1KQ4A

Crystal structure of a thy1-complementing protein (tm0449) from thermotoga maritima at 2.25 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
203
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN TM0449
publication title Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 68
structure length 203
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1kq4A00
3N0CA 4KARA 4P5AA 1O29A 4KATA 1O2BA 2CFAB 4GT9A 4P5BA 4GTCA 4GTFA 1O28A 1O27A 1KQ4A 3N0BA 1O2AA 2CFAA 5IOTA 5JFEA 4GTBA 4KASA 5IOQA 5IORA 4GTDA 3G4AA 3AH5A 5CHPA 3G4CA 1O24A 4GTAA 1O26A 4FZBA 1O25A 4GTEA 4GTLA 3N3YA 5IOSA
chains in the Genus database with same CATH superfamily
3H0GC 4KARA 2B63K 1USMA 4KAWX 4Y52K 1SMYA 3VA7A 1XZPB 1O28A 3A8KA 1KQ4A 3S15C 5M5YK 2A6HA 5EGHA 3IPJA 5C44K 4ILDA 1ZYRA 1VH2A 3HOWK 4A3LK 3RZOK 2YU9A 2NVYC 4C2MC 1J6VA 3FOFA 3GTMK 3S2DC 3I4NC 4X6AC 1O29A 1TWCA 4XLPA 2NVXA 3TTGA 4Q4ZA 4GT9A 5C4XC 3CQZA 2YU9C 1O27A 3HKZD 1K83K 4XSXA 1TWHA 1UV7A 3GEIA 4AH6A 2WB1D 4C3IC 1TWAA 5IOTA 2O5JA 2R93A 4BY7K 4A3EK 2PA8L 2JA7K 4J3NA 4BLAA 3GTOK 4NOIA 2JA6C 3HOVC 1YCLA 3JSTA 4A3JK 4KMHA 1TWAC 5D4DA 3FOEA 4P5AA 3H3VL 3M3YK 1ZVUA 3A8JA 3TFJA 2R93C 1ISEA 3PO3C 1I6HK 1SFOA 3S16K 4OIQA 1PJ5A 1I3QA 4LQYA 2NVTK 3S1NK 3SZZA 1GE9A 4GTAA 4KMUA 1DD5A 4FZBA 2XCRB 2PPBA 4Q5SA 1SFOC 4OIRA 5IYCC 1Y1VA 2JA7A 3N3YA 3GSIA 4C3HK 1F93A 2A69A 4G0WA 3HOYC 2R92K 4O2DA 4BBSK 3K7AC 1F9NA 3CAGA 5C3EC 3GTJC 4A3KK 3HOZK 1IQ0A 1Y1VC 5FJ8K 4PAAA 4BY1C 4A3IK 3BUEA 2NVQK 3GTKA 4A3GK 5M5WK 3FKIC 2E2JK 3GTGC 1J98A 2CW0A 4KMDA 4ZH4A 3S1RC 2V6UA 3LAPA 4LK1A 3M4OC 5IYDK 1L0WA 3GTQK 1Y1WC 1XXAA 1WCMC 3GTKC 1I50C 3L4KA 2JA8K 2JA5C 4FM9A 3I4MK 1IS1A 4MEXA 1ZBSA 1HI9A 2Y3PA 1DCPA 1B4BA 3S15K 1JQWA 4XSZA 2A68A 4M1XA 2WAQD 3S1QK 1TWFC 4Y7NK 4G7HA 1F7UA 4BLBA 2NVYK 5C4JC 4BXXC 1B4AA 3S2DK 1BGWA 3I4NK 4X6AK 4AYBD 2R7ZC 4LLGA 3HOXC 1F7VA 2EBBA 4KB2A 4P9SA 4LJZA 2XCOA 5C4XK 1DCOA 1JOEA 2E2HC 1O2AA 5IP7C 4GTBA 1TWGA 4C3IK 3S0XA 1R9TA 4G7OA 2GSOA 5JVOA 3ERED 2E2IA 3N0CA 1WORA 2JA6K 1XZQB 3HOVK 5TMCA 1RU0A 4GTFA 1PJ6A 4BBRC 1R9TC 3S14C 2B63A 1PJ7A 1WQGA 2XCQA 3PO3K 4KASA 2GAHC 2ZUEA 1TWCC 2NVXC 1EFWA 2WB1L 3T00A 3CQZC 3LPXA 5IYBC 4A3MC 4XCHA 4KC6A 5EGEA 1TWHC 2V6TA 3GTMA 3WODA 3S1MK 4JK1A 4G7ZA 4OIOA 1WSVA 3N0BA 5E68A 2PA8D 3HOYK 4QJVA 1IW7A 3K7AK 3Q3QA 2CFAA 5C3EK 4A3LC 1WQFA 3GTJK 1K83A 3T02A 3GTMC 2Y0SD 1O24A 3AD9C 3H3VD 2VUMK 1WOOA 1IBAA 5M3MK 3GTPK 3FKIK 3GTGK 3GTOA 1K83C 2P5MA 3S1RK 1I3QC 3AD7C 5CJ9A 2BE5A 4C3JK 3M4OK 1Y1WK 3AQPA 1WCMK 4BY7C 3NUHA 1I50K 4A3EC 4KM8A 4KN7A 2JA7C 3S17C 2JA5K 4KB4A 3PO2C 3HOUC 4DDQA 3TFIA 1O26A 2FQTA 1IL2A 4LK0A 1ZQ1C 5FLMK 2V6SA 4GTLA 3GTLK 1XXBA 5IOSA 4A3BC 3MMLB 1EI6A 1TWFK 2PMZL 5C4JK 2CFAB 4KMAA 1AB4A 2KWAA 3H0GK 3ADAC 2GSUA 2R7ZK 3OREA 3AD8C 3HOXK 1XPPA 1XZPA 3RZDC 2R92A 1HQMA 2ZUFA 4GFQA 3G4AA 2E2HK 2GSNA 5TJ3A 5IP7K 3HXAA 1WIHA 2W7VA 1V5VA 4OIPA 4QIWD 4GTEA 2R92C 4C2MK 4GZYA 3EQLA 4A3KC 4A93C 1I6VA 3GDZA 4GTCA 2D6FC 3S2HC 3GTQA 4RMFA 4A3IC 2RH6A 3H0GA 5TMFA 4BBRK 2NVQC 3S14K 2YU9K 5IP9C 4YFXA 5CHPA 1VRQC 4LR2A 1TWCK 4A3FC 2NVXK 1ZXOA 4A3CC 5M3FK 3CQZK 5IYBK 2JA8C 4A3MK 1TWHK 1TWGC 2NVYA 4PABA 3I4MC 3V4GA 1TWAK 1DCHA 1INNA 1WOPA 2R93K 4YFKA 4A3DC 2ZFZA 2E2IC 5JFEA 3OEPA 3S1QC 4Y7NC 3HKZL 1EK8A 1IE0A 3T01A 2B63C 4G0UA 5HL8A 4Y52C 3FHZA 2JH3A 4WJ4A 3AQOA 3L4JA 1C0AA 1SFOK 1O2BA 4P5BA 5IYCK 4MQ9A 2JA6A 1I3QK 5C44C 2GAGC 3HOWC 1EH1A 3RZOC 1G51A 1VJEA 1WSRA 3S17K 1Y1VK 3G4CA 3QX3A 3PO2K 3OPFA 3HOUK 4KN4A 4BY1K 3GIRA 2Y0SL 4WILA 2RGRA 1YNJA 5L46A 4XLNA 4A3BK 1BS2A 3GEHA 3A8IA 3BP8C 3GTKK 5IOQA 5IORA 1YNNA 4GTDA 3LAJA 3RZDK 3GTOC 2PHCB 1J6XA 4A3JC 1J6WA 3GTJA 1X31C 1YX2A 2A6EA 3DXJA 3S1MC 3M3YC 2VUMA 4KATA 4OINA 1VGXA 1I6HC 4QJVB 3GTPA 4YFNA 3FKIA 3GTGA 3S16C 4BXXK 4A93K 3GEEA 1BJTA 3TFHA 2NVTC 3S1NC 1JVIA 3S2HK 1EQRA 2VUMC 1Y1WA 1WCMA 3BP3A 2O5IA 1BDFA 1I50A 3AH5A 3GTPC 2PMZD 4C3HC 1WQHA 5IP9K 2JA5A 4C45A 1WOSA 3SZYA 4MEYA 1O2FB 4C3JC 4A3FK 4KDDA 2P8TA 4BBSC 2WAQL 4A3CK 4QIWL 3GTLA 3HOZC 1VLOA 1TWFA 1XZQA 1TWGK 4KM9A 4AYBL 1R9TK 4A3GC 2R7ZA 1USOA 2E2JC 1XXCA 5FLMC 4A3DK 2E2IK 3GTLC 2FQOA 4LOWA 4WJ3M 5M5XK 4G0VA 1O25A 4YG2A 2E2HA 4BKWA 5IYDC 3GTQC
chains in the Genus database with same CATH topology
3LAPA 3AQOA 4KARA 4KAWX 3GTOA 3L4JA 2P5MA 3VA7A 1O2BA 4P5BA 1XXAA 5CJ9A 1O28A 3L4KA 2JA6A 1KQ4A 3AQPA 4FM9A 3NUHA 1IS1A 4KM8A 1ZBSA 1EH1A 5EGHA 4KB4A 2Y3PA 1B4BA 4ILDA 4DDQA 3G4CA 3QX3A 2YU9A 4C2MC 1O26A 4M1XA 3OPFA 3FOFA 4GTLA 4BLBA 1XXBA 5IOSA 3MMLB 2RGRA 1O29A 1B4AA 1TWCA 2NVXA 1BGWA 2CFAB 4GT9A 1AB4A 4KMAA 3CQZA 4KB2A 2KWAA 1O27A 2GSUA 2XCOA 3OREA 1TWHA 1O2AA 2R92A 4C3IC 1TWAA 5IOTA 4GTBA 4GFQA 5IOQA 4GTDA 5IORA 3G4AA 1TWGA 3LAJA 2GSNA 2R93A 2PHCB 5TJ3A 3S0XA 1R9TA 4J3NA 1WIHA 3GTJA 4BLAA 2GSOA 5JVOA 3ERED 2E2IA 4GTEA 4KMHA 3N0CA 2VUMA 3FOEA 4P5AA 4KATA 1ZVUA 3GTPA 3FKIA 4GTCA 1ISEA 4GTFA 3GTGA 2B63A 1BJTA 1WQGA 2XCQA 1SFOA 3GTQA 2RH6A 3H0GA 4KASA 1Y1WA 1I3QA 4LQYA 1WCMA 1I50A 1GE9A 3AH5A 5CHPA 4GTAA 1WQHA 4C3HC 1DD5A 3LPXA 4FZBA 4LR2A 2XCRB 2JA5A 1ZXOA 2JA7A 1Y1VA 3N3YA 4KC6A 5EGEA 4C3JC 4KDDA 3GTMA 3GTLA 4G0WA 2NVYA 3V4GA 1TWFA 1F9NA 3CAGA 3N0BA 4KM9A 2ZFZA 3Q3QA 2CFAA 5JFEA 1WQFA 3OEPA 1K83A 2R7ZA 1XXCA 1EK8A 3BUEA 3GTKA 1O24A 4G0VA 1O25A 4G0UA 2E2HA 4BKWA 4KMDA 3FHZA 2JH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0C A;  4KAR A;  4P5A A;  1O29 A;  4KAT A;  1O2B A;  2CFA B;  4GT9 A;  4P5B A;  4GTC A;  4GTF A;  1O28 A;  1O27 A;  1KQ4 A;  3N0B A;  1O2A A;  2CFA A;  5IOT A;  5JFE A;  4GTB A;  4KAS A;  5IOQ A;  5IOR A;  4GTD A;  3G4A A;  3AH5 A;  5CHP A;  3G4C A;  1O24 A;  4GTA A;  1O26 A;  4FZB A;  1O25 A;  4GTE A;  4GTL A;  3N3Y A;  5IOS A; 
#chains in the Genus database with same CATH topology
 3H0G C;  4KAR A;  2B63 K;  1USM A;  4KAW X;  4Y52 K;  1SMY A;  3VA7 A;  1XZP B;  1O28 A;  3A8K A;  1KQ4 A;  3S15 C;  5M5Y K;  2A6H A;  5EGH A;  3IPJ A;  5C44 K;  4ILD A;  1ZYR A;  1VH2 A;  3HOW K;  4A3L K;  3RZO K;  2YU9 A;  2NVY C;  4C2M C;  1J6V A;  3FOF A;  3GTM K;  3S2D C;  3I4N C;  4X6A C;  1O29 A;  1TWC A;  4XLP A;  2NVX A;  3TTG A;  4Q4Z A;  4GT9 A;  5C4X C;  3CQZ A;  2YU9 C;  1O27 A;  3HKZ D;  1K83 K;  4XSX A;  1TWH A;  1UV7 A;  3GEI A;  4AH6 A;  2WB1 D;  4C3I C;  1TWA A;  5IOT A;  2O5J A;  2R93 A;  4BY7 K;  4A3E K;  2PA8 L;  2JA7 K;  4J3N A;  4BLA A;  3GTO K;  4NOI A;  2JA6 C;  3HOV C;  1YCL A;  3JST A;  4A3J K;  4KMH A;  1TWA C;  5D4D A;  3FOE A;  4P5A A;  3H3V L;  3M3Y K;  1ZVU A;  3A8J A;  3TFJ A;  2R93 C;  1ISE A;  3PO3 C;  1I6H K;  1SFO A;  3S16 K;  4OIQ A;  1PJ5 A;  1I3Q A;  4LQY A;  2NVT K;  3S1N K;  3SZZ A;  1GE9 A;  4GTA A;  4KMU A;  1DD5 A;  4FZB A;  2XCR B;  2PPB A;  4Q5S A;  1SFO C;  4OIR A;  5IYC C;  1Y1V A;  2JA7 A;  3N3Y A;  3GSI A;  4C3H K;  1F93 A;  2A69 A;  4G0W A;  3HOY C;  2R92 K;  4O2D A;  4BBS K;  3K7A C;  1F9N A;  3CAG A;  5C3E C;  3GTJ C;  4A3K K;  3HOZ K;  1IQ0 A;  1Y1V C;  5FJ8 K;  4PAA A;  4BY1 C;  4A3I K;  3BUE A;  2NVQ K;  3GTK A;  4A3G K;  5M5W K;  3FKI C;  2E2J K;  3GTG C;  1J98 A;  2CW0 A;  4KMD A;  4ZH4 A;  3S1R C;  2V6U A;  3LAP A;  4LK1 A;  3M4O C;  5IYD K;  1L0W A;  3GTQ K;  1Y1W C;  1XXA A;  1WCM C;  3GTK C;  1I50 C;  3L4K A;  2JA8 K;  2JA5 C;  4FM9 A;  3I4M K;  1IS1 A;  4MEX A;  1ZBS A;  1HI9 A;  2Y3P A;  1DCP A;  1B4B A;  3S15 K;  1JQW A;  4XSZ A;  2A68 A;  4M1X A;  2WAQ D;  3S1Q K;  1TWF C;  4Y7N K;  4G7H A;  1F7U A;  4BLB A;  2NVY K;  5C4J C;  4BXX C;  1B4A A;  3S2D K;  1BGW A;  3I4N K;  4X6A K;  4AYB D;  2R7Z C;  4LLG A;  3HOX C;  1F7V A;  2EBB A;  4KB2 A;  4P9S A;  4LJZ A;  2XCO A;  5C4X K;  1DCO A;  1JOE A;  2E2H C;  1O2A A;  5IP7 C;  4GTB A;  1TWG A;  4C3I K;  3S0X A;  1R9T A;  4G7O A;  2GSO A;  5JVO A;  3ERE D;  2E2I A;  3N0C A;  1WOR A;  2JA6 K;  1XZQ B;  3HOV K;  5TMC A;  1RU0 A;  4GTF A;  1PJ6 A;  4BBR C;  1R9T C;  3S14 C;  2B63 A;  1PJ7 A;  1WQG A;  2XCQ A;  3PO3 K;  4KAS A;  2GAH C;  2ZUE A;  1TWC C;  2NVX C;  1EFW A;  2WB1 L;  3T00 A;  3CQZ C;  3LPX A;  5IYB C;  4A3M C;  4XCH A;  4KC6 A;  5EGE A;  1TWH C;  2V6T A;  3GTM A;  3WOD A;  3S1M K;  4JK1 A;  4G7Z A;  4OIO A;  1WSV A;  3N0B A;  5E68 A;  2PA8 D;  3HOY K;  4QJV A;  1IW7 A;  3K7A K;  3Q3Q A;  2CFA A;  5C3E K;  4A3L C;  1WQF A;  3GTJ K;  1K83 A;  3T02 A;  3GTM C;  2Y0S D;  1O24 A;  3AD9 C;  3H3V D;  2VUM K;  1WOO A;  1IBA A;  5M3M K;  3GTP K;  3FKI K;  3GTG K;  3GTO A;  1K83 C;  2P5M A;  3S1R K;  1I3Q C;  3AD7 C;  5CJ9 A;  2BE5 A;  4C3J K;  3M4O K;  1Y1W K;  3AQP A;  1WCM K;  4BY7 C;  3NUH A;  1I50 K;  4A3E C;  4KM8 A;  4KN7 A;  2JA7 C;  3S17 C;  2JA5 K;  4KB4 A;  3PO2 C;  3HOU C;  4DDQ A;  3TFI A;  1O26 A;  2FQT A;  1IL2 A;  4LK0 A;  1ZQ1 C;  5FLM K;  2V6S A;  4GTL A;  3GTL K;  1XXB A;  5IOS A;  4A3B C;  3MML B;  1EI6 A;  1TWF K;  2PMZ L;  5C4J K;  2CFA B;  4KMA A;  1AB4 A;  2KWA A;  3H0G K;  3ADA C;  2GSU A;  2R7Z K;  3ORE A;  3AD8 C;  3HOX K;  1XPP A;  1XZP A;  3RZD C;  2R92 A;  1HQM A;  2ZUF A;  4GFQ A;  3G4A A;  2E2H K;  2GSN A;  5TJ3 A;  5IP7 K;  3HXA A;  1WIH A;  2W7V A;  1V5V A;  4OIP A;  4QIW D;  4GTE A;  2R92 C;  4C2M K;  4GZY A;  3EQL A;  4A3K C;  4A93 C;  1I6V A;  3GDZ A;  4GTC A;  2D6F C;  3S2H C;  3GTQ A;  4RMF A;  4A3I C;  2RH6 A;  3H0G A;  5TMF A;  4BBR K;  2NVQ C;  3S14 K;  2YU9 K;  5IP9 C;  4YFX A;  5CHP A;  1VRQ C;  4LR2 A;  1TWC K;  4A3F C;  2NVX K;  1ZXO A;  4A3C C;  5M3F K;  3CQZ K;  5IYB K;  2JA8 C;  4A3M K;  1TWH K;  1TWG C;  2NVY A;  4PAB A;  3I4M C;  3V4G A;  1TWA K;  1DCH A;  1INN A;  1WOP A;  2R93 K;  4YFK A;  4A3D C;  2ZFZ A;  2E2I C;  5JFE A;  3OEP A;  3S1Q C;  4Y7N C;  3HKZ L;  1EK8 A;  1IE0 A;  3T01 A;  2B63 C;  4G0U A;  5HL8 A;  4Y52 C;  3FHZ A;  2JH3 A;  4WJ4 A;  3AQO A;  3L4J A;  1C0A A;  1SFO K;  1O2B A;  4P5B A;  5IYC K;  4MQ9 A;  2JA6 A;  1I3Q K;  5C44 C;  2GAG C;  3HOW C;  1EH1 A;  3RZO C;  1G51 A;  1VJE A;  1WSR A;  3S17 K;  1Y1V K;  3G4C A;  3QX3 A;  3PO2 K;  3OPF A;  3HOU K;  4KN4 A;  4BY1 K;  3GIR A;  2Y0S L;  4WIL A;  2RGR A;  1YNJ A;  5L46 A;  4XLN A;  4A3B K;  1BS2 A;  3GEH A;  3A8I A;  3BP8 C;  3GTK K;  5IOQ A;  5IOR A;  1YNN A;  4GTD A;  3LAJ A;  3RZD K;  3GTO C;  2PHC B;  1J6X A;  4A3J C;  1J6W A;  3GTJ A;  1X31 C;  1YX2 A;  2A6E A;  3DXJ A;  3S1M C;  3M3Y C;  2VUM A;  4KAT A;  4OIN A;  1VGX A;  1I6H C;  4QJV B;  3GTP A;  4YFN A;  3FKI A;  3GTG A;  3S16 C;  4BXX K;  4A93 K;  3GEE A;  1BJT A;  3TFH A;  2NVT C;  3S1N C;  1JVI A;  3S2H K;  1EQR A;  2VUM C;  1Y1W A;  1WCM A;  3BP3 A;  2O5I A;  1BDF A;  1I50 A;  3AH5 A;  3GTP C;  2PMZ D;  4C3H C;  1WQH A;  5IP9 K;  2JA5 A;  4C45 A;  1WOS A;  3SZY A;  4MEY A;  1O2F B;  4C3J C;  4A3F K;  4KDD A;  2P8T A;  4BBS C;  2WAQ L;  4A3C K;  4QIW L;  3GTL A;  3HOZ C;  1VLO A;  1TWF A;  1XZQ A;  1TWG K;  4KM9 A;  4AYB L;  1R9T K;  4A3G C;  2R7Z A;  1USO A;  2E2J C;  1XXC A;  5FLM C;  4A3D K;  2E2I K;  3GTL C;  2FQO A;  4LOW A;  4WJ3 M;  5M5X K;  4G0V A;  1O25 A;  4YG2 A;  2E2H A;  4BKW A;  5IYD C;  3GTQ C; 
#chains in the Genus database with same CATH homology
 3LAP A;  3AQO A;  4KAR A;  4KAW X;  3GTO A;  3L4J A;  2P5M A;  3VA7 A;  1O2B A;  4P5B A;  1XXA A;  5CJ9 A;  1O28 A;  3L4K A;  2JA6 A;  1KQ4 A;  3AQP A;  4FM9 A;  3NUH A;  1IS1 A;  4KM8 A;  1ZBS A;  1EH1 A;  5EGH A;  4KB4 A;  2Y3P A;  1B4B A;  4ILD A;  4DDQ A;  3G4C A;  3QX3 A;  2YU9 A;  4C2M C;  1O26 A;  4M1X A;  3OPF A;  3FOF A;  4GTL A;  4BLB A;  1XXB A;  5IOS A;  3MML B;  2RGR A;  1O29 A;  1B4A A;  1TWC A;  2NVX A;  1BGW A;  2CFA B;  4GT9 A;  1AB4 A;  4KMA A;  3CQZ A;  4KB2 A;  2KWA A;  1O27 A;  2GSU A;  2XCO A;  3ORE A;  1TWH A;  1O2A A;  2R92 A;  4C3I C;  1TWA A;  5IOT A;  4GTB A;  4GFQ A;  5IOQ A;  4GTD A;  5IOR A;  3G4A A;  1TWG A;  3LAJ A;  2GSN A;  2R93 A;  2PHC B;  5TJ3 A;  3S0X A;  1R9T A;  4J3N A;  1WIH A;  3GTJ A;  4BLA A;  2GSO A;  5JVO A;  3ERE D;  2E2I A;  4GTE A;  4KMH A;  3N0C A;  2VUM A;  3FOE A;  4P5A A;  4KAT A;  1ZVU A;  3GTP A;  3FKI A;  4GTC A;  1ISE A;  4GTF A;  3GTG A;  2B63 A;  1BJT A;  1WQG A;  2XCQ A;  1SFO A;  3GTQ A;  2RH6 A;  3H0G A;  4KAS A;  1Y1W A;  1I3Q A;  4LQY A;  1WCM A;  1I50 A;  1GE9 A;  3AH5 A;  5CHP A;  4GTA A;  1WQH A;  4C3H C;  1DD5 A;  3LPX A;  4FZB A;  4LR2 A;  2XCR B;  2JA5 A;  1ZXO A;  2JA7 A;  1Y1V A;  3N3Y A;  4KC6 A;  5EGE A;  4C3J C;  4KDD A;  3GTM A;  3GTL A;  4G0W A;  2NVY A;  3V4G A;  1TWF A;  1F9N A;  3CAG A;  3N0B A;  4KM9 A;  2ZFZ A;  3Q3Q A;  2CFA A;  5JFE A;  1WQF A;  3OEP A;  1K83 A;  2R7Z A;  1XXC A;  1EK8 A;  3BUE A;  3GTK A;  1O24 A;  4G0V A;  1O25 A;  4G0U A;  2E2H A;  4BKW A;  4KMD A;  3FHZ A;  2JH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...