1KQ4A

Crystal structure of a thy1-complementing protein (tm0449) from thermotoga maritima at 2.25 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
203
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN TM0449
publication title Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline
pubmed doi rcsb
source organism Thermotoga maritima
total genus 68
structure length 203
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1kq4A00
3N0CA 3G4CA 5IOSA 3N0BA 4GTEA 4KATA 4GTAA 4P5BA 1O25A 4GTBA 4GT9A 2CFAB 3AH5A 1O24A 1KQ4A 3N3YA 4GTFA 1O29A 2CFAA 1O26A 5IORA 1O28A 4GTCA 4KASA 1O2AA 4P5AA 5IOTA 4GTLA 1O2BA 3G4AA 5JFEA 4KARA 4GTDA 4FZBA 5CHPA 5IOQA 1O27A
chains in the Genus database with same CATH superfamily
1WSVA 4G7ZA 5CJ9A 3GTLC 1PJ5A 4A3DK 1F7UA 4C2MK 3S1NK 1XXCA 1Y1VK 4XSZA 3S1RC 1XZQA 4WJ3M 5C4XC 4C3HK 4YG2A 3GTJA 1TWGC 2E2IK 2WAQD 3GTOC 3IPJA 1B4AA 5FLMC 4BBRC 1RU0A 1JVIA 3S1MC 4GTLA 2NVXA 2P5MA 3GTLA 5IYCK 4C3JK 3S17K 4BKWA 2R7ZK 1UV7A 4G7OA 3FOFA 1TWGA 2PMZL 4OIQA 1XXBA 4LJZA 1O25A 1SMYA 3GTOA 3JSTA 3FKIK 3S14C 5JVOA 1GE9A 1USOA 1V5VA 2RGRA 3I4NK 3BP8C 4A3KC 5IOTA 1JQWA 2A6HA 3GTPK 2NVYK 3BP3A 4LK1A 4XLPA 1XXAA 3GTKK 3LAJA 1WOPA 1TWHK 5C44K 1HQMA 3GTGK 4GTAA 1I50K 4BBSK 4A3EC 3GEHA 5IP9K 2CFAB 2WB1L 2R7ZA 5M3FK 4GTCA 2XCQA 3H0GK 4MEYA 4A3GC 3TFJA 4GFQA 1B4BA 3GEIA 4A3FC 3TFHA 3HOWK 3FKIA 1IW7A 4A3JC 1R9TK 4A3BC 5IYBK 2GAGC 4NOIA 4J3NA 2JA7K 3CQZC 4KMAA 2E2JC 3S1QK 4LQYA 1EFWA 2E2HC 1WORA 4Y7NC 1VH2A 1I6HK 2NVYA 3CAGA 2ZFZA 4C45A 4C3IC 3M3YK 4WILA 1X31C 2BE5A 4X6AC 1BS2A 2JA6C 2JA8C 3HOWC 1TWCC 3RZOK 3AQPA 3HOUK 4XCHA 1I3QK 1ZYRA 5TMCA 3GTJK 3L4JA 4A3MC 2JA7C 3K7AC 3N0CA 3S16K 3HKZD 3S1QC 1JOEA 3RZDC 3I4MK 3WODA 2VUMK 3GTLK 2P8TA 3SZYA 1O24A 1WQGA 4BLAA 4LLGA 1L0WA 1R9TA 3S1RK 1WSRA 2JA7A 1EK8A 1O2AA 5HL8A 2YU9K 3HOUC 3LPXA 4Q5SA 1C0AA 4GTDA 2NVQK 1I3QC 3GTOK 5FLMK 4BBRK 3DXJA 4KN4A 1WQHA 1ZQ1C 3S2DK 4Y52C 2VUMC 2A69A 4P5BA 1XZQB 1K83C 4WJ4A 5FJ8K 1I3QA 4GTFA 4KB4A 2YU9C 1O28A 1IE0A 4OINA 3S14K 2NVQC 1EH1A 1EI6A 3G4AA 4A3KK 1XPPA 4A93C 2VUMA 3AD7C 5EGHA 2A6EA 3S0XA 1K83A 1G51A 3ADAC 3S2DC 3GSIA 2CW0A 4A3CC 4KN7A 4GTEA 4KATA 4KDDA 2YU9A 2V6UA 4QJVB 1USMA 5C3EC 4KM8A 5L46A 4QJVA 1IQ0A 1YNNA 4A3EK 3AD9C 2W7VA 2NVTK 1DCHA 3HOVC 5TJ3A 1IBAA 3GIRA 2O5IA 1IS1A 4A3GK 1J6WA 1AB4A 2B63C 3ERED 3M4OK 3OREA 1EQRA 3G4CA 4A3FK 3V4GA 4BY7C 4A3BK 4A3JK 1J6XA 1IL2A 4RMFA 4GTBA 2WAQL 3CQZK 1YCLA 2E2JK 1TWAK 2E2HK 1J98A 2NVTC 4Y7NK 5IORA 2B63A 1HI9A 5IYDK 3VA7A 4C3IK 4A3IC 1WOOA 3HOYC 3M4OC 4X6AK 2Y3PA 5D4DA 2JA6K 2JA8K 1VGXA 1TWCK 4QIWD 5IOSA 3N0BA 3AD8C 1XZPA 2PA8D 4A3MK 2KWAA 3K7AK 1ZVUA 1TWAC 3RZDK 2JA5K 4G0VA 1VRQC 4G7HA 2ZUEA 5IYDC 4KMUA 5TMFA 1WIHA 4O2DA 3SZZA 4DDQA 4MEXA 3CQZA 5CHPA 1TWAA 4KMDA 2E2HA 4M1XA 3OEPA 1BJTA 1WQFA 3BUEA 3A8JA 2JA5C 3HXAA 1DD5A 4Y52K 3AH5A 2JA6A 1K83K 3OPFA 1TWCA 1VLOA 1J6VA 4KB2A 4PAAA 4QIWL 1ISEA 1F7VA 1WCMC 4AYBD 1ZXOA 4KARA 4YFNA 2JA5A 2GSOA 1PJ7A 4A93K 3TFIA 3PO3K 3T02A 3H3VD 1Y1WC 4G0UA 4A3CK 4FM9A 4YFKA 2JH3A 1WCMA 4BY1C 2V6TA 1KQ4A 2V6SA 3GDZA 5C3EK 3S15K 1TWFK 2XCOA 3HKZL 1F93A 3HOVK 5IOQA 3GTMK 3PO3C 4BXXC 2NVXC 2B63K 3QX3A 3EQLA 4BY7K 4GT9A 3S2HC 4AYBL 4YFXA 3S15C 4OIPA 1TWFC 2R92K 1SFOK 5C4JC 1VJEA 3LAPA 2PPBA 4A3LC 3PO2C 3HOZC 2WB1D 5E68A 4FZBA 4OIOA 3GTMC 3H3VL 4KM9A 4KMHA 5M5WK 4A3IK 2ZUFA 3HOYK 2FQOA 4KC6A 4LR2A 3HOXK 4A3DC 1F9NA 2EBBA 4C2MC 3S1NC 2R93K 1Y1VC 4LOWA 1TWFA 3FOEA 4XSXA 4OIRA 4C3HC 1PJ6A 4BLBA 4GZYA 2R92C 2E2IC 3GTMA 1SFOC 1DCPA 2O5JA 3Q3QA 1BDFA 4Q4ZA 5IYCC 4LK0A 4C3JC 3S17C 1Y1VA 4KAWX 2A68A 2R7ZC 4P9SA 3HOXC 2RH6A 5EGEA 2R93C 1WOSA 2R92A 1XZPB 2E2IA 1SFOA 1DCOA 3FKIC 3GTQK 4PABA 3I4NC 2Y0SD 1O2FB 2GSNA 3A8KA 2GSUA 1O29A 2CFAA 3TTGA 1INNA 2R93A 3T01A 4P5AA 3GTPC 1O2BA 2NVYC 2XCRB 3MMLB 3GTKC 4JK1A 5M3MK 1WCMK 2GAHC 1O27A 1TWHC 5JFEA 5C44C 3GTGC 1I50C 4BBSC 1I6VA 3GTQC 5IP9C 1ZBSA 4G0WA 3GTPA 1Y1WK 2D6FC 2PHCB 1BGWA 3GTKA 3N3YA 3H0GC 4BY1K 1TWHA 3GTGA 1I50A 3GTQA 1R9TC 5IYBC 2PA8L 5IP7K 1YNJA 4ILDA 3L4KA 3FHZA 2Y0SL 2FQTA 5M5XK 3T00A 3H0GA 4BXXK 5M5YK 3AQOA 3NUHA 1YX2A 1I6HC 2NVXK 4MQ9A 3A8IA 3M3YC 4AH6A 5C4XK 3GEEA 4XLNA 2PMZD 1O26A 3S2HK 4KASA 1TWGK 3RZOC 4ZH4A 3GTJC 5C4JK 5IP7C 3S16C 3S1MK 4A3LK 1Y1WA 3PO2K 3HOZK 3I4MC
chains in the Genus database with same CATH topology
1F9NA 3N0CA 5IOSA 4C2MC 3N0BA 1TWFA 5CJ9A 3FOEA 2KWAA 4C3HC 1ZVUA 1XXCA 4BLBA 4G0VA 3GTJA 1O24A 1WQGA 4BLAA 3GTMA 1R9TA 1WIHA 3Q3QA 2JA7A 1B4AA 1EK8A 1O2AA 4C3JC 4GTLA 4DDQA 1Y1VA 3LPXA 4KAWX 2NVXA 4GTDA 2P5MA 3GTLA 3CQZA 5CHPA 2RH6A 5EGEA 1TWAA 4KMDA 4BKWA 2E2HA 2R92A 4M1XA 3OEPA 2E2IA 3FOFA 1SFOA 1BJTA 1WQFA 1TWGA 3BUEA 1WQHA 1XXBA 4P5BA 1DD5A 1O25A 3GTOA 2GSNA 3AH5A 2GSUA 2JA6A 1I3QA 3OPFA 4GTFA 1O29A 2CFAA 1TWCA 4KB4A 5JVOA 1GE9A 1O28A 2RGRA 2R93A 4KB2A 1ISEA 4P5AA 5IOTA 1EH1A 1O2BA 1ZXOA 3G4AA 4KARA 2XCRB 3MMLB 2JA5A 2VUMA 2GSOA 5EGHA 3S0XA 1K83A 1O27A 5JFEA 1XXAA 3LAJA 4GTEA 4KATA 4KDDA 2YU9A 4GTAA 4G0UA 1ZBSA 4G0WA 4FM9A 2JH3A 4KM8A 3GTPA 1WCMA 2PHCB 2CFAB 1BGWA 1KQ4A 3N3YA 3GTKA 2R7ZA 4GTCA 1TWHA 2XCQA 3GTGA 2XCOA 5TJ3A 1I50A 3GTQA 1IS1A 4GFQA 1B4BA 1AB4A 5IOQA 3ERED 3FKIA 3OREA 4ILDA 3L4KA 3G4CA 3FHZA 4J3NA 3QX3A 3V4GA 3H0GA 4KMAA 3AQOA 3NUHA 4LQYA 4GTBA 4GT9A 2NVYA 3CAGA 2ZFZA 4C3IC 2B63A 1O26A 5IORA 4KASA 3LAPA 3VA7A 4FZBA 4KM9A 3AQPA 4KMHA 1Y1WA 2Y3PA 3L4JA 4KC6A 4LR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0C A;  3G4C A;  5IOS A;  3N0B A;  4GTE A;  4KAT A;  4GTA A;  4P5B A;  1O25 A;  4GTB A;  4GT9 A;  2CFA B;  3AH5 A;  1O24 A;  1KQ4 A;  3N3Y A;  4GTF A;  1O29 A;  2CFA A;  1O26 A;  5IOR A;  1O28 A;  4GTC A;  4KAS A;  1O2A A;  4P5A A;  5IOT A;  4GTL A;  1O2B A;  3G4A A;  5JFE A;  4KAR A;  4GTD A;  4FZB A;  5CHP A;  5IOQ A;  1O27 A; 
#chains in the Genus database with same CATH topology
 1WSV A;  4G7Z A;  5CJ9 A;  3GTL C;  1PJ5 A;  4A3D K;  1F7U A;  4C2M K;  3S1N K;  1XXC A;  1Y1V K;  4XSZ A;  3S1R C;  1XZQ A;  4WJ3 M;  5C4X C;  4C3H K;  4YG2 A;  3GTJ A;  1TWG C;  2E2I K;  2WAQ D;  3GTO C;  3IPJ A;  1B4A A;  5FLM C;  4BBR C;  1RU0 A;  1JVI A;  3S1M C;  4GTL A;  2NVX A;  2P5M A;  3GTL A;  5IYC K;  4C3J K;  3S17 K;  4BKW A;  2R7Z K;  1UV7 A;  4G7O A;  3FOF A;  1TWG A;  2PMZ L;  4OIQ A;  1XXB A;  4LJZ A;  1O25 A;  1SMY A;  3GTO A;  3JST A;  3FKI K;  3S14 C;  5JVO A;  1GE9 A;  1USO A;  1V5V A;  2RGR A;  3I4N K;  3BP8 C;  4A3K C;  5IOT A;  1JQW A;  2A6H A;  3GTP K;  2NVY K;  3BP3 A;  4LK1 A;  4XLP A;  1XXA A;  3GTK K;  3LAJ A;  1WOP A;  1TWH K;  5C44 K;  1HQM A;  3GTG K;  4GTA A;  1I50 K;  4BBS K;  4A3E C;  3GEH A;  5IP9 K;  2CFA B;  2WB1 L;  2R7Z A;  5M3F K;  4GTC A;  2XCQ A;  3H0G K;  4MEY A;  4A3G C;  3TFJ A;  4GFQ A;  1B4B A;  3GEI A;  4A3F C;  3TFH A;  3HOW K;  3FKI A;  1IW7 A;  4A3J C;  1R9T K;  4A3B C;  5IYB K;  2GAG C;  4NOI A;  4J3N A;  2JA7 K;  3CQZ C;  4KMA A;  2E2J C;  3S1Q K;  4LQY A;  1EFW A;  2E2H C;  1WOR A;  4Y7N C;  1VH2 A;  1I6H K;  2NVY A;  3CAG A;  2ZFZ A;  4C45 A;  4C3I C;  3M3Y K;  4WIL A;  1X31 C;  2BE5 A;  4X6A C;  1BS2 A;  2JA6 C;  2JA8 C;  3HOW C;  1TWC C;  3RZO K;  3AQP A;  3HOU K;  4XCH A;  1I3Q K;  1ZYR A;  5TMC A;  3GTJ K;  3L4J A;  4A3M C;  2JA7 C;  3K7A C;  3N0C A;  3S16 K;  3HKZ D;  3S1Q C;  1JOE A;  3RZD C;  3I4M K;  3WOD A;  2VUM K;  3GTL K;  2P8T A;  3SZY A;  1O24 A;  1WQG A;  4BLA A;  4LLG A;  1L0W A;  1R9T A;  3S1R K;  1WSR A;  2JA7 A;  1EK8 A;  1O2A A;  5HL8 A;  2YU9 K;  3HOU C;  3LPX A;  4Q5S A;  1C0A A;  4GTD A;  2NVQ K;  1I3Q C;  3GTO K;  5FLM K;  4BBR K;  3DXJ A;  4KN4 A;  1WQH A;  1ZQ1 C;  3S2D K;  4Y52 C;  2VUM C;  2A69 A;  4P5B A;  1XZQ B;  1K83 C;  4WJ4 A;  5FJ8 K;  1I3Q A;  4GTF A;  4KB4 A;  2YU9 C;  1O28 A;  1IE0 A;  4OIN A;  3S14 K;  2NVQ C;  1EH1 A;  1EI6 A;  3G4A A;  4A3K K;  1XPP A;  4A93 C;  2VUM A;  3AD7 C;  5EGH A;  2A6E A;  3S0X A;  1K83 A;  1G51 A;  3ADA C;  3S2D C;  3GSI A;  2CW0 A;  4A3C C;  4KN7 A;  4GTE A;  4KAT A;  4KDD A;  2YU9 A;  2V6U A;  4QJV B;  1USM A;  5C3E C;  4KM8 A;  5L46 A;  4QJV A;  1IQ0 A;  1YNN A;  4A3E K;  3AD9 C;  2W7V A;  2NVT K;  1DCH A;  3HOV C;  5TJ3 A;  1IBA A;  3GIR A;  2O5I A;  1IS1 A;  4A3G K;  1J6W A;  1AB4 A;  2B63 C;  3ERE D;  3M4O K;  3ORE A;  1EQR A;  3G4C A;  4A3F K;  3V4G A;  4BY7 C;  4A3B K;  4A3J K;  1J6X A;  1IL2 A;  4RMF A;  4GTB A;  2WAQ L;  3CQZ K;  1YCL A;  2E2J K;  1TWA K;  2E2H K;  1J98 A;  2NVT C;  4Y7N K;  5IOR A;  2B63 A;  1HI9 A;  5IYD K;  3VA7 A;  4C3I K;  4A3I C;  1WOO A;  3HOY C;  3M4O C;  4X6A K;  2Y3P A;  5D4D A;  2JA6 K;  2JA8 K;  1VGX A;  1TWC K;  4QIW D;  5IOS A;  3N0B A;  3AD8 C;  1XZP A;  2PA8 D;  4A3M K;  2KWA A;  3K7A K;  1ZVU A;  1TWA C;  3RZD K;  2JA5 K;  4G0V A;  1VRQ C;  4G7H A;  2ZUE A;  5IYD C;  4KMU A;  5TMF A;  1WIH A;  4O2D A;  3SZZ A;  4DDQ A;  4MEX A;  3CQZ A;  5CHP A;  1TWA A;  4KMD A;  2E2H A;  4M1X A;  3OEP A;  1BJT A;  1WQF A;  3BUE A;  3A8J A;  2JA5 C;  3HXA A;  1DD5 A;  4Y52 K;  3AH5 A;  2JA6 A;  1K83 K;  3OPF A;  1TWC A;  1VLO A;  1J6V A;  4KB2 A;  4PAA A;  4QIW L;  1ISE A;  1F7V A;  1WCM C;  4AYB D;  1ZXO A;  4KAR A;  4YFN A;  2JA5 A;  2GSO A;  1PJ7 A;  4A93 K;  3TFI A;  3PO3 K;  3T02 A;  3H3V D;  1Y1W C;  4G0U A;  4A3C K;  4FM9 A;  4YFK A;  2JH3 A;  1WCM A;  4BY1 C;  2V6T A;  1KQ4 A;  2V6S A;  3GDZ A;  5C3E K;  3S15 K;  1TWF K;  2XCO A;  3HKZ L;  1F93 A;  3HOV K;  5IOQ A;  3GTM K;  3PO3 C;  4BXX C;  2NVX C;  2B63 K;  3QX3 A;  3EQL A;  4BY7 K;  4GT9 A;  3S2H C;  4AYB L;  4YFX A;  3S15 C;  4OIP A;  1TWF C;  2R92 K;  1SFO K;  5C4J C;  1VJE A;  3LAP A;  2PPB A;  4A3L C;  3PO2 C;  3HOZ C;  2WB1 D;  5E68 A;  4FZB A;  4OIO A;  3GTM C;  3H3V L;  4KM9 A;  4KMH A;  5M5W K;  4A3I K;  2ZUF A;  3HOY K;  2FQO A;  4KC6 A;  4LR2 A;  3HOX K;  4A3D C;  1F9N A;  2EBB A;  4C2M C;  3S1N C;  2R93 K;  1Y1V C;  4LOW A;  1TWF A;  3FOE A;  4XSX A;  4OIR A;  4C3H C;  1PJ6 A;  4BLB A;  4GZY A;  2R92 C;  2E2I C;  3GTM A;  1SFO C;  1DCP A;  2O5J A;  3Q3Q A;  1BDF A;  4Q4Z A;  5IYC C;  4LK0 A;  4C3J C;  3S17 C;  1Y1V A;  4KAW X;  2A68 A;  2R7Z C;  4P9S A;  3HOX C;  2RH6 A;  5EGE A;  2R93 C;  1WOS A;  2R92 A;  1XZP B;  2E2I A;  1SFO A;  1DCO A;  3FKI C;  3GTQ K;  4PAB A;  3I4N C;  2Y0S D;  1O2F B;  2GSN A;  3A8K A;  2GSU A;  1O29 A;  2CFA A;  3TTG A;  1INN A;  2R93 A;  3T01 A;  4P5A A;  3GTP C;  1O2B A;  2NVY C;  2XCR B;  3MML B;  3GTK C;  4JK1 A;  5M3M K;  1WCM K;  2GAH C;  1O27 A;  1TWH C;  5JFE A;  5C44 C;  3GTG C;  1I50 C;  4BBS C;  1I6V A;  3GTQ C;  5IP9 C;  1ZBS A;  4G0W A;  3GTP A;  1Y1W K;  2D6F C;  2PHC B;  1BGW A;  3GTK A;  3N3Y A;  3H0G C;  4BY1 K;  1TWH A;  3GTG A;  1I50 A;  3GTQ A;  1R9T C;  5IYB C;  2PA8 L;  5IP7 K;  1YNJ A;  4ILD A;  3L4K A;  3FHZ A;  2Y0S L;  2FQT A;  5M5X K;  3T00 A;  3H0G A;  4BXX K;  5M5Y K;  3AQO A;  3NUH A;  1YX2 A;  1I6H C;  2NVX K;  4MQ9 A;  3A8I A;  3M3Y C;  4AH6 A;  5C4X K;  3GEE A;  4XLN A;  2PMZ D;  1O26 A;  3S2H K;  4KAS A;  1TWG K;  3RZO C;  4ZH4 A;  3GTJ C;  5C4J K;  5IP7 C;  3S16 C;  3S1M K;  4A3L K;  1Y1W A;  3PO2 K;  3HOZ K;  3I4M C; 
#chains in the Genus database with same CATH homology
 1F9N A;  3N0C A;  5IOS A;  4C2M C;  3N0B A;  1TWF A;  5CJ9 A;  3FOE A;  2KWA A;  4C3H C;  1ZVU A;  1XXC A;  4BLB A;  4G0V A;  3GTJ A;  1O24 A;  1WQG A;  4BLA A;  3GTM A;  1R9T A;  1WIH A;  3Q3Q A;  2JA7 A;  1B4A A;  1EK8 A;  1O2A A;  4C3J C;  4GTL A;  4DDQ A;  1Y1V A;  3LPX A;  4KAW X;  2NVX A;  4GTD A;  2P5M A;  3GTL A;  3CQZ A;  5CHP A;  2RH6 A;  5EGE A;  1TWA A;  4KMD A;  4BKW A;  2E2H A;  2R92 A;  4M1X A;  3OEP A;  2E2I A;  3FOF A;  1SFO A;  1BJT A;  1WQF A;  1TWG A;  3BUE A;  1WQH A;  1XXB A;  4P5B A;  1DD5 A;  1O25 A;  3GTO A;  2GSN A;  3AH5 A;  2GSU A;  2JA6 A;  1I3Q A;  3OPF A;  4GTF A;  1O29 A;  2CFA A;  1TWC A;  4KB4 A;  5JVO A;  1GE9 A;  1O28 A;  2RGR A;  2R93 A;  4KB2 A;  1ISE A;  4P5A A;  5IOT A;  1EH1 A;  1O2B A;  1ZXO A;  3G4A A;  4KAR A;  2XCR B;  3MML B;  2JA5 A;  2VUM A;  2GSO A;  5EGH A;  3S0X A;  1K83 A;  1O27 A;  5JFE A;  1XXA A;  3LAJ A;  4GTE A;  4KAT A;  4KDD A;  2YU9 A;  4GTA A;  4G0U A;  1ZBS A;  4G0W A;  4FM9 A;  2JH3 A;  4KM8 A;  3GTP A;  1WCM A;  2PHC B;  2CFA B;  1BGW A;  1KQ4 A;  3N3Y A;  3GTK A;  2R7Z A;  4GTC A;  1TWH A;  2XCQ A;  3GTG A;  2XCO A;  5TJ3 A;  1I50 A;  3GTQ A;  1IS1 A;  4GFQ A;  1B4B A;  1AB4 A;  5IOQ A;  3ERE D;  3FKI A;  3ORE A;  4ILD A;  3L4K A;  3G4C A;  3FHZ A;  4J3N A;  3QX3 A;  3V4G A;  3H0G A;  4KMA A;  3AQO A;  3NUH A;  4LQY A;  4GTB A;  4GT9 A;  2NVY A;  3CAG A;  2ZFZ A;  4C3I C;  2B63 A;  1O26 A;  5IOR A;  4KAS A;  3LAP A;  3VA7 A;  4FZB A;  4KM9 A;  3AQP A;  4KMH A;  1Y1W A;  2Y3P A;  3L4J A;  4KC6 A;  4LR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...