1KQ4A

Crystal structure of a thy1-complementing protein (tm0449) from thermotoga maritima at 2.25 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
203
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN TM0449
publication title Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 68
structure length 203
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1kq4A00
1O24A 2CFAB 1O27A 5JFEA 1O2AA 1O2BA 3AH5A 2CFAA 5IORA 1O25A 3N0BA 3N0CA 4KARA 5CHPA 4GTCA 4KATA 1KQ4A 1O26A 4P5BA 3G4AA 4GTFA 4FZBA 4GTLA 4GTBA 5IOQA 4GT9A 4KASA 1O29A 3G4CA 4P5AA 4GTDA 5IOTA 4GTEA 4GTAA 3N3YA 1O28A 5IOSA
chains in the Genus database with same CATH superfamily
1J98A 2RGRA 1BGWA 4NOIA 1TWAC 3AD7C 4A3EC 1SMYA 4XSZA 3GTJA 1VJEA 5C44C 2ZFZA 3QX3A 2FQTA 4A3MK 1YNNA 4A93K 3GTGA 1USOA 1B4AA 3BP3A 2ZUFA 2A68A 4A3DK 4GTLA 3H0GA 3FOEA 1EK8A 1JOEA 4PAAA 4A3KK 3NUHA 1F7VA 2R92C 3HOYC 3HOVK 3FKIC 1WQHA 4QJVB 3I4MK 4DDQA 3OEPA 3AH5A 4C3JK 5C4JC 2NVQC 3N0CA 4C2MK 1TWHC 3GTKK 4LOWA 3HOZK 1I3QC 4P5BA 4KMHA 2O5JA 4YG2A 1VRQC 5M3FK 4KMUA 4J3NA 3GTJK 2XCRB 3GTGK 1ZVUA 3OPFA 4KM9A 4A3GC 4OINA 1EFWA 1K83K 3DXJA 2EBBA 3PO3K 4XLPA 3S1RC 3N0BA 3AD9C 1ZQ1C 4KB2A 1JVIA 1TWFC 4C3HC 3M4OK 2JA6A 2B63C 3CQZA 4MQ9A 4GTBA 3WODA 5IP7C 5IP7K 4GTEA 4RMFA 4Y52C 2NVXK 3S17K 3T02A 2JA7A 5IP9C 3S1MK 3HKZL 1O27A 1I6HK 4BBRC 1XXAA 1O2BA 1O2AA 3GTQC 3AQOA 1WCMA 3S16K 1WSVA 1WOSA 3T01A 2JA5C 4BXXK 1L0WA 1V5VA 2E2IK 1Y1WC 2Y0SL 1O29A 2E2HC 1VGXA 3OREA 5M3MK 5IOTA 1TWAA 3I4NC 4X6AK 4GTAA 4A3FK 2JA6K 3CQZK 3S14K 1HI9A 4AYBD 2CFAA 3HOXC 5IYBC 3H3VL 3LPXA 3HOXK 3M3YK 3GTPC 4A3LC 3GTOC 5IYDK 5IOQA 4GT9A 3G4CA 5EGHA 5EGEA 4A3CK 3GTMC 4A3BK 2JA8C 2JA8K 1INNA 1TWHA 1I50K 1GE9A 1I3QA 2VUMC 3HXAA 2GSUA 5IORA 2XCOA 2GAGC 4G7HA 1TWAK 4A3EK 4FM9A 5C44K 2D6FC 5D4DA 3BUEA 1K83A 3S2DC 2YU9C 2W7VA 4LR2A 3N3YA 5IOSA 1YX2A 3PO2C 2R92K 2R93C 4JK1A 1F93A 5TMCA 3HOYK 2PMZD 1Y1VC 1XZPB 3FKIK 1TWFA 3GSIA 3S15C 1IBAA 4OIOA 1WSRA 2R93K 3GEHA 4LLGA 5C4XC 2B63A 4KAWX 4G0WA 1EQRA 5L46A 1KQ4A 4WJ3M 5C4JK 2NVQK 1USMA 4WILA 3G4AA 2NVXA 1TWHK 3L4KA 4FZBA 1I3QK 1XXBA 3GEEA 4YFNA 2R7ZC 1IQ0A 1WIHA 1ZBSA 4KMDA 3AQPA 5IYCC 4C45A 1PJ7A 3ADAC 3GTQA 1VLOA 3TFJA 3FHZA 2A6EA 4A3GK 4AYBL 2WB1D 1DD5A 4Q5SA 3V4GA 5CHPA 4M1XA 1PJ5A 2E2IA 1DCHA 3S1RK 2JA5A 3S1NC 2E2HA 1ISEA 2E2JC 1TWFK 4C3HK 5C3EC 4A3JC 4LK0A 1J6VA 2GSOA 2B63K 2PA8D 3A8JA 3H0GC 3JSTA 4BBSC 1XPPA 5M5XK 1DCOA 4Y52K 2CFAB 4Y7NC 3RZOC 2RH6A 3SZYA 2O5IA 5IP9K 5M5YK 1ZXOA 4GZYA 4BBRK 3RZDC 3GTPA 1C0AA 3GTOA 2NVYC 1PJ6A 3GTQK 1R9TC 3RZDK 1XZQA 1YCLA 3AD8C 2NVYK 4BLBA 3VA7A 1F7UA 3GTMA 1IS1A 5JVOA 5HL8A 4MEXA 1YNJA 1I50A 2JA5K 2WAQD 1Y1WK 2NVTC 2VUMA 1DCPA 2E2HK 3HOWC 4XCHA 2NVTK 3I4NK 1XXCA 3HOWK 2PMZL 5JFEA 4XLNA 1UV7A 1O25A 2FQOA 1TWGC 5E68A 2ZUEA 1TWGK 2PHCB 5IYBK 4A3IC 2R92A 3CAGA 3FKIA 3GTPK 4A3LK 3K7AC 3GTOK 2R93A 3TTGA 4OIRA 1Y1VA 3K7AK 1ZYRA 3LAPA 1O28A 4BY7C 3GTMK 1O24A 4BY7K 4KDDA 2JA7C 1IE0A 2WB1L 3HOUC 2Y3PA 4C3IC 1WQFA 4KM8A 4GFQA 4WJ4A 2VUMK 4MEYA 3ERED 5FLMC 3S1QC 1WCMC 3GEIA 5FLMK 3GTLC 3EQLA 1EH1A 3MMLB 4KC6A 1TWCC 1J6WA 4BY1C 1SFOC 4OIQA 2A69A 4KN7A 2P5MA 3HKZD 2YU9K 3S2DK 2KWAA 4A3MC 1WORA 4A93C 3PO2K 1Y1VK 4QIWD 3S15K 4GTCA 4KN4A 4A3DC 1WQGA 2V6TA 1HQMA 5C4XK 4OIPA 3T00A 4A3KC 1JQWA 3GIRA 2Y0SD 3GDZA 4LK1A 5M5WK 4KASA 3HOVC 2R7ZK 2WAQL 3I4MC 1VH2A 3A8KA 4C3JC 3S2HC 5IYCK 4LJZA 3IPJA 4C2MC 4XSXA 2NVYA 1R9TA 1BDFA 3S2HK 3GTKC 2A6HA 3HOZC 1XZQB 4KB4A 3H3VD 5TMFA 3TFHA 4KATA 1B4BA 3GTJC 4ILDA 3SZZA 1Y1WA 3S1NK 3GTGC 3TFIA 2GSNA 4P9SA 2E2JK 5C3EK 2CW0A 4G0UA 1J6XA 2V6UA 2P8TA 4P5AA 4A3JK 1K83C 4AH6A 3PO3C 1WOOA 1G51A 3H0GK 1I6VA 1TWGA 4QJVA 4BBSK 1XZPA 2PPBA 4Y7NK 3LAJA 3RZOK 4YFXA 3M4OC 1O2FB 2BE5A 1O26A 4BLAA 4BKWA 3L4JA 1R9TK 1X31C 3A8IA 5CJ9A 4PABA 2NVXC 3S17C 2XCQA 3S1MC 3Q3QA 4YFKA 1I6HC 4KARA 2JH3A 1RU0A 5TJ3A 3S16C 4QIWL 3GTLA 1TWCA 4BXXC 4ZH4A 1BJTA 2E2IC 2V6SA 4GTFA 1SFOA 4G0VA 2YU9A 1BS2A 4Q4ZA 4G7OA 3S0XA 4LQYA 4X6AC 4A3IK 4A3FC 2JA6C 3CQZC 4GTDA 4KMAA 1WOPA 3S14C 1AB4A 1EI6A 1IL2A 4O2DA 1IW7A 3M3YC 2JA7K 3HOUK 4C3IK 5IYDC 2R7ZA 3FOFA 2GAHC 4G7ZA 3S1QK 4A3CC 4A3BC 1F9NA 1WCMK 5FJ8K 3GTLK 2PA8L 1TWCK 4BY1K 3GTKA 1I50C 3BP8C 1SFOK
chains in the Genus database with same CATH topology
2RGRA 1BGWA 4C3JC 2CFAB 4C2MC 2RH6A 2NVYA 1R9TA 3GTJA 2CFAA 2ZFZA 3QX3A 1ZXOA 4KB4A 3GTPA 3GTGA 4KATA 1B4BA 3GTOA 3LPXA 1B4AA 4ILDA 4BLBA 3VA7A 1Y1WA 4GTLA 3GTMA 3H0GA 1IS1A 2GSNA 5IOQA 3FOEA 1EK8A 5JVOA 4GT9A 1I50A 3G4CA 4G0UA 3NUHA 5EGHA 4P5AA 5EGEA 2VUMA 1WQHA 1XXCA 1TWGA 1TWHA 5JFEA 4DDQA 1I3QA 1GE9A 3OEPA 2GSUA 3AH5A 5IORA 2XCOA 1O25A 3LAJA 3N0CA 4FM9A 1O26A 4BLAA 4P5BA 4KMHA 2PHCB 4BKWA 3L4JA 3BUEA 4J3NA 2R92A 5CJ9A 1K83A 3CAGA 2XCQA 3FKIA 2XCRB 2R93A 3Q3QA 1ZVUA 3OPFA 1Y1VA 4KM9A 4LR2A 3LAPA 3N3YA 1O28A 4KARA 5IOSA 1O24A 1TWFA 4KDDA 2JH3A 5TJ3A 2Y3PA 4C3IC 3N0BA 1WQFA 2B63A 4KAWX 4KB2A 4KM8A 4G0WA 4GFQA 3GTLA 4C3HC 1KQ4A 3ERED 1TWCA 2JA6A 3G4AA 2NVXA 1BJTA 3L4KA 3CQZA 4GTFA 1SFOA 4G0VA 4FZBA 2YU9A 4GTBA 1XXBA 1EH1A 3MMLB 4KC6A 3S0XA 4LQYA 1WIHA 1ZBSA 4GTDA 4KMDA 4GTEA 4KMAA 3AQPA 2P5MA 3GTQA 2KWAA 1AB4A 2JA7A 3FHZA 1O27A 1XXAA 1O2BA 1O2AA 1DD5A 5CHPA 3V4GA 3AQOA 4M1XA 1WCMA 4GTCA 2E2IA 2JA5A 1WQGA 2R7ZA 3FOFA 2E2HA 1ISEA 1F9NA 2GSOA 4KASA 1O29A 3OREA 5IOTA 1TWAA 4GTAA 3GTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O24 A;  2CFA B;  1O27 A;  5JFE A;  1O2A A;  1O2B A;  3AH5 A;  2CFA A;  5IOR A;  1O25 A;  3N0B A;  3N0C A;  4KAR A;  5CHP A;  4GTC A;  4KAT A;  1KQ4 A;  1O26 A;  4P5B A;  3G4A A;  4GTF A;  4FZB A;  4GTL A;  4GTB A;  5IOQ A;  4GT9 A;  4KAS A;  1O29 A;  3G4C A;  4P5A A;  4GTD A;  5IOT A;  4GTE A;  4GTA A;  3N3Y A;  1O28 A;  5IOS A; 
#chains in the Genus database with same CATH topology
 1J98 A;  2RGR A;  1BGW A;  4NOI A;  1TWA C;  3AD7 C;  4A3E C;  1SMY A;  4XSZ A;  3GTJ A;  1VJE A;  5C44 C;  2ZFZ A;  3QX3 A;  2FQT A;  4A3M K;  1YNN A;  4A93 K;  3GTG A;  1USO A;  1B4A A;  3BP3 A;  2ZUF A;  2A68 A;  4A3D K;  4GTL A;  3H0G A;  3FOE A;  1EK8 A;  1JOE A;  4PAA A;  4A3K K;  3NUH A;  1F7V A;  2R92 C;  3HOY C;  3HOV K;  3FKI C;  1WQH A;  4QJV B;  3I4M K;  4DDQ A;  3OEP A;  3AH5 A;  4C3J K;  5C4J C;  2NVQ C;  3N0C A;  4C2M K;  1TWH C;  3GTK K;  4LOW A;  3HOZ K;  1I3Q C;  4P5B A;  4KMH A;  2O5J A;  4YG2 A;  1VRQ C;  5M3F K;  4KMU A;  4J3N A;  3GTJ K;  2XCR B;  3GTG K;  1ZVU A;  3OPF A;  4KM9 A;  4A3G C;  4OIN A;  1EFW A;  1K83 K;  3DXJ A;  2EBB A;  3PO3 K;  4XLP A;  3S1R C;  3N0B A;  3AD9 C;  1ZQ1 C;  4KB2 A;  1JVI A;  1TWF C;  4C3H C;  3M4O K;  2JA6 A;  2B63 C;  3CQZ A;  4MQ9 A;  4GTB A;  3WOD A;  5IP7 C;  5IP7 K;  4GTE A;  4RMF A;  4Y52 C;  2NVX K;  3S17 K;  3T02 A;  2JA7 A;  5IP9 C;  3S1M K;  3HKZ L;  1O27 A;  1I6H K;  4BBR C;  1XXA A;  1O2B A;  1O2A A;  3GTQ C;  3AQO A;  1WCM A;  3S16 K;  1WSV A;  1WOS A;  3T01 A;  2JA5 C;  4BXX K;  1L0W A;  1V5V A;  2E2I K;  1Y1W C;  2Y0S L;  1O29 A;  2E2H C;  1VGX A;  3ORE A;  5M3M K;  5IOT A;  1TWA A;  3I4N C;  4X6A K;  4GTA A;  4A3F K;  2JA6 K;  3CQZ K;  3S14 K;  1HI9 A;  4AYB D;  2CFA A;  3HOX C;  5IYB C;  3H3V L;  3LPX A;  3HOX K;  3M3Y K;  3GTP C;  4A3L C;  3GTO C;  5IYD K;  5IOQ A;  4GT9 A;  3G4C A;  5EGH A;  5EGE A;  4A3C K;  3GTM C;  4A3B K;  2JA8 C;  2JA8 K;  1INN A;  1TWH A;  1I50 K;  1GE9 A;  1I3Q A;  2VUM C;  3HXA A;  2GSU A;  5IOR A;  2XCO A;  2GAG C;  4G7H A;  1TWA K;  4A3E K;  4FM9 A;  5C44 K;  2D6F C;  5D4D A;  3BUE A;  1K83 A;  3S2D C;  2YU9 C;  2W7V A;  4LR2 A;  3N3Y A;  5IOS A;  1YX2 A;  3PO2 C;  2R92 K;  2R93 C;  4JK1 A;  1F93 A;  5TMC A;  3HOY K;  2PMZ D;  1Y1V C;  1XZP B;  3FKI K;  1TWF A;  3GSI A;  3S15 C;  1IBA A;  4OIO A;  1WSR A;  2R93 K;  3GEH A;  4LLG A;  5C4X C;  2B63 A;  4KAW X;  4G0W A;  1EQR A;  5L46 A;  1KQ4 A;  4WJ3 M;  5C4J K;  2NVQ K;  1USM A;  4WIL A;  3G4A A;  2NVX A;  1TWH K;  3L4K A;  4FZB A;  1I3Q K;  1XXB A;  3GEE A;  4YFN A;  2R7Z C;  1IQ0 A;  1WIH A;  1ZBS A;  4KMD A;  3AQP A;  5IYC C;  4C45 A;  1PJ7 A;  3ADA C;  3GTQ A;  1VLO A;  3TFJ A;  3FHZ A;  2A6E A;  4A3G K;  4AYB L;  2WB1 D;  1DD5 A;  4Q5S A;  3V4G A;  5CHP A;  4M1X A;  1PJ5 A;  2E2I A;  1DCH A;  3S1R K;  2JA5 A;  3S1N C;  2E2H A;  1ISE A;  2E2J C;  1TWF K;  4C3H K;  5C3E C;  4A3J C;  4LK0 A;  1J6V A;  2GSO A;  2B63 K;  2PA8 D;  3A8J A;  3H0G C;  3JST A;  4BBS C;  1XPP A;  5M5X K;  1DCO A;  4Y52 K;  2CFA B;  4Y7N C;  3RZO C;  2RH6 A;  3SZY A;  2O5I A;  5IP9 K;  5M5Y K;  1ZXO A;  4GZY A;  4BBR K;  3RZD C;  3GTP A;  1C0A A;  3GTO A;  2NVY C;  1PJ6 A;  3GTQ K;  1R9T C;  3RZD K;  1XZQ A;  1YCL A;  3AD8 C;  2NVY K;  4BLB A;  3VA7 A;  1F7U A;  3GTM A;  1IS1 A;  5JVO A;  5HL8 A;  4MEX A;  1YNJ A;  1I50 A;  2JA5 K;  2WAQ D;  1Y1W K;  2NVT C;  2VUM A;  1DCP A;  2E2H K;  3HOW C;  4XCH A;  2NVT K;  3I4N K;  1XXC A;  3HOW K;  2PMZ L;  5JFE A;  4XLN A;  1UV7 A;  1O25 A;  2FQO A;  1TWG C;  5E68 A;  2ZUE A;  1TWG K;  2PHC B;  5IYB K;  4A3I C;  2R92 A;  3CAG A;  3FKI A;  3GTP K;  4A3L K;  3K7A C;  3GTO K;  2R93 A;  3TTG A;  4OIR A;  1Y1V A;  3K7A K;  1ZYR A;  3LAP A;  1O28 A;  4BY7 C;  3GTM K;  1O24 A;  4BY7 K;  4KDD A;  2JA7 C;  1IE0 A;  2WB1 L;  3HOU C;  2Y3P A;  4C3I C;  1WQF A;  4KM8 A;  4GFQ A;  4WJ4 A;  2VUM K;  4MEY A;  3ERE D;  5FLM C;  3S1Q C;  1WCM C;  3GEI A;  5FLM K;  3GTL C;  3EQL A;  1EH1 A;  3MML B;  4KC6 A;  1TWC C;  1J6W A;  4BY1 C;  1SFO C;  4OIQ A;  2A69 A;  4KN7 A;  2P5M A;  3HKZ D;  2YU9 K;  3S2D K;  2KWA A;  4A3M C;  1WOR A;  4A93 C;  3PO2 K;  1Y1V K;  4QIW D;  3S15 K;  4GTC A;  4KN4 A;  4A3D C;  1WQG A;  2V6T A;  1HQM A;  5C4X K;  4OIP A;  3T00 A;  4A3K C;  1JQW A;  3GIR A;  2Y0S D;  3GDZ A;  4LK1 A;  5M5W K;  4KAS A;  3HOV C;  2R7Z K;  2WAQ L;  3I4M C;  1VH2 A;  3A8K A;  4C3J C;  3S2H C;  5IYC K;  4LJZ A;  3IPJ A;  4C2M C;  4XSX A;  2NVY A;  1R9T A;  1BDF A;  3S2H K;  3GTK C;  2A6H A;  3HOZ C;  1XZQ B;  4KB4 A;  3H3V D;  5TMF A;  3TFH A;  4KAT A;  1B4B A;  3GTJ C;  4ILD A;  3SZZ A;  1Y1W A;  3S1N K;  3GTG C;  3TFI A;  2GSN A;  4P9S A;  2E2J K;  5C3E K;  2CW0 A;  4G0U A;  1J6X A;  2V6U A;  2P8T A;  4P5A A;  4A3J K;  1K83 C;  4AH6 A;  3PO3 C;  1WOO A;  1G51 A;  3H0G K;  1I6V A;  1TWG A;  4QJV A;  4BBS K;  1XZP A;  2PPB A;  4Y7N K;  3LAJ A;  3RZO K;  4YFX A;  3M4O C;  1O2F B;  2BE5 A;  1O26 A;  4BLA A;  4BKW A;  3L4J A;  1R9T K;  1X31 C;  3A8I A;  5CJ9 A;  4PAB A;  2NVX C;  3S17 C;  2XCQ A;  3S1M C;  3Q3Q A;  4YFK A;  1I6H C;  4KAR A;  2JH3 A;  1RU0 A;  5TJ3 A;  3S16 C;  4QIW L;  3GTL A;  1TWC A;  4BXX C;  4ZH4 A;  1BJT A;  2E2I C;  2V6S A;  4GTF A;  1SFO A;  4G0V A;  2YU9 A;  1BS2 A;  4Q4Z A;  4G7O A;  3S0X A;  4LQY A;  4X6A C;  4A3I K;  4A3F C;  2JA6 C;  3CQZ C;  4GTD A;  4KMA A;  1WOP A;  3S14 C;  1AB4 A;  1EI6 A;  1IL2 A;  4O2D A;  1IW7 A;  3M3Y C;  2JA7 K;  3HOU K;  4C3I K;  5IYD C;  2R7Z A;  3FOF A;  2GAH C;  4G7Z A;  3S1Q K;  4A3C C;  4A3B C;  1F9N A;  1WCM K;  5FJ8 K;  3GTL K;  2PA8 L;  1TWC K;  4BY1 K;  3GTK A;  1I50 C;  3BP8 C;  1SFO K; 
#chains in the Genus database with same CATH homology
 2RGR A;  1BGW A;  4C3J C;  2CFA B;  4C2M C;  2RH6 A;  2NVY A;  1R9T A;  3GTJ A;  2CFA A;  2ZFZ A;  3QX3 A;  1ZXO A;  4KB4 A;  3GTP A;  3GTG A;  4KAT A;  1B4B A;  3GTO A;  3LPX A;  1B4A A;  4ILD A;  4BLB A;  3VA7 A;  1Y1W A;  4GTL A;  3GTM A;  3H0G A;  1IS1 A;  2GSN A;  5IOQ A;  3FOE A;  1EK8 A;  5JVO A;  4GT9 A;  1I50 A;  3G4C A;  4G0U A;  3NUH A;  5EGH A;  4P5A A;  5EGE A;  2VUM A;  1WQH A;  1XXC A;  1TWG A;  1TWH A;  5JFE A;  4DDQ A;  1I3Q A;  1GE9 A;  3OEP A;  2GSU A;  3AH5 A;  5IOR A;  2XCO A;  1O25 A;  3LAJ A;  3N0C A;  4FM9 A;  1O26 A;  4BLA A;  4P5B A;  4KMH A;  2PHC B;  4BKW A;  3L4J A;  3BUE A;  4J3N A;  2R92 A;  5CJ9 A;  1K83 A;  3CAG A;  2XCQ A;  3FKI A;  2XCR B;  2R93 A;  3Q3Q A;  1ZVU A;  3OPF A;  1Y1V A;  4KM9 A;  4LR2 A;  3LAP A;  3N3Y A;  1O28 A;  4KAR A;  5IOS A;  1O24 A;  1TWF A;  4KDD A;  2JH3 A;  5TJ3 A;  2Y3P A;  4C3I C;  3N0B A;  1WQF A;  2B63 A;  4KAW X;  4KB2 A;  4KM8 A;  4G0W A;  4GFQ A;  3GTL A;  4C3H C;  1KQ4 A;  3ERE D;  1TWC A;  2JA6 A;  3G4A A;  2NVX A;  1BJT A;  3L4K A;  3CQZ A;  4GTF A;  1SFO A;  4G0V A;  4FZB A;  2YU9 A;  4GTB A;  1XXB A;  1EH1 A;  3MML B;  4KC6 A;  3S0X A;  4LQY A;  1WIH A;  1ZBS A;  4GTD A;  4KMD A;  4GTE A;  4KMA A;  3AQP A;  2P5M A;  3GTQ A;  2KWA A;  1AB4 A;  2JA7 A;  3FHZ A;  1O27 A;  1XXA A;  1O2B A;  1O2A A;  1DD5 A;  5CHP A;  3V4G A;  3AQO A;  4M1X A;  1WCM A;  4GTC A;  2E2I A;  2JA5 A;  1WQG A;  2R7Z A;  3FOF A;  2E2H A;  1ISE A;  1F9N A;  2GSO A;  4KAS A;  1O29 A;  3ORE A;  5IOT A;  1TWA A;  4GTA A;  3GTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...