1KQ4A

Crystal structure of a thy1-complementing protein (tm0449) from thermotoga maritima at 2.25 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
203
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords HYPOTHETICAL PROTEIN TM0449
total genus 68
structure length 203
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1kq4A00
5IOQA 1O2AA 3G4AA 1O24A 3N3YA 4KARA 1O28A 4KASA 4KATA 3AH5A 4GTDA 5IORA 4GTBA 4GTCA 3G4CA 1O27A 3N0CA 1O29A 3N0BA 1O25A 4GTAA 5IOTA 5IOSA 1KQ4A 2CFAB 1O26A 4FZBA 5JFEA 4GTFA 4GT9A 5CHPA 1O2BA 2CFAA 4GTEA 4GTLA 4P5AA 4P5BA
chains in the Genus database with same CATH superfamily
3HOUC 3GTKC 1O2AA 2O5JA 3G4AA 3HOVC 4GZYA 3GTKK 2JA7A 3AH5A 1WIHA 3FHZA 4A3DC 4BLBA 1WQGA 2WAQD 4A3FC 4BBSK 5CJ9A 2E2HC 4BBRK 1BGWA 5EGEA 4G7HA 3HXAA 3A8JA 4GT9A 4QJVA 3S1MC 1WOSA 2E2HA 4M1XA 1EFWA 4YFXA 1Y1VC 2V6UA 2B63A 4PABA 3S15K 3Q3QA 1I50A 3I4NC 2NVQC 3I4MC 4Y52K 3BP8C 4KM9A 3ERED 2Y0SL 1O27A 3S2HC 1XPPA 2GAGC 3TFHA 1KQ4A 4G7OA 3GTQK 4FZBA 5C3EK 3GTQC 1K83K 5HL8A 5CHPA 2VUMC 4A3DK 3V4GA 4QIWL 4GTLA 4P5AA 5TJ3A 1XZQA 2NVYK 1TWCK 5D4DA 4G0VA 1I50C 2JA5K 1TWHK 1Y1WC 4KARA 3GIRA 4GTBA 4KMHA 1C0AA 2WB1L 1IE0A 2P5MA 2XCOA 3HOZC 2WAQL 4G0WA 3FKIC 2R93C 3S17K 3GTGA 2JA8K 4LLGA 3HOZK 4ILDA 3GTLC 3S17C 3GTPK 1JQWA 3GTGC 4P5BA 3GTPC 2W7VA 3HKZD 4C45A 5C3EC 4LJZA 4C3IK 1K83C 3PO2K 1YNJA 1VGXA 4GTCA 1JVIA 1TWCC 3HOUK 1YCLA 2PMZD 5L46A 3GTMC 1L0WA 3LAJA 5M5WK 3S2DC 5M3FK 3HOYC 3OEPA 2V6SA 3T00A 1TWCA 3BP3A 2A6EA 1F93A 4A3IC 3HOWC 4Q4ZA 1TWAK 3I4NK 1IL2A 1O2BA 3GTKA 5IYCC 4BLAA 3JSTA 2R93K 4KMDA 5IOQA 1O2FB 1VJEA 1K83A 3GTLK 1O24A 3QX3A 3M4OK 1WOPA 3BUEA 4KASA 2P8TA 5IP9K 3A8KA 4A3JK 4A3MC 2B63K 1WOOA 1O29A 3T02A 2A6HA 5IOTA 1EQRA 2Y3PA 4OIRA 1XXCA 3H3VL 5C4XK 3LPXA 1VH2A 2A68A 4KM8A 4G0UA 3HKZL 2NVQK 4LQYA 3I4MK 5M3MK 1WQHA 2E2JC 4KAWX 1USOA 1G51A 5IORA 1IS1A 3FKIA 2XCQA 4Y7NC 3CQZK 2ZUEA 3RZDC 5IYDK 3TTGA 5C44K 4FM9A 1O25A 4A93K 4A3LC 1IBAA 3S16C 1INNA 4O2DA 1XZPA 4A3LK 4A3JC 5E68A 2JA5A 4WJ4A 2NVXC 1EH1A 4XLNA 1ZBSA 4C3HC 4AYBL 4LR2A 1DCPA 2A69A 3IPJA 4KN7A 2E2JK 4GTAA 3EQLA 4G7ZA 2D6FC 5JFEA 3PO2C 1Y1VA 5FLMC 5TMFA 1IW7A 2YU9C 3GTOK 4A3GK 2JA6A 1Y1VK 1RU0A 2PMZL 5FLMK 1R9TK 1BJTA 2R92C 3L4KA 4A3MK 2JA7K 2R92A 4KATA 4MEXA 4YG2A 2NVXK 4BKWA 2E2IK 4Y52C 4A3CC 4C3JK 4LOWA 2R7ZC 4A3BC 4XSXA 4XSZA 3H3VD 4Q5SA 2VUMA 1F7UA 5JVOA 4QIWD 1WSRA 3WODA 1GE9A 4A3EK 2PA8L 2CFAA 4ZH4A 2JA5C 1I3QA 1WCMC 3GSIA 2NVYC 4OIQA 5C44C 4KMUA 1EK8A 4GTDA 1IQ0A 2FQOA 2FQTA 2B63C 1HQMA 3S1QC 3S15C 3FOFA 3TFIA 2NVXA 1B4AA 3OPFA 1JOEA 3FKIK 3S1NC 2E2IC 2EBBA 2KWAA 2JA6K 3GTOA 1WSVA 2R7ZK 4X6AC 4AYBD 5TMCA 1R9TA 3GTJA 2YU9A 4C2MK 2JA6C 4A93C 4BXXK 2JH3A 3S16K 1UV7A 4QJVB 3T01A 3AQPA 3S14C 3GTMK 3S2DK 1YNNA 1F7VA 5IOSA 2Y0SD 1VRQC 4OIPA 3AD7C 5IYCK 2NVTC 1B4BA 4GTEA 4A3IK 3HOWK 1PJ7A 4KN4A 3GTLA 3ADAC 2JA8C 5IP9C 3CQZA 5IP7C 1WCMA 1TWGC 2O5IA 1J6VA 3A8IA 1F9NA 5M5YK 3MMLB 4A3EC 3RZOK 3HOXC 1VLOA 3RZOC 1XXBA 3FOEA 2RH6A 1SFOA 3HOXK 3S1RC 4A3CK 1AB4A 3M3YK 1EI6A 3S1MK 4KB2A 3HOYK 1BS2A 1PJ5A 2JA7C 5IYBK 3GTJC 3LAPA 4J3NA 5C4JC 2PA8D 1V5VA 4BY1K 3GEHA 1ZQ1C 3VA7A 1WCMK 5M5XK 3GTGK 4XLPA 3N0CA 1X31C 4DDQA 2CW0A 1TWFA 4XCHA 1ZXOA 2NVYA 4KC6A 4P9SA 1TWAA 3K7AC 3AD8C 1TWFK 4KB4A 4LK0A 3NUHA 2PPBA 4KDDA 3GTMA 4JK1A 2GSUA 4X6AK 1TWHC 1Y1WK 1DCHA 1WQFA 4C2MC 2RGRA 4BXXC 3OREA 3S1NK 2CFAB 2YU9K 3GTOC 4A3GC 2E2HK 1TWGK 1XZQB 1R9TC 4Y7NK 1I6VA 3GEEA 4A3KK 2GAHC 1I6HK 4C3IC 4A3KC 1Y1WA 3S14K 2PHCB 4A3FK 3GTPA 3L4JA 2NVTK 1TWHA 1SFOK 3AD9C 1J98A 4RMFA 3S1RK 4BY7C 2R93A 5C4XC 4KMAA 2GSOA 3K7AK 2V6TA 3S2HK 1J6XA 5FJ8K 1BDFA 3GDZA 1WORA 3GTQA 3CAGA 4BBSC 2VUMK 4BBRC 3M4OC 1XZPB 3S0XA 3SZYA 4OIOA 1O28A 3GEIA 1I6HC 3G4CA 2R92K 1YX2A 4NOIA 2BE5A 2E2IA 3S1QK 1PJ6A 1O26A 1HI9A 4GFQA 1I50K 4MEYA 1SMYA 4GTFA 4C3HK 4BY1C 2R7ZA 3AQOA 3M3YC 3H0GC 3PO3C 4WJ3M 1ZYRA 4YFKA 4C3JC 4A3BK 3DXJA 1XXAA 3H0GK 3PO3K 4AH6A 5IYBC 3GTJK 3H0GA 1USMA 1J6WA 1ISEA 1DCOA 2GSNA 5C4JK 2WB1D 3N3YA 4WILA 3TFJA 1I3QC 3CQZC 4LK1A 1TWGA 3RZDK 1I3QK 3SZZA 2XCRB 1DD5A 3N0BA 2ZFZA 1TWFC 5EGHA 5IYDC 1ZVUA 4YFNA 4OINA 1SFOC 2ZUFA 4MQ9A 4PAAA 1TWAC 4BY7K 3HOVK 5IP7K
chains in the Genus database with same CATH topology
5IOQA 4KC6A 1O2AA 1K83A 1TWAA 3G4AA 1O24A 4KB4A 3QX3A 2JA7A 3NUHA 4KDDA 3BUEA 4KASA 3GTMA 1EK8A 3AH5A 4GTDA 1WIHA 2GSUA 3FHZA 1WQFA 4C2MC 2RGRA 4BLBA 1WQGA 3OREA 1O29A 3FOFA 5CJ9A 5IOTA 2NVXA 2CFAB 1B4AA 1BGWA 5EGEA 2Y3PA 3OPFA 1XXCA 2KWAA 4GT9A 3GTOA 2E2HA 3LPXA 4M1XA 2YU9A 1R9TA 3GTJA 4KM8A 4G0UA 2JH3A 4C3IC 1Y1WA 2PHCB 4LQYA 2B63A 3GTPA 3L4JA 1WQHA 4KAWX 1TWHA 3AQPA 3Q3QA 1I50A 4KM9A 1IS1A 5IORA 3ERED 3FKIA 2XCQA 1O27A 2R93A 4KMAA 2GSOA 4FM9A 1O25A 5IOSA 1KQ4A 4FZBA 1B4BA 2JA5A 5CHPA 3V4GA 4GTLA 4GTEA 4P5AA 5TJ3A 1EH1A 3GTQA 3CAGA 3GTLA 4G0VA 1ZBSA 4C3HC 3S0XA 3CQZA 4LR2A 1WCMA 1I3QA 4KARA 1O28A 1F9NA 4GTBA 3G4CA 3MMLB 4KMHA 2P5MA 2E2IA 2XCOA 4G0WA 4GTAA 1XXBA 3GTGA 3FOEA 1O26A 2RH6A 4GFQA 1SFOA 5JFEA 4GTFA 2R7ZA 4ILDA 3AQOA 1Y1VA 2JA6A 1AB4A 4C3JC 4P5BA 1XXAA 4KB2A 1BJTA 3H0GA 1ISEA 2GSNA 3L4KA 3LAPA 4J3NA 3N3YA 2R92A 4KATA 4BKWA 1TWGA 4GTCA 3VA7A 3LAJA 3N0CA 2XCRB 1DD5A 3N0BA 2ZFZA 3OEPA 2VUMA 1TWCA 5EGHA 4DDQA 5JVOA 1TWFA 1ZVUA 1GE9A 1ZXOA 1O2BA 2CFAA 3GTKA 4BLAA 2NVYA 4KMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOQ A;  1O2A A;  3G4A A;  1O24 A;  3N3Y A;  4KAR A;  1O28 A;  4KAS A;  4KAT A;  3AH5 A;  4GTD A;  5IOR A;  4GTB A;  4GTC A;  3G4C A;  1O27 A;  3N0C A;  1O29 A;  3N0B A;  1O25 A;  4GTA A;  5IOT A;  5IOS A;  1KQ4 A;  2CFA B;  1O26 A;  4FZB A;  5JFE A;  4GTF A;  4GT9 A;  5CHP A;  1O2B A;  2CFA A;  4GTE A;  4GTL A;  4P5A A;  4P5B A; 
#chains in the Genus database with same CATH topology
 3HOU C;  3GTK C;  1O2A A;  2O5J A;  3G4A A;  3HOV C;  4GZY A;  3GTK K;  2JA7 A;  3AH5 A;  1WIH A;  3FHZ A;  4A3D C;  4BLB A;  1WQG A;  2WAQ D;  4A3F C;  4BBS K;  5CJ9 A;  2E2H C;  4BBR K;  1BGW A;  5EGE A;  4G7H A;  3HXA A;  3A8J A;  4GT9 A;  4QJV A;  3S1M C;  1WOS A;  2E2H A;  4M1X A;  1EFW A;  4YFX A;  1Y1V C;  2V6U A;  2B63 A;  4PAB A;  3S15 K;  3Q3Q A;  1I50 A;  3I4N C;  2NVQ C;  3I4M C;  4Y52 K;  3BP8 C;  4KM9 A;  3ERE D;  2Y0S L;  1O27 A;  3S2H C;  1XPP A;  2GAG C;  3TFH A;  1KQ4 A;  4G7O A;  3GTQ K;  4FZB A;  5C3E K;  3GTQ C;  1K83 K;  5HL8 A;  5CHP A;  2VUM C;  4A3D K;  3V4G A;  4QIW L;  4GTL A;  4P5A A;  5TJ3 A;  1XZQ A;  2NVY K;  1TWC K;  5D4D A;  4G0V A;  1I50 C;  2JA5 K;  1TWH K;  1Y1W C;  4KAR A;  3GIR A;  4GTB A;  4KMH A;  1C0A A;  2WB1 L;  1IE0 A;  2P5M A;  2XCO A;  3HOZ C;  2WAQ L;  4G0W A;  3FKI C;  2R93 C;  3S17 K;  3GTG A;  2JA8 K;  4LLG A;  3HOZ K;  4ILD A;  3GTL C;  3S17 C;  3GTP K;  1JQW A;  3GTG C;  4P5B A;  3GTP C;  2W7V A;  3HKZ D;  4C45 A;  5C3E C;  4LJZ A;  4C3I K;  1K83 C;  3PO2 K;  1YNJ A;  1VGX A;  4GTC A;  1JVI A;  1TWC C;  3HOU K;  1YCL A;  2PMZ D;  5L46 A;  3GTM C;  1L0W A;  3LAJ A;  5M5W K;  3S2D C;  5M3F K;  3HOY C;  3OEP A;  2V6S A;  3T00 A;  1TWC A;  3BP3 A;  2A6E A;  1F93 A;  4A3I C;  3HOW C;  4Q4Z A;  1TWA K;  3I4N K;  1IL2 A;  1O2B A;  3GTK A;  5IYC C;  4BLA A;  3JST A;  2R93 K;  4KMD A;  5IOQ A;  1O2F B;  1VJE A;  1K83 A;  3GTL K;  1O24 A;  3QX3 A;  3M4O K;  1WOP A;  3BUE A;  4KAS A;  2P8T A;  5IP9 K;  3A8K A;  4A3J K;  4A3M C;  2B63 K;  1WOO A;  1O29 A;  3T02 A;  2A6H A;  5IOT A;  1EQR A;  2Y3P A;  4OIR A;  1XXC A;  3H3V L;  5C4X K;  3LPX A;  1VH2 A;  2A68 A;  4KM8 A;  4G0U A;  3HKZ L;  2NVQ K;  4LQY A;  3I4M K;  5M3M K;  1WQH A;  2E2J C;  4KAW X;  1USO A;  1G51 A;  5IOR A;  1IS1 A;  3FKI A;  2XCQ A;  4Y7N C;  3CQZ K;  2ZUE A;  3RZD C;  5IYD K;  3TTG A;  5C44 K;  4FM9 A;  1O25 A;  4A93 K;  4A3L C;  1IBA A;  3S16 C;  1INN A;  4O2D A;  1XZP A;  4A3L K;  4A3J C;  5E68 A;  2JA5 A;  4WJ4 A;  2NVX C;  1EH1 A;  4XLN A;  1ZBS A;  4C3H C;  4AYB L;  4LR2 A;  1DCP A;  2A69 A;  3IPJ A;  4KN7 A;  2E2J K;  4GTA A;  3EQL A;  4G7Z A;  2D6F C;  5JFE A;  3PO2 C;  1Y1V A;  5FLM C;  5TMF A;  1IW7 A;  2YU9 C;  3GTO K;  4A3G K;  2JA6 A;  1Y1V K;  1RU0 A;  2PMZ L;  5FLM K;  1R9T K;  1BJT A;  2R92 C;  3L4K A;  4A3M K;  2JA7 K;  2R92 A;  4KAT A;  4MEX A;  4YG2 A;  2NVX K;  4BKW A;  2E2I K;  4Y52 C;  4A3C C;  4C3J K;  4LOW A;  2R7Z C;  4A3B C;  4XSX A;  4XSZ A;  3H3V D;  4Q5S A;  2VUM A;  1F7U A;  5JVO A;  4QIW D;  1WSR A;  3WOD A;  1GE9 A;  4A3E K;  2PA8 L;  2CFA A;  4ZH4 A;  2JA5 C;  1I3Q A;  1WCM C;  3GSI A;  2NVY C;  4OIQ A;  5C44 C;  4KMU A;  1EK8 A;  4GTD A;  1IQ0 A;  2FQO A;  2FQT A;  2B63 C;  1HQM A;  3S1Q C;  3S15 C;  3FOF A;  3TFI A;  2NVX A;  1B4A A;  3OPF A;  1JOE A;  3FKI K;  3S1N C;  2E2I C;  2EBB A;  2KWA A;  2JA6 K;  3GTO A;  1WSV A;  2R7Z K;  4X6A C;  4AYB D;  5TMC A;  1R9T A;  3GTJ A;  2YU9 A;  4C2M K;  2JA6 C;  4A93 C;  4BXX K;  2JH3 A;  3S16 K;  1UV7 A;  4QJV B;  3T01 A;  3AQP A;  3S14 C;  3GTM K;  3S2D K;  1YNN A;  1F7V A;  5IOS A;  2Y0S D;  1VRQ C;  4OIP A;  3AD7 C;  5IYC K;  2NVT C;  1B4B A;  4GTE A;  4A3I K;  3HOW K;  1PJ7 A;  4KN4 A;  3GTL A;  3ADA C;  2JA8 C;  5IP9 C;  3CQZ A;  5IP7 C;  1WCM A;  1TWG C;  2O5I A;  1J6V A;  3A8I A;  1F9N A;  5M5Y K;  3MML B;  4A3E C;  3RZO K;  3HOX C;  1VLO A;  3RZO C;  1XXB A;  3FOE A;  2RH6 A;  1SFO A;  3HOX K;  3S1R C;  4A3C K;  1AB4 A;  3M3Y K;  1EI6 A;  3S1M K;  4KB2 A;  3HOY K;  1BS2 A;  1PJ5 A;  2JA7 C;  5IYB K;  3GTJ C;  3LAP A;  4J3N A;  5C4J C;  2PA8 D;  1V5V A;  4BY1 K;  3GEH A;  1ZQ1 C;  3VA7 A;  1WCM K;  5M5X K;  3GTG K;  4XLP A;  3N0C A;  1X31 C;  4DDQ A;  2CW0 A;  1TWF A;  4XCH A;  1ZXO A;  2NVY A;  4KC6 A;  4P9S A;  1TWA A;  3K7A C;  3AD8 C;  1TWF K;  4KB4 A;  4LK0 A;  3NUH A;  2PPB A;  4KDD A;  3GTM A;  4JK1 A;  2GSU A;  4X6A K;  1TWH C;  1Y1W K;  1DCH A;  1WQF A;  4C2M C;  2RGR A;  4BXX C;  3ORE A;  3S1N K;  2CFA B;  2YU9 K;  3GTO C;  4A3G C;  2E2H K;  1TWG K;  1XZQ B;  1R9T C;  4Y7N K;  1I6V A;  3GEE A;  4A3K K;  2GAH C;  1I6H K;  4C3I C;  4A3K C;  1Y1W A;  3S14 K;  2PHC B;  4A3F K;  3GTP A;  3L4J A;  2NVT K;  1TWH A;  1SFO K;  3AD9 C;  1J98 A;  4RMF A;  3S1R K;  4BY7 C;  2R93 A;  5C4X C;  4KMA A;  2GSO A;  3K7A K;  2V6T A;  3S2H K;  1J6X A;  5FJ8 K;  1BDF A;  3GDZ A;  1WOR A;  3GTQ A;  3CAG A;  4BBS C;  2VUM K;  4BBR C;  3M4O C;  1XZP B;  3S0X A;  3SZY A;  4OIO A;  1O28 A;  3GEI A;  1I6H C;  3G4C A;  2R92 K;  1YX2 A;  4NOI A;  2BE5 A;  2E2I A;  3S1Q K;  1PJ6 A;  1O26 A;  1HI9 A;  4GFQ A;  1I50 K;  4MEY A;  1SMY A;  4GTF A;  4C3H K;  4BY1 C;  2R7Z A;  3AQO A;  3M3Y C;  3H0G C;  3PO3 C;  4WJ3 M;  1ZYR A;  4YFK A;  4C3J C;  4A3B K;  3DXJ A;  1XXA A;  3H0G K;  3PO3 K;  4AH6 A;  5IYB C;  3GTJ K;  3H0G A;  1USM A;  1J6W A;  1ISE A;  1DCO A;  2GSN A;  5C4J K;  2WB1 D;  3N3Y A;  4WIL A;  3TFJ A;  1I3Q C;  3CQZ C;  4LK1 A;  1TWG A;  3RZD K;  1I3Q K;  3SZZ A;  2XCR B;  1DD5 A;  3N0B A;  2ZFZ A;  1TWF C;  5EGH A;  5IYD C;  1ZVU A;  4YFN A;  4OIN A;  1SFO C;  2ZUF A;  4MQ9 A;  4PAA A;  1TWA C;  4BY7 K;  3HOV K;  5IP7 K; 
#chains in the Genus database with same CATH homology
 5IOQ A;  4KC6 A;  1O2A A;  1K83 A;  1TWA A;  3G4A A;  1O24 A;  4KB4 A;  3QX3 A;  2JA7 A;  3NUH A;  4KDD A;  3BUE A;  4KAS A;  3GTM A;  1EK8 A;  3AH5 A;  4GTD A;  1WIH A;  2GSU A;  3FHZ A;  1WQF A;  4C2M C;  2RGR A;  4BLB A;  1WQG A;  3ORE A;  1O29 A;  3FOF A;  5CJ9 A;  5IOT A;  2NVX A;  2CFA B;  1B4A A;  1BGW A;  5EGE A;  2Y3P A;  3OPF A;  1XXC A;  2KWA A;  4GT9 A;  3GTO A;  2E2H A;  3LPX A;  4M1X A;  2YU9 A;  1R9T A;  3GTJ A;  4KM8 A;  4G0U A;  2JH3 A;  4C3I C;  1Y1W A;  2PHC B;  4LQY A;  2B63 A;  3GTP A;  3L4J A;  1WQH A;  4KAW X;  1TWH A;  3AQP A;  3Q3Q A;  1I50 A;  4KM9 A;  1IS1 A;  5IOR A;  3ERE D;  3FKI A;  2XCQ A;  1O27 A;  2R93 A;  4KMA A;  2GSO A;  4FM9 A;  1O25 A;  5IOS A;  1KQ4 A;  4FZB A;  1B4B A;  2JA5 A;  5CHP A;  3V4G A;  4GTL A;  4GTE A;  4P5A A;  5TJ3 A;  1EH1 A;  3GTQ A;  3CAG A;  3GTL A;  4G0V A;  1ZBS A;  4C3H C;  3S0X A;  3CQZ A;  4LR2 A;  1WCM A;  1I3Q A;  4KAR A;  1O28 A;  1F9N A;  4GTB A;  3G4C A;  3MML B;  4KMH A;  2P5M A;  2E2I A;  2XCO A;  4G0W A;  4GTA A;  1XXB A;  3GTG A;  3FOE A;  1O26 A;  2RH6 A;  4GFQ A;  1SFO A;  5JFE A;  4GTF A;  2R7Z A;  4ILD A;  3AQO A;  1Y1V A;  2JA6 A;  1AB4 A;  4C3J C;  4P5B A;  1XXA A;  4KB2 A;  1BJT A;  3H0G A;  1ISE A;  2GSN A;  3L4K A;  3LAP A;  4J3N A;  3N3Y A;  2R92 A;  4KAT A;  4BKW A;  1TWG A;  4GTC A;  3VA7 A;  3LAJ A;  3N0C A;  2XCR B;  1DD5 A;  3N0B A;  2ZFZ A;  3OEP A;  2VUM A;  1TWC A;  5EGH A;  4DDQ A;  5JVO A;  1TWF A;  1ZVU A;  1GE9 A;  1ZXO A;  1O2B A;  2CFA A;  3GTK A;  4BLA A;  2NVY A;  4KMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...