1KQ4A

Crystal structure of a thy1-complementing protein (tm0449) from thermotoga maritima at 2.25 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
203
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN TM0449
publication title Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 68
structure length 203
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1kq4A00
5JFEA 2CFAB 4GTEA 4GTFA 5IOSA 4GTCA 1KQ4A 4KATA 3G4AA 1O28A 5IOTA 4GT9A 3N0CA 5IORA 4GTLA 5IOQA 4P5BA 1O2AA 1O27A 1O25A 1O2BA 3N0BA 4P5AA 4FZBA 2CFAA 4GTBA 3N3YA 1O26A 4GTAA 3G4CA 1O24A 1O29A 3AH5A 5CHPA 4GTDA 4KASA 4KARA
chains in the Genus database with same CATH superfamily
3H3VD 3S15K 2NVXA 4KC6A 3BP8C 4GTFA 2JH3A 1TWGC 5IP9K 4BXXC 4A3DK 2BE5A 3BUEA 5IOTA 5HL8A 2WAQD 2PA8D 2Y3PA 4LOWA 5TMCA 4KM8A 1EQRA 4C2MC 1PJ5A 1K83C 1PJ7A 2GAHC 1XXCA 4KAWX 3PO2C 1IS1A 1Y1VK 4C3IK 2R7ZA 3RZOC 2CW0A 3T00A 1F7UA 1ZBSA 3V4GA 3HXAA 2V6SA 1G51A 4C45A 4XSXA 3AQOA 2JA6C 3GTMA 1I50K 4KN7A 1SFOC 5IYCC 4RMFA 2NVQK 1VJEA 3GTJK 3I4MC 2PMZL 4KMDA 5C3EC 1USOA 1EH1A 1O2BA 2YU9K 4A3IK 1J6VA 2VUMK 2E2IA 4C3JK 4J3NA 1VH2A 3T02A 1TWCC 1O24A 3G4CA 3GTGC 5M5YK 3S1NC 4KASA 3S1QC 5C4JK 3OPFA 2E2JC 1USMA 5IYBK 1WOSA 3TFIA 5IYDK 4A3FK 2A68A 3CQZK 2JA8C 5EGEA 4KB2A 3OREA 3HOUC 4G0UA 4XCHA 4BLAA 2E2HA 4Q4ZA 3GTOA 1ZYRA 3LPXA 1I3QC 3GTQC 4G0VA 3L4KA 4A3LK 2JA7C 4Y52K 2B63A 5M5WK 3S16C 5JFEA 4LQYA 4BBRC 2EBBA 3S0XA 4A3CC 2JA5K 2E2IC 1IW7A 1TWGK 4QJVA 1KQ4A 3M4OK 4YFXA 1WQFA 4WJ3M 1WQHA 2FQTA 4LR2A 4Y7NK 3N0BA 1YNNA 3LAPA 1I6HC 1WCMC 4MEYA 5CHPA 3PO2K 1XPPA 3RZOK 2PMZD 3S1MK 4GTEA 3M3YK 4Q5SA 4WILA 3S17K 4FM9A 5L46A 1O28A 2B63C 5M3MK 3H0GA 3HOVC 3WODA 4C3HC 2RH6A 3I4MK 1O27A 3SZYA 2R93A 2R92K 3FKIC 1O29A 4QIWL 3A8IA 1F93A 4BY1C 2D6FC 1TWCK 3GTGK 3FOEA 1PJ6A 3S1NK 1TWHC 3FOFA 4A3KC 3S1RK 1BDFA 1UV7A 4KATA 3AD9C 2Y0SD 3AQPA 2P8TA 4KB4A 4NOIA 3S2DC 2XCRB 4G0WA 2WB1L 1IBAA 1I6VA 1WQGA 1WIHA 3HOUK 4P5AA 5IP7C 4P9SA 3H0GC 4DDQA 3GTKC 5TJ3A 1I3QK 3GTQK 2V6UA 2JA7K 2NVTK 1TWAA 4MQ9A 1WORA 4A3CK 3TTGA 1TWFA 3JSTA 4GT9A 3N0CA 4XLPA 1IE0A 5IOQA 5FLMK 1O2AA 2NVXC 3SZZA 4X6AC 1BS2A 3GTPK 3S14C 2P5MA 4BY7K 1F9NA 1JVIA 4G7ZA 4AYBL 1WCMK 1R9TK 4KN4A 2PPBA 1J6XA 4OINA 5C44C 5IOSA 4A3JC 2NVYK 4OIRA 1Y1VA 4XLNA 3A8KA 2R7ZC 3GTLK 4A93K 4PAAA 1VLOA 1Y1WK 3IPJA 3DXJA 3I4NK 4OIOA 3HOVK 1TWAC 3K7AC 1YCLA 3GTMC 3HOXC 4C3HK 4A3GK 2FQOA 1I50A 4JK1A 1TWFC 3EQLA 1V5VA 5EGHA 2GSNA 3GTJA 3S15C 1WOPA 3FKIK 5IP9C 2YU9A 1DD5A 4A3DC 2VUMA 3HOWK 1TWHK 4KM9A 4A3KK 2GSUA 1GE9A 3H3VL 4BXXK 3NUHA 5E68A 1XXAA 1XZQB 3S2DK 4GZYA 1Y1VC 3HOYC 3CQZA 4C2MK 1K83K 4GTBA 1EK8A 2PHCB 2XCOA 5C4XC 3GTKK 4O2DA 1B4AA 1I50C 4ZH4A 2E2HC 4G7HA 3GTOC 2NVQC 4KDDA 3GTJC 2JA6K 4BLBA 5JVOA 4AYBD 4A3EC 2YU9C 3GSIA 1SFOK 1XZPA 4GTLA 5IYCK 4P5BA 2JA5A 1ZVUA 3HKZL 1TWGA 2NVXK 5C3EK 4M1XA 1YNJA 3TFJA 4KMUA 2KWAA 5IYDC 4A3FC 1BGWA 1O2FB 3S1QK 3CQZC 2E2JK 1X31C 4A3JK 3FHZA 3S2HC 2XCQA 2R7ZK 5CJ9A 4AH6A 2JA8K 1J98A 4A3LC 1VGXA 2ZFZA 4FZBA 3HOXK 1SMYA 4Y52C 3GTMK 1XZPB 3PO3C 3CAGA 4XSZA 2JA5C 3QX3A 4BBSC 3M4OC 3S16K 2R92A 2R93C 4BBRK 3GEIA 1DCHA 4KMHA 1TWCA 2E2IK 3GTGA 4Y7NC 3ADAC 1HI9A 3T01A 2O5IA 3GEEA 4KMAA 3HOYK 2A6EA 3RZDC 3S1MC 1RU0A 1B4BA 1C0AA 4G7OA 1I6HK 3M3YC 5C4XK 2CFAB 1BJTA 3S17C 5FJ8K 3HKZD 3MMLB 3HOZC 1XZQA 2E2HK 1I3QA 3GTOK 3GTQA 1IL2A 4A3MC 2V6TA 2JA7A 1J6WA 4A3BC 4QIWD 1ZQ1C 4A3EK 2B63K 2ZUEA 2R92C 4GFQA 4OIQA 2O5JA 3Q3QA 2GSOA 3BP3A 3GDZA 4YG2A 3N3YA 3AD7C 4OIPA 1DCPA 4YFKA 4LK0A 1EFWA 3GTPA 4BY1K 3S1RC 2WB1D 1YX2A 4YFNA 1HQMA 1WCMA 1JQWA 1R9TA 5IORA 3S2HK 2W7VA 2NVYA 3GIRA 4LK1A 1DCOA 4WJ4A 4C3IC 2Y0SL 3GTLA 1Y1WA 2RGRA 2WAQL 2PA8L 4ILDA 1F7VA 2NVTC 5IP7K 3L4JA 3PO3K 3H0GK 1ISEA 4BBSK 4GTCA 2R93K 5FLMC 3G4AA 3FKIA 3OEPA 3GTPC 3VA7A 4BY7C 1IQ0A 4A3IC 4BKWA 2VUMC 1O25A 1TWHA 4MEXA 4C3JC 1R9TC 4X6AK 2A6HA 1O26A 1WSVA 3S14K 5C4JC 3AH5A 3TFHA 5IYBC 1WSRA 3A8JA 1JOEA 1EI6A 2NVYC 3RZDK 2A69A 1INNA 4LJZA 5M5XK 3GTLC 1K83A 4A93C 1Y1WC 5C44K 3I4NC 3LAJA 3GTKA 3HOZK 3AD8C 2ZUFA 4A3GC 5D4DA 4A3MK 5M3FK 1ZXOA 4QJVB 2GAGC 4A3BK 1WOOA 2JA6A 5TMFA 1TWAK 3K7AK 4PABA 1AB4A 1XXBA 2CFAA 3ERED 4GTAA 1SFOA 1TWFK 4LLGA 4GTDA 4KARA 1L0WA 3GEHA 3HOWC 1VRQC
chains in the Genus database with same CATH topology
1DD5A 2CFAB 1BJTA 4GTEA 4KC6A 2VUMA 4GTFA 2NVXA 2JH3A 4KM9A 3MMLB 2GSUA 1GE9A 1I3QA 4FM9A 3GTQA 3BUEA 1O28A 5IOTA 3H0GA 2JA7A 2Y3PA 3NUHA 4C3HC 4KM8A 1XXAA 2RH6A 4C2MC 1O27A 4GFQA 3Q3QA 1XXCA 2GSOA 3CQZA 2R93A 4KAWX 4GTBA 3N3YA 1IS1A 1EK8A 2PHCB 1O29A 2R7ZA 2XCOA 1ZBSA 3V4GA 3FOEA 3GTPA 1B4AA 3FOFA 3AQOA 3GTMA 4KDDA 1WCMA 4KATA 4BLBA 1R9TA 5JVOA 3AQPA 4KB4A 5IORA 2XCRB 4GTLA 4G0WA 4KMDA 4P5BA 1WQGA 2NVYA 2JA5A 1WIHA 1EH1A 1O2BA 1ZVUA 1TWGA 4P5AA 4C3IC 3GTLA 2E2IA 1Y1WA 4J3NA 4DDQA 3G4CA 1O24A 4ILDA 4M1XA 2RGRA 5TJ3A 3L4JA 4KASA 3OPFA 2KWAA 1BGWA 1TWAA 1ISEA 4GTCA 1TWFA 3FHZA 3G4AA 3FKIA 3OEPA 2XCQA 3N0CA 4GT9A 5EGEA 5CJ9A 3VA7A 4KB2A 3OREA 5IOQA 1O2AA 4BKWA 4G0UA 1O25A 1TWHA 4BLAA 2P5MA 4C3JC 1F9NA 2E2HA 2ZFZA 4FZBA 3GTOA 3LPXA 1O26A 4G0VA 3L4KA 3AH5A 3CAGA 2B63A 5JFEA 3QX3A 4LQYA 3S0XA 5IOSA 1K83A 2R92A 1Y1VA 3LAJA 1KQ4A 4KMHA 1WQFA 1TWCA 3GTGA 3GTKA 1WQHA 1ZXOA 4LR2A 3N0BA 1I50A 3LAPA 2JA6A 1AB4A 1XXBA 2CFAA 4KMAA 3ERED 5EGHA 2GSNA 4GTAA 3GTJA 5CHPA 1SFOA 1B4BA 4GTDA 4KARA 2YU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFE A;  2CFA B;  4GTE A;  4GTF A;  5IOS A;  4GTC A;  1KQ4 A;  4KAT A;  3G4A A;  1O28 A;  5IOT A;  4GT9 A;  3N0C A;  5IOR A;  4GTL A;  5IOQ A;  4P5B A;  1O2A A;  1O27 A;  1O25 A;  1O2B A;  3N0B A;  4P5A A;  4FZB A;  2CFA A;  4GTB A;  3N3Y A;  1O26 A;  4GTA A;  3G4C A;  1O24 A;  1O29 A;  3AH5 A;  5CHP A;  4GTD A;  4KAS A;  4KAR A; 
#chains in the Genus database with same CATH topology
 3H3V D;  3S15 K;  2NVX A;  4KC6 A;  3BP8 C;  4GTF A;  2JH3 A;  1TWG C;  5IP9 K;  4BXX C;  4A3D K;  2BE5 A;  3BUE A;  5IOT A;  5HL8 A;  2WAQ D;  2PA8 D;  2Y3P A;  4LOW A;  5TMC A;  4KM8 A;  1EQR A;  4C2M C;  1PJ5 A;  1K83 C;  1PJ7 A;  2GAH C;  1XXC A;  4KAW X;  3PO2 C;  1IS1 A;  1Y1V K;  4C3I K;  2R7Z A;  3RZO C;  2CW0 A;  3T00 A;  1F7U A;  1ZBS A;  3V4G A;  3HXA A;  2V6S A;  1G51 A;  4C45 A;  4XSX A;  3AQO A;  2JA6 C;  3GTM A;  1I50 K;  4KN7 A;  1SFO C;  5IYC C;  4RMF A;  2NVQ K;  1VJE A;  3GTJ K;  3I4M C;  2PMZ L;  4KMD A;  5C3E C;  1USO A;  1EH1 A;  1O2B A;  2YU9 K;  4A3I K;  1J6V A;  2VUM K;  2E2I A;  4C3J K;  4J3N A;  1VH2 A;  3T02 A;  1TWC C;  1O24 A;  3G4C A;  3GTG C;  5M5Y K;  3S1N C;  4KAS A;  3S1Q C;  5C4J K;  3OPF A;  2E2J C;  1USM A;  5IYB K;  1WOS A;  3TFI A;  5IYD K;  4A3F K;  2A68 A;  3CQZ K;  2JA8 C;  5EGE A;  4KB2 A;  3ORE A;  3HOU C;  4G0U A;  4XCH A;  4BLA A;  2E2H A;  4Q4Z A;  3GTO A;  1ZYR A;  3LPX A;  1I3Q C;  3GTQ C;  4G0V A;  3L4K A;  4A3L K;  2JA7 C;  4Y52 K;  2B63 A;  5M5W K;  3S16 C;  5JFE A;  4LQY A;  4BBR C;  2EBB A;  3S0X A;  4A3C C;  2JA5 K;  2E2I C;  1IW7 A;  1TWG K;  4QJV A;  1KQ4 A;  3M4O K;  4YFX A;  1WQF A;  4WJ3 M;  1WQH A;  2FQT A;  4LR2 A;  4Y7N K;  3N0B A;  1YNN A;  3LAP A;  1I6H C;  1WCM C;  4MEY A;  5CHP A;  3PO2 K;  1XPP A;  3RZO K;  2PMZ D;  3S1M K;  4GTE A;  3M3Y K;  4Q5S A;  4WIL A;  3S17 K;  4FM9 A;  5L46 A;  1O28 A;  2B63 C;  5M3M K;  3H0G A;  3HOV C;  3WOD A;  4C3H C;  2RH6 A;  3I4M K;  1O27 A;  3SZY A;  2R93 A;  2R92 K;  3FKI C;  1O29 A;  4QIW L;  3A8I A;  1F93 A;  4BY1 C;  2D6F C;  1TWC K;  3GTG K;  3FOE A;  1PJ6 A;  3S1N K;  1TWH C;  3FOF A;  4A3K C;  3S1R K;  1BDF A;  1UV7 A;  4KAT A;  3AD9 C;  2Y0S D;  3AQP A;  2P8T A;  4KB4 A;  4NOI A;  3S2D C;  2XCR B;  4G0W A;  2WB1 L;  1IBA A;  1I6V A;  1WQG A;  1WIH A;  3HOU K;  4P5A A;  5IP7 C;  4P9S A;  3H0G C;  4DDQ A;  3GTK C;  5TJ3 A;  1I3Q K;  3GTQ K;  2V6U A;  2JA7 K;  2NVT K;  1TWA A;  4MQ9 A;  1WOR A;  4A3C K;  3TTG A;  1TWF A;  3JST A;  4GT9 A;  3N0C A;  4XLP A;  1IE0 A;  5IOQ A;  5FLM K;  1O2A A;  2NVX C;  3SZZ A;  4X6A C;  1BS2 A;  3GTP K;  3S14 C;  2P5M A;  4BY7 K;  1F9N A;  1JVI A;  4G7Z A;  4AYB L;  1WCM K;  1R9T K;  4KN4 A;  2PPB A;  1J6X A;  4OIN A;  5C44 C;  5IOS A;  4A3J C;  2NVY K;  4OIR A;  1Y1V A;  4XLN A;  3A8K A;  2R7Z C;  3GTL K;  4A93 K;  4PAA A;  1VLO A;  1Y1W K;  3IPJ A;  3DXJ A;  3I4N K;  4OIO A;  3HOV K;  1TWA C;  3K7A C;  1YCL A;  3GTM C;  3HOX C;  4C3H K;  4A3G K;  2FQO A;  1I50 A;  4JK1 A;  1TWF C;  3EQL A;  1V5V A;  5EGH A;  2GSN A;  3GTJ A;  3S15 C;  1WOP A;  3FKI K;  5IP9 C;  2YU9 A;  1DD5 A;  4A3D C;  2VUM A;  3HOW K;  1TWH K;  4KM9 A;  4A3K K;  2GSU A;  1GE9 A;  3H3V L;  4BXX K;  3NUH A;  5E68 A;  1XXA A;  1XZQ B;  3S2D K;  4GZY A;  1Y1V C;  3HOY C;  3CQZ A;  4C2M K;  1K83 K;  4GTB A;  1EK8 A;  2PHC B;  2XCO A;  5C4X C;  3GTK K;  4O2D A;  1B4A A;  1I50 C;  4ZH4 A;  2E2H C;  4G7H A;  3GTO C;  2NVQ C;  4KDD A;  3GTJ C;  2JA6 K;  4BLB A;  5JVO A;  4AYB D;  4A3E C;  2YU9 C;  3GSI A;  1SFO K;  1XZP A;  4GTL A;  5IYC K;  4P5B A;  2JA5 A;  1ZVU A;  3HKZ L;  1TWG A;  2NVX K;  5C3E K;  4M1X A;  1YNJ A;  3TFJ A;  4KMU A;  2KWA A;  5IYD C;  4A3F C;  1BGW A;  1O2F B;  3S1Q K;  3CQZ C;  2E2J K;  1X31 C;  4A3J K;  3FHZ A;  3S2H C;  2XCQ A;  2R7Z K;  5CJ9 A;  4AH6 A;  2JA8 K;  1J98 A;  4A3L C;  1VGX A;  2ZFZ A;  4FZB A;  3HOX K;  1SMY A;  4Y52 C;  3GTM K;  1XZP B;  3PO3 C;  3CAG A;  4XSZ A;  2JA5 C;  3QX3 A;  4BBS C;  3M4O C;  3S16 K;  2R92 A;  2R93 C;  4BBR K;  3GEI A;  1DCH A;  4KMH A;  1TWC A;  2E2I K;  3GTG A;  4Y7N C;  3ADA C;  1HI9 A;  3T01 A;  2O5I A;  3GEE A;  4KMA A;  3HOY K;  2A6E A;  3RZD C;  3S1M C;  1RU0 A;  1B4B A;  1C0A A;  4G7O A;  1I6H K;  3M3Y C;  5C4X K;  2CFA B;  1BJT A;  3S17 C;  5FJ8 K;  3HKZ D;  3MML B;  3HOZ C;  1XZQ A;  2E2H K;  1I3Q A;  3GTO K;  3GTQ A;  1IL2 A;  4A3M C;  2V6T A;  2JA7 A;  1J6W A;  4A3B C;  4QIW D;  1ZQ1 C;  4A3E K;  2B63 K;  2ZUE A;  2R92 C;  4GFQ A;  4OIQ A;  2O5J A;  3Q3Q A;  2GSO A;  3BP3 A;  3GDZ A;  4YG2 A;  3N3Y A;  3AD7 C;  4OIP A;  1DCP A;  4YFK A;  4LK0 A;  1EFW A;  3GTP A;  4BY1 K;  3S1R C;  2WB1 D;  1YX2 A;  4YFN A;  1HQM A;  1WCM A;  1JQW A;  1R9T A;  5IOR A;  3S2H K;  2W7V A;  2NVY A;  3GIR A;  4LK1 A;  1DCO A;  4WJ4 A;  4C3I C;  2Y0S L;  3GTL A;  1Y1W A;  2RGR A;  2WAQ L;  2PA8 L;  4ILD A;  1F7V A;  2NVT C;  5IP7 K;  3L4J A;  3PO3 K;  3H0G K;  1ISE A;  4BBS K;  4GTC A;  2R93 K;  5FLM C;  3G4A A;  3FKI A;  3OEP A;  3GTP C;  3VA7 A;  4BY7 C;  1IQ0 A;  4A3I C;  4BKW A;  2VUM C;  1O25 A;  1TWH A;  4MEX A;  4C3J C;  1R9T C;  4X6A K;  2A6H A;  1O26 A;  1WSV A;  3S14 K;  5C4J C;  3AH5 A;  3TFH A;  5IYB C;  1WSR A;  3A8J A;  1JOE A;  1EI6 A;  2NVY C;  3RZD K;  2A69 A;  1INN A;  4LJZ A;  5M5X K;  3GTL C;  1K83 A;  4A93 C;  1Y1W C;  5C44 K;  3I4N C;  3LAJ A;  3GTK A;  3HOZ K;  3AD8 C;  2ZUF A;  4A3G C;  5D4D A;  4A3M K;  5M3F K;  1ZXO A;  4QJV B;  2GAG C;  4A3B K;  1WOO A;  2JA6 A;  5TMF A;  1TWA K;  3K7A K;  4PAB A;  1AB4 A;  1XXB A;  2CFA A;  3ERE D;  4GTA A;  1SFO A;  1TWF K;  4LLG A;  4GTD A;  4KAR A;  1L0W A;  3GEH A;  3HOW C;  1VRQ C; 
#chains in the Genus database with same CATH homology
 1DD5 A;  2CFA B;  1BJT A;  4GTE A;  4KC6 A;  2VUM A;  4GTF A;  2NVX A;  2JH3 A;  4KM9 A;  3MML B;  2GSU A;  1GE9 A;  1I3Q A;  4FM9 A;  3GTQ A;  3BUE A;  1O28 A;  5IOT A;  3H0G A;  2JA7 A;  2Y3P A;  3NUH A;  4C3H C;  4KM8 A;  1XXA A;  2RH6 A;  4C2M C;  1O27 A;  4GFQ A;  3Q3Q A;  1XXC A;  2GSO A;  3CQZ A;  2R93 A;  4KAW X;  4GTB A;  3N3Y A;  1IS1 A;  1EK8 A;  2PHC B;  1O29 A;  2R7Z A;  2XCO A;  1ZBS A;  3V4G A;  3FOE A;  3GTP A;  1B4A A;  3FOF A;  3AQO A;  3GTM A;  4KDD A;  1WCM A;  4KAT A;  4BLB A;  1R9T A;  5JVO A;  3AQP A;  4KB4 A;  5IOR A;  2XCR B;  4GTL A;  4G0W A;  4KMD A;  4P5B A;  1WQG A;  2NVY A;  2JA5 A;  1WIH A;  1EH1 A;  1O2B A;  1ZVU A;  1TWG A;  4P5A A;  4C3I C;  3GTL A;  2E2I A;  1Y1W A;  4J3N A;  4DDQ A;  3G4C A;  1O24 A;  4ILD A;  4M1X A;  2RGR A;  5TJ3 A;  3L4J A;  4KAS A;  3OPF A;  2KWA A;  1BGW A;  1TWA A;  1ISE A;  4GTC A;  1TWF A;  3FHZ A;  3G4A A;  3FKI A;  3OEP A;  2XCQ A;  3N0C A;  4GT9 A;  5EGE A;  5CJ9 A;  3VA7 A;  4KB2 A;  3ORE A;  5IOQ A;  1O2A A;  4BKW A;  4G0U A;  1O25 A;  1TWH A;  4BLA A;  2P5M A;  4C3J C;  1F9N A;  2E2H A;  2ZFZ A;  4FZB A;  3GTO A;  3LPX A;  1O26 A;  4G0V A;  3L4K A;  3AH5 A;  3CAG A;  2B63 A;  5JFE A;  3QX3 A;  4LQY A;  3S0X A;  5IOS A;  1K83 A;  2R92 A;  1Y1V A;  3LAJ A;  1KQ4 A;  4KMH A;  1WQF A;  1TWC A;  3GTG A;  3GTK A;  1WQH A;  1ZXO A;  4LR2 A;  3N0B A;  1I50 A;  3LAP A;  2JA6 A;  1AB4 A;  1XXB A;  2CFA A;  4KMA A;  3ERE D;  5EGH A;  2GSN A;  4GTA A;  3GTJ A;  5CHP A;  1SFO A;  1B4B A;  4GTD A;  4KAR A;  2YU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...