superfamily
1IE0A 3GTQK 2Y3PA 4RMFA 1F7VA 3TFIA 2YU9C 1ZVUA 4GTCA 4KN4A 4Y7NC 4C45A 4G7ZA 4A3JC 3BP3A 4A3EC 1J98A 4GT9A 1O25A 1PJ7A 4Y52C 3HOXC 1O2AA 1DD5A 1TWAC 4KMAA 4C3JC 4Q4ZA 2JA7C 1JOEA 4XLNA 3M3YC 1J6VA 3GEEA 1Y1WA 4A93C 3GTOK 1Y1WK 3CAGA 1I3QA 3GTMA 2B63K 4O2DA 1UV7A 1PJ5A 3I4MK 4OIQA 1Y1VA 1XXBA 1HI9A 2W7VA 3GTOC 1IL2A 2B63C 3LAJA 3FOEA 1V5VA 3LPXA 5TMCA 2JA8K 4LQYA 4A3BC 3L4KA 5IP9C 3ERED 4BY1C 3GTLA 1VRQC 1ZXOA 2PMZD 3S2DK 1PJ6A 2P5MA 5IP7K 1R9TA 3GTLK 1AB4A 1TWGA 2JA8C 3AH5A 4YFXA 1TWFC 1TWGK 4XSXA 1F93A 5IORA 1J6WA 3GTPC 3H0GC 3S2DC 5CHPA 4A3KC 4QIWD 5E68A 5C3EC 4OIPA 3H3VL 3A8JA 4LK1A 1WCMA 5FJ8K 3A8IA 2V6TA 2R92C 3PO2K 1I6HC 4BBSC 2E2IA 3S16K 2A6HA 5IYCK 1DCPA 2XCRB 5IYDK 1O27A 2D6FC 4ZH4A 1WIHA 5M3MK 2NVQK 3GTKA 3N0BA 3S14K 2JA5A 1GE9A 5IYBK 2NVTC 2GSNA 3S16C 1USOA 2NVXC 3HXAA 4GTLA 3TFJA 3HOWC 2JA5K 3GIRA 5IYDC 2NVQC 1SFOA 4KARA 2WB1L 2GAGC 5C4JK 4KMUA 1O24A 2PA8D 4YFKA 2YU9A 3JSTA 1BGWA 1ZBSA 1EI6A 2YU9K 2JA6K 3TFHA 3RZDK 4A3LK 3S1MK 1USMA 4NOIA 4C2MK 4KATA 3BP8C 2Y0SL 1KQ4A 4G7HA 1TWAA 4Y52K 2JA7A 3HOXK 3IPJA 3SZZA 4G0UA 1ZYRA 1IBAA 2JA6C 1TWAK 4C3JK 2JA7K 3M3YK 3RZDC 4A3LC 3S1MC 1O28A 4GFQA 4C2MC 4A93K 3T01A 3PO3C 3AD9C 1WQGA 2RGRA 3V4GA 2WAQL 3M4OC 4KB4A 3HOUC 3GTOA 3TTGA 1WQHA 4XCHA 2E2JC 2B63A 5EGEA 4GTFA 4LR2A 3N3YA 3RZOC 2RH6A 5TJ3A 2FQOA 3MMLB 4LOWA 1WOSA 4GTDA 1INNA 4A3BK 5IP9K 1I50K 3Q3QA 4BY1K 1BJTA 1WSRA 4KMHA 3HOVC 4BLBA 1TWFA 3BUEA 2PPBA 2R93C 4G0VA 1XZPA 1TWFK 3S1RK 4WJ3M 1IQ0A 3H0GA 5C44K 4KAWX 1I50C 3AD7C 3ADAC 3G4CA 3GTPK 4A3GK 3H0GK 3CQZC 4A3KK 1TWCK 4DDQA 3NUHA 5C3EK 1DCOA 4AYBL 2PHCB 4WJ4A 2A6EA 2O5JA 3S1RC 5C44C 4YG2A 2GSUA 1BDFA 1O29A 4A3GC 1BS2A 2R92A 4KM8A 5C4XC 1TWCC 1X31C 1XXCA 3HKZD 2R92K 3EQLA 2R7ZK 1I6HK 2NVYK 4BBSK 4FZBA 3GDZA 2VUMK 1WSVA 1WORA 4PABA 3DXJA 1O2FB 4WILA 4OIOA 3HOYC 1JVIA 2P8TA 4KN7A 2R7ZC 2NVXA 3QX3A 4ILDA 3GTGC 2NVYC 2NVTK 2GAHC 5M5WK 2NVXK 3HOZC 1EFWA 2VUMC 3HOWK 1O26A 1IS1A 3I4NC 1DCHA 4P5AA 5HL8A 4BXXK 4X6AK 1O2BA 1XZQA 5CJ9A 1VH2A 2XCQA 4A3DC 1VLOA 2ZFZA 3S15K 1B4BA 3GTJK 2JA6A 3GSIA 4BXXC 4X6AC 2CFAA 3L4JA 4C3HC 4BBRK 4P9SA 3T02A 1IW7A 5IOTA 2PMZL 3S2HK 3S15C 1YNNA 2E2IC 1F9NA 3GTJC 3PO3K 2A69A 4A3FK 1XXAA 1K83C 3M4OK 4BBRC 3AD8C 1G51A 1VJEA 3HOUK 4BKWA 4Q5SA 2E2JK 3S2HC 4QIWL 1XZPB 4A3IC 1EQRA 3RZOK 4A3FC 4QJVA 4GTEA 3GEIA 4GTBA 3N0CA 3FKIC 2GSOA 4OIRA 1EK8A 4M1XA 4BY7K 4A3MK 3H3VD 4GTAA 2XCOA 2R93A 3HOVK 1TWHC 3GEHA 2O5IA 3AQOA 2A68A 2ZUFA 3G4AA 1I50A 2E2HC 4P5BA 2R93K 3GTQC 4LK0A 4KM9A 3CQZA 5EGHA 5IOQA 1L0WA 4BY7C 4A3MC 2FQTA 3CQZK 3S1NK 3GTPA 3VA7A 1TWCA 4G0WA 4MQ9A 5M5YK 4LJZA 1I3QK 4MEXA 1YCLA 1JQWA 5C4XK 3GTMK 1B4AA 2V6UA 3S1NC 2PA8L 2CW0A 1Y1VK 4AH6A 2WB1D 2KWAA 1Y1WC 4KMDA 2EBBA 4G7OA 5M3FK 2R7ZA 3I4MC 1I3QC 3GTMC 3HOYK 3GTGA 4XLPA 2NVYA 4OINA 1XZQB 4MEYA 1Y1VC 2VUMA 5M5XK 3GTGK 4XSZA 3HOZK 3S17K 2Y0SD 4YFNA 4GZYA 1R9TK 3S0XA 1WOOA 4BLAA 4C3IK 3FHZA 3SZYA 1F7UA 1WOPA 3I4NK 2JH3A 2CFAB 1RU0A 5IP7C 3S17C 3GTLC 5JVOA 1XPPA 1R9TC 4A3DK 2WAQD 1TWGC 4C3IC 4A3CK 1WQFA 5D4DA 4LLGA 1YX2A 1WCMK 3A8KA 1ISEA 4C3HK 3LAPA 5JFEA 3WODA 1ZQ1C 3AQPA 1SMYA 3GTJA 4QJVB 2E2IK 3T00A 1K83A 4A3CC 4KDDA 1WCMC 1K83K 3K7AK 1HQMA 3PO2C 3OEPA 3GTKK 2ZUEA 4JK1A 5IYCC 3S1QK 3FKIA 4A3IK 4KB2A 5IOSA 5TMFA 4J3NA 2BE5A 3K7AC 3FKIK 5FLMK 3OREA 3S14C 5L46A 1SFOK 5IYBC 4KASA 4AYBD 3GTKC 4PAAA 3FOFA 3OPFA 1TWHA 2JA5C 1YNJA 1VGXA 3HKZL 3S1QC 2E2HA 1TWHK 1C0AA 2V6SA 1I6VA 4KC6A 4Y7NK 1EH1A 5C4JC 3GTQA 1J6XA 5FLMC 4A3JK 4FM9A 4A3EK 1SFOC 2E2HK
chains in the Genus database with same CATH topology
3BP8C 1O2FB 3IPJA 3BP3A 1IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 C;  1O2F B;  3IPJ A;  3BP3 A;  1IBA A; 
#chains in the Genus database with same CATH topology
 1IE0 A;  3GTQ K;  2Y3P A;  4RMF A;  1F7V A;  3TFI A;  2YU9 C;  1ZVU A;  4GTC A;  4KN4 A;  4Y7N C;  4C45 A;  4G7Z A;  4A3J C;  3BP3 A;  4A3E C;  1J98 A;  4GT9 A;  1O25 A;  1PJ7 A;  4Y52 C;  3HOX C;  1O2A A;  1DD5 A;  1TWA C;  4KMA A;  4C3J C;  4Q4Z A;  2JA7 C;  1JOE A;  4XLN A;  3M3Y C;  1J6V A;  3GEE A;  1Y1W A;  4A93 C;  3GTO K;  1Y1W K;  3CAG A;  1I3Q A;  3GTM A;  2B63 K;  4O2D A;  1UV7 A;  1PJ5 A;  3I4M K;  4OIQ A;  1Y1V A;  1XXB A;  1HI9 A;  2W7V A;  3GTO C;  1IL2 A;  2B63 C;  3LAJ A;  3FOE A;  1V5V A;  3LPX A;  5TMC A;  2JA8 K;  4LQY A;  4A3B C;  3L4K A;  5IP9 C;  3ERE D;  4BY1 C;  3GTL A;  1VRQ C;  1ZXO A;  2PMZ D;  3S2D K;  1PJ6 A;  2P5M A;  5IP7 K;  1R9T A;  3GTL K;  1AB4 A;  1TWG A;  2JA8 C;  3AH5 A;  4YFX A;  1TWF C;  1TWG K;  4XSX A;  1F93 A;  5IOR A;  1J6W A;  3GTP C;  3H0G C;  3S2D C;  5CHP A;  4A3K C;  4QIW D;  5E68 A;  5C3E C;  4OIP A;  3H3V L;  3A8J A;  4LK1 A;  1WCM A;  5FJ8 K;  3A8I A;  2V6T A;  2R92 C;  3PO2 K;  1I6H C;  4BBS C;  2E2I A;  3S16 K;  2A6H A;  5IYC K;  1DCP A;  2XCR B;  5IYD K;  1O27 A;  2D6F C;  4ZH4 A;  1WIH A;  5M3M K;  2NVQ K;  3GTK A;  3N0B A;  3S14 K;  2JA5 A;  1GE9 A;  5IYB K;  2NVT C;  2GSN A;  3S16 C;  1USO A;  2NVX C;  3HXA A;  4GTL A;  3TFJ A;  3HOW C;  2JA5 K;  3GIR A;  5IYD C;  2NVQ C;  1SFO A;  4KAR A;  2WB1 L;  2GAG C;  5C4J K;  4KMU A;  1O24 A;  2PA8 D;  4YFK A;  2YU9 A;  3JST A;  1BGW A;  1ZBS A;  1EI6 A;  2YU9 K;  2JA6 K;  3TFH A;  3RZD K;  4A3L K;  3S1M K;  1USM A;  4NOI A;  4C2M K;  4KAT A;  3BP8 C;  2Y0S L;  1KQ4 A;  4G7H A;  1TWA A;  4Y52 K;  2JA7 A;  3HOX K;  3IPJ A;  3SZZ A;  4G0U A;  1ZYR A;  1IBA A;  2JA6 C;  1TWA K;  4C3J K;  2JA7 K;  3M3Y K;  3RZD C;  4A3L C;  3S1M C;  1O28 A;  4GFQ A;  4C2M C;  4A93 K;  3T01 A;  3PO3 C;  3AD9 C;  1WQG A;  2RGR A;  3V4G A;  2WAQ L;  3M4O C;  4KB4 A;  3HOU C;  3GTO A;  3TTG A;  1WQH A;  4XCH A;  2E2J C;  2B63 A;  5EGE A;  4GTF A;  4LR2 A;  3N3Y A;  3RZO C;  2RH6 A;  5TJ3 A;  2FQO A;  3MML B;  4LOW A;  1WOS A;  4GTD A;  1INN A;  4A3B K;  5IP9 K;  1I50 K;  3Q3Q A;  4BY1 K;  1BJT A;  1WSR A;  4KMH A;  3HOV C;  4BLB A;  1TWF A;  3BUE A;  2PPB A;  2R93 C;  4G0V A;  1XZP A;  1TWF K;  3S1R K;  4WJ3 M;  1IQ0 A;  3H0G A;  5C44 K;  4KAW X;  1I50 C;  3AD7 C;  3ADA C;  3G4C A;  3GTP K;  4A3G K;  3H0G K;  3CQZ C;  4A3K K;  1TWC K;  4DDQ A;  3NUH A;  5C3E K;  1DCO A;  4AYB L;  2PHC B;  4WJ4 A;  2A6E A;  2O5J A;  3S1R C;  5C44 C;  4YG2 A;  2GSU A;  1BDF A;  1O29 A;  4A3G C;  1BS2 A;  2R92 A;  4KM8 A;  5C4X C;  1TWC C;  1X31 C;  1XXC A;  3HKZ D;  2R92 K;  3EQL A;  2R7Z K;  1I6H K;  2NVY K;  4BBS K;  4FZB A;  3GDZ A;  2VUM K;  1WSV A;  1WOR A;  4PAB A;  3DXJ A;  1O2F B;  4WIL A;  4OIO A;  3HOY C;  1JVI A;  2P8T A;  4KN7 A;  2R7Z C;  2NVX A;  3QX3 A;  4ILD A;  3GTG C;  2NVY C;  2NVT K;  2GAH C;  5M5W K;  2NVX K;  3HOZ C;  1EFW A;  2VUM C;  3HOW K;  1O26 A;  1IS1 A;  3I4N C;  1DCH A;  4P5A A;  5HL8 A;  4BXX K;  4X6A K;  1O2B A;  1XZQ A;  5CJ9 A;  1VH2 A;  2XCQ A;  4A3D C;  1VLO A;  2ZFZ A;  3S15 K;  1B4B A;  3GTJ K;  2JA6 A;  3GSI A;  4BXX C;  4X6A C;  2CFA A;  3L4J A;  4C3H C;  4BBR K;  4P9S A;  3T02 A;  1IW7 A;  5IOT A;  2PMZ L;  3S2H K;  3S15 C;  1YNN A;  2E2I C;  1F9N A;  3GTJ C;  3PO3 K;  2A69 A;  4A3F K;  1XXA A;  1K83 C;  3M4O K;  4BBR C;  3AD8 C;  1G51 A;  1VJE A;  3HOU K;  4BKW A;  4Q5S A;  2E2J K;  3S2H C;  4QIW L;  1XZP B;  4A3I C;  1EQR A;  3RZO K;  4A3F C;  4QJV A;  4GTE A;  3GEI A;  4GTB A;  3N0C A;  3FKI C;  2GSO A;  4OIR A;  1EK8 A;  4M1X A;  4BY7 K;  4A3M K;  3H3V D;  4GTA A;  2XCO A;  2R93 A;  3HOV K;  1TWH C;  3GEH A;  2O5I A;  3AQO A;  2A68 A;  2ZUF A;  3G4A A;  1I50 A;  2E2H C;  4P5B A;  2R93 K;  3GTQ C;  4LK0 A;  4KM9 A;  3CQZ A;  5EGH A;  5IOQ A;  1L0W A;  4BY7 C;  4A3M C;  2FQT A;  3CQZ K;  3S1N K;  3GTP A;  3VA7 A;  1TWC A;  4G0W A;  4MQ9 A;  5M5Y K;  4LJZ A;  1I3Q K;  4MEX A;  1YCL A;  1JQW A;  5C4X K;  3GTM K;  1B4A A;  2V6U A;  3S1N C;  2PA8 L;  2CW0 A;  1Y1V K;  4AH6 A;  2WB1 D;  2KWA A;  1Y1W C;  4KMD A;  2EBB A;  4G7O A;  5M3F K;  2R7Z A;  3I4M C;  1I3Q C;  3GTM C;  3HOY K;  3GTG A;  4XLP A;  2NVY A;  4OIN A;  1XZQ B;  4MEY A;  1Y1V C;  2VUM A;  5M5X K;  3GTG K;  4XSZ A;  3HOZ K;  3S17 K;  2Y0S D;  4YFN A;  4GZY A;  1R9T K;  3S0X A;  1WOO A;  4BLA A;  4C3I K;  3FHZ A;  3SZY A;  1F7U A;  1WOP A;  3I4N K;  2JH3 A;  2CFA B;  1RU0 A;  5IP7 C;  3S17 C;  3GTL C;  5JVO A;  1XPP A;  1R9T C;  4A3D K;  2WAQ D;  1TWG C;  4C3I C;  4A3C K;  1WQF A;  5D4D A;  4LLG A;  1YX2 A;  1WCM K;  3A8K A;  1ISE A;  4C3H K;  3LAP A;  5JFE A;  3WOD A;  1ZQ1 C;  3AQP A;  1SMY A;  3GTJ A;  4QJV B;  2E2I K;  3T00 A;  1K83 A;  4A3C C;  4KDD A;  1WCM C;  1K83 K;  3K7A K;  1HQM A;  3PO2 C;  3OEP A;  3GTK K;  2ZUE A;  4JK1 A;  5IYC C;  3S1Q K;  3FKI A;  4A3I K;  4KB2 A;  5IOS A;  5TMF A;  4J3N A;  2BE5 A;  3K7A C;  3FKI K;  5FLM K;  3ORE A;  3S14 C;  5L46 A;  1SFO K;  5IYB C;  4KAS A;  4AYB D;  3GTK C;  4PAA A;  3FOF A;  3OPF A;  1TWH A;  2JA5 C;  1YNJ A;  1VGX A;  3HKZ L;  3S1Q C;  2E2H A;  1TWH K;  1C0A A;  2V6S A;  1I6V A;  4KC6 A;  4Y7N K;  1EH1 A;  5C4J C;  3GTQ A;  1J6X A;  5FLM C;  4A3J K;  4FM9 A;  4A3E K;  1SFO C;  2E2H K; 
#chains in the Genus database with same CATH homology
 3BP8 C;  1O2F B;  3IPJ A;  3BP3 A;  1IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...