1ZXOA

X-ray crystal structure of protein q8a1p1 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr25.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
265
Chain Sequence
LIADSGSTKTDWCVVLNGAVIKRLGTKGINPFFQSEEEIQQKLTAVYFYGAGCTPEKAPVLRRAIADSLPVIGNIKANSDMLAAAHGLCGQKAGIACILGTGSNSCFYNGKEIVSNISPLGFILGDEGSGAVLGKLLVGDILKNQLPATLKEEFLKQFDLTPPEIIDRVYRQPFPNRFLASLSPFIAQHLEEPAIRQLVMNSFIAFFRRNVMQYDYKQYPVHFIGSIAYCYKEILQDAARQTGIQIGKILQSPMEGLIQYHSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords conserved hypothetical protein Q8A1P1
publication title X-Ray structure of the hypothetical protein Q8A1P1 at the resolution 3.2A. Northeast Structural Genomics Consortium target BtR25.
rcsb
source organism Bacteroides thetaiotaomicron
total genus 43
structure length 265
sequence length 278
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zxoA03
5E84A 2W40A 4YDUC 3L4IA 4FSVA 4XH5A 2P9PB 1U2VA 3VOVA 1MA9B 2V51B 3WQTA 2VYPA 5AR0A 3VEOA 2I7PA 4CJ7A 2P9KB 1BOTO 2NRHA 3JXUA 2E2PA 3VETA 3A5NC 3H3NO 3FLCO 2I7NA 4L3QA 5AQHA 3WEEB 4B1ZA 3A0IX 2QWOA 5AQRA 3H46O 3CQYA 5JLFA 3CJAA 2H3GX 2A6AA 4BR9A 3O80A 3LDPA 1GLLO 4H0OA 5AQTA 1YVNA 5BRHA 3DXKA 1NGAA 5E26A 3J8AA 3WQUA 1NGCA 2E2OA 4BC2A 1NGFA 2A42A 1ATRA 5KPZA 2HMPA 2NZTA 4CZIA 3LDOA 5F2RA 3VEZA 4B1WB 4FWNA 5FPMA 3A5LC 2E8AA 3IMXA 3VEYA 4BRQA 4I6MA 1Z05A 3FE1A 5FPNA 3H3OB 4EIAA 2IVNA 1S22A 4CZFA 1G99A 3ZETB 1HKBA 4QS9A 5TKYA 4Y0WA 4EHUA 4JAXA 4CZEA 4IJNA 3EZWA 5AQIA 3CERA 5AQWA 5AQMA 4BVOA 3KVGA 3HZ6A 2IVPA 3KHYA 3EN9A 1GLJO 2YHYA 1H1VA 5ELZA 3WUHA 4E1JA 4CZHA 3AARA 4CZLA 3C0BA 5ADXA 3U4LA 4B1VA 2A5XA 4MLEA 4BRFA 3O1BA 2Q0RA 3QFPA 2QWNA 2Q1NA 3U9DA 3O4WA 4BROA 3FZHA 1JCEA 2P9NA 2QWPA 1DGKN 3MN6A 3BP8A 5KQDA 3L6QA 4CZKA 1JCGA 2D4WA 2P9IA 3HM8A 3RSEB 5BPMA 1NLVA 3O8MA 2P9UB 4JN4A 4LC9B 1T6CA 1MWKA 2D1KA 2FSNA 4H0VB 3G25A 5AQNA 1ZC6A 3GOIA 4M7XA 3UKRA 4MLHA 4B1XB 1U2VB 4BG8A 4BREA 4K25A 5BREA 4JD2A 2IIRA 4BRKA 3R9PA 4EFHA 3U8XA 4BRMA 3IUCA 2VWBA 3GE1A 1BO5O 3VPZA 4H5NA 4BRNA 4MO4A 3D2EA 4NB4A 5F1XA 5KPTA 4DB3A 5CE3A 1SZ2A 4DHYA 4BRCA 4XH4A 3QMLA 4IJAA 3WT0A 1GLEG 1DEJA 1HLUA 3LDNA 1NGIA 2A40A 2Q2RA 2CH5A 4BR7A 3FZKA 5AQYA 5JMVA 1NGGA 4BGAA 1SQKA 3ZEUA 1TYQA 2ASMA 2AA4A 2PBDA 2ZWHA 3A5MC 5EX5A 3WXJA 5ADXH 3MMVA 5AQJA 3VEVA 1XC3A 4PKIA 3DXKB 1HKGA 5JLHA 2HF3A 2GWKA 1NGBA 2GEMA 3WXIA 4JHDA 4BRHA 2D0OA 5I9EB 3EO3A 3F9MA 4FOIA 2F9WA 2F9TA 2ZGYA 4H5WA 3WXKA 4BRGA 2GTDA 3MN5A 3KZBA 4XH1A 1OKJA 4CD3A 3BF1A 1R59O 1K8KA 1BG3A 4I6MB 3ID8A 4RWTA 3AY9A 2P9LA 1NBWA 1DKGD 4FWLA 1ATNA 4BRAA 4H0XB 5LY3A 5BRFA 1NGJA 3D2FA 5AQKA 5LJVA 2PAVA 1C0GA 4BRIA 4FPBA 3C7NA 3O5BA 3ZX3A 2EWSA 3SMSA 3VGLA 2FF3B 3DWLA 3GDQA 2E88A 3TPQA 2GWJA 3VF6A 3QDKA 3R8EA 1MWMA 3IFRA 3LDLA 5AQGA 3UB5A 1Y64A 5AZJA 4C23A 1BA0A 1GLDG 5AQXA 1YAGA 5AQLA 3CIPA 2VCPA 4H0TB 2E2QA 2P9NB 2P9SA 3A8YA 3VGKA 4A2AA 4CBWA 5KQ8A 4FWOA 5LJWA 4H5VA 5FPDA 2P9IB 2QWQA 1X3NA 3GL1A 3CJ7A 1QQNA 3VGMA 2E1ZA 5EVZA 4BC5A 3ZX2A 1X3MA 3IDHA 4PL8A 2ASPA 1HX1A 1QQOA 3HTVA 3AAQA 1NGDA 3UKRB 4DCHA 3LM9A 4PL7A 3VENA 2D0PA 4IWVA 2CH6A 1T6DA 4JD2B 2OANA 4ISGA 2ZGZA 1XQSC 3LL3A 4H0YB 5FPEA 3ATUA 3D2EB 1HUXA 4AM7A 3VEWA 5JICA 5F0XA 3BEXA 3M3ZA 5AQQA 1SAZA 3SK3A 1D4XA 3UKUA 3CJCA 1C0FA 2E2NA 1ATSA 4BVPA 3ULEA 1LCUA 1V4TA 2YJEA 3ZEUB 1TYQB 3I8BA 4WQ4A 4H5RA 5AQZA 4QS8A 5AZIA 2E20A 2FLOA 3GBTA 3BUZB 3CHWA 2YCHA 1HKCA 4JHDB 1KXPA 3VERA 5AFUA 4FWQA 3B8AX 4WYBA 5BPNA 1U6ZA 3W3DA 1WUAA 4CD1A 1KAZA 4H5TA 4CZGA 4BGBA 3CQXA 1GLBG 2ZF5O 1K8KB 3QBWA 2GELA 2AP1A 2P9LB 3WXLA 5AQOA 1ZBSA 2Q36A 4WQ5A 3D2FB 3H1QA 4J8FA 3TU5A 4BQZA 2YHXA 3DXMA 3M1FA 3HSCA 4K42A 3C7NB 1NGHA 2Q97A 2ASOA 1QHAA 4FO0A 4BG9A 1QZ6A 4MO5A 2Q0UA 1GLCG 3QB0A 3D7EO 1HPMA 1IG8A 3MCPA 4YDUA 4AM6A 1BA1A 4BC3A 4CZMA 5AQPA 1GLFO 4NO7A 3FGUA 4H03B 2FSKA 5AZJB 5BN9A 4PKHA 4F9OA 1V4SA 2NLXA 2HF4A 1J6ZA 4BC4A 1Z6RA 5EXWA 3QBXA 4H0PA 4K43A 2HOEA 3AAPA 2P9SB 3S41A 2KHOA 5AFUH 1E4GT 3FZLA 1GLAG 3VF2A 3GG4A 4FOEA 1HJOA 1NM1A 1ZXOA 4FL9A 1ESVA 4DQ8A 3A5OC 4PKGA 1KAYA 3I33A 4GNIA 4GY2B 3P4IA 3WEEA 4EAHD 1X9JA 2QW9A 4HWIA 1S3XA 3HI0A 3O1WA 1YUWA 2P9PA 3M6GA 3SMPA 3FFKB 2V7YA 5BRDA 1JCFA 2DPNA 2YHWA 4BR0A 2FF6A 4FWKA 2IVOA 4CBUA 3LM2A 2P9KA 1KAXA 4FWRA 1IJJA 4HTLA 3O08A 1EQYA 3UKUB 3BF3A 4A61A 1LOTB 3ULEB 4IXCA 3SJHA 2ITMA 3ATVA 2BUPA 1CZAN 2CGKA 3CJBA 3EKUA 3H6EA 3MK6A 5AQSA 5AZIB 2J4RA 3QICA 3R6MA 1RDWX 4O5FA 4B1UB 4BR2A 3VESA 2FSJA 3MN9A 4IO8A 2QWRA 4M7YA 4CBXA 3ZX0A 4ISEA 4Z94A 2FXUA 1RFQA 4ISFA 5BPLA 3CETA 4B1YB 3MDQA 3QFUA 4CZJA 3VF4A 4EHTA 4RTFD 5KPRA 3H45C 1BU6O 3H1VX 4BQLA 2A3ZA 3ZETA 2CGJA 4BR5A 2QWLA 2QWMA 3DXMB 2YI1A 3ENOA 1NMDA 1YXQA 4WQ4C 4M63C 4RCHA 1BDGA 4B9QA 1NGEA 2CGLA 3UE5A 4O8KA 4KBOA 1XUPO 3FZFA 3ENHA 1E4FT 1P8ZA 4IZ9A 2BTFA 3FZMA 4JNEA 4CI6A 3FR0A 3CI5A 3SLCA 1BUPA 4FWMA 1MDUB 1QQMA 2YJFA 5EY4A 1TUYA 4BR4A 5AQVA 4QS7A 2V7ZA 1TUUA 5AQUA 2E1YA 3LDQA 3EKSA 2A41A 3OHRA 4FPAA 2Q31A 3MN7A 4BRPA 2QXLA 1Q18A 1RGIA 3VEXA 1NWKA 4A2BA 1QZ5A 2V52B 3EL2A 4XEIA 3DJCA 4FWSA 4K41A 4WQ5C 2QM1A 1WOQA 3O6WA 3CJ9A 5B8HA 4BRDA 3L0QA 2UYTA 3W0LA 5BN8A 2GUPA 5AQFA 3JS6A 3RSEA 2WUSA 4FWPA 5EOYA 4BRLA 2P9UA 3HBTA 4A62A 3CJ1A 3DAWA 3U9ZA 5BR9A 2W41A 1BWFO 1T44A
chains in the Genus database with same CATH superfamily
4HCBA 2HW3A 3K2PA 1WQHA 2UU9K 2P9PB 1C0AA 3KLHA 1MA9B 2V51B 3IPJA 3WQTA 2VYPA 3V9SA 1WSFA 3VEOA 3HM9A 3TSPA 4Z4EA 1BOTO 3JXUA 4Y1CA 2E2PA 3B6PA 3AVGA 4GKKK 4L3QA 3ZT4A 2Z1HA 1WSHA 3AVMA 1K83C 1ISEA 2QWOA 5AQRA 4P9SA 5JLFA 5FLMK 1VSIA 1RBUA 2Y1IA 3CJAA 4FZYA 2JA8C 2H3GX 1I6HC 2XY7A 3RR8A 4C3JC 1JXEA 2G8HA 4FJMA 4Z4IA 1S1UA 4NLCA 5HOOA 2YX6A 5AQTA 1JOEA 2OPPA 5BRHA 4C8LA 2HNDA 3RMAA 1K9MO 2R7ZK 1WSIA 4DV5K 3FOFA 1NGAA 1S1TA 2O8BB 3SQ2A 1BGXT 4KH5A 5IYCK 3ZYYX 4N76A 4I9LA 4FJIA 3S1QK 3VTIA 4CGHA 4E7KA 5F2RA 1TKTA 1NK5A 4FWNA 4MFBA 2O8FA 4KM8A 1IBMK 1TK5A 3HP6A 3KTQA 3TTCA 3GTOK 5CZ1A 1G51A 2W6LA 1TWHC 5DM6L 3FKIK 4O5BA 3NVKA 3H0GC 2BE5A 1X9SA 4JAXA 1FK9A 1IH7A 3MECA 4IJNA 3EZWA 3K5OA 3EEQA 5AQIA 3GTQK 4N41A 4A93K 2BDPA 3F9KA 2YU9C 3KVGA 4WFAL 2IVPA 4KN7A 4DFKA 2UXBK 3P83D 1JXBA 3WUHA 1J53A 4CZHA 3AARA 5ADXA 4PUOA 4B1VA 3OYIA 1RTHA 1GOBA 3O1BA 3QFPA 4LSLA 4F8RA 2Q1NA 3I4MK 4LF8K 1JCEA 4XIUA 3RZOC 2DTUA 4CZKA 4IFYA 1HI9A 2QXFA 1NK6A 3PUFA 3THYA 2HSTA 2DY4A 2P9UB 2FBTA 4JN4A 4CFBA 2A6HA 3HO1A 3JSMA 2ZJPL 4BBRC 1VJEA 3C6UA 4H0VB 3G25A 4F4KA 5TMFA 5CR4A 2R93C 3S3OA 2DFFA 3HOUC 5I3UA 2P8TA 1U2VB 3S0XA 4JD2A 3R9PA 3U8XA 1BO5O 4KMHA 4FZBA 5HRSA 1KTQA 1YVUA 4YOTA 1RDBA 1KVCA 5F1XA 4DDQA 1W7AA 3AGKA 3QIPA 5CE3A 3AGRA 4BRCA 4LF7K 3QMLA 4GTAA 1DEJA 1PJ6A 4CK1A 2VGNA 1JLAA 3AQOA 4CFAA 3NF6A 3NH0A 3HRGA 1WQGA 1SQKA 3L2WA 3ZEUA 2ZWHA 1U48A 5ADXH 3E01A 4G0WA 4CW7B 3A2FA 1QSYA 3DXKB 1HRHA 1NJWA 1NGBA 4JK9A 4JHDA 4DFPA 1PJ7A 5I9EB 2ZFZA 1TK8A 1DCOA 4JI1K 1JLCA 4ID1A 2F9WA 3ZSWA 3WXKA 1OH6A 5EGEA 3GTLC 1RT5A 3AVJA 3F2KA 3KK2A 1OKJA 5MLCQ 3BF1A 4FWLA 4BE2A 1SKWA 4OO1J 4PHTX 4BE0A 1BQMA 3KK7A 1XC9A 3OTOK 3SCXA 2JA5K 3WNGA 3VQ5A 3NF9A 3NGZA 3QESA 4ILGB 2FF3B 4A3BC 3LAJA 3GDQA 3H3VL 4E7IA 1XPPA 5C10A 4CECA 4C2MK 1L3VA 2B63K 3G10A 2YHBA 2NVQK 4PABA 2KKZA 3V1QA 2R92K 1XNRK 1C6VA 3VQ7A 1O2AA 3RZDC 1JVIA 1BA0A 1Q81O 3OYLA 4KO0A 3F73A 4DV0K 1EFWA 3AVLA 1IL2A 5M3FK 3CIPA 2GSOA 2VCPA 5C0YA 2QI2A 2P9NB 3A8YA 3ZSZA 5KQ8A 5LJWA 4OGEA 3S1NK 4GTDA 4LD0A 1TWFK 1WSEA 5H1SQ 4CK2A 1QTMA 3CCMN 5EVZA 3IDHA 4B08A 3O4QA 1N8RO 3HTVA 4KHPK 4HTUA 3T69A 2NNWA 3UKRB 3P5JA 3OBWA 3LM9A 3VENA 4KTZA 5HL8A 1RT7A 3CG7A 4DF4A 2XRIA 1SS6A 3THXA 2ETJA 3SZ2A 3LL3A 5HRNA 1IV0A 5IP9C 3D2EB 1GE9A 1HUXA 5F0XA 3M3ZA 3SK3A 3BP8C 4PA1A 5D4DA 1YF5L 3G4AA 1K8AO 4RW7A 1HQEA 2HHTA 1Y1VK 2HNZA 3EYZA 1KLNA 1R9TK 4M1XA 3I8BA 3G0ZA 5FDLA 4DS5A 3R3LA 1S6PA 4M3TA 4YFXA 2V6UA 5J2MA 3CHWA 4C8OA 3GTKC 5AJ3K 1LWEA 3ID6A 3ZSVA 5C2FA 5HRPA 3NH1A 3T00A 3CFPA 3HL8A 3RMDA 3AO5A 4CD1A 1TWAA 2JA6C 1TVRA 3C6AA 1CXQA 3CQXA 2ZF5O 5C2DA 3VQDA 1B9FA 5M3MK 2AP1A 4M3YA 3AVAA 3WXLA 3CCVN 4FJNA 4NCBA 3CF5L 3K59A 2Q36A 3D2FB 4NXMK 1IQ0A 2A1SA 2YHXA 5M1PA 2WB1D 2B6AA 1QSSA 2E2HC 1W97L 2JWLA 2QKBA 1QHAA 3JSTA 2IGIA 3T19A 4YOYA 5SZTA 1JLGA 1I3QC 1VQKN 4KB0A 1IG8A 3SYZA 5TMCA 4AM6A 4OIOA 1S5JA 2VQEK 3DRRA 1SL1A 4NO7A 4Y7NC 3OYDA 1ZBIA 1V4SA 1UWBA 1CLQA 3VN5A 4NYFA 1NKEA 4K43A 2HVHA 1VH2A 1J6WA 3AA3A 5C4XC 3MEEA 4DLEA 2P9SB 3M4OK 1UA1A 1VQMN 1B4AA 1EWRA 1E4GT 3ZSOA 4CJLA 3FZLA 1GLAG 5GADP 4DTPA 1EXQA 1HJOA 1I50K 4FL9A 3LALA 4FCYA 3N3YA 3C65A 3A5OC 4PKGA 3SQ0A 5TKWA 3S1MC 3T7ZA 2OZSA 3HXAA 4FVMA 1VSHA 2D0BA 3MXMA 4UQGA 3ERED 3SMPA 2ZUEA 4WE1A 1X31C 5BRDA 2DPNA 4A3LC 4CFDA 4BR0A 4DTJA 4ILHA 1O2FB 3DLLL 2P9KA 2NVXK 4NCAA 3UKUB 3CPEA 1OVQA 1ILYA 4DTUA 3CJBA 1CZAN 4W5NA 3MK6A 4R79A 1SFOK 1P90A 5AZIB 2RPIA 2B63A 2CW0A 4BR2A 3PO2C 4KB1A 4DKWA 4QJVB 1BI4A 2P5GA 1NJIO 4CEOA 2E6MA 2FC0A 4CEEA 1J9AA 3ZX0A 3LWMA 4ISEA 1B4BA 4EP4A 3PV8A 3I4NK 3HKZD 1USMA 1T05A 2GX9A 4FJGA 1S1WA 4CZJA 3VF4A 1S9EA 4C3HK 4KHUA 3TTFA 2CFAA 1VQ8N 2A3ZA 3OA9A 1TWCK 3GTJK 3NGIA 5FROA 1S1XA 2QWLA 2QWMA 3DXMB 3L2RA 4DF8A 3TFJA 1QVFM 1RT3A 4RCHA 2PYJA 2FBYA 3CQZA 1A5WA 1EP4A 2CGLA 4CJSA 1KVBA 4KBOA 1ASWA 1P8ZA 2PFUA 3CCJN 4AYBL 2BTFA 3FZMA 4BLAA 2O4IA 4AHVA 4E1MA 3AH5A 4M3UA 5C24A 1MDUB 4DR1K 5IYBK 3CCLN 1YITN 2V7ZA 2X78A 5AQUA 1WNSA 3J81O 2Z1IA 4JKCA 3MN7A 2BANA 3OS1A 1Q18A 4DWIA 3T1YK 2E2JK 3D6RA 2XY5A 4JI7K 4XEIA 4FWSA 4K41A 4CESA 3BP3A 4H4MA 4WQ5C 4M3RA 1WOQA 4M3WA 4BRDA 4CJ3A 4A3KK 3L0QA 5AQFA 1HJRA 2WUSA 1IKXA 3P31A 1KQSM 1WCMC 1Y1VA 1R9TA 2WOMA 1Q82O 3LP2A 3DAWA 3TSUA 2W41A 1BWFO 3EE9A 1T44A 1RDDA 5E84A 2W40A 4YDUC 1VQNN 3L4IA 3I55N 4RW6A 2NUBA 4JI8K 3OYCA 3AA5X 2A6EA 2JGUA 3LAMA 4E19A 4A3EC 5LMUK 1DTTA 3TAPA 1WSRA 1Y1WA 3R1XA 3NF7A 3CCUN 3FLCO 5AQHA 1EKEA 5C25A 3A0IX 4A3DK 3I8DA 2HHSA 3H46O 4FK4A 4YFKA 3SJJA 3S3NA 1BDFA 3VQBA 4A3MK 4GW6A 4KH6A 4BR9A 3OEPA 3O80A 3LDPA 2WONA 1U47A 4KTWA 1GLLO 2OPRA 4H0OA 4IG0A 4GTBA 1YVNA 5IOSA 3LPUA 1VSFA 4E1NA 1T8EA 3WQUA 4BC2A 2A42A 3JAMO 1ATRA 5CHPA 1KVAA 2NZTA 1VRTA 3AD8C 4JKHA 3HOWC 4KB2A 4CERA 1XZQA 3QETA 3EZ5A 3OJSA 3U3GA 3EE8A 1BCOA 4I6MA 3ITHA 2VUMA 3CAGA 3FE1A 3WNHA 4BACA 1RT4A 4M3XA 4CZFA 1G99A 2PZSA 1HKBA 1JL2A 2LSNA 4ELTA 3S17K 2GBZA 5TKYA 5IP7K 2P1JA 3BY5A 4GV6A 1F21A 1FW6A 3THYB 2FQOA 1J98A 5AQMA 1SL0A 1WSGA 3KHYA 3EN9A 1WN7A 3GTGA 3CC4N 4CF8A 1X1PA 1HMVA 1H1VA 3C0BA 2A5XA 1FXXA 4MLEA 5A2QO 4YOXA 3AVNA 2Q0RA 1CZBA 1L3TA 4A3JK 4B8AB 3O4WA 4BROA 3FZHA 1J5EK 3OPFA 1YIJN 4CF0A 3L6QA 2D4WA 3HM8A 4LF5K 3AQPA 2HB5A 2XCOA 3O8MA 4DTMA 5LL6Z 4FYDA 4J2DA 1YNNA 4F2SA 3S2HK 4B3MK 4DTNA 3SUOA 2G8VA 2X74A 1J54A 1TWGA 4BDYA 4BREA 3MXIA 2IIRA 4BRKA 4WILA 4J2EA 4J2BA 4BRMA 3TR8A 3GE1A 4R5PA 2DFHA 5I42A 4A3CK 3SZYA 3PX4A 4GTCA 4BRNA 4J3NA 4MDBA 4LOWA 4OPKA 4W5QA 1TWCA 3GTJA 3H3VD 4EZ6A 2A40A 4JK7A 4BR7A 3OYMA 3LZIA 4FLYA 3S14K 2WFBA 5AQYA 4OKJA 4B9NA 2HNYA 5IT9O 3G71N 1TYQA 2ASMA 4DSJA 3WXJA 1VSDA 1VQ4N 3IKMA 4PKIA 1HKGA 2PA8D 2HF3A 2E2IC 1Q8IA 4X65K 4BRHA 2D0OA 4JI3K 3EO3A 2NVTC 3I4NC 4FW1A 3V1RA 4BY1C 4FJKA 2F9TA 2ZGYA 2GSUA 3S15C 2FBVA 2QTDA 2GTDA 2P5OA 3GTMC 4IO9L 3TWHA 1TKZA 2OYQA 4O0JA 4AHSA 3MXJA 3TABA 3IRXA 4FJHA 1R59O 3AA4A 4DSEA 4RWTA 2P9LA 4BRAA 4JV5K 2YV0X 4H0XB 5CY4A 2NVYC 4Z4HA 5LY3A 1M1KO 1NOZA 2O4GA 4U7BA 2PAVA 1C0GA 4BRIA 3O5BA 4B9TA 2EWSA 5C4JK 5KRSA 3VGLA 3PO3K 3OY9A 3DWLA 1IS1A 4CHYA 2RE2A 2HBMA 4OIRA 4HVJA 5IYDC 2YKNA 4C8NA 4DV2K 2JA7C 2HVIA 4A3FC 4W5OA 3WODA 3GTPA 3VF6A 3ZCMA 4QIWL 2KW4A 4LFBK 3HOTA 1MWMA 3IFRA 2XHBA 2BE2A 4E7HA 5KTQA 4DTOA 2X6NA 4GV9A 1LW2A 5AZJA 3M8RA 2UXDK 3OYEA 5IOTA 2W7VA 2KLAA 3V1OA 4PY5A 5DK5A 4CGFA 4A2AA 3VGKA 4CBWA 1IKVA 4BXXK 4C3IK 3O9TA 5FPDA 2P9IB 1QHTA 3ZSRA 5FLMC 2QK9A 2Y0SD 2HHXA 3K9KA 4OJRA 2O8DA 1XMQK 4RW4A 3VGMA 3MWPA 1VSMA 4BC5A 3ZX2A 4A3IK 1TWAK 3AAQA 3VA3A 3P38A 2R7ZC 3S3MA 5KI6A 1VQPN 2D0PA 1ZQ1C 4LQYA 5IYCC 3L2VA 1KSPA 2OANA 5GAEP 3VQAA 4CIEA 3S1QC 4DV6K 4RG8A 4XSZA 2Z1JA 4X62K 4Q5SA 4W5TA 5JICA 4DFJA 1WSVA 3BEXA 5AQQA 1SAZA 3CJCA 1ATSA 5JS1A 1WSJA 3ULEA 2IC3A 4FLZA 1O24A 3P1GA 1LCUA 4FK2A 3GTOC 4WQ4A 1LWCA 4QS8A 3FKIC 3SV4A 1DT9A 1W0HA 4OKEA 3GEIA 2YCHA 3VQ6A 1KXPA 4WFNL 2UXCK 4ILDA 3GTQC 3M3YK 4DV1K 4WYBA 2NRVA 4A93C 2XO7A 1WUAA 1QVGM 4BBSK 3NCIA 4H5TA 3AD7C 3KD5E 4FM2A 3LAKA 2OPQA 4V19S 4KATA 4BGBA 2YNFA 1XHZA 1K8KB 1C1BA 3V4GA 1HR0K 4KMAA 1ZYRA 1JLFA 3RTVA 4OVLA 1OH7A 5AQOA 4KV8A 1ZBUA 3I4MC 5FRNA 3M1FA 4K42A 2OPSA 4DQIA 4OKKA 3C7NB 4BWMA 4H4OA 1NGHA 3DOKA 2Q97A 1O28A 3HOVK 2ASOA 4BG9A 4JS4A 1DCPA 4CHOA 1VSLA 3OYFA 1VQ7N 3N0BA 1BA1A 4BC3A 4CZMA 5AQPA 3L4KA 1GLFO 3FOEA 3FGUA 1N33K 3K7AK 3MWTA 2NLXA 1NK9A 2IAJA 3CMAN 3QBXA 4LF9K 4TSXA 2D5RA 1F9NA 1EO1A 3AAPA 4YNQA 4CHPA 4FJ9A 4AHRA 3GDZA 1VRUA 2AJQA 1XNQK 4JI6K 4BY9C 1GOAA 4LK1A 4IKFA 3QNOA 2QA4N 1NM1A 4GVEA 3E9OA 2B5JA 3JYTA 1ESVA 3SBGA 4IDHA 1J5OA 1KAYA 3I33A 3RRGA 3P4IA 4DSKA 2ZM6K 5KGXA 4CEQA 2QW9A 2P9PA 2UUBK 1SL2A 4FJLA 1F93A 3FFKB 2V7YA 3DLRA 1JCFA 1LV5A 3B6OA 4GMJB 2FF6A 4FWKA 3LM2A 3C94A 2JWKA 2A69A 1KAXA 3AVCA 3VQEA 4DMNA 2XY8A 2V6SA 4XLNA 4HTLA 3BF3A 2NRZA 5LMNK 3FHZA 4HHTA 3CQZK 4AYBD 5JS2A 1TWHA 2JA5C 3EKUA 1VSJA 4CHZA 1B9DA 1ASVA 3E1YA 3QICA 4IDKA 4O5FA 3MAQA 4CJWA 2O8BA 1XXBA 4C2MC 4MDAA 3AVKA 4CIFA 4WFBL 1QSLA 2B63C 1BIUA 3LPXA 2YU9A 4WF9L 3AVIA 2NVQC 3E66A 1IBAA 4FM9A 1EX4A 2FXUA 2R92C 1NKCA 1ZVUA 3KJVA 2WAQD 1D9FA 3TAMA 4ISFA 1LW0A 2OTJN 3WXMB 4JI5K 4KREA 4DR7K 2PY5A 3T01A 2VWJA 4EHTA 5J2QA 3H45C 2RH6A 3AVHA 3LWLA 3PLAA 4BQLA 3QLHA 3LZJA 4B9MA 2O5JA 5HLFA 4NLBA 4BR5A 3OVNA 3PSFA 3OYBA 1NMDA 3J7YP 3S1NC 4KC6A 3NMUA 1BDGA 2Y1JA 3UE5A 1TWFC 1XUPO 4JNEA 4AHCA 4CI6A 1ASUA 2R93A 1VK0A 4KRFA 2YJFA 1Y1WK 4A3GK 5AQVA 3TTDA 1TUUA 1UAXA 2KTQA 3M5RA 2VQFK 1RT2A 3LDQA 3KD1E 1C1CA 2O8EB 3OHRA 4G1QA 1REVA 3HOZK 3VEXA 4K8XA 5C44K 5HL7L 1D5AA 1KLMA 3EL2A 4RMFA 3DJCA 2GAHC 3VTHA 2O8CB 2KFZA 3O6WA 5B8HA 1KFSA 5EU7A 4PAAA 5BN8A 2GUPA 4IFVA 4KDDA 3HSTB 5M1OA 1RT6A 2P9UA 4A62A 5FJ8K 3PO4A 1Y1VC 3WEEB 1R9TC 4X6AK 3HVTA 1WIHA 3V9WA 4FSVA 4CF2A 1U2VA 2ZUFA 4IEIA 3LPTA 4YG2A 4KB4A 2VUMK 1VSEA 1Q86O 4DV3K 4KPYA 5AR0A 4DTXA 3TARA 3GTLA 2GUIA 5SWMA 2NRHA 4FW2A 1I6VA 3A5NC 3H3NO 2I7NA 3HOXK 3TAQA 1VRQC 1N5YA 4BDPA 3OJUA 3C95A 3SZZA 4CEZA 4JKBA 3AA2A 3E9PA 4LF6K 4JKGB 4PQUA 4YFNA 2D0AA 4GTEA 5CYMA 5DM7L 3GTGK 4CJKA 3DXKA 3ALYA 3RR7A 2FQTA 3G6EN 1DLOA 4QOZB 5KPZA 1TL3A 4B3RK 3LDOA 3SI6A 4B1WB 3OYAA 4JKDA 3O3HA 2E8AA 2HBLA 3IMXA 4BRQA 3NVMA 2HBKA 5C3EK 3I0RA 1RBSA 3H3OB 1IE0A 3O3GA 3ZETB 3S16K 4LLGA 4G0UA 4ID5A 2OA8A 3M4OC 3NBPA 4QS9A 3V9UA 2WC9A 4Y0WA 1WQFA 4BY7K 4CJTA 2OZMA 5GINA 1I50C 3AO3A 3LP1A 3CERA 5AQWA 4FVUA 1TWGK 1XZPB 3GEEA 1IKWA 1C0UA 1R0AA 1LAWA 3DLHA 3HZ6A 3D45A 4OLBA 2YHYA 5M5XK 2IOCA 2B4JA 5ELZA 1IBLK 3DLGA 4CZLA 4KHQA 1KFDA 3HK2A 4O44A 4E7LA 3U4LA 3O9QA 4BRFA 3QERA 2QWNA 1OVYA 4Y52K 4LH5A 1TV6A 3L2QA 2NVXC 3A8IA 1TAUA 2P9NA 2QWPA 3V81A 3MN6A 3BP8A 4B9VA 5BPMA 3RSEB 1NLVA 1WOPA 4LC9B 4CK3A 4CEDA 2D1KA 2FSNA 2RHKA 3V9XA 1HNZK 1SFOC 4Q4ZA 3S2DK 3C6TA 2WBNA 3GOIA 5GAHP 3BZCA 4A59A 3GTKA 1T3VA 4MLHA 3UKRA 1YI2N 3CFOA 1EWQA 4BG8A 4KHSA 3DYAA 1N36K 4EFHA 1RTDA 4JI0K 4IG3A 1MU2A 2VWBA 3ENBA 3VPZA 1SKRA 3TTGA 2JA6A 1WOSA 3S1RK 4NB4A 3D2EA 3CMEN 1SZ2A 4GKJK 4XH4A 3T1HK 2Y3PA 4IJAA 3WT0A 1HLUA 3IS9A 3LDNA 1NGIA 2ITGA 2Q2RA 4C3HC 2RF2A 4P5AA 3FZKA 1U4BA 1TWCC 3GTJC 1JL1A 1WBDA 3GTPK 1NGGA 4BGAA 4CCHA 2PBDA 4BE1A 5M5YK 3MMVA 4FM0A 3VEVA 1JJ2M 1XC3A 4KM9A 4ELUA 1I3QA 2GWKA 4CJPA 1O26A 3WXIA 1E3MA 3F9MA 4FOIA 1O25A 5IYBC 4BRGA 4FLWA 2O8FB 3MN5A 3KZBA 1RT1A 2F7TA 4M41A 1BG3A 1WAFA 1C1AA 3AY9A 1DKGD 2E2JC 3UIQA 4U67L 3HOYK 2F96A 3PIOL 3D2FA 2HHHK 4A3KC 3ZX3A 3SMSA 3NE6A 2ZJRL 5J2NA 1Q9YA 3LP0A 1NK0A 3MMLB 3TPQA 5M1QA 4KAWX 3KKSA 3QDKA 4B8CA 3LDLA 2GAGC 3V6DA 3VQ4A 3UB5A 3SUPA 3WNEA 3NAEA 1RCHA 5CYQA 2WB1L 1GLDG 2FBXA 3J7ZO 1M90O 3ASMA 2E6LA 3DLKA 1VQ9N 1F7UA 1RTJA 4DR5K 5M1FA 2E2QA 2P9SA 4JEPA 4KMUA 4OINA 4H5VA 3KLGA 5CJ9A 4A3DC 3GL1A 3RRHA 3QEWA 4IEEA 4A3MC 1HNIA 4JRPA 1QQNA 3OREA 1O1WA 4IOCL 4LF4K 4DQQA 2E1ZA 3H08A 1X3MA 1NU0A 2ASPA 4LY7A 3ZSXA 4K8ZA 4O0IA 1QE1A 1NGDA 5HROA 3AO1A 4DCHA 1S1VA 4PL7A 4DTSA 3RWUA 2CH6A 4YORA 5JVHL 3S9HA 1T6DA 4JD2B 3QNNA 2XCQA 1BISA 5JFEA 2ZGZA 4N5SA 4G0VA 4ZHRA 4KI4A 1BGWA 1EK8A 5FPEA 4DLGA 4AM7A 3EQLA 3CCRN 3CCQN 1RDAA 4F3TA 3UKUA 3CM6A 4JK1A 4KN4A 3SUNA 2QKKA 1Z25A 4BVPA 1BS2A 2XY6A 2YJEA 4FLUA 3ZEUB 3S17C 1RTIA 5AZIA 1IG9A 5IP7C 3T3FA 1G15A 1I3AA 3N4QA 1W2BM 5EGHA 4JHDB 4HCCA 3VERA 5AFUA 3O9UA 3QINA 4FWQA 1N32K 4QJVA 3B8AX 5BPNA 3K0SA 5BR8K 1KAZA 1BCMA 4CZGA 3GEHA 1HNXK 3ZT2A 4OPHA 1K83K 4B9LA 3OYHA 1VAZA 2R7YA 3KKRA 2G8UA 2JA8K 1I6HK 4CIGA 1ZBSA 2YNIA 4WQ5A 1KC8O 4F3OA 4C3JK 4J8FA 4A3JC 4BQZA 2X6SA 4DR3K 1D9DA 3DXMA 1JLEA 3SUQA 3HKZL 1WCMA 3HXMA 4NCGA 2OCEA 2ZE2A 1U45A 4LFCK 4UY8O 1SUQA 4MO5A 5C42A 4CF1A 1ZBFA 4CFCA 4YDUA 3K5NA 3ULDA 2XCRB 4AHTA 3S2HC 1OH8A 2KFNA 2O5IA 1EH1A 4PKHA 2PHCB 4FK0A 1Z6RA 5DMRA 5EXWA 5GIPA 2HOEA 4OPAA 4CF9A 4GTLA 1IW7A 4A3CC 1B92A 4FZZA 1TWHK 4AQYK 1SV5A 2KHOA 5AFUH 5M1NA 3H0GK 3WNFA 3VF2A 3A8KA 3GG4A 4LSNA 3Q7CA 4FOEA 2A68A 3S14C 1ZXOA 4G7HA 4DQ8A 4X64K 1RBTA 3VA7A 3AO2A 4GNIA 2YU9K 1X9JA 4FZXC 4FLVA 4ZTJA 3QX3A 4HWIA 1S3XA 3O1WA 1A5VA 3M6GA 2YHWA 4MQ9A 3THXB 4OX9K 5IORA 3T1AA 4CBUA 2IVOA 3RZOK 3O08A 3THWA 1LAVA 1ITGA 4LK0A 4BWJA 3L8BA 1T03A 1FJGK 2ATQA 2NRWA 4IXCA 4OPJA 2QEXN 4F2RA 3SJHA 4BBRK 3TFHA 3ATVA 2BUPA 2CGKA 4JRQA 3HPGA 4B3OA 1UV7A 2R93K 4DSFA 5C4JC 3HOUK 3PO3C 3SNNA 4KHNA 4B1UB 2YNGA 1HYSA 2HBJA 2FSJA 3AD9C 4IO8A 4CEAA 4CBXA 2F8SA 4Z94A 2YNHA 3K58A 3CETA 1X9MA 4B1YB 5E41A 3MDQA 3QFUA 1L3SA 4WJ4A 2EX3A 4RTFD 1RBVA 2E4LA 3K5MA 2PMZL 4YOUA 1BU6O 3H1VX 2KZMA 3NH2A 3CYMA 4KHYA 2YI1A 1JKHA 3AVBA 3ENOA 4BXXC 4HUEA 4C3IC 1HPZA 1YXQA 4M63C 1C0MA 3Q7BA 4CHQA 4XSXA 2NRTA 4O8KA 2HHUA 4IZ9A 4ICLA 1E4FT 3KWGA 3SQ4A 2KWAA 3SLCA 3OBYA 4G9ZA 2HHQA 2G8IA 1QQMA 4GVMA 1TWAC 1TAQA 4A3IC 4YOWA 3GTLK 1BQNA 1RDCA 2E1YA 3AVFA 3QEVA 3EKSA 3RMCA 1WLJA 2A41A 4BRPA 2QXLA 4KARA 1RGIA 4LFAK 3RVCA 4A2BA 3ZT0A 3CC7N 3P39A 1A5XA 2V52B 1BHLA 1WBBA 4L8RB 4OIPA 3CJ9A 4KH4A 3TAEA 1NK8A 3W0LA 1OH5A 1L0WA 4A3BK 3NDKA 1TL1A 4FJJA 1XI1A 3JS6A 4QAGA 5HBMA 3VA0A 3O9SA 4LH4A 4BRLA 3HBTA 1NK7A 3BUEA 5FLXO 5BR9A 3SBTA 1NK4A 2JLEA 2W6KA 1IO2A 5M5WK 3RZDK 3ISNC 4XH5A 2E2IA 3VOVA 3M3YC 3L4QA 3KK3A 2PPBA 1TKDA 3KIOA 3L3UA 4BBSC 3DOLA 1K83A 3GTMA 1HQUA 3CM5A 2I7PA 4CJ7A 2P9KB 3VETA 4HUGA 4G7ZA 4B1ZA 4YOVA 1XXAA 4DSLA 2F4VK 1S6QA 4JKEA 3CQYA 2NVYA 3SV3A 2A1RA 4CE9A 2D0CA 2VWKA 1T7PA 2A6AA 2HMIA 1EETA 4JKFA 1N6QA 4N56A 4CJRA 3TSQA 3HPHA 3U6FA 1XMOK 3OW2M 3HOVC 3LP3A 1NOYA 5E26A 2JA7A 3J8AA 1NGCA 2E2OA 1BI4B 1NGFA 2HMPA 4CZIA 1VQ5N 1KQ4A 3V4IA 3VEZA 4C45A 5IP9K 3ZLJA 3K7AC 5FPMA 3A5LC 3KLFA 3VEYA 3PX0A 2KZZA 3DXJA 1Z05A 2PA8L 4CJEA 5FPNA 4EIAA 2IVNA 2CFAB 3TAFA 1ZBLA 1S22A 2G8KA 4CGDA 1QQCA 1UA0A 3H0GA 1VQ6N 3OYNA 3HP9A 4AH9A 3VQCA 3MCAB 4M42A 4Z4GA 4Z0UA 4FLTA 4JI2K 4EHUA 3D0PA 1QS4A 4CGJA 2ZD1A 4CZEA 3GTKK 1XWLA 1WB9A 1KD1O 4G7OA 3PY8A 4AILC 4BVOA 1YHQN 1YJ9N 4C8KA 5L46A 2R7ZA 2WTUA 1GLJO 2JA6K 5J2PA 1YTUA 4E1JA 3IG1A 1O2BA 3TFIA 3TAGA 4DQSA 1VGXA 1U04A 1Y97A 3U9DA 3KLEA 3J80O 1DGKN 3SAHA 4XCHA 1PJ5A 1VLOA 5KQDA 3MEGA 1JCGA 2P9IA 2E2HK 4KKOA 1YCLA 4DU4A 4AH6A 3CQZC 4GV3A 1I3QK 4AHUA 3N0CA 1T6CA 2YKMA 3PSIA 4CEFA 5D3GA 1BJTA 1MWKA 3GTOA 3IAYA 1N34K 2RN2A 5AQNA 3K5LA 4WJ3M 1RU0A 3FKIA 3DRPA 3NHGA 1ZC6A 3J7AP 4Y7NK 4Y1DA 4M7XA 3OS0A 3CCSN 4B9SA 4B1XB 3GTQA 4B3SK 4P5BA 4K25A 4OGCA 5BREA 3NFAA 2Y0SL 3KWIA 4EZ9A 3IUCA 3DRSA 1NNEA 3F5TA 5C4XK 4JS5A 4H5NA 4ILJA 3BZKA 4DG1A 4MO4A 4PWDA 3DM2A 5KPTA 4DB3A 4DHYA 4KFBA 4CJVA 4OIQA 1GLEG 1HYVA 3KLIA 4DU3A 2CH5A 1ZBHA 2D6FC 1I39A 3TANA 4O8UA 5JMVA 3S1MK 2HHWA 4KASA 4IBNA 4A57A 4M45A 5EX5A 2AA4A 3A5MC 1W9HA 4XLPA 5AQJA 3EY1A 1RILA 5CHIA 3M8SA 5JLHA 5GIOA 2GEMA 4CJ4A 2RKIA 4BDZA 3M8QA 4A3LK 2VG5A 4CJQA 4DUYK 4H5WA 1F7VA 1L5UA 1Y1WC 1AB4A 4A3GC 1YX2A 1TK0A 1XZQB 4CJ5A 4IFEA 4DQRA 1VQON 4XH1A 4CD3A 3N4PA 1K8KA 3THVA 4I6MB 3HOZC 3C6HA 3ID8A 1VQLN 3HVRA 2KQ2A 4DFMA 5C44C 1NBWA 4DU1A 1ATNA 4IOXA 3Q3QA 5BRFA 1L3UA 1NGJA 4O55A 5AQKA 5LJVA 3U3YA 4E7JA 4FPBA 3C7NA 3OYKA 4Q0BA 5M1KA 5J1EA 3PO2K 3I56N 2E88A 5HRRA 4H8KA 2UUAK 2GWJA 1Q7YO 3O3FA 4X66K 4CJUA 1YT3A 3R8EA 3TI0A 4X6AC 4GZYA 3GIRA 2ZJQL 4KTQA 1BIZA 5AQGA 3NGYA 4QCLA 4IOAL 1Y64A 1U49A 4C23A 4I9QA 1J6VA 4FJ8A 3DI6A 5AQXA 4B3TK 1YAGA 5AQLA 3SAGA 2VUMC 3I0SA 1FKPA 2DFEA 3L2UA 4H0TB 4DQPA 3HOXC 1O13A 4FWOA 3QIOA 2QWQA 1X3NA 3ZSYA 4Q5VA 4YHHK 1RDUA 3CJ7A 4B9UA 3CXCM 1JLQA 1NJXA 1CXUA 2JA5A 5E68A 1TKXA 3M8PA 1WAJA 4PL8A 2RGRA 1NMNA 1HX1A 1QQOA 3GTGC 2VG6A 3QEPA 3G4SN 1HNWK 4IWVA 2G8FA 1NJYA 2YHAA 1HQMA 4ISGA 1RBRA 4BKWA 4KI6A 2R92A 1XQSC 3VQ8A 1WORA 4H0YB 5KRTA 3ATUA 1KCFA 1JQWA 4DTRA 4JKAA 3VEWA 5CZ2A 3OYGA 3L3VA 1D4XA 3SQ1A 1C0FA 2E2NA 1WCMK 2EBBA 5C3EC 4MEYA 3HPOA 3QEXA 4BLBA 3S16C 1NG9A 1V4TA 3FFIA 1TYQB 3CC2N 4H5RA 5AQZA 3E9LA 3ZSQA 4DV7K 1XXCA 2E20A 2FLOA 3GBTA 3BUZB 1TWFA 4BY7C 2GV9A 1HKCA 1J6XA 4ELVA 4RW9A 4E3SA 4A3EK 3NF8A 1TWGC 4MEXA 1U6ZA 4KHWA 3W3DA 4NYNA 3AO4A 1Q9XA 5FRMA 4DR6K 3CFRA 1TGOA 3PO5A 3G4CA 1GLBG 3QBWA 1LWFA 3ADAC 2GELA 1HYZA 2P9LB 4E0DA 2GSNA 3RMBA 4QIWD 4CHNA 4A5AA 4O4GA 5IOQA 3LDSA 3O9RA 4Y52C 3H1QA 3TU5A 4CGIA 2E2HA 3DMJA 4I2QA 3HSCA 4YY3K 1FKOA 3CCEN 1INNA 2WAQL 2NRXA 4FO0A 1X9WA 1QZ6A 3OYJA 2Q0UA 1GLCG 3QB0A 3D7EO 1JLBA 4JI4K 1HPMA 4HUFA 4W5RA 3MCPA 3S2DC 4I2PA 3MX5A 1KRPA 1ZYQA 5TJ3A 2ZQBA 3HOWK 4H03B 2FSKA 2Z1GA 4CEBA 5AZJB 4GT9A 5BN9A 5KGWA 4F9OA 5IWAK 2O8EA 2HF4A 1C0TA 3AV9A 3VMFB 1J6ZA 4BC4A 1S72N 2E5LK 4K0KK 2HHVA 4H0PA 4M3ZA 4OLAA 4C1NK 1SMYA 3LAPA 1USOA 1EQRA 3VQ9A 2O8CA 3S41A 4WCEL 3CD6N 3S1RC 4NXNK 1V5VA 1YTAA 1D8YA 3THWB 3T02A 2VG7A 1NKBA 4GTFA 1VHXA 2O8DB 3DLEA 1O29A 3GTPC 3WEEA 4GY2B 4EAHD 3OS2A 4E89A 1XHXA 1UOCA 4C1NI 3L4JA 3HI0A 1YUWA 4LJZA 1I94K 1RNHA 4FM1A 4FJ5A 1SKSA 2PMZD 3HYFA 3BGRA 2EHGA 5K14A 4ZTFA 2VGMA 4DSIA 2P5MA 4FWRA 1IJJA 5C15A 3ZT1A 1WOOA 1CZ9A 1EQYA 4A61A 2JH3A 4CVNE 3QEIA 4FLXA 1LOTB 3ULEB 5C12A 1Z26A 5JVGL 4YFUA 3HOYC 3MEDA 2Q3SA 2ITMA 4GFQA 3V9ZA 2NRRA 3H6EA 3K9JA 4EP5A 4JKGA 1DD5A 3PX6A 5AQSA 4DS4A 2J4RA 3SPYA 3DLBA 3R6MA 4MQ3A 1RDWX 3KK1A 3GSIA 4N47A 3MX2A 4Z4FA 2IDOA 1I50A 3SAFA 3VESA 3MN9A 4M7YA 2QWRA 2PYLA 3CQ8A 1YJNN 2F8TA 4ZH4A 1RFQA 4RW8A 5JVOA 5BPLA 3PIPL 4JYAK 3O4NA 4JK8A 4DV4K 1K73O 5KPRA 4CJFA 2I5JA 5GAGP 2NVXA 3ZETA 2CGJA 1GOCA 3HJFA 4LR2A 1HNVA 2V6TA 4I7FA 4WQ4C 4O2DA 1S9GA 4FJXA 4KAZA 1DTQA 4B9QA 1NGEA 2E2IK 2P51A 3FZFA 3ENHA 3HOSA 2NVTK 4Z4CA 3VQQA 4NOIA 1K6YA 1SFOA 1XZPA 3FR0A 1IKYA 3CI5A 5T7BA 1BUPA 4BY1K 4J2AA 4FWMA 1IBKK 5EY4A 3QO9A 3CPWM 1TUYA 4BR4A 1DCHA 3A8JA 3S15K 4QS7A 3GTMK 3ZT3A 5HP1A 2UUCK 3VQPA 1O27A 2BGGA 1YNJA 1BL3A 4FPAA 2Q31A 1VSKA 4DUZK 4DR4K 4FXDA 4KMDA 3HT3A 1NWKA 2BH1A 4CGGA 1YJWN 2NVYK 4FJ7A 1QZ5A 4AF1A 2QM1A 2W42A 2G8WA 2UYTA 1NJZA 3RSEA 4FWPA 5EOYA 1EI6A 2OTLN 5IYDK 2JA7K 2IS3A 4A3FK 3CJ1A 3BDPA 4A5BA 4JLHA 3U9ZA 4DR2K 3LANA 3SPZA 3NUHA 3K57A 4C8MA
chains in the Genus database with same CATH topology
3SBTA 5E84A 2W40A 4YDUC 1VQNN 3L4IA 3I55N 1WIHA 1WQHA 4FSVA 4XH5A 2P9PB 2E2IA 1U2VA 3VOVA 3L4QA 4IEIA 1MA9B 2V51B 4KB4A 1Q86O 3WQTA 1Y1WA 3R1XA 1K83A 2VYPA 5AR0A 3CCUN 3GTMA 3VEOA 2I7PA 3TSPA 2P9KB 1BOTO 2NRHA 3JXUA 2E2PA 3VETA 4CJ7A 3A5NC 3H3NO 3FLCO 2I7NA 4L3QA 5AQHA 3WEEB 4B1ZA 4YOVA 1XXAA 3A0IX 1ISEA 2QWOA 5AQRA 4JKEA 3H46O 3CQYA 5JLFA 2NVYA 4KH6A 3CJAA 2H3GX 2A6AA 4BR9A 3OEPA 4C3JC 4JKFA 3O80A 3LDPA 4JKBA 3E9PA 4JKGB 4NLCA 1GLLO 5HOOA 2YX6A 4H0OA 3TSQA 4GTEA 4GTBA 5AQTA 1YVNA 5BRHA 5DM7L 3OW2M 1K9MO 5IOSA 3DXKA 3FOFA 1NGAA 2JA7A 5E26A 3J8AA 3WQUA 1NGCA 4KH5A 2E2OA 3ZYYX 4BC2A 3G6EN 1NGFA 2A42A 1ATRA 5CHPA 5KPZA 2HMPA 2NZTA 3VTIA 4CZIA 1VQ5N 4DDQA 1KQ4A 3LDOA 4JKHA 5F2RA 3VEZA 4B1WB 4KB2A 4FWNA 4JKDA 4KM8A 5FPMA 3A5LC 2E8AA 2HBLA 3IMXA 3VEYA 4BRQA 3EE8A 3NVMA 4I6MA 1Z05A 2HBKA 2VUMA 3CAGA 3FE1A 5FPNA 3H3OB 4EIAA 2IVNA 2CFAB 1S22A 4CZFA 1G99A 3ZETB 4G0UA 3TTCA 1HKBA 3H0GA 1VQ6N 5DM6L 4QS9A 5TKYA 2WC9A 3MCAB 4Y0WA 3NVKA 4GV6A 1WQFA 4EHUA 4JAXA 4CZEA 4IJNA 3EZWA 1KD1O 5AQIA 5GINA 3CERA 5AQWA 4FVUA 5AQMA 4BVOA 1YHQN 3KVGA 1YJ9N 4WFAL 3HZ6A 2IVPA 2R7ZA 3KHYA 3GTGA 3EN9A 1GLJO 3CC4N 2YHYA 1H1VA 5ELZA 3WUHA 4E1JA 1O2BA 4CZHA 3AARA 4CZLA 3C0BA 5ADXA 3U4LA 4B1VA 2A5XA 4MLEA 3O9QA 4BRFA 4YOXA 3O1BA 2Q0RA 3QFPA 2QWNA 1OVYA 2Q1NA 3U9DA 3O4WA 4BROA 3FZHA 1JCEA 2P9NA 2QWPA 1DGKN 3SAHA 1YIJN 3MN6A 3OPFA 3BP8A 5KQDA 3L6QA 4CZKA 1JCGA 2D4WA 2P9IA 3HM8A 3RSEB 5BPMA 3AQPA 2XCOA 1NLVA 3O8MA 2HSTA 2P9UB 4GV3A 4JN4A 4LC9B 3N0CA 1T6CA 1BJTA 3GTOA 2ZJPL 1MWKA 2D1KA 2RHKA 2FSNA 4H0VB 3G25A 5AQNA 3FKIA 5CR4A 1ZC6A 2WBNA 3GOIA 5GAHP 4M7XA 4A59A 3GTKA 1T3VA 4MLHA 3UKRA 3CCSN 1YI2N 4B1XB 3GTQA 1U2VB 4BG8A 1TWGA 4P5BA 4BREA 4K25A 5BREA 3S0XA 4JD2A 2IIRA 4BRKA 3R9PA 3KWIA 4EFHA 3U8XA 4BRMA 3IUCA 2JA6A 2VWBA 3ENBA 1BO5O 3F5TA 3GE1A 3VPZA 4KMHA 4FZBA 4GTCA 4H5NA 4ILJA 4YOTA 4BRNA 4MO4A 3D2EA 4NB4A 5F1XA 5KPTA 4DB3A 3CMEN 4J3NA 3AGKA 1SZ2A 4MDBA 3AGRA 4DHYA 4BRCA 5CE3A 4XH4A 3QMLA 2Y3PA 4GTAA 1TWCA 4IJAA 3WT0A 1GLEG 3GTJA 1DEJA 1HLUA 3LDNA 1NGIA 2A40A 2Q2RA 4JK7A 2VGNA 4C3HC 2CH5A 3AQOA 4BR7A 4P5AA 3FZKA 4O8UA 2WFBA 5AQYA 5JMVA 3HRGA 1WQGA 1NGGA 4BGAA 1SQKA 4KASA 3ZEUA 1TYQA 2ASMA 2AA4A 2PBDA 2ZWHA 3A5MC 5EX5A 3WXJA 4A57A 3MMVA 5ADXH 1VQ4N 4G0WA 3IKMA 5AQJA 3VEVA 1XC3A 4PKIA 5CHIA 3DXKB 1JJ2M 1HKGA 3VA7A 5JLHA 5GIOA 4KM9A 2HF3A 1I3QA 2GWKA 1NGBA 2GEMA 1O26A 4JK9A 3WXIA 4JHDA 4BRHA 2D0OA 5I9EB 3EO3A 2ZFZA 3F9MA 4FOIA 1O25A 2F9WA 2F9TA 2ZGYA 4H5WA 2GSUA 3WXKA 4BRGA 1AB4A 2QTDA 2GTDA 5EGEA 4IO9L 4IFEA 3MN5A 3F2KA 1VQON 3KZBA 4XH1A 1OKJA 4CD3A 2F7TA 3N4PA 3BF1A 5MLCQ 1R59O 1K8KA 1BG3A 4I6MB 3C6HA 3ID8A 1VQLN 4RWTA 3AY9A 2P9LA 1NBWA 1DKGD 4FWLA 1ATNA 4BRAA 4H0XB 4OO1J 4PHTX 4IOXA 5LY3A 4U67L 3Q3QA 3PIOL 5BRFA 1M1KO 1NGJA 3KK7A 3D2FA 4U7BA 5AQKA 5LJVA 2PAVA 1C0GA 4BRIA 4FPBA 3C7NA 3O5BA 3ZX3A 2EWSA 3SMSA 4ILGB 2FF3B 3VGLA 3DWLA 5M1KA 2ZJRL 1IS1A 2RE2A 3LAJA 2HBMA 3GDQA 3I56N 3MMLB 2E88A 5C10A 3TPQA 2GWJA 5M1QA 3GTPA 3VF6A 1Q7YO 4KAWX 3QDKA 3R8EA 3HOTA 1MWMA 3IFRA 3LDLA 2ZJQL 2KKZA 5AQGA 3UB5A 4IOAL 1Y64A 4GV9A 1O2AA 5AZJA 4C23A 1BA0A 1GLDG 5AQXA 1Q81O 3J7ZO 5IOTA 1YAGA 2KLAA 5AQLA 1M90O 3SAGA 3CIPA 2GSOA 1VQ9N 2VCPA 5C0YA 5M1FA 2QI2A 4H0TB 2E2QA 2P9NB 2P9SA 3A8YA 3VGKA 4A2AA 4CBWA 5KQ8A 1O13A 4FWOA 4JEPA 5LJWA 3O9TA 4H5VA 5FPDA 2P9IB 5CJ9A 2QWQA 1X3NA 3GL1A 4GTDA 1RDUA 3CJ7A 4IEEA 3CXCM 3OREA 1QQNA 3K9KA 5H1SQ 4IOCL 3VGMA 3MWPA 2JA5A 3CCMN 2E1ZA 5EVZA 4BC5A 3ZX2A 1X3MA 3IDHA 4PL8A 2RGRA 2ASPA 1HX1A 1N8RO 1QQOA 3HTVA 3AAQA 3T69A 3P38A 1NGDA 2NNWA 3UKRB 4DCHA 3OBWA 3LM9A 4PL7A 3VENA 3G4SN 2D0PA 1VQPN 4IWVA 2CH6A 4LQYA 4YORA 5JVHL 1T6DA 4JD2B 2OANA 5GAEP 4ISGA 2XCQA 5JFEA 4BKWA 1SS6A 2ZGZA 4G0VA 2R92A 1XQSC 1BGWA 3LL3A 1EK8A 4H0YB 5FPEA 3ATUA 3D2EB 1GE9A 1HUXA 4AM7A 4JKAA 3VEWA 5JICA 3CCQN 3CCRN 5F0XA 3BEXA 3M3ZA 5AQQA 1SAZA 3SK3A 1D4XA 3UKUA 3CJCA 1C0FA 1YF5L 2E2NA 1ATSA 3G4AA 4BVPA 1K8AO 3ULEA 1O24A 4BLBA 1LCUA 1V4TA 2YJEA 3ZEUB 1TYQB 4M1XA 3CC2N 3I8BA 4WQ4A 4H5RA 5AQZA 3E9LA 3R3LA 4QS8A 5AZIA 1XXCA 2E20A 1DT9A 2FLOA 1W2BM 3N4QA 3GBTA 3BUZB 1TWFA 3CHWA 2YCHA 5EGHA 1HKCA 4JHDB 4ILDA 1KXPA 3VERA 3O9UA 5AFUA 4FWQA 4WFNL 3ID6A 3B8AX 4WYBA 2NRVA 5BPNA 1U6ZA 5C2FA 3W3DA 1WUAA 1QVGM 1TWAA 4CD1A 1KAZA 4H5TA 4CZGA 4KATA 4BGBA 4OPHA 3C6AA 3G4CA 3CQXA 1GLBG 2ZF5O 1K8KB 3QBWA 5C2DA 2GELA 1VAZA 3V4GA 2AP1A 4KMAA 2P9LB 3WXLA 2GSNA 3CCVN 4A5AA 3CF5L 5AQOA 5IOQA 1ZBSA 2Q36A 3O9RA 4WQ5A 3D2FB 3H1QA 4J8FA 3TU5A 4BQZA 1KC8O 2E2HA 2YHXA 3DXMA 3M1FA 3HSCA 4K42A 5M1PA 3C7NB 3CCEN 1NGHA 1WCMA 2NRXA 1W97L 2Q97A 2ASOA 2JWLA 1O28A 1QHAA 4FO0A 3G71N 4UY8O 4BG9A 1QZ6A 4YOYA 4MO5A 2Q0UA 1GLCG 3QB0A 3D7EO 1VQKN 1HPMA 1IG8A 3MCPA 1VQ7N 4YDUA 3N0BA 4AM6A 1BA1A 4BC3A 4CZMA 3MX5A 5AQPA 2XCRB 3L4KA 1GLFO 5TJ3A 4NO7A 3FOEA 3FGUA 4H03B 2FSKA 5AZJB 1EH1A 4GT9A 5BN9A 4PKHA 4F9OA 2PHCB 3MWTA 1V4SA 2NLXA 2HF4A 3VMFB 1J6ZA 4BC4A 1S72N 1Z6RA 5EXWA 5GIPA 3QBXA 3CMAN 4H0PA 4K43A 2HOEA 4C1NK 4OPAA 4GTLA 1F9NA 1EO1A 3LAPA 3AAPA 2P9SB 3S41A 4WCEL 3CD6N 1VQMN 1B4AA 2KHOA 5AFUH 1E4GT 5M1NA 3FZLA 1GLAG 3VF2A 5GADP 3GG4A 4BY9C 4GTFA 3Q7CA 4FOEA 1HJOA 2QA4N 1NM1A 4GVEA 1ZXOA 3E9OA 4FL9A 1ESVA 3SBGA 4IDHA 4DQ8A 1O29A 3N3YA 3C65A 3A5OC 4PKGA 1KAYA 3I33A 4GNIA 4GY2B 3P4IA 5TKWA 3T7ZA 3WEEA 1X9JA 4EAHD 2QW9A 4C1NI 3QX3A 3L4JA 4HWIA 1S3XA 3HI0A 3O1WA 1YUWA 2P9PA 3ERED 3M6GA 3SMPA 3FFKB 2V7YA 5BRDA 1JCFA 2DPNA 2YHWA 4BR0A 5IORA 2FF6A 4ILHA 4FWKA 2IVOA 4CBUA 3LM2A 3DLLL 2VGMA 2P9KA 2JWKA 1KAXA 2P5MA 4FWRA 1IJJA 4HTLA 3O08A 5C15A 1EQYA 3UKUB 3BF3A 4A61A 2NRZA 2JH3A 3FHZA 3CPEA 1LOTB 3ULEB 5C12A 5JVGL 2NRWA 2QEXN 4IXCA 3SJHA 2ITMA 1TWHA 4GFQA 1ILYA 3ATVA 2BUPA 1CZAN 2CGKA 2NRRA 3CJBA 3EKUA 3H6EA 3K9JA 3MK6A 4JKGA 4R79A 1P90A 5AQSA 5AZIB 3E1YA 1DD5A 2J4RA 3QICA 3R6MA 1RDWX 4O5FA 2B63A 4B1UB 4BR2A 3MX2A 1I50A 3SAFA 1XXBA 3VESA 4DKWA 4C2MC 4MDAA 4WFBL 2HBJA 2FSJA 1NJIO 3MN9A 4IO8A 2QWRA 4M7YA 3LPXA 2YU9A 1YJNN 4WF9L 4CBXA 3E66A 4FM9A 3ZX0A 4ISEA 1B4BA 4Z94A 2FXUA 1RFQA 1ZVUA 4ISFA 5JVOA 2OTJN 5BPLA 3CETA 3WXMB 3PIPL 4B1YB 2GX9A 3MDQA 3QFUA 4JK8A 4CZJA 3VF4A 1K73O 4EHTA 4RTFD 5KPRA 3H45C 2RH6A 4YOUA 1BU6O 3H1VX 3TTFA 3PLAA 2CFAA 1VQ8N 4BQLA 5GAGP 2A3ZA 3OA9A 2NVXA 3ZETA 2CGJA 4NLBA 4BR5A 2QWLA 2QWMA 3DXMB 2YI1A 4LR2A 3ENOA 1QVFM 1NMDA 4C3IC 1YXQA 4WQ4C 4M63C 4RCHA 4KC6A 3Q7BA 3NMUA 3CQZA 1BDGA 4B9QA 2NRTA 1NGEA 2CGLA 3UE5A 4O8KA 4KBOA 1XUPO 3FZFA 3ENHA 1E4FT 1P8ZA 2PFUA 3KWGA 4IZ9A 2BTFA 3FZMA 3HOSA 3CCJN 4BLAA 4JNEA 4CI6A 3FR0A 2KWAA 3CI5A 3SLCA 1BUPA 3AH5A 3OBYA 4FWMA 2R93A 4G9ZA 1MDUB 1QQMA 2YJFA 5EY4A 1TUYA 4BR4A 3CPWM 3CCLN 5AQVA 3TTDA 4QS7A 2V7ZA 1YITN 4YOWA 1TUUA 5AQUA 2E1YA 3M5RA 3LDQA 1O27A 3EKSA 4JKCA 2A41A 3OHRA 4FPAA 2Q31A 3MN7A 4BRPA 2QXLA 1Q18A 4KARA 4KMDA 1RGIA 3VEXA 1NWKA 3RVCA 4A2BA 2BH1A 5HL7L 1YJWN 3CC7N 3D6RA 1QZ5A 3P39A 2V52B 3EL2A 4XEIA 3DJCA 4FWSA 4K41A 4AF1A 4WQ5C 3VTHA 2QM1A 1WOQA 3O6WA 3CJ9A 5B8HA 4BRDA 4KH4A 3L0QA 2UYTA 3W0LA 5BN8A 2GUPA 5AQFA 4KDDA 3JS6A 3RSEA 3P31A 2WUSA 4FWPA 5EOYA 5M1OA 1KQSM 1Y1VA 2OTLN 1R9TA 1SFOA 3O9SA 4BRLA 2P9UA 3HBTA 4A62A 1Q82O 3CJ1A 4A5BA 3DAWA 3U9ZA 3BUEA 3TSUA 3NUHA 5BR9A 2W41A 1BWFO 3GTLA 3EE9A 1T44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E84 A;  2W40 A;  4YDU C;  3L4I A;  4FSV A;  4XH5 A;  2P9P B;  1U2V A;  3VOV A;  1MA9 B;  2V51 B;  3WQT A;  2VYP A;  5AR0 A;  3VEO A;  2I7P A;  4CJ7 A;  2P9K B;  1BOT O;  2NRH A;  3JXU A;  2E2P A;  3VET A;  3A5N C;  3H3N O;  3FLC O;  2I7N A;  4L3Q A;  5AQH A;  3WEE B;  4B1Z A;  3A0I X;  2QWO A;  5AQR A;  3H46 O;  3CQY A;  5JLF A;  3CJA A;  2H3G X;  2A6A A;  4BR9 A;  3O80 A;  3LDP A;  1GLL O;  4H0O A;  5AQT A;  1YVN A;  5BRH A;  3DXK A;  1NGA A;  5E26 A;  3J8A A;  3WQU A;  1NGC A;  2E2O A;  4BC2 A;  1NGF A;  2A42 A;  1ATR A;  5KPZ A;  2HMP A;  2NZT A;  4CZI A;  3LDO A;  5F2R A;  3VEZ A;  4B1W B;  4FWN A;  5FPM A;  3A5L C;  2E8A A;  3IMX A;  3VEY A;  4BRQ A;  4I6M A;  1Z05 A;  3FE1 A;  5FPN A;  3H3O B;  4EIA A;  2IVN A;  1S22 A;  4CZF A;  1G99 A;  3ZET B;  1HKB A;  4QS9 A;  5TKY A;  4Y0W A;  4EHU A;  4JAX A;  4CZE A;  4IJN A;  3EZW A;  5AQI A;  3CER A;  5AQW A;  5AQM A;  4BVO A;  3KVG A;  3HZ6 A;  2IVP A;  3KHY A;  3EN9 A;  1GLJ O;  2YHY A;  1H1V A;  5ELZ A;  3WUH A;  4E1J A;  4CZH A;  3AAR A;  4CZL A;  3C0B A;  5ADX A;  3U4L A;  4B1V A;  2A5X A;  4MLE A;  4BRF A;  3O1B A;  2Q0R A;  3QFP A;  2QWN A;  2Q1N A;  3U9D A;  3O4W A;  4BRO A;  3FZH A;  1JCE A;  2P9N A;  2QWP A;  1DGK N;  3MN6 A;  3BP8 A;  5KQD A;  3L6Q A;  4CZK A;  1JCG A;  2D4W A;  2P9I A;  3HM8 A;  3RSE B;  5BPM A;  1NLV A;  3O8M A;  2P9U B;  4JN4 A;  4LC9 B;  1T6C A;  1MWK A;  2D1K A;  2FSN A;  4H0V B;  3G25 A;  5AQN A;  1ZC6 A;  3GOI A;  4M7X A;  3UKR A;  4MLH A;  4B1X B;  1U2V B;  4BG8 A;  4BRE A;  4K25 A;  5BRE A;  4JD2 A;  2IIR A;  4BRK A;  3R9P A;  4EFH A;  3U8X A;  4BRM A;  3IUC A;  2VWB A;  3GE1 A;  1BO5 O;  3VPZ A;  4H5N A;  4BRN A;  4MO4 A;  3D2E A;  4NB4 A;  5F1X A;  5KPT A;  4DB3 A;  5CE3 A;  1SZ2 A;  4DHY A;  4BRC A;  4XH4 A;  3QML A;  4IJA A;  3WT0 A;  1GLE G;  1DEJ A;  1HLU A;  3LDN A;  1NGI A;  2A40 A;  2Q2R A;  2CH5 A;  4BR7 A;  3FZK A;  5AQY A;  5JMV A;  1NGG A;  4BGA A;  1SQK A;  3ZEU A;  1TYQ A;  2ASM A;  2AA4 A;  2PBD A;  2ZWH A;  3A5M C;  5EX5 A;  3WXJ A;  5ADX H;  3MMV A;  5AQJ A;  3VEV A;  1XC3 A;  4PKI A;  3DXK B;  1HKG A;  5JLH A;  2HF3 A;  2GWK A;  1NGB A;  2GEM A;  3WXI A;  4JHD A;  4BRH A;  2D0O A;  5I9E B;  3EO3 A;  3F9M A;  4FOI A;  2F9W A;  2F9T A;  2ZGY A;  4H5W A;  3WXK A;  4BRG A;  2GTD A;  3MN5 A;  3KZB A;  4XH1 A;  1OKJ A;  4CD3 A;  3BF1 A;  1R59 O;  1K8K A;  1BG3 A;  4I6M B;  3ID8 A;  4RWT A;  3AY9 A;  2P9L A;  1NBW A;  1DKG D;  4FWL A;  1ATN A;  4BRA A;  4H0X B;  5LY3 A;  5BRF A;  1NGJ A;  3D2F A;  5AQK A;  5LJV A;  2PAV A;  1C0G A;  4BRI A;  4FPB A;  3C7N A;  3O5B A;  3ZX3 A;  2EWS A;  3SMS A;  3VGL A;  2FF3 B;  3DWL A;  3GDQ A;  2E88 A;  3TPQ A;  2GWJ A;  3VF6 A;  3QDK A;  3R8E A;  1MWM A;  3IFR A;  3LDL A;  5AQG A;  3UB5 A;  1Y64 A;  5AZJ A;  4C23 A;  1BA0 A;  1GLD G;  5AQX A;  1YAG A;  5AQL A;  3CIP A;  2VCP A;  4H0T B;  2E2Q A;  2P9N B;  2P9S A;  3A8Y A;  3VGK A;  4A2A A;  4CBW A;  5KQ8 A;  4FWO A;  5LJW A;  4H5V A;  5FPD A;  2P9I B;  2QWQ A;  1X3N A;  3GL1 A;  3CJ7 A;  1QQN A;  3VGM A;  2E1Z A;  5EVZ A;  4BC5 A;  3ZX2 A;  1X3M A;  3IDH A;  4PL8 A;  2ASP A;  1HX1 A;  1QQO A;  3HTV A;  3AAQ A;  1NGD A;  3UKR B;  4DCH A;  3LM9 A;  4PL7 A;  3VEN A;  2D0P A;  4IWV A;  2CH6 A;  1T6D A;  4JD2 B;  2OAN A;  4ISG A;  2ZGZ A;  1XQS C;  3LL3 A;  4H0Y B;  5FPE A;  3ATU A;  3D2E B;  1HUX A;  4AM7 A;  3VEW A;  5JIC A;  5F0X A;  3BEX A;  3M3Z A;  5AQQ A;  1SAZ A;  3SK3 A;  1D4X A;  3UKU A;  3CJC A;  1C0F A;  2E2N A;  1ATS A;  4BVP A;  3ULE A;  1LCU A;  1V4T A;  2YJE A;  3ZEU B;  1TYQ B;  3I8B A;  4WQ4 A;  4H5R A;  5AQZ A;  4QS8 A;  5AZI A;  2E20 A;  2FLO A;  3GBT A;  3BUZ B;  3CHW A;  2YCH A;  1HKC A;  4JHD B;  1KXP A;  3VER A;  5AFU A;  4FWQ A;  3B8A X;  4WYB A;  5BPN A;  1U6Z A;  3W3D A;  1WUA A;  4CD1 A;  1KAZ A;  4H5T A;  4CZG A;  4BGB A;  3CQX A;  1GLB G;  2ZF5 O;  1K8K B;  3QBW A;  2GEL A;  2AP1 A;  2P9L B;  3WXL A;  5AQO A;  1ZBS A;  2Q36 A;  4WQ5 A;  3D2F B;  3H1Q A;  4J8F A;  3TU5 A;  4BQZ A;  2YHX A;  3DXM A;  3M1F A;  3HSC A;  4K42 A;  3C7N B;  1NGH A;  2Q97 A;  2ASO A;  1QHA A;  4FO0 A;  4BG9 A;  1QZ6 A;  4MO5 A;  2Q0U A;  1GLC G;  3QB0 A;  3D7E O;  1HPM A;  1IG8 A;  3MCP A;  4YDU A;  4AM6 A;  1BA1 A;  4BC3 A;  4CZM A;  5AQP A;  1GLF O;  4NO7 A;  3FGU A;  4H03 B;  2FSK A;  5AZJ B;  5BN9 A;  4PKH A;  4F9O A;  1V4S A;  2NLX A;  2HF4 A;  1J6Z A;  4BC4 A;  1Z6R A;  5EXW A;  3QBX A;  4H0P A;  4K43 A;  2HOE A;  3AAP A;  2P9S B;  3S41 A;  2KHO A;  5AFU H;  1E4G T;  3FZL A;  1GLA G;  3VF2 A;  3GG4 A;  4FOE A;  1HJO A;  1NM1 A;  1ZXO A;  4FL9 A;  1ESV A;  4DQ8 A;  3A5O C;  4PKG A;  1KAY A;  3I33 A;  4GNI A;  4GY2 B;  3P4I A;  3WEE A;  4EAH D;  1X9J A;  2QW9 A;  4HWI A;  1S3X A;  3HI0 A;  3O1W A;  1YUW A;  2P9P A;  3M6G A;  3SMP A;  3FFK B;  2V7Y A;  5BRD A;  1JCF A;  2DPN A;  2YHW A;  4BR0 A;  2FF6 A;  4FWK A;  2IVO A;  4CBU A;  3LM2 A;  2P9K A;  1KAX A;  4FWR A;  1IJJ A;  4HTL A;  3O08 A;  1EQY A;  3UKU B;  3BF3 A;  4A61 A;  1LOT B;  3ULE B;  4IXC A;  3SJH A;  2ITM A;  3ATV A;  2BUP A;  1CZA N;  2CGK A;  3CJB A;  3EKU A;  3H6E A;  3MK6 A;  5AQS A;  5AZI B;  2J4R A;  3QIC A;  3R6M A;  1RDW X;  4O5F A;  4B1U B;  4BR2 A;  3VES A;  2FSJ A;  3MN9 A;  4IO8 A;  2QWR A;  4M7Y A;  4CBX A;  3ZX0 A;  4ISE A;  4Z94 A;  2FXU A;  1RFQ A;  4ISF A;  5BPL A;  3CET A;  4B1Y B;  3MDQ A;  3QFU A;  4CZJ A;  3VF4 A;  4EHT A;  4RTF D;  5KPR A;  3H45 C;  1BU6 O;  3H1V X;  4BQL A;  2A3Z A;  3ZET A;  2CGJ A;  4BR5 A;  2QWL A;  2QWM A;  3DXM B;  2YI1 A;  3ENO A;  1NMD A;  1YXQ A;  4WQ4 C;  4M63 C;  4RCH A;  1BDG A;  4B9Q A;  1NGE A;  2CGL A;  3UE5 A;  4O8K A;  4KBO A;  1XUP O;  3FZF A;  3ENH A;  1E4F T;  1P8Z A;  4IZ9 A;  2BTF A;  3FZM A;  4JNE A;  4CI6 A;  3FR0 A;  3CI5 A;  3SLC A;  1BUP A;  4FWM A;  1MDU B;  1QQM A;  2YJF A;  5EY4 A;  1TUY A;  4BR4 A;  5AQV A;  4QS7 A;  2V7Z A;  1TUU A;  5AQU A;  2E1Y A;  3LDQ A;  3EKS A;  2A41 A;  3OHR A;  4FPA A;  2Q31 A;  3MN7 A;  4BRP A;  2QXL A;  1Q18 A;  1RGI A;  3VEX A;  1NWK A;  4A2B A;  1QZ5 A;  2V52 B;  3EL2 A;  4XEI A;  3DJC A;  4FWS A;  4K41 A;  4WQ5 C;  2QM1 A;  1WOQ A;  3O6W A;  3CJ9 A;  5B8H A;  4BRD A;  3L0Q A;  2UYT A;  3W0L A;  5BN8 A;  2GUP A;  5AQF A;  3JS6 A;  3RSE A;  2WUS A;  4FWP A;  5EOY A;  4BRL A;  2P9U A;  3HBT A;  4A62 A;  3CJ1 A;  3DAW A;  3U9Z A;  5BR9 A;  2W41 A;  1BWF O;  1T44 A; 
#chains in the Genus database with same CATH topology
 4HCB A;  2HW3 A;  3K2P A;  1WQH A;  2UU9 K;  2P9P B;  1C0A A;  3KLH A;  1MA9 B;  2V51 B;  3IPJ A;  3WQT A;  2VYP A;  3V9S A;  1WSF A;  3VEO A;  3HM9 A;  3TSP A;  4Z4E A;  1BOT O;  3JXU A;  4Y1C A;  2E2P A;  3B6P A;  3AVG A;  4GKK K;  4L3Q A;  3ZT4 A;  2Z1H A;  1WSH A;  3AVM A;  1K83 C;  1ISE A;  2QWO A;  5AQR A;  4P9S A;  5JLF A;  5FLM K;  1VSI A;  1RBU A;  2Y1I A;  3CJA A;  4FZY A;  2JA8 C;  2H3G X;  1I6H C;  2XY7 A;  3RR8 A;  4C3J C;  1JXE A;  2G8H A;  4FJM A;  4Z4I A;  1S1U A;  4NLC A;  5HOO A;  2YX6 A;  5AQT A;  1JOE A;  2OPP A;  5BRH A;  4C8L A;  2HND A;  3RMA A;  1K9M O;  2R7Z K;  1WSI A;  4DV5 K;  3FOF A;  1NGA A;  1S1T A;  2O8B B;  3SQ2 A;  1BGX T;  4KH5 A;  5IYC K;  3ZYY X;  4N76 A;  4I9L A;  4FJI A;  3S1Q K;  3VTI A;  4CGH A;  4E7K A;  5F2R A;  1TKT A;  1NK5 A;  4FWN A;  4MFB A;  2O8F A;  4KM8 A;  1IBM K;  1TK5 A;  3HP6 A;  3KTQ A;  3TTC A;  3GTO K;  5CZ1 A;  1G51 A;  2W6L A;  1TWH C;  5DM6 L;  3FKI K;  4O5B A;  3NVK A;  3H0G C;  2BE5 A;  1X9S A;  4JAX A;  1FK9 A;  1IH7 A;  3MEC A;  4IJN A;  3EZW A;  3K5O A;  3EEQ A;  5AQI A;  3GTQ K;  4N41 A;  4A93 K;  2BDP A;  3F9K A;  2YU9 C;  3KVG A;  4WFA L;  2IVP A;  4KN7 A;  4DFK A;  2UXB K;  3P83 D;  1JXB A;  3WUH A;  1J53 A;  4CZH A;  3AAR A;  5ADX A;  4PUO A;  4B1V A;  3OYI A;  1RTH A;  1GOB A;  3O1B A;  3QFP A;  4LSL A;  4F8R A;  2Q1N A;  3I4M K;  4LF8 K;  1JCE A;  4XIU A;  3RZO C;  2DTU A;  4CZK A;  4IFY A;  1HI9 A;  2QXF A;  1NK6 A;  3PUF A;  3THY A;  2HST A;  2DY4 A;  2P9U B;  2FBT A;  4JN4 A;  4CFB A;  2A6H A;  3HO1 A;  3JSM A;  2ZJP L;  4BBR C;  1VJE A;  3C6U A;  4H0V B;  3G25 A;  4F4K A;  5TMF A;  5CR4 A;  2R93 C;  3S3O A;  2DFF A;  3HOU C;  5I3U A;  2P8T A;  1U2V B;  3S0X A;  4JD2 A;  3R9P A;  3U8X A;  1BO5 O;  4KMH A;  4FZB A;  5HRS A;  1KTQ A;  1YVU A;  4YOT A;  1RDB A;  1KVC A;  5F1X A;  4DDQ A;  1W7A A;  3AGK A;  3QIP A;  5CE3 A;  3AGR A;  4BRC A;  4LF7 K;  3QML A;  4GTA A;  1DEJ A;  1PJ6 A;  4CK1 A;  2VGN A;  1JLA A;  3AQO A;  4CFA A;  3NF6 A;  3NH0 A;  3HRG A;  1WQG A;  1SQK A;  3L2W A;  3ZEU A;  2ZWH A;  1U48 A;  5ADX H;  3E01 A;  4G0W A;  4CW7 B;  3A2F A;  1QSY A;  3DXK B;  1HRH A;  1NJW A;  1NGB A;  4JK9 A;  4JHD A;  4DFP A;  1PJ7 A;  5I9E B;  2ZFZ A;  1TK8 A;  1DCO A;  4JI1 K;  1JLC A;  4ID1 A;  2F9W A;  3ZSW A;  3WXK A;  1OH6 A;  5EGE A;  3GTL C;  1RT5 A;  3AVJ A;  3F2K A;  3KK2 A;  1OKJ A;  5MLC Q;  3BF1 A;  4FWL A;  4BE2 A;  1SKW A;  4OO1 J;  4PHT X;  4BE0 A;  1BQM A;  3KK7 A;  1XC9 A;  3OTO K;  3SCX A;  2JA5 K;  3WNG A;  3VQ5 A;  3NF9 A;  3NGZ A;  3QES A;  4ILG B;  2FF3 B;  4A3B C;  3LAJ A;  3GDQ A;  3H3V L;  4E7I A;  1XPP A;  5C10 A;  4CEC A;  4C2M K;  1L3V A;  2B63 K;  3G10 A;  2YHB A;  2NVQ K;  4PAB A;  2KKZ A;  3V1Q A;  2R92 K;  1XNR K;  1C6V A;  3VQ7 A;  1O2A A;  3RZD C;  1JVI A;  1BA0 A;  1Q81 O;  3OYL A;  4KO0 A;  3F73 A;  4DV0 K;  1EFW A;  3AVL A;  1IL2 A;  5M3F K;  3CIP A;  2GSO A;  2VCP A;  5C0Y A;  2QI2 A;  2P9N B;  3A8Y A;  3ZSZ A;  5KQ8 A;  5LJW A;  4OGE A;  3S1N K;  4GTD A;  4LD0 A;  1TWF K;  1WSE A;  5H1S Q;  4CK2 A;  1QTM A;  3CCM N;  5EVZ A;  3IDH A;  4B08 A;  3O4Q A;  1N8R O;  3HTV A;  4KHP K;  4HTU A;  3T69 A;  2NNW A;  3UKR B;  3P5J A;  3OBW A;  3LM9 A;  3VEN A;  4KTZ A;  5HL8 A;  1RT7 A;  3CG7 A;  4DF4 A;  2XRI A;  1SS6 A;  3THX A;  2ETJ A;  3SZ2 A;  3LL3 A;  5HRN A;  1IV0 A;  5IP9 C;  3D2E B;  1GE9 A;  1HUX A;  5F0X A;  3M3Z A;  3SK3 A;  3BP8 C;  4PA1 A;  5D4D A;  1YF5 L;  3G4A A;  1K8A O;  4RW7 A;  1HQE A;  2HHT A;  1Y1V K;  2HNZ A;  3EYZ A;  1KLN A;  1R9T K;  4M1X A;  3I8B A;  3G0Z A;  5FDL A;  4DS5 A;  3R3L A;  1S6P A;  4M3T A;  4YFX A;  2V6U A;  5J2M A;  3CHW A;  4C8O A;  3GTK C;  5AJ3 K;  1LWE A;  3ID6 A;  3ZSV A;  5C2F A;  5HRP A;  3NH1 A;  3T00 A;  3CFP A;  3HL8 A;  3RMD A;  3AO5 A;  4CD1 A;  1TWA A;  2JA6 C;  1TVR A;  3C6A A;  1CXQ A;  3CQX A;  2ZF5 O;  5C2D A;  3VQD A;  1B9F A;  5M3M K;  2AP1 A;  4M3Y A;  3AVA A;  3WXL A;  3CCV N;  4FJN A;  4NCB A;  3CF5 L;  3K59 A;  2Q36 A;  3D2F B;  4NXM K;  1IQ0 A;  2A1S A;  2YHX A;  5M1P A;  2WB1 D;  2B6A A;  1QSS A;  2E2H C;  1W97 L;  2JWL A;  2QKB A;  1QHA A;  3JST A;  2IGI A;  3T19 A;  4YOY A;  5SZT A;  1JLG A;  1I3Q C;  1VQK N;  4KB0 A;  1IG8 A;  3SYZ A;  5TMC A;  4AM6 A;  4OIO A;  1S5J A;  2VQE K;  3DRR A;  1SL1 A;  4NO7 A;  4Y7N C;  3OYD A;  1ZBI A;  1V4S A;  1UWB A;  1CLQ A;  3VN5 A;  4NYF A;  1NKE A;  4K43 A;  2HVH A;  1VH2 A;  1J6W A;  3AA3 A;  5C4X C;  3MEE A;  4DLE A;  2P9S B;  3M4O K;  1UA1 A;  1VQM N;  1B4A A;  1EWR A;  1E4G T;  3ZSO A;  4CJL A;  3FZL A;  1GLA G;  5GAD P;  4DTP A;  1EXQ A;  1HJO A;  1I50 K;  4FL9 A;  3LAL A;  4FCY A;  3N3Y A;  3C65 A;  3A5O C;  4PKG A;  3SQ0 A;  5TKW A;  3S1M C;  3T7Z A;  2OZS A;  3HXA A;  4FVM A;  1VSH A;  2D0B A;  3MXM A;  4UQG A;  3ERE D;  3SMP A;  2ZUE A;  4WE1 A;  1X31 C;  5BRD A;  2DPN A;  4A3L C;  4CFD A;  4BR0 A;  4DTJ A;  4ILH A;  1O2F B;  3DLL L;  2P9K A;  2NVX K;  4NCA A;  3UKU B;  3CPE A;  1OVQ A;  1ILY A;  4DTU A;  3CJB A;  1CZA N;  4W5N A;  3MK6 A;  4R79 A;  1SFO K;  1P90 A;  5AZI B;  2RPI A;  2B63 A;  2CW0 A;  4BR2 A;  3PO2 C;  4KB1 A;  4DKW A;  4QJV B;  1BI4 A;  2P5G A;  1NJI O;  4CEO A;  2E6M A;  2FC0 A;  4CEE A;  1J9A A;  3ZX0 A;  3LWM A;  4ISE A;  1B4B A;  4EP4 A;  3PV8 A;  3I4N K;  3HKZ D;  1USM A;  1T05 A;  2GX9 A;  4FJG A;  1S1W A;  4CZJ A;  3VF4 A;  1S9E A;  4C3H K;  4KHU A;  3TTF A;  2CFA A;  1VQ8 N;  2A3Z A;  3OA9 A;  1TWC K;  3GTJ K;  3NGI A;  5FRO A;  1S1X A;  2QWL A;  2QWM A;  3DXM B;  3L2R A;  4DF8 A;  3TFJ A;  1QVF M;  1RT3 A;  4RCH A;  2PYJ A;  2FBY A;  3CQZ A;  1A5W A;  1EP4 A;  2CGL A;  4CJS A;  1KVB A;  4KBO A;  1ASW A;  1P8Z A;  2PFU A;  3CCJ N;  4AYB L;  2BTF A;  3FZM A;  4BLA A;  2O4I A;  4AHV A;  4E1M A;  3AH5 A;  4M3U A;  5C24 A;  1MDU B;  4DR1 K;  5IYB K;  3CCL N;  1YIT N;  2V7Z A;  2X78 A;  5AQU A;  1WNS A;  3J81 O;  2Z1I A;  4JKC A;  3MN7 A;  2BAN A;  3OS1 A;  1Q18 A;  4DWI A;  3T1Y K;  2E2J K;  3D6R A;  2XY5 A;  4JI7 K;  4XEI A;  4FWS A;  4K41 A;  4CES A;  3BP3 A;  4H4M A;  4WQ5 C;  4M3R A;  1WOQ A;  4M3W A;  4BRD A;  4CJ3 A;  4A3K K;  3L0Q A;  5AQF A;  1HJR A;  2WUS A;  1IKX A;  3P31 A;  1KQS M;  1WCM C;  1Y1V A;  1R9T A;  2WOM A;  1Q82 O;  3LP2 A;  3DAW A;  3TSU A;  2W41 A;  1BWF O;  3EE9 A;  1T44 A;  1RDD A;  5E84 A;  2W40 A;  4YDU C;  1VQN N;  3L4I A;  3I55 N;  4RW6 A;  2NUB A;  4JI8 K;  3OYC A;  3AA5 X;  2A6E A;  2JGU A;  3LAM A;  4E19 A;  4A3E C;  5LMU K;  1DTT A;  3TAP A;  1WSR A;  1Y1W A;  3R1X A;  3NF7 A;  3CCU N;  3FLC O;  5AQH A;  1EKE A;  5C25 A;  3A0I X;  4A3D K;  3I8D A;  2HHS A;  3H46 O;  4FK4 A;  4YFK A;  3SJJ A;  3S3N A;  1BDF A;  3VQB A;  4A3M K;  4GW6 A;  4KH6 A;  4BR9 A;  3OEP A;  3O80 A;  3LDP A;  2WON A;  1U47 A;  4KTW A;  1GLL O;  2OPR A;  4H0O A;  4IG0 A;  4GTB A;  1YVN A;  5IOS A;  3LPU A;  1VSF A;  4E1N A;  1T8E A;  3WQU A;  4BC2 A;  2A42 A;  3JAM O;  1ATR A;  5CHP A;  1KVA A;  2NZT A;  1VRT A;  3AD8 C;  4JKH A;  3HOW C;  4KB2 A;  4CER A;  1XZQ A;  3QET A;  3EZ5 A;  3OJS A;  3U3G A;  3EE8 A;  1BCO A;  4I6M A;  3ITH A;  2VUM A;  3CAG A;  3FE1 A;  3WNH A;  4BAC A;  1RT4 A;  4M3X A;  4CZF A;  1G99 A;  2PZS A;  1HKB A;  1JL2 A;  2LSN A;  4ELT A;  3S17 K;  2GBZ A;  5TKY A;  5IP7 K;  2P1J A;  3BY5 A;  4GV6 A;  1F21 A;  1FW6 A;  3THY B;  2FQO A;  1J98 A;  5AQM A;  1SL0 A;  1WSG A;  3KHY A;  3EN9 A;  1WN7 A;  3GTG A;  3CC4 N;  4CF8 A;  1X1P A;  1HMV A;  1H1V A;  3C0B A;  2A5X A;  1FXX A;  4MLE A;  5A2Q O;  4YOX A;  3AVN A;  2Q0R A;  1CZB A;  1L3T A;  4A3J K;  4B8A B;  3O4W A;  4BRO A;  3FZH A;  1J5E K;  3OPF A;  1YIJ N;  4CF0 A;  3L6Q A;  2D4W A;  3HM8 A;  4LF5 K;  3AQP A;  2HB5 A;  2XCO A;  3O8M A;  4DTM A;  5LL6 Z;  4FYD A;  4J2D A;  1YNN A;  4F2S A;  3S2H K;  4B3M K;  4DTN A;  3SUO A;  2G8V A;  2X74 A;  1J54 A;  1TWG A;  4BDY A;  4BRE A;  3MXI A;  2IIR A;  4BRK A;  4WIL A;  4J2E A;  4J2B A;  4BRM A;  3TR8 A;  3GE1 A;  4R5P A;  2DFH A;  5I42 A;  4A3C K;  3SZY A;  3PX4 A;  4GTC A;  4BRN A;  4J3N A;  4MDB A;  4LOW A;  4OPK A;  4W5Q A;  1TWC A;  3GTJ A;  3H3V D;  4EZ6 A;  2A40 A;  4JK7 A;  4BR7 A;  3OYM A;  3LZI A;  4FLY A;  3S14 K;  2WFB A;  5AQY A;  4OKJ A;  4B9N A;  2HNY A;  5IT9 O;  3G71 N;  1TYQ A;  2ASM A;  4DSJ A;  3WXJ A;  1VSD A;  1VQ4 N;  3IKM A;  4PKI A;  1HKG A;  2PA8 D;  2HF3 A;  2E2I C;  1Q8I A;  4X65 K;  4BRH A;  2D0O A;  4JI3 K;  3EO3 A;  2NVT C;  3I4N C;  4FW1 A;  3V1R A;  4BY1 C;  4FJK A;  2F9T A;  2ZGY A;  2GSU A;  3S15 C;  2FBV A;  2QTD A;  2GTD A;  2P5O A;  3GTM C;  4IO9 L;  3TWH A;  1TKZ A;  2OYQ A;  4O0J A;  4AHS A;  3MXJ A;  3TAB A;  3IRX A;  4FJH A;  1R59 O;  3AA4 A;  4DSE A;  4RWT A;  2P9L A;  4BRA A;  4JV5 K;  2YV0 X;  4H0X B;  5CY4 A;  2NVY C;  4Z4H A;  5LY3 A;  1M1K O;  1NOZ A;  2O4G A;  4U7B A;  2PAV A;  1C0G A;  4BRI A;  3O5B A;  4B9T A;  2EWS A;  5C4J K;  5KRS A;  3VGL A;  3PO3 K;  3OY9 A;  3DWL A;  1IS1 A;  4CHY A;  2RE2 A;  2HBM A;  4OIR A;  4HVJ A;  5IYD C;  2YKN A;  4C8N A;  4DV2 K;  2JA7 C;  2HVI A;  4A3F C;  4W5O A;  3WOD A;  3GTP A;  3VF6 A;  3ZCM A;  4QIW L;  2KW4 A;  4LFB K;  3HOT A;  1MWM A;  3IFR A;  2XHB A;  2BE2 A;  4E7H A;  5KTQ A;  4DTO A;  2X6N A;  4GV9 A;  1LW2 A;  5AZJ A;  3M8R A;  2UXD K;  3OYE A;  5IOT A;  2W7V A;  2KLA A;  3V1O A;  4PY5 A;  5DK5 A;  4CGF A;  4A2A A;  3VGK A;  4CBW A;  1IKV A;  4BXX K;  4C3I K;  3O9T A;  5FPD A;  2P9I B;  1QHT A;  3ZSR A;  5FLM C;  2QK9 A;  2Y0S D;  2HHX A;  3K9K A;  4OJR A;  2O8D A;  1XMQ K;  4RW4 A;  3VGM A;  3MWP A;  1VSM A;  4BC5 A;  3ZX2 A;  4A3I K;  1TWA K;  3AAQ A;  3VA3 A;  3P38 A;  2R7Z C;  3S3M A;  5KI6 A;  1VQP N;  2D0P A;  1ZQ1 C;  4LQY A;  5IYC C;  3L2V A;  1KSP A;  2OAN A;  5GAE P;  3VQA A;  4CIE A;  3S1Q C;  4DV6 K;  4RG8 A;  4XSZ A;  2Z1J A;  4X62 K;  4Q5S A;  4W5T A;  5JIC A;  4DFJ A;  1WSV A;  3BEX A;  5AQQ A;  1SAZ A;  3CJC A;  1ATS A;  5JS1 A;  1WSJ A;  3ULE A;  2IC3 A;  4FLZ A;  1O24 A;  3P1G A;  1LCU A;  4FK2 A;  3GTO C;  4WQ4 A;  1LWC A;  4QS8 A;  3FKI C;  3SV4 A;  1DT9 A;  1W0H A;  4OKE A;  3GEI A;  2YCH A;  3VQ6 A;  1KXP A;  4WFN L;  2UXC K;  4ILD A;  3GTQ C;  3M3Y K;  4DV1 K;  4WYB A;  2NRV A;  4A93 C;  2XO7 A;  1WUA A;  1QVG M;  4BBS K;  3NCI A;  4H5T A;  3AD7 C;  3KD5 E;  4FM2 A;  3LAK A;  2OPQ A;  4V19 S;  4KAT A;  4BGB A;  2YNF A;  1XHZ A;  1K8K B;  1C1B A;  3V4G A;  1HR0 K;  4KMA A;  1ZYR A;  1JLF A;  3RTV A;  4OVL A;  1OH7 A;  5AQO A;  4KV8 A;  1ZBU A;  3I4M C;  5FRN A;  3M1F A;  4K42 A;  2OPS A;  4DQI A;  4OKK A;  3C7N B;  4BWM A;  4H4O A;  1NGH A;  3DOK A;  2Q97 A;  1O28 A;  3HOV K;  2ASO A;  4BG9 A;  4JS4 A;  1DCP A;  4CHO A;  1VSL A;  3OYF A;  1VQ7 N;  3N0B A;  1BA1 A;  4BC3 A;  4CZM A;  5AQP A;  3L4K A;  1GLF O;  3FOE A;  3FGU A;  1N33 K;  3K7A K;  3MWT A;  2NLX A;  1NK9 A;  2IAJ A;  3CMA N;  3QBX A;  4LF9 K;  4TSX A;  2D5R A;  1F9N A;  1EO1 A;  3AAP A;  4YNQ A;  4CHP A;  4FJ9 A;  4AHR A;  3GDZ A;  1VRU A;  2AJQ A;  1XNQ K;  4JI6 K;  4BY9 C;  1GOA A;  4LK1 A;  4IKF A;  3QNO A;  2QA4 N;  1NM1 A;  4GVE A;  3E9O A;  2B5J A;  3JYT A;  1ESV A;  3SBG A;  4IDH A;  1J5O A;  1KAY A;  3I33 A;  3RRG A;  3P4I A;  4DSK A;  2ZM6 K;  5KGX A;  4CEQ A;  2QW9 A;  2P9P A;  2UUB K;  1SL2 A;  4FJL A;  1F93 A;  3FFK B;  2V7Y A;  3DLR A;  1JCF A;  1LV5 A;  3B6O A;  4GMJ B;  2FF6 A;  4FWK A;  3LM2 A;  3C94 A;  2JWK A;  2A69 A;  1KAX A;  3AVC A;  3VQE A;  4DMN A;  2XY8 A;  2V6S A;  4XLN A;  4HTL A;  3BF3 A;  2NRZ A;  5LMN K;  3FHZ A;  4HHT A;  3CQZ K;  4AYB D;  5JS2 A;  1TWH A;  2JA5 C;  3EKU A;  1VSJ A;  4CHZ A;  1B9D A;  1ASV A;  3E1Y A;  3QIC A;  4IDK A;  4O5F A;  3MAQ A;  4CJW A;  2O8B A;  1XXB A;  4C2M C;  4MDA A;  3AVK A;  4CIF A;  4WFB L;  1QSL A;  2B63 C;  1BIU A;  3LPX A;  2YU9 A;  4WF9 L;  3AVI A;  2NVQ C;  3E66 A;  1IBA A;  4FM9 A;  1EX4 A;  2FXU A;  2R92 C;  1NKC A;  1ZVU A;  3KJV A;  2WAQ D;  1D9F A;  3TAM A;  4ISF A;  1LW0 A;  2OTJ N;  3WXM B;  4JI5 K;  4KRE A;  4DR7 K;  2PY5 A;  3T01 A;  2VWJ A;  4EHT A;  5J2Q A;  3H45 C;  2RH6 A;  3AVH A;  3LWL A;  3PLA A;  4BQL A;  3QLH A;  3LZJ A;  4B9M A;  2O5J A;  5HLF A;  4NLB A;  4BR5 A;  3OVN A;  3PSF A;  3OYB A;  1NMD A;  3J7Y P;  3S1N C;  4KC6 A;  3NMU A;  1BDG A;  2Y1J A;  3UE5 A;  1TWF C;  1XUP O;  4JNE A;  4AHC A;  4CI6 A;  1ASU A;  2R93 A;  1VK0 A;  4KRF A;  2YJF A;  1Y1W K;  4A3G K;  5AQV A;  3TTD A;  1TUU A;  1UAX A;  2KTQ A;  3M5R A;  2VQF K;  1RT2 A;  3LDQ A;  3KD1 E;  1C1C A;  2O8E B;  3OHR A;  4G1Q A;  1REV A;  3HOZ K;  3VEX A;  4K8X A;  5C44 K;  5HL7 L;  1D5A A;  1KLM A;  3EL2 A;  4RMF A;  3DJC A;  2GAH C;  3VTH A;  2O8C B;  2KFZ A;  3O6W A;  5B8H A;  1KFS A;  5EU7 A;  4PAA A;  5BN8 A;  2GUP A;  4IFV A;  4KDD A;  3HST B;  5M1O A;  1RT6 A;  2P9U A;  4A62 A;  5FJ8 K;  3PO4 A;  1Y1V C;  3WEE B;  1R9T C;  4X6A K;  3HVT A;  1WIH A;  3V9W A;  4FSV A;  4CF2 A;  1U2V A;  2ZUF A;  4IEI A;  3LPT A;  4YG2 A;  4KB4 A;  2VUM K;  1VSE A;  1Q86 O;  4DV3 K;  4KPY A;  5AR0 A;  4DTX A;  3TAR A;  3GTL A;  2GUI A;  5SWM A;  2NRH A;  4FW2 A;  1I6V A;  3A5N C;  3H3N O;  2I7N A;  3HOX K;  3TAQ A;  1VRQ C;  1N5Y A;  4BDP A;  3OJU A;  3C95 A;  3SZZ A;  4CEZ A;  4JKB A;  3AA2 A;  3E9P A;  4LF6 K;  4JKG B;  4PQU A;  4YFN A;  2D0A A;  4GTE A;  5CYM A;  5DM7 L;  3GTG K;  4CJK A;  3DXK A;  3ALY A;  3RR7 A;  2FQT A;  3G6E N;  1DLO A;  4QOZ B;  5KPZ A;  1TL3 A;  4B3R K;  3LDO A;  3SI6 A;  4B1W B;  3OYA A;  4JKD A;  3O3H A;  2E8A A;  2HBL A;  3IMX A;  4BRQ A;  3NVM A;  2HBK A;  5C3E K;  3I0R A;  1RBS A;  3H3O B;  1IE0 A;  3O3G A;  3ZET B;  3S16 K;  4LLG A;  4G0U A;  4ID5 A;  2OA8 A;  3M4O C;  3NBP A;  4QS9 A;  3V9U A;  2WC9 A;  4Y0W A;  1WQF A;  4BY7 K;  4CJT A;  2OZM A;  5GIN A;  1I50 C;  3AO3 A;  3LP1 A;  3CER A;  5AQW A;  4FVU A;  1TWG K;  1XZP B;  3GEE A;  1IKW A;  1C0U A;  1R0A A;  1LAW A;  3DLH A;  3HZ6 A;  3D45 A;  4OLB A;  2YHY A;  5M5X K;  2IOC A;  2B4J A;  5ELZ A;  1IBL K;  3DLG A;  4CZL A;  4KHQ A;  1KFD A;  3HK2 A;  4O44 A;  4E7L A;  3U4L A;  3O9Q A;  4BRF A;  3QER A;  2QWN A;  1OVY A;  4Y52 K;  4LH5 A;  1TV6 A;  3L2Q A;  2NVX C;  3A8I A;  1TAU A;  2P9N A;  2QWP A;  3V81 A;  3MN6 A;  3BP8 A;  4B9V A;  5BPM A;  3RSE B;  1NLV A;  1WOP A;  4LC9 B;  4CK3 A;  4CED A;  2D1K A;  2FSN A;  2RHK A;  3V9X A;  1HNZ K;  1SFO C;  4Q4Z A;  3S2D K;  3C6T A;  2WBN A;  3GOI A;  5GAH P;  3BZC A;  4A59 A;  3GTK A;  1T3V A;  4MLH A;  3UKR A;  1YI2 N;  3CFO A;  1EWQ A;  4BG8 A;  4KHS A;  3DYA A;  1N36 K;  4EFH A;  1RTD A;  4JI0 K;  4IG3 A;  1MU2 A;  2VWB A;  3ENB A;  3VPZ A;  1SKR A;  3TTG A;  2JA6 A;  1WOS A;  3S1R K;  4NB4 A;  3D2E A;  3CME N;  1SZ2 A;  4GKJ K;  4XH4 A;  3T1H K;  2Y3P A;  4IJA A;  3WT0 A;  1HLU A;  3IS9 A;  3LDN A;  1NGI A;  2ITG A;  2Q2R A;  4C3H C;  2RF2 A;  4P5A A;  3FZK A;  1U4B A;  1TWC C;  3GTJ C;  1JL1 A;  1WBD A;  3GTP K;  1NGG A;  4BGA A;  4CCH A;  2PBD A;  4BE1 A;  5M5Y K;  3MMV A;  4FM0 A;  3VEV A;  1JJ2 M;  1XC3 A;  4KM9 A;  4ELU A;  1I3Q A;  2GWK A;  4CJP A;  1O26 A;  3WXI A;  1E3M A;  3F9M A;  4FOI A;  1O25 A;  5IYB C;  4BRG A;  4FLW A;  2O8F B;  3MN5 A;  3KZB A;  1RT1 A;  2F7T A;  4M41 A;  1BG3 A;  1WAF A;  1C1A A;  3AY9 A;  1DKG D;  2E2J C;  3UIQ A;  4U67 L;  3HOY K;  2F96 A;  3PIO L;  3D2F A;  2HHH K;  4A3K C;  3ZX3 A;  3SMS A;  3NE6 A;  2ZJR L;  5J2N A;  1Q9Y A;  3LP0 A;  1NK0 A;  3MML B;  3TPQ A;  5M1Q A;  4KAW X;  3KKS A;  3QDK A;  4B8C A;  3LDL A;  2GAG C;  3V6D A;  3VQ4 A;  3UB5 A;  3SUP A;  3WNE A;  3NAE A;  1RCH A;  5CYQ A;  2WB1 L;  1GLD G;  2FBX A;  3J7Z O;  1M90 O;  3ASM A;  2E6L A;  3DLK A;  1VQ9 N;  1F7U A;  1RTJ A;  4DR5 K;  5M1F A;  2E2Q A;  2P9S A;  4JEP A;  4KMU A;  4OIN A;  4H5V A;  3KLG A;  5CJ9 A;  4A3D C;  3GL1 A;  3RRH A;  3QEW A;  4IEE A;  4A3M C;  1HNI A;  4JRP A;  1QQN A;  3ORE A;  1O1W A;  4IOC L;  4LF4 K;  4DQQ A;  2E1Z A;  3H08 A;  1X3M A;  1NU0 A;  2ASP A;  4LY7 A;  3ZSX A;  4K8Z A;  4O0I A;  1QE1 A;  1NGD A;  5HRO A;  3AO1 A;  4DCH A;  1S1V A;  4PL7 A;  4DTS A;  3RWU A;  2CH6 A;  4YOR A;  5JVH L;  3S9H A;  1T6D A;  4JD2 B;  3QNN A;  2XCQ A;  1BIS A;  5JFE A;  2ZGZ A;  4N5S A;  4G0V A;  4ZHR A;  4KI4 A;  1BGW A;  1EK8 A;  5FPE A;  4DLG A;  4AM7 A;  3EQL A;  3CCR N;  3CCQ N;  1RDA A;  4F3T A;  3UKU A;  3CM6 A;  4JK1 A;  4KN4 A;  3SUN A;  2QKK A;  1Z25 A;  4BVP A;  1BS2 A;  2XY6 A;  2YJE A;  4FLU A;  3ZEU B;  3S17 C;  1RTI A;  5AZI A;  1IG9 A;  5IP7 C;  3T3F A;  1G15 A;  1I3A A;  3N4Q A;  1W2B M;  5EGH A;  4JHD B;  4HCC A;  3VER A;  5AFU A;  3O9U A;  3QIN A;  4FWQ A;  1N32 K;  4QJV A;  3B8A X;  5BPN A;  3K0S A;  5BR8 K;  1KAZ A;  1BCM A;  4CZG A;  3GEH A;  1HNX K;  3ZT2 A;  4OPH A;  1K83 K;  4B9L A;  3OYH A;  1VAZ A;  2R7Y A;  3KKR A;  2G8U A;  2JA8 K;  1I6H K;  4CIG A;  1ZBS A;  2YNI A;  4WQ5 A;  1KC8 O;  4F3O A;  4C3J K;  4J8F A;  4A3J C;  4BQZ A;  2X6S A;  4DR3 K;  1D9D A;  3DXM A;  1JLE A;  3SUQ A;  3HKZ L;  1WCM A;  3HXM A;  4NCG A;  2OCE A;  2ZE2 A;  1U45 A;  4LFC K;  4UY8 O;  1SUQ A;  4MO5 A;  5C42 A;  4CF1 A;  1ZBF A;  4CFC A;  4YDU A;  3K5N A;  3ULD A;  2XCR B;  4AHT A;  3S2H C;  1OH8 A;  2KFN A;  2O5I A;  1EH1 A;  4PKH A;  2PHC B;  4FK0 A;  1Z6R A;  5DMR A;  5EXW A;  5GIP A;  2HOE A;  4OPA A;  4CF9 A;  4GTL A;  1IW7 A;  4A3C C;  1B92 A;  4FZZ A;  1TWH K;  4AQY K;  1SV5 A;  2KHO A;  5AFU H;  5M1N A;  3H0G K;  3WNF A;  3VF2 A;  3A8K A;  3GG4 A;  4LSN A;  3Q7C A;  4FOE A;  2A68 A;  3S14 C;  1ZXO A;  4G7H A;  4DQ8 A;  4X64 K;  1RBT A;  3VA7 A;  3AO2 A;  4GNI A;  2YU9 K;  1X9J A;  4FZX C;  4FLV A;  4ZTJ A;  3QX3 A;  4HWI A;  1S3X A;  3O1W A;  1A5V A;  3M6G A;  2YHW A;  4MQ9 A;  3THX B;  4OX9 K;  5IOR A;  3T1A A;  4CBU A;  2IVO A;  3RZO K;  3O08 A;  3THW A;  1LAV A;  1ITG A;  4LK0 A;  4BWJ A;  3L8B A;  1T03 A;  1FJG K;  2ATQ A;  2NRW A;  4IXC A;  4OPJ A;  2QEX N;  4F2R A;  3SJH A;  4BBR K;  3TFH A;  3ATV A;  2BUP A;  2CGK A;  4JRQ A;  3HPG A;  4B3O A;  1UV7 A;  2R93 K;  4DSF A;  5C4J C;  3HOU K;  3PO3 C;  3SNN A;  4KHN A;  4B1U B;  2YNG A;  1HYS A;  2HBJ A;  2FSJ A;  3AD9 C;  4IO8 A;  4CEA A;  4CBX A;  2F8S A;  4Z94 A;  2YNH A;  3K58 A;  3CET A;  1X9M A;  4B1Y B;  5E41 A;  3MDQ A;  3QFU A;  1L3S A;  4WJ4 A;  2EX3 A;  4RTF D;  1RBV A;  2E4L A;  3K5M A;  2PMZ L;  4YOU A;  1BU6 O;  3H1V X;  2KZM A;  3NH2 A;  3CYM A;  4KHY A;  2YI1 A;  1JKH A;  3AVB A;  3ENO A;  4BXX C;  4HUE A;  4C3I C;  1HPZ A;  1YXQ A;  4M63 C;  1C0M A;  3Q7B A;  4CHQ A;  4XSX A;  2NRT A;  4O8K A;  2HHU A;  4IZ9 A;  4ICL A;  1E4F T;  3KWG A;  3SQ4 A;  2KWA A;  3SLC A;  3OBY A;  4G9Z A;  2HHQ A;  2G8I A;  1QQM A;  4GVM A;  1TWA C;  1TAQ A;  4A3I C;  4YOW A;  3GTL K;  1BQN A;  1RDC A;  2E1Y A;  3AVF A;  3QEV A;  3EKS A;  3RMC A;  1WLJ A;  2A41 A;  4BRP A;  2QXL A;  4KAR A;  1RGI A;  4LFA K;  3RVC A;  4A2B A;  3ZT0 A;  3CC7 N;  3P39 A;  1A5X A;  2V52 B;  1BHL A;  1WBB A;  4L8R B;  4OIP A;  3CJ9 A;  4KH4 A;  3TAE A;  1NK8 A;  3W0L A;  1OH5 A;  1L0W A;  4A3B K;  3NDK A;  1TL1 A;  4FJJ A;  1XI1 A;  3JS6 A;  4QAG A;  5HBM A;  3VA0 A;  3O9S A;  4LH4 A;  4BRL A;  3HBT A;  1NK7 A;  3BUE A;  5FLX O;  5BR9 A;  3SBT A;  1NK4 A;  2JLE A;  2W6K A;  1IO2 A;  5M5W K;  3RZD K;  3ISN C;  4XH5 A;  2E2I A;  3VOV A;  3M3Y C;  3L4Q A;  3KK3 A;  2PPB A;  1TKD A;  3KIO A;  3L3U A;  4BBS C;  3DOL A;  1K83 A;  3GTM A;  1HQU A;  3CM5 A;  2I7P A;  4CJ7 A;  2P9K B;  3VET A;  4HUG A;  4G7Z A;  4B1Z A;  4YOV A;  1XXA A;  4DSL A;  2F4V K;  1S6Q A;  4JKE A;  3CQY A;  2NVY A;  3SV3 A;  2A1R A;  4CE9 A;  2D0C A;  2VWK A;  1T7P A;  2A6A A;  2HMI A;  1EET A;  4JKF A;  1N6Q A;  4N56 A;  4CJR A;  3TSQ A;  3HPH A;  3U6F A;  1XMO K;  3OW2 M;  3HOV C;  3LP3 A;  1NOY A;  5E26 A;  2JA7 A;  3J8A A;  1NGC A;  2E2O A;  1BI4 B;  1NGF A;  2HMP A;  4CZI A;  1VQ5 N;  1KQ4 A;  3V4I A;  3VEZ A;  4C45 A;  5IP9 K;  3ZLJ A;  3K7A C;  5FPM A;  3A5L C;  3KLF A;  3VEY A;  3PX0 A;  2KZZ A;  3DXJ A;  1Z05 A;  2PA8 L;  4CJE A;  5FPN A;  4EIA A;  2IVN A;  2CFA B;  3TAF A;  1ZBL A;  1S22 A;  2G8K A;  4CGD A;  1QQC A;  1UA0 A;  3H0G A;  1VQ6 N;  3OYN A;  3HP9 A;  4AH9 A;  3VQC A;  3MCA B;  4M42 A;  4Z4G A;  4Z0U A;  4FLT A;  4JI2 K;  4EHU A;  3D0P A;  1QS4 A;  4CGJ A;  2ZD1 A;  4CZE A;  3GTK K;  1XWL A;  1WB9 A;  1KD1 O;  4G7O A;  3PY8 A;  4AIL C;  4BVO A;  1YHQ N;  1YJ9 N;  4C8K A;  5L46 A;  2R7Z A;  2WTU A;  1GLJ O;  2JA6 K;  5J2P A;  1YTU A;  4E1J A;  3IG1 A;  1O2B A;  3TFI A;  3TAG A;  4DQS A;  1VGX A;  1U04 A;  1Y97 A;  3U9D A;  3KLE A;  3J80 O;  1DGK N;  3SAH A;  4XCH A;  1PJ5 A;  1VLO A;  5KQD A;  3MEG A;  1JCG A;  2P9I A;  2E2H K;  4KKO A;  1YCL A;  4DU4 A;  4AH6 A;  3CQZ C;  4GV3 A;  1I3Q K;  4AHU A;  3N0C A;  1T6C A;  2YKM A;  3PSI A;  4CEF A;  5D3G A;  1BJT A;  1MWK A;  3GTO A;  3IAY A;  1N34 K;  2RN2 A;  5AQN A;  3K5L A;  4WJ3 M;  1RU0 A;  3FKI A;  3DRP A;  3NHG A;  1ZC6 A;  3J7A P;  4Y7N K;  4Y1D A;  4M7X A;  3OS0 A;  3CCS N;  4B9S A;  4B1X B;  3GTQ A;  4B3S K;  4P5B A;  4K25 A;  4OGC A;  5BRE A;  3NFA A;  2Y0S L;  3KWI A;  4EZ9 A;  3IUC A;  3DRS A;  1NNE A;  3F5T A;  5C4X K;  4JS5 A;  4H5N A;  4ILJ A;  3BZK A;  4DG1 A;  4MO4 A;  4PWD A;  3DM2 A;  5KPT A;  4DB3 A;  4DHY A;  4KFB A;  4CJV A;  4OIQ A;  1GLE G;  1HYV A;  3KLI A;  4DU3 A;  2CH5 A;  1ZBH A;  2D6F C;  1I39 A;  3TAN A;  4O8U A;  5JMV A;  3S1M K;  2HHW A;  4KAS A;  4IBN A;  4A57 A;  4M45 A;  5EX5 A;  2AA4 A;  3A5M C;  1W9H A;  4XLP A;  5AQJ A;  3EY1 A;  1RIL A;  5CHI A;  3M8S A;  5JLH A;  5GIO A;  2GEM A;  4CJ4 A;  2RKI A;  4BDZ A;  3M8Q A;  4A3L K;  2VG5 A;  4CJQ A;  4DUY K;  4H5W A;  1F7V A;  1L5U A;  1Y1W C;  1AB4 A;  4A3G C;  1YX2 A;  1TK0 A;  1XZQ B;  4CJ5 A;  4IFE A;  4DQR A;  1VQO N;  4XH1 A;  4CD3 A;  3N4P A;  1K8K A;  3THV A;  4I6M B;  3HOZ C;  3C6H A;  3ID8 A;  1VQL N;  3HVR A;  2KQ2 A;  4DFM A;  5C44 C;  1NBW A;  4DU1 A;  1ATN A;  4IOX A;  3Q3Q A;  5BRF A;  1L3U A;  1NGJ A;  4O55 A;  5AQK A;  5LJV A;  3U3Y A;  4E7J A;  4FPB A;  3C7N A;  3OYK A;  4Q0B A;  5M1K A;  5J1E A;  3PO2 K;  3I56 N;  2E88 A;  5HRR A;  4H8K A;  2UUA K;  2GWJ A;  1Q7Y O;  3O3F A;  4X66 K;  4CJU A;  1YT3 A;  3R8E A;  3TI0 A;  4X6A C;  4GZY A;  3GIR A;  2ZJQ L;  4KTQ A;  1BIZ A;  5AQG A;  3NGY A;  4QCL A;  4IOA L;  1Y64 A;  1U49 A;  4C23 A;  4I9Q A;  1J6V A;  4FJ8 A;  3DI6 A;  5AQX A;  4B3T K;  1YAG A;  5AQL A;  3SAG A;  2VUM C;  3I0S A;  1FKP A;  2DFE A;  3L2U A;  4H0T B;  4DQP A;  3HOX C;  1O13 A;  4FWO A;  3QIO A;  2QWQ A;  1X3N A;  3ZSY A;  4Q5V A;  4YHH K;  1RDU A;  3CJ7 A;  4B9U A;  3CXC M;  1JLQ A;  1NJX A;  1CXU A;  2JA5 A;  5E68 A;  1TKX A;  3M8P A;  1WAJ A;  4PL8 A;  2RGR A;  1NMN A;  1HX1 A;  1QQO A;  3GTG C;  2VG6 A;  3QEP A;  3G4S N;  1HNW K;  4IWV A;  2G8F A;  1NJY A;  2YHA A;  1HQM A;  4ISG A;  1RBR A;  4BKW A;  4KI6 A;  2R92 A;  1XQS C;  3VQ8 A;  1WOR A;  4H0Y B;  5KRT A;  3ATU A;  1KCF A;  1JQW A;  4DTR A;  4JKA A;  3VEW A;  5CZ2 A;  3OYG A;  3L3V A;  1D4X A;  3SQ1 A;  1C0F A;  2E2N A;  1WCM K;  2EBB A;  5C3E C;  4MEY A;  3HPO A;  3QEX A;  4BLB A;  3S16 C;  1NG9 A;  1V4T A;  3FFI A;  1TYQ B;  3CC2 N;  4H5R A;  5AQZ A;  3E9L A;  3ZSQ A;  4DV7 K;  1XXC A;  2E20 A;  2FLO A;  3GBT A;  3BUZ B;  1TWF A;  4BY7 C;  2GV9 A;  1HKC A;  1J6X A;  4ELV A;  4RW9 A;  4E3S A;  4A3E K;  3NF8 A;  1TWG C;  4MEX A;  1U6Z A;  4KHW A;  3W3D A;  4NYN A;  3AO4 A;  1Q9X A;  5FRM A;  4DR6 K;  3CFR A;  1TGO A;  3PO5 A;  3G4C A;  1GLB G;  3QBW A;  1LWF A;  3ADA C;  2GEL A;  1HYZ A;  2P9L B;  4E0D A;  2GSN A;  3RMB A;  4QIW D;  4CHN A;  4A5A A;  4O4G A;  5IOQ A;  3LDS A;  3O9R A;  4Y52 C;  3H1Q A;  3TU5 A;  4CGI A;  2E2H A;  3DMJ A;  4I2Q A;  3HSC A;  4YY3 K;  1FKO A;  3CCE N;  1INN A;  2WAQ L;  2NRX A;  4FO0 A;  1X9W A;  1QZ6 A;  3OYJ A;  2Q0U A;  1GLC G;  3QB0 A;  3D7E O;  1JLB A;  4JI4 K;  1HPM A;  4HUF A;  4W5R A;  3MCP A;  3S2D C;  4I2P A;  3MX5 A;  1KRP A;  1ZYQ A;  5TJ3 A;  2ZQB A;  3HOW K;  4H03 B;  2FSK A;  2Z1G A;  4CEB A;  5AZJ B;  4GT9 A;  5BN9 A;  5KGW A;  4F9O A;  5IWA K;  2O8E A;  2HF4 A;  1C0T A;  3AV9 A;  3VMF B;  1J6Z A;  4BC4 A;  1S72 N;  2E5L K;  4K0K K;  2HHV A;  4H0P A;  4M3Z A;  4OLA A;  4C1N K;  1SMY A;  3LAP A;  1USO A;  1EQR A;  3VQ9 A;  2O8C A;  3S41 A;  4WCE L;  3CD6 N;  3S1R C;  4NXN K;  1V5V A;  1YTA A;  1D8Y A;  3THW B;  3T02 A;  2VG7 A;  1NKB A;  4GTF A;  1VHX A;  2O8D B;  3DLE A;  1O29 A;  3GTP C;  3WEE A;  4GY2 B;  4EAH D;  3OS2 A;  4E89 A;  1XHX A;  1UOC A;  4C1N I;  3L4J A;  3HI0 A;  1YUW A;  4LJZ A;  1I94 K;  1RNH A;  4FM1 A;  4FJ5 A;  1SKS A;  2PMZ D;  3HYF A;  3BGR A;  2EHG A;  5K14 A;  4ZTF A;  2VGM A;  4DSI A;  2P5M A;  4FWR A;  1IJJ A;  5C15 A;  3ZT1 A;  1WOO A;  1CZ9 A;  1EQY A;  4A61 A;  2JH3 A;  4CVN E;  3QEI A;  4FLX A;  1LOT B;  3ULE B;  5C12 A;  1Z26 A;  5JVG L;  4YFU A;  3HOY C;  3MED A;  2Q3S A;  2ITM A;  4GFQ A;  3V9Z A;  2NRR A;  3H6E A;  3K9J A;  4EP5 A;  4JKG A;  1DD5 A;  3PX6 A;  5AQS A;  4DS4 A;  2J4R A;  3SPY A;  3DLB A;  3R6M A;  4MQ3 A;  1RDW X;  3KK1 A;  3GSI A;  4N47 A;  3MX2 A;  4Z4F A;  2IDO A;  1I50 A;  3SAF A;  3VES A;  3MN9 A;  4M7Y A;  2QWR A;  2PYL A;  3CQ8 A;  1YJN N;  2F8T A;  4ZH4 A;  1RFQ A;  4RW8 A;  5JVO A;  5BPL A;  3PIP L;  4JYA K;  3O4N A;  4JK8 A;  4DV4 K;  1K73 O;  5KPR A;  4CJF A;  2I5J A;  5GAG P;  2NVX A;  3ZET A;  2CGJ A;  1GOC A;  3HJF A;  4LR2 A;  1HNV A;  2V6T A;  4I7F A;  4WQ4 C;  4O2D A;  1S9G A;  4FJX A;  4KAZ A;  1DTQ A;  4B9Q A;  1NGE A;  2E2I K;  2P51 A;  3FZF A;  3ENH A;  3HOS A;  2NVT K;  4Z4C A;  3VQQ A;  4NOI A;  1K6Y A;  1SFO A;  1XZP A;  3FR0 A;  1IKY A;  3CI5 A;  5T7B A;  1BUP A;  4BY1 K;  4J2A A;  4FWM A;  1IBK K;  5EY4 A;  3QO9 A;  3CPW M;  1TUY A;  4BR4 A;  1DCH A;  3A8J A;  3S15 K;  4QS7 A;  3GTM K;  3ZT3 A;  5HP1 A;  2UUC K;  3VQP A;  1O27 A;  2BGG A;  1YNJ A;  1BL3 A;  4FPA A;  2Q31 A;  1VSK A;  4DUZ K;  4DR4 K;  4FXD A;  4KMD A;  3HT3 A;  1NWK A;  2BH1 A;  4CGG A;  1YJW N;  2NVY K;  4FJ7 A;  1QZ5 A;  4AF1 A;  2QM1 A;  2W42 A;  2G8W A;  2UYT A;  1NJZ A;  3RSE A;  4FWP A;  5EOY A;  1EI6 A;  2OTL N;  5IYD K;  2JA7 K;  2IS3 A;  4A3F K;  3CJ1 A;  3BDP A;  4A5B A;  4JLH A;  3U9Z A;  4DR2 K;  3LAN A;  3SPZ A;  3NUH A;  3K57 A;  4C8M A; 
#chains in the Genus database with same CATH homology
 3SBT A;  5E84 A;  2W40 A;  4YDU C;  1VQN N;  3L4I A;  3I55 N;  1WIH A;  1WQH A;  4FSV A;  4XH5 A;  2P9P B;  2E2I A;  1U2V A;  3VOV A;  3L4Q A;  4IEI A;  1MA9 B;  2V51 B;  4KB4 A;  1Q86 O;  3WQT A;  1Y1W A;  3R1X A;  1K83 A;  2VYP A;  5AR0 A;  3CCU N;  3GTM A;  3VEO A;  2I7P A;  3TSP A;  2P9K B;  1BOT O;  2NRH A;  3JXU A;  2E2P A;  3VET A;  4CJ7 A;  3A5N C;  3H3N O;  3FLC O;  2I7N A;  4L3Q A;  5AQH A;  3WEE B;  4B1Z A;  4YOV A;  1XXA A;  3A0I X;  1ISE A;  2QWO A;  5AQR A;  4JKE A;  3H46 O;  3CQY A;  5JLF A;  2NVY A;  4KH6 A;  3CJA A;  2H3G X;  2A6A A;  4BR9 A;  3OEP A;  4C3J C;  4JKF A;  3O80 A;  3LDP A;  4JKB A;  3E9P A;  4JKG B;  4NLC A;  1GLL O;  5HOO A;  2YX6 A;  4H0O A;  3TSQ A;  4GTE A;  4GTB A;  5AQT A;  1YVN A;  5BRH A;  5DM7 L;  3OW2 M;  1K9M O;  5IOS A;  3DXK A;  3FOF A;  1NGA A;  2JA7 A;  5E26 A;  3J8A A;  3WQU A;  1NGC A;  4KH5 A;  2E2O A;  3ZYY X;  4BC2 A;  3G6E N;  1NGF A;  2A42 A;  1ATR A;  5CHP A;  5KPZ A;  2HMP A;  2NZT A;  3VTI A;  4CZI A;  1VQ5 N;  4DDQ A;  1KQ4 A;  3LDO A;  4JKH A;  5F2R A;  3VEZ A;  4B1W B;  4KB2 A;  4FWN A;  4JKD A;  4KM8 A;  5FPM A;  3A5L C;  2E8A A;  2HBL A;  3IMX A;  3VEY A;  4BRQ A;  3EE8 A;  3NVM A;  4I6M A;  1Z05 A;  2HBK A;  2VUM A;  3CAG A;  3FE1 A;  5FPN A;  3H3O B;  4EIA A;  2IVN A;  2CFA B;  1S22 A;  4CZF A;  1G99 A;  3ZET B;  4G0U A;  3TTC A;  1HKB A;  3H0G A;  1VQ6 N;  5DM6 L;  4QS9 A;  5TKY A;  2WC9 A;  3MCA B;  4Y0W A;  3NVK A;  4GV6 A;  1WQF A;  4EHU A;  4JAX A;  4CZE A;  4IJN A;  3EZW A;  1KD1 O;  5AQI A;  5GIN A;  3CER A;  5AQW A;  4FVU A;  5AQM A;  4BVO A;  1YHQ N;  3KVG A;  1YJ9 N;  4WFA L;  3HZ6 A;  2IVP A;  2R7Z A;  3KHY A;  3GTG A;  3EN9 A;  1GLJ O;  3CC4 N;  2YHY A;  1H1V A;  5ELZ A;  3WUH A;  4E1J A;  1O2B A;  4CZH A;  3AAR A;  4CZL A;  3C0B A;  5ADX A;  3U4L A;  4B1V A;  2A5X A;  4MLE A;  3O9Q A;  4BRF A;  4YOX A;  3O1B A;  2Q0R A;  3QFP A;  2QWN A;  1OVY A;  2Q1N A;  3U9D A;  3O4W A;  4BRO A;  3FZH A;  1JCE A;  2P9N A;  2QWP A;  1DGK N;  3SAH A;  1YIJ N;  3MN6 A;  3OPF A;  3BP8 A;  5KQD A;  3L6Q A;  4CZK A;  1JCG A;  2D4W A;  2P9I A;  3HM8 A;  3RSE B;  5BPM A;  3AQP A;  2XCO A;  1NLV A;  3O8M A;  2HST A;  2P9U B;  4GV3 A;  4JN4 A;  4LC9 B;  3N0C A;  1T6C A;  1BJT A;  3GTO A;  2ZJP L;  1MWK A;  2D1K A;  2RHK A;  2FSN A;  4H0V B;  3G25 A;  5AQN A;  3FKI A;  5CR4 A;  1ZC6 A;  2WBN A;  3GOI A;  5GAH P;  4M7X A;  4A59 A;  3GTK A;  1T3V A;  4MLH A;  3UKR A;  3CCS N;  1YI2 N;  4B1X B;  3GTQ A;  1U2V B;  4BG8 A;  1TWG A;  4P5B A;  4BRE A;  4K25 A;  5BRE A;  3S0X A;  4JD2 A;  2IIR A;  4BRK A;  3R9P A;  3KWI A;  4EFH A;  3U8X A;  4BRM A;  3IUC A;  2JA6 A;  2VWB A;  3ENB A;  1BO5 O;  3F5T A;  3GE1 A;  3VPZ A;  4KMH A;  4FZB A;  4GTC A;  4H5N A;  4ILJ A;  4YOT A;  4BRN A;  4MO4 A;  3D2E A;  4NB4 A;  5F1X A;  5KPT A;  4DB3 A;  3CME N;  4J3N A;  3AGK A;  1SZ2 A;  4MDB A;  3AGR A;  4DHY A;  4BRC A;  5CE3 A;  4XH4 A;  3QML A;  2Y3P A;  4GTA A;  1TWC A;  4IJA A;  3WT0 A;  1GLE G;  3GTJ A;  1DEJ A;  1HLU A;  3LDN A;  1NGI A;  2A40 A;  2Q2R A;  4JK7 A;  2VGN A;  4C3H C;  2CH5 A;  3AQO A;  4BR7 A;  4P5A A;  3FZK A;  4O8U A;  2WFB A;  5AQY A;  5JMV A;  3HRG A;  1WQG A;  1NGG A;  4BGA A;  1SQK A;  4KAS A;  3ZEU A;  1TYQ A;  2ASM A;  2AA4 A;  2PBD A;  2ZWH A;  3A5M C;  5EX5 A;  3WXJ A;  4A57 A;  3MMV A;  5ADX H;  1VQ4 N;  4G0W A;  3IKM A;  5AQJ A;  3VEV A;  1XC3 A;  4PKI A;  5CHI A;  3DXK B;  1JJ2 M;  1HKG A;  3VA7 A;  5JLH A;  5GIO A;  4KM9 A;  2HF3 A;  1I3Q A;  2GWK A;  1NGB A;  2GEM A;  1O26 A;  4JK9 A;  3WXI A;  4JHD A;  4BRH A;  2D0O A;  5I9E B;  3EO3 A;  2ZFZ A;  3F9M A;  4FOI A;  1O25 A;  2F9W A;  2F9T A;  2ZGY A;  4H5W A;  2GSU A;  3WXK A;  4BRG A;  1AB4 A;  2QTD A;  2GTD A;  5EGE A;  4IO9 L;  4IFE A;  3MN5 A;  3F2K A;  1VQO N;  3KZB A;  4XH1 A;  1OKJ A;  4CD3 A;  2F7T A;  3N4P A;  3BF1 A;  5MLC Q;  1R59 O;  1K8K A;  1BG3 A;  4I6M B;  3C6H A;  3ID8 A;  1VQL N;  4RWT A;  3AY9 A;  2P9L A;  1NBW A;  1DKG D;  4FWL A;  1ATN A;  4BRA A;  4H0X B;  4OO1 J;  4PHT X;  4IOX A;  5LY3 A;  4U67 L;  3Q3Q A;  3PIO L;  5BRF A;  1M1K O;  1NGJ A;  3KK7 A;  3D2F A;  4U7B A;  5AQK A;  5LJV A;  2PAV A;  1C0G A;  4BRI A;  4FPB A;  3C7N A;  3O5B A;  3ZX3 A;  2EWS A;  3SMS A;  4ILG B;  2FF3 B;  3VGL A;  3DWL A;  5M1K A;  2ZJR L;  1IS1 A;  2RE2 A;  3LAJ A;  2HBM A;  3GDQ A;  3I56 N;  3MML B;  2E88 A;  5C10 A;  3TPQ A;  2GWJ A;  5M1Q A;  3GTP A;  3VF6 A;  1Q7Y O;  4KAW X;  3QDK A;  3R8E A;  3HOT A;  1MWM A;  3IFR A;  3LDL A;  2ZJQ L;  2KKZ A;  5AQG A;  3UB5 A;  4IOA L;  1Y64 A;  4GV9 A;  1O2A A;  5AZJ A;  4C23 A;  1BA0 A;  1GLD G;  5AQX A;  1Q81 O;  3J7Z O;  5IOT A;  1YAG A;  2KLA A;  5AQL A;  1M90 O;  3SAG A;  3CIP A;  2GSO A;  1VQ9 N;  2VCP A;  5C0Y A;  5M1F A;  2QI2 A;  4H0T B;  2E2Q A;  2P9N B;  2P9S A;  3A8Y A;  3VGK A;  4A2A A;  4CBW A;  5KQ8 A;  1O13 A;  4FWO A;  4JEP A;  5LJW A;  3O9T A;  4H5V A;  5FPD A;  2P9I B;  5CJ9 A;  2QWQ A;  1X3N A;  3GL1 A;  4GTD A;  1RDU A;  3CJ7 A;  4IEE A;  3CXC M;  3ORE A;  1QQN A;  3K9K A;  5H1S Q;  4IOC L;  3VGM A;  3MWP A;  2JA5 A;  3CCM N;  2E1Z A;  5EVZ A;  4BC5 A;  3ZX2 A;  1X3M A;  3IDH A;  4PL8 A;  2RGR A;  2ASP A;  1HX1 A;  1N8R O;  1QQO A;  3HTV A;  3AAQ A;  3T69 A;  3P38 A;  1NGD A;  2NNW A;  3UKR B;  4DCH A;  3OBW A;  3LM9 A;  4PL7 A;  3VEN A;  3G4S N;  2D0P A;  1VQP N;  4IWV A;  2CH6 A;  4LQY A;  4YOR A;  5JVH L;  1T6D A;  4JD2 B;  2OAN A;  5GAE P;  4ISG A;  2XCQ A;  5JFE A;  4BKW A;  1SS6 A;  2ZGZ A;  4G0V A;  2R92 A;  1XQS C;  1BGW A;  3LL3 A;  1EK8 A;  4H0Y B;  5FPE A;  3ATU A;  3D2E B;  1GE9 A;  1HUX A;  4AM7 A;  4JKA A;  3VEW A;  5JIC A;  3CCQ N;  3CCR N;  5F0X A;  3BEX A;  3M3Z A;  5AQQ A;  1SAZ A;  3SK3 A;  1D4X A;  3UKU A;  3CJC A;  1C0F A;  1YF5 L;  2E2N A;  1ATS A;  3G4A A;  4BVP A;  1K8A O;  3ULE A;  1O24 A;  4BLB A;  1LCU A;  1V4T A;  2YJE A;  3ZEU B;  1TYQ B;  4M1X A;  3CC2 N;  3I8B A;  4WQ4 A;  4H5R A;  5AQZ A;  3E9L A;  3R3L A;  4QS8 A;  5AZI A;  1XXC A;  2E20 A;  1DT9 A;  2FLO A;  1W2B M;  3N4Q A;  3GBT A;  3BUZ B;  1TWF A;  3CHW A;  2YCH A;  5EGH A;  1HKC A;  4JHD B;  4ILD A;  1KXP A;  3VER A;  3O9U A;  5AFU A;  4FWQ A;  4WFN L;  3ID6 A;  3B8A X;  4WYB A;  2NRV A;  5BPN A;  1U6Z A;  5C2F A;  3W3D A;  1WUA A;  1QVG M;  1TWA A;  4CD1 A;  1KAZ A;  4H5T A;  4CZG A;  4KAT A;  4BGB A;  4OPH A;  3C6A A;  3G4C A;  3CQX A;  1GLB G;  2ZF5 O;  1K8K B;  3QBW A;  5C2D A;  2GEL A;  1VAZ A;  3V4G A;  2AP1 A;  4KMA A;  2P9L B;  3WXL A;  2GSN A;  3CCV N;  4A5A A;  3CF5 L;  5AQO A;  5IOQ A;  1ZBS A;  2Q36 A;  3O9R A;  4WQ5 A;  3D2F B;  3H1Q A;  4J8F A;  3TU5 A;  4BQZ A;  1KC8 O;  2E2H A;  2YHX A;  3DXM A;  3M1F A;  3HSC A;  4K42 A;  5M1P A;  3C7N B;  3CCE N;  1NGH A;  1WCM A;  2NRX A;  1W97 L;  2Q97 A;  2ASO A;  2JWL A;  1O28 A;  1QHA A;  4FO0 A;  3G71 N;  4UY8 O;  4BG9 A;  1QZ6 A;  4YOY A;  4MO5 A;  2Q0U A;  1GLC G;  3QB0 A;  3D7E O;  1VQK N;  1HPM A;  1IG8 A;  3MCP A;  1VQ7 N;  4YDU A;  3N0B A;  4AM6 A;  1BA1 A;  4BC3 A;  4CZM A;  3MX5 A;  5AQP A;  2XCR B;  3L4K A;  1GLF O;  5TJ3 A;  4NO7 A;  3FOE A;  3FGU A;  4H03 B;  2FSK A;  5AZJ B;  1EH1 A;  4GT9 A;  5BN9 A;  4PKH A;  4F9O A;  2PHC B;  3MWT A;  1V4S A;  2NLX A;  2HF4 A;  3VMF B;  1J6Z A;  4BC4 A;  1S72 N;  1Z6R A;  5EXW A;  5GIP A;  3QBX A;  3CMA N;  4H0P A;  4K43 A;  2HOE A;  4C1N K;  4OPA A;  4GTL A;  1F9N A;  1EO1 A;  3LAP A;  3AAP A;  2P9S B;  3S41 A;  4WCE L;  3CD6 N;  1VQM N;  1B4A A;  2KHO A;  5AFU H;  1E4G T;  5M1N A;  3FZL A;  1GLA G;  3VF2 A;  5GAD P;  3GG4 A;  4BY9 C;  4GTF A;  3Q7C A;  4FOE A;  1HJO A;  2QA4 N;  1NM1 A;  4GVE A;  1ZXO A;  3E9O A;  4FL9 A;  1ESV A;  3SBG A;  4IDH A;  4DQ8 A;  1O29 A;  3N3Y A;  3C65 A;  3A5O C;  4PKG A;  1KAY A;  3I33 A;  4GNI A;  4GY2 B;  3P4I A;  5TKW A;  3T7Z A;  3WEE A;  1X9J A;  4EAH D;  2QW9 A;  4C1N I;  3QX3 A;  3L4J A;  4HWI A;  1S3X A;  3HI0 A;  3O1W A;  1YUW A;  2P9P A;  3ERE D;  3M6G A;  3SMP A;  3FFK B;  2V7Y A;  5BRD A;  1JCF A;  2DPN A;  2YHW A;  4BR0 A;  5IOR A;  2FF6 A;  4ILH A;  4FWK A;  2IVO A;  4CBU A;  3LM2 A;  3DLL L;  2VGM A;  2P9K A;  2JWK A;  1KAX A;  2P5M A;  4FWR A;  1IJJ A;  4HTL A;  3O08 A;  5C15 A;  1EQY A;  3UKU B;  3BF3 A;  4A61 A;  2NRZ A;  2JH3 A;  3FHZ A;  3CPE A;  1LOT B;  3ULE B;  5C12 A;  5JVG L;  2NRW A;  2QEX N;  4IXC A;  3SJH A;  2ITM A;  1TWH A;  4GFQ A;  1ILY A;  3ATV A;  2BUP A;  1CZA N;  2CGK A;  2NRR A;  3CJB A;  3EKU A;  3H6E A;  3K9J A;  3MK6 A;  4JKG A;  4R79 A;  1P90 A;  5AQS A;  5AZI B;  3E1Y A;  1DD5 A;  2J4R A;  3QIC A;  3R6M A;  1RDW X;  4O5F A;  2B63 A;  4B1U B;  4BR2 A;  3MX2 A;  1I50 A;  3SAF A;  1XXB A;  3VES A;  4DKW A;  4C2M C;  4MDA A;  4WFB L;  2HBJ A;  2FSJ A;  1NJI O;  3MN9 A;  4IO8 A;  2QWR A;  4M7Y A;  3LPX A;  2YU9 A;  1YJN N;  4WF9 L;  4CBX A;  3E66 A;  4FM9 A;  3ZX0 A;  4ISE A;  1B4B A;  4Z94 A;  2FXU A;  1RFQ A;  1ZVU A;  4ISF A;  5JVO A;  2OTJ N;  5BPL A;  3CET A;  3WXM B;  3PIP L;  4B1Y B;  2GX9 A;  3MDQ A;  3QFU A;  4JK8 A;  4CZJ A;  3VF4 A;  1K73 O;  4EHT A;  4RTF D;  5KPR A;  3H45 C;  2RH6 A;  4YOU A;  1BU6 O;  3H1V X;  3TTF A;  3PLA A;  2CFA A;  1VQ8 N;  4BQL A;  5GAG P;  2A3Z A;  3OA9 A;  2NVX A;  3ZET A;  2CGJ A;  4NLB A;  4BR5 A;  2QWL A;  2QWM A;  3DXM B;  2YI1 A;  4LR2 A;  3ENO A;  1QVF M;  1NMD A;  4C3I C;  1YXQ A;  4WQ4 C;  4M63 C;  4RCH A;  4KC6 A;  3Q7B A;  3NMU A;  3CQZ A;  1BDG A;  4B9Q A;  2NRT A;  1NGE A;  2CGL A;  3UE5 A;  4O8K A;  4KBO A;  1XUP O;  3FZF A;  3ENH A;  1E4F T;  1P8Z A;  2PFU A;  3KWG A;  4IZ9 A;  2BTF A;  3FZM A;  3HOS A;  3CCJ N;  4BLA A;  4JNE A;  4CI6 A;  3FR0 A;  2KWA A;  3CI5 A;  3SLC A;  1BUP A;  3AH5 A;  3OBY A;  4FWM A;  2R93 A;  4G9Z A;  1MDU B;  1QQM A;  2YJF A;  5EY4 A;  1TUY A;  4BR4 A;  3CPW M;  3CCL N;  5AQV A;  3TTD A;  4QS7 A;  2V7Z A;  1YIT N;  4YOW A;  1TUU A;  5AQU A;  2E1Y A;  3M5R A;  3LDQ A;  1O27 A;  3EKS A;  4JKC A;  2A41 A;  3OHR A;  4FPA A;  2Q31 A;  3MN7 A;  4BRP A;  2QXL A;  1Q18 A;  4KAR A;  4KMD A;  1RGI A;  3VEX A;  1NWK A;  3RVC A;  4A2B A;  2BH1 A;  5HL7 L;  1YJW N;  3CC7 N;  3D6R A;  1QZ5 A;  3P39 A;  2V52 B;  3EL2 A;  4XEI A;  3DJC A;  4FWS A;  4K41 A;  4AF1 A;  4WQ5 C;  3VTH A;  2QM1 A;  1WOQ A;  3O6W A;  3CJ9 A;  5B8H A;  4BRD A;  4KH4 A;  3L0Q A;  2UYT A;  3W0L A;  5BN8 A;  2GUP A;  5AQF A;  4KDD A;  3JS6 A;  3RSE A;  3P31 A;  2WUS A;  4FWP A;  5EOY A;  5M1O A;  1KQS M;  1Y1V A;  2OTL N;  1R9T A;  1SFO A;  3O9S A;  4BRL A;  2P9U A;  3HBT A;  4A62 A;  1Q82 O;  3CJ1 A;  4A5B A;  3DAW A;  3U9Z A;  3BUE A;  3TSU A;  3NUH A;  5BR9 A;  2W41 A;  1BWF O;  3GTL A;  3EE9 A;  1T44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...