1KQ4A

Crystal structure of a thy1-complementing protein (tm0449) from thermotoga maritima at 2.25 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
203
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN TM0449
total genus 68
structure length 203
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1kq4A00
4KATA 4GTAA 4GTDA 2CFAB 4GTFA 4KASA 2CFAA 4GTBA 5JFEA 1O27A 5IORA 4GTCA 1O2BA 4FZBA 4GT9A 4P5BA 3N0BA 1O28A 5CHPA 4KARA 3G4CA 1O25A 1O26A 4GTLA 3N0CA 5IOSA 3N3YA 1O24A 1KQ4A 3AH5A 5IOTA 5IOQA 1O29A 4GTEA 4P5AA 1O2AA 3G4AA
chains in the Genus database with same CATH superfamily
1I6HK 2E2HA 3SZYA 1DCHA 3S1QK 3HKZL 1WQGA 3FKIC 4OIPA 1C0AA 4A3KK 2JA7C 1WOSA 4PABA 3CQZC 1USMA 3GTMA 5C44K 1WIHA 4MEXA 4A3GK 4A3EC 1O26A 4A3FC 3H0GC 4QIWL 1ZYRA 3N3YA 1BS2A 3BP3A 2E2IC 2XCOA 2JA8C 4KB2A 2PA8L 4QJVB 4OIQA 4GTBA 3GTGK 4A3CC 4KN4A 2YU9C 1AB4A 2R93C 2R92A 4GFQA 2JA7K 2B63C 2W7VA 2JH3A 3H0GA 4BKWA 3CQZK 3TTGA 2R7ZK 4KM8A 3HOZK 1O24A 1I3QA 1WQFA 1JOEA 5IOQA 5FJ8K 3PO3C 2GAGC 3GTLC 4KM9A 4GTEA 2R7ZA 3IPJA 4Y52C 1VJEA 5IYCK 5C4JK 3GSIA 2JA8K 4A3MK 3S15K 3S1MC 1GE9A 1HQMA 1I6VA 4KB4A 4G7ZA 1TWAA 5C4XK 5IYBC 2R92C 3HOYK 2R93A 1ISEA 3HXAA 3GTLK 3CAGA 4KARA 4XSXA 4KMAA 4AYBD 3S16C 3GTKA 2GAHC 1DCOA 3HOXK 2NVXA 1INNA 2A6EA 4Q4ZA 3GTQK 3AQPA 1K83C 1TWGA 2V6UA 2E2IA 1ZXOA 4A3EK 2Y0SL 3NUHA 4GTAA 1YNJA 5C3EC 2JA5A 1BJTA 1TWAC 4RMFA 5IP9K 1XZPA 5M5XK 4FZBA 4LQYA 1X31C 1I3QK 3OREA 4KMHA 2JA6C 3OEPA 2ZUFA 1WOOA 3GTOK 3JSTA 2ZUEA 1SMYA 4C3HK 3VA7A 5FLMC 2B63A 1YNNA 3GEEA 5C3EK 3GTMK 5M5YK 5IP9C 1I3QC 1IL2A 2BE5A 2R7ZC 3HOZC 3GTQC 4G0UA 3RZOC 4AYBL 4DDQA 2RH6A 1I6HC 1B4AA 5EGEA 1RU0A 3H3VD 3RZDC 2PMZL 4O2DA 4BY1C 4YFKA 3HOWC 3GIRA 1Y1WK 1XPPA 5IOSA 1VGXA 3AH5A 5FLMK 3HOVC 2NVXC 4LJZA 3GTKK 4KN7A 2XCRB 3S2DC 4J3NA 1K83A 1XXAA 2E2HC 1O27A 2VUMC 3FKIA 5TMCA 3TFJA 2GSOA 1EK8A 2RGRA 1EI6A 1I50K 1TWFK 3AD8C 4WJ3M 3GTOC 1O29A 4LOWA 3I4MK 2NVTC 3G4AA 2D6FC 4P9SA 4LR2A 3EQLA 1WQHA 5JFEA 2R92K 3HOYC 1WCMA 3GTQA 4A3FK 1O2BA 1G51A 1YCLA 3K7AC 5C4JC 1I50C 1TWFC 3FOFA 4P5BA 1R9TC 1O28A 4G0VA 4BY7C 4OIRA 3GTJC 4BXXC 3HOXC 3M3YC 5IYDC 3S2HK 4KC6A 4OIOA 3GTGC 3A8KA 3LAJA 2EBBA 2FQOA 3S17K 1O2FB 4C45A 3I4MC 4LK0A 4A3DC 4C2MK 3HOVK 5D4DA 3M4OC 2NVQC 2VUMA 4GT9A 3N0BA 1IQ0A 3PO3K 1TWCK 3H0GK 4ZH4A 2E2IK 4QIWD 3PO2K 5IYCC 4XLNA 3GTJK 4YFXA 1J6WA 4X6AK 3FOEA 1F7UA 1J6XA 2WB1L 4A3CK 4GTDA 2CFAB 1TWGC 4GTFA 3MMLB 2CFAA 3I4NC 2YU9K 2KWAA 3V4GA 2R93K 4YG2A 3GEHA 2WAQD 4A3BC 2A68A 2FQTA 3GEIA 1Y1WC 1J98A 2JA6A 3LAPA 4C3JC 2A6HA 1WSVA 4ILDA 5L46A 3OPFA 3I4NK 4BY1K 1TWHK 2PMZD 3S1NC 5IOTA 1F7VA 3PO2C 5HL8A 4BLBA 4M1XA 5C44C 3BUEA 4OINA 1F93A 3Q3QA 4A3JC 1F9NA 4XCHA 4Y7NK 2PPBA 3ADAC 3S17C 4A3MC 2YU9A 2O5JA 3G4CA 1BDFA 3BP8C 3M4OK 5IYBK 5E68A 1XXCA 2NVYA 1XZQA 3L4KA 4KAWX 1O2AA 3TFHA 1EFWA 4KASA 1BGWA 3SZZA 2B63K 3AQOA 4FM9A 5TMFA 1L0WA 3A8JA 4X6AC 1Y1VK 1SFOA 2PHCB 5IYDK 4LK1A 3S2HC 2NVXK 3GDZA 4JK1A 1Y1WA 1R9TK 1O25A 1EH1A 1XXBA 3QX3A 1PJ5A 1TWHA 4YFNA 5TJ3A 3S14K 2V6TA 4A3DK 4P5AA 4GTLA 2E2JK 4QJVA 2P8TA 3S1RC 2JA5C 3ERED 4MQ9A 2NVYK 4G0WA 3HOWK 1I50A 1TWFA 1WSRA 4A93C 2Y0SD 4C3IC 1WORA 4A3IK 4BBSK 2Y3PA 1SFOK 3K7AK 1ZVUA 1WCMK 4Q5SA 3FKIK 2NVYC 1VRQC 1XZPB 4BY7K 1DD5A 4C3HC 2XCQA 4BBSC 1TWCA 4A3BK 2PA8D 1IBAA 4AH6A 1UV7A 2E2JC 1TWGK 5M3MK 4LLGA 1TWAK 1SFOC 4Y52K 2JA5K 2GSUA 1JQWA 1ZQ1C 4A93K 3RZOK 1B4BA 3GTLA 1KQ4A 4C3IK 4A3IC 2NVQK 4XSZA 1TWHC 3S0XA 3AD9C 3S16K 4MEYA 1J6VA 1ZBSA 4PAAA 4KMDA 5CHPA 2O5IA 3H3VL 1XZQB 3GTKC 1USOA 4Y7NC 2E2HK 3GTOA 2GSNA 2VUMK 4WJ4A 4A3KC 1Y1VC 4KATA 5EGHA 3AD7C 2JA7A 5IORA 4A3LC 4GTCA 2P5MA 3LPXA 4XLPA 5M5WK 4G7HA 1PJ7A 1PJ6A 1TWCC 3T02A 1WCMC 3GTJA 5JVOA 1JVIA 2WAQL 1DCPA 1HI9A 4BBRK 1IW7A 1R9TA 2NVTK 5C4XC 4C2MC 5IP7K 1IS1A 3HOUK 4GZYA 3HKZD 1VH2A 3S14C 3N0CA 1IE0A 2CW0A 5CJ9A 3RZDK 2WB1D 1Y1VA 3T01A 3GTPC 4A3JK 3GTGA 3S1RK 3WODA 2V6SA 4BXXK 3T00A 1EQRA 1K83K 1V5VA 2JA6K 3M3YK 3A8IA 5M3FK 3FHZA 1WOPA 4KDDA 4G7OA 3S2DK 4A3LK 3L4JA 3GTPK 4WILA 4BLAA 3S1QC 3CQZA 3GTMC 3S1NK 2A69A 4KMUA 3TFIA 3S1MK 3S15C 4BBRC 3GTPA 3DXJA 5IP7C 1YX2A 3HOUC 4NOIA 1VLOA 2ZFZA 4C3JK 4A3GC
chains in the Genus database with same CATH topology
2E2HA 4GTDA 2CFAB 4GTFA 1DD5A 4C3HC 4G0UA 3MMLB 2CFAA 2XCQA 1WQGA 1TWCA 4DDQA 2RH6A 2KWAA 3V4GA 1B4AA 5EGEA 3GTMA 2JA6A 3LAPA 4C3JC 1WIHA 2GSUA 4ILDA 1O26A 3OPFA 5IOSA 1B4BA 3N3YA 3GTLA 1KQ4A 3AH5A 5IOTA 2XCOA 4BLBA 2XCRB 3S0XA 4M1XA 4J3NA 1K83A 4KB2A 1XXAA 4GTBA 1O27A 3BUEA 3FKIA 1ZBSA 3Q3QA 1F9NA 2GSOA 4KMDA 5CHPA 1AB4A 2R92A 4GFQA 2YU9A 1EK8A 3G4CA 2JH3A 3H0GA 4BKWA 2RGRA 4KM8A 3GTOA 2GSNA 1O24A 1XXCA 2NVYA 1I3QA 1WQFA 5IOQA 1O29A 3L4KA 4KM9A 4GTEA 4KAWX 2R7ZA 1O2AA 3G4AA 4KATA 4LR2A 5EGHA 4KASA 1GE9A 1BGWA 1WQHA 5JFEA 3AQOA 4FM9A 5IORA 2JA7A 1WCMA 2P5MA 3LPXA 4GTCA 1O2BA 4KB4A 3GTQA 1SFOA 1TWAA 2PHCB 3FOFA 2R93A 1ISEA 4P5BA 3GTJA 5JVOA 1O28A 4G0VA 1R9TA 3CAGA 4KARA 4C2MC 1Y1WA 4KMAA 1IS1A 1O25A 1EH1A 3GTKA 1XXBA 3QX3A 3N0CA 2NVXA 4KC6A 5CJ9A 1TWHA 1Y1VA 3AQPA 5TJ3A 4P5AA 4GTLA 1TWGA 3GTGA 2E2IA 1ZXOA 3LAJA 3NUHA 4GTAA 2JA5A 1BJTA 3FHZA 4FZBA 4LQYA 3ERED 2VUMA 4KDDA 3OREA 4GT9A 4KMHA 4G0WA 3N0BA 3OEPA 3L4JA 1I50A 1TWFA 4BLAA 3VA7A 3CQZA 4C3IC 2B63A 3GTPA 2Y3PA 3FOEA 1ZVUA 2ZFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAT A;  4GTA A;  4GTD A;  2CFA B;  4GTF A;  4KAS A;  2CFA A;  4GTB A;  5JFE A;  1O27 A;  5IOR A;  4GTC A;  1O2B A;  4FZB A;  4GT9 A;  4P5B A;  3N0B A;  1O28 A;  5CHP A;  4KAR A;  3G4C A;  1O25 A;  1O26 A;  4GTL A;  3N0C A;  5IOS A;  3N3Y A;  1O24 A;  1KQ4 A;  3AH5 A;  5IOT A;  5IOQ A;  1O29 A;  4GTE A;  4P5A A;  1O2A A;  3G4A A; 
#chains in the Genus database with same CATH topology
 1I6H K;  2E2H A;  3SZY A;  1DCH A;  3S1Q K;  3HKZ L;  1WQG A;  3FKI C;  4OIP A;  1C0A A;  4A3K K;  2JA7 C;  1WOS A;  4PAB A;  3CQZ C;  1USM A;  3GTM A;  5C44 K;  1WIH A;  4MEX A;  4A3G K;  4A3E C;  1O26 A;  4A3F C;  3H0G C;  4QIW L;  1ZYR A;  3N3Y A;  1BS2 A;  3BP3 A;  2E2I C;  2XCO A;  2JA8 C;  4KB2 A;  2PA8 L;  4QJV B;  4OIQ A;  4GTB A;  3GTG K;  4A3C C;  4KN4 A;  2YU9 C;  1AB4 A;  2R93 C;  2R92 A;  4GFQ A;  2JA7 K;  2B63 C;  2W7V A;  2JH3 A;  3H0G A;  4BKW A;  3CQZ K;  3TTG A;  2R7Z K;  4KM8 A;  3HOZ K;  1O24 A;  1I3Q A;  1WQF A;  1JOE A;  5IOQ A;  5FJ8 K;  3PO3 C;  2GAG C;  3GTL C;  4KM9 A;  4GTE A;  2R7Z A;  3IPJ A;  4Y52 C;  1VJE A;  5IYC K;  5C4J K;  3GSI A;  2JA8 K;  4A3M K;  3S15 K;  3S1M C;  1GE9 A;  1HQM A;  1I6V A;  4KB4 A;  4G7Z A;  1TWA A;  5C4X K;  5IYB C;  2R92 C;  3HOY K;  2R93 A;  1ISE A;  3HXA A;  3GTL K;  3CAG A;  4KAR A;  4XSX A;  4KMA A;  4AYB D;  3S16 C;  3GTK A;  2GAH C;  1DCO A;  3HOX K;  2NVX A;  1INN A;  2A6E A;  4Q4Z A;  3GTQ K;  3AQP A;  1K83 C;  1TWG A;  2V6U A;  2E2I A;  1ZXO A;  4A3E K;  2Y0S L;  3NUH A;  4GTA A;  1YNJ A;  5C3E C;  2JA5 A;  1BJT A;  1TWA C;  4RMF A;  5IP9 K;  1XZP A;  5M5X K;  4FZB A;  4LQY A;  1X31 C;  1I3Q K;  3ORE A;  4KMH A;  2JA6 C;  3OEP A;  2ZUF A;  1WOO A;  3GTO K;  3JST A;  2ZUE A;  1SMY A;  4C3H K;  3VA7 A;  5FLM C;  2B63 A;  1YNN A;  3GEE A;  5C3E K;  3GTM K;  5M5Y K;  5IP9 C;  1I3Q C;  1IL2 A;  2BE5 A;  2R7Z C;  3HOZ C;  3GTQ C;  4G0U A;  3RZO C;  4AYB L;  4DDQ A;  2RH6 A;  1I6H C;  1B4A A;  5EGE A;  1RU0 A;  3H3V D;  3RZD C;  2PMZ L;  4O2D A;  4BY1 C;  4YFK A;  3HOW C;  3GIR A;  1Y1W K;  1XPP A;  5IOS A;  1VGX A;  3AH5 A;  5FLM K;  3HOV C;  2NVX C;  4LJZ A;  3GTK K;  4KN7 A;  2XCR B;  3S2D C;  4J3N A;  1K83 A;  1XXA A;  2E2H C;  1O27 A;  2VUM C;  3FKI A;  5TMC A;  3TFJ A;  2GSO A;  1EK8 A;  2RGR A;  1EI6 A;  1I50 K;  1TWF K;  3AD8 C;  4WJ3 M;  3GTO C;  1O29 A;  4LOW A;  3I4M K;  2NVT C;  3G4A A;  2D6F C;  4P9S A;  4LR2 A;  3EQL A;  1WQH A;  5JFE A;  2R92 K;  3HOY C;  1WCM A;  3GTQ A;  4A3F K;  1O2B A;  1G51 A;  1YCL A;  3K7A C;  5C4J C;  1I50 C;  1TWF C;  3FOF A;  4P5B A;  1R9T C;  1O28 A;  4G0V A;  4BY7 C;  4OIR A;  3GTJ C;  4BXX C;  3HOX C;  3M3Y C;  5IYD C;  3S2H K;  4KC6 A;  4OIO A;  3GTG C;  3A8K A;  3LAJ A;  2EBB A;  2FQO A;  3S17 K;  1O2F B;  4C45 A;  3I4M C;  4LK0 A;  4A3D C;  4C2M K;  3HOV K;  5D4D A;  3M4O C;  2NVQ C;  2VUM A;  4GT9 A;  3N0B A;  1IQ0 A;  3PO3 K;  1TWC K;  3H0G K;  4ZH4 A;  2E2I K;  4QIW D;  3PO2 K;  5IYC C;  4XLN A;  3GTJ K;  4YFX A;  1J6W A;  4X6A K;  3FOE A;  1F7U A;  1J6X A;  2WB1 L;  4A3C K;  4GTD A;  2CFA B;  1TWG C;  4GTF A;  3MML B;  2CFA A;  3I4N C;  2YU9 K;  2KWA A;  3V4G A;  2R93 K;  4YG2 A;  3GEH A;  2WAQ D;  4A3B C;  2A68 A;  2FQT A;  3GEI A;  1Y1W C;  1J98 A;  2JA6 A;  3LAP A;  4C3J C;  2A6H A;  1WSV A;  4ILD A;  5L46 A;  3OPF A;  3I4N K;  4BY1 K;  1TWH K;  2PMZ D;  3S1N C;  5IOT A;  1F7V A;  3PO2 C;  5HL8 A;  4BLB A;  4M1X A;  5C44 C;  3BUE A;  4OIN A;  1F93 A;  3Q3Q A;  4A3J C;  1F9N A;  4XCH A;  4Y7N K;  2PPB A;  3ADA C;  3S17 C;  4A3M C;  2YU9 A;  2O5J A;  3G4C A;  1BDF A;  3BP8 C;  3M4O K;  5IYB K;  5E68 A;  1XXC A;  2NVY A;  1XZQ A;  3L4K A;  4KAW X;  1O2A A;  3TFH A;  1EFW A;  4KAS A;  1BGW A;  3SZZ A;  2B63 K;  3AQO A;  4FM9 A;  5TMF A;  1L0W A;  3A8J A;  4X6A C;  1Y1V K;  1SFO A;  2PHC B;  5IYD K;  4LK1 A;  3S2H C;  2NVX K;  3GDZ A;  4JK1 A;  1Y1W A;  1R9T K;  1O25 A;  1EH1 A;  1XXB A;  3QX3 A;  1PJ5 A;  1TWH A;  4YFN A;  5TJ3 A;  3S14 K;  2V6T A;  4A3D K;  4P5A A;  4GTL A;  2E2J K;  4QJV A;  2P8T A;  3S1R C;  2JA5 C;  3ERE D;  4MQ9 A;  2NVY K;  4G0W A;  3HOW K;  1I50 A;  1TWF A;  1WSR A;  4A93 C;  2Y0S D;  4C3I C;  1WOR A;  4A3I K;  4BBS K;  2Y3P A;  1SFO K;  3K7A K;  1ZVU A;  1WCM K;  4Q5S A;  3FKI K;  2NVY C;  1VRQ C;  1XZP B;  4BY7 K;  1DD5 A;  4C3H C;  2XCQ A;  4BBS C;  1TWC A;  4A3B K;  2PA8 D;  1IBA A;  4AH6 A;  1UV7 A;  2E2J C;  1TWG K;  5M3M K;  4LLG A;  1TWA K;  1SFO C;  4Y52 K;  2JA5 K;  2GSU A;  1JQW A;  1ZQ1 C;  4A93 K;  3RZO K;  1B4B A;  3GTL A;  1KQ4 A;  4C3I K;  4A3I C;  2NVQ K;  4XSZ A;  1TWH C;  3S0X A;  3AD9 C;  3S16 K;  4MEY A;  1J6V A;  1ZBS A;  4PAA A;  4KMD A;  5CHP A;  2O5I A;  3H3V L;  1XZQ B;  3GTK C;  1USO A;  4Y7N C;  2E2H K;  3GTO A;  2GSN A;  2VUM K;  4WJ4 A;  4A3K C;  1Y1V C;  4KAT A;  5EGH A;  3AD7 C;  2JA7 A;  5IOR A;  4A3L C;  4GTC A;  2P5M A;  3LPX A;  4XLP A;  5M5W K;  4G7H A;  1PJ7 A;  1PJ6 A;  1TWC C;  3T02 A;  1WCM C;  3GTJ A;  5JVO A;  1JVI A;  2WAQ L;  1DCP A;  1HI9 A;  4BBR K;  1IW7 A;  1R9T A;  2NVT K;  5C4X C;  4C2M C;  5IP7 K;  1IS1 A;  3HOU K;  4GZY A;  3HKZ D;  1VH2 A;  3S14 C;  3N0C A;  1IE0 A;  2CW0 A;  5CJ9 A;  3RZD K;  2WB1 D;  1Y1V A;  3T01 A;  3GTP C;  4A3J K;  3GTG A;  3S1R K;  3WOD A;  2V6S A;  4BXX K;  3T00 A;  1EQR A;  1K83 K;  1V5V A;  2JA6 K;  3M3Y K;  3A8I A;  5M3F K;  3FHZ A;  1WOP A;  4KDD A;  4G7O A;  3S2D K;  4A3L K;  3L4J A;  3GTP K;  4WIL A;  4BLA A;  3S1Q C;  3CQZ A;  3GTM C;  3S1N K;  2A69 A;  4KMU A;  3TFI A;  3S1M K;  3S15 C;  4BBR C;  3GTP A;  3DXJ A;  5IP7 C;  1YX2 A;  3HOU C;  4NOI A;  1VLO A;  2ZFZ A;  4C3J K;  4A3G C; 
#chains in the Genus database with same CATH homology
 2E2H A;  4GTD A;  2CFA B;  4GTF A;  1DD5 A;  4C3H C;  4G0U A;  3MML B;  2CFA A;  2XCQ A;  1WQG A;  1TWC A;  4DDQ A;  2RH6 A;  2KWA A;  3V4G A;  1B4A A;  5EGE A;  3GTM A;  2JA6 A;  3LAP A;  4C3J C;  1WIH A;  2GSU A;  4ILD A;  1O26 A;  3OPF A;  5IOS A;  1B4B A;  3N3Y A;  3GTL A;  1KQ4 A;  3AH5 A;  5IOT A;  2XCO A;  4BLB A;  2XCR B;  3S0X A;  4M1X A;  4J3N A;  1K83 A;  4KB2 A;  1XXA A;  4GTB A;  1O27 A;  3BUE A;  3FKI A;  1ZBS A;  3Q3Q A;  1F9N A;  2GSO A;  4KMD A;  5CHP A;  1AB4 A;  2R92 A;  4GFQ A;  2YU9 A;  1EK8 A;  3G4C A;  2JH3 A;  3H0G A;  4BKW A;  2RGR A;  4KM8 A;  3GTO A;  2GSN A;  1O24 A;  1XXC A;  2NVY A;  1I3Q A;  1WQF A;  5IOQ A;  1O29 A;  3L4K A;  4KM9 A;  4GTE A;  4KAW X;  2R7Z A;  1O2A A;  3G4A A;  4KAT A;  4LR2 A;  5EGH A;  4KAS A;  1GE9 A;  1BGW A;  1WQH A;  5JFE A;  3AQO A;  4FM9 A;  5IOR A;  2JA7 A;  1WCM A;  2P5M A;  3LPX A;  4GTC A;  1O2B A;  4KB4 A;  3GTQ A;  1SFO A;  1TWA A;  2PHC B;  3FOF A;  2R93 A;  1ISE A;  4P5B A;  3GTJ A;  5JVO A;  1O28 A;  4G0V A;  1R9T A;  3CAG A;  4KAR A;  4C2M C;  1Y1W A;  4KMA A;  1IS1 A;  1O25 A;  1EH1 A;  3GTK A;  1XXB A;  3QX3 A;  3N0C A;  2NVX A;  4KC6 A;  5CJ9 A;  1TWH A;  1Y1V A;  3AQP A;  5TJ3 A;  4P5A A;  4GTL A;  1TWG A;  3GTG A;  2E2I A;  1ZXO A;  3LAJ A;  3NUH A;  4GTA A;  2JA5 A;  1BJT A;  3FHZ A;  4FZB A;  4LQY A;  3ERE D;  2VUM A;  4KDD A;  3ORE A;  4GT9 A;  4KMH A;  4G0W A;  3N0B A;  3OEP A;  3L4J A;  1I50 A;  1TWF A;  4BLA A;  3VA7 A;  3CQZ A;  4C3I C;  2B63 A;  3GTP A;  2Y3P A;  3FOE A;  1ZVU A;  2ZFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...