1ZXOA

X-ray crystal structure of protein q8a1p1 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr25.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
265
Chain Sequence
LIADSGSTKTDWCVVLNGAVIKRLGTKGINPFFQSEEEIQQKLTAVYFYGAGCTPEKAPVLRRAIADSLPVIGNIKANSDMLAAAHGLCGQKAGIACILGTGSNSCFYNGKEIVSNISPLGFILGDEGSGAVLGKLLVGDILKNQLPATLKEEFLKQFDLTPPEIIDRVYRQPFPNRFLASLSPFIAQHLEEPAIRQLVMNSFIAFFRRNVMQYDYKQYPVHFIGSIAYCYKEILQDAARQTGIQIGKILQSPMEGLIQYHSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein Q8A1P1
publication title X-Ray structure of the hypothetical protein Q8A1P1 at the resolution 3.2A. Northeast Structural Genomics Consortium target BtR25.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 43
structure length 265
sequence length 278
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zxoA03
1QQMA 2P9KB 3WXJA 3D7EO 2A6AA 2E88A 3UKRB 1Y64A 3ZETA 2P9UA 2Q0RA 4K41A 3ULEA 4BRNA 1NGJA 2FSNA 5AQLA 4BROA 3TU5A 4BRFA 4A62A 4A2AA 3L6QA 2HF3A 2EWSA 4M63C 4BRKA 3QDKA 3A5MC 2HMPA 2BTFA 3U9ZA 2CGKA 4FWPA 4EIAA 1U2VB 5AR0A 5FPDA 1E4FT 5AQWA 2VCPA 3VEYA 1LOTB 2CGLA 1U6ZA 3ENHA 2FF6A 4DCHA 4FSVA 3WEEB 1RGIA 1P8ZA 3QFUA 2DPNA 3KHYA 3VEWA 2ZGYA 2P9LA 3DWLA 1NGCA 3KVGA 3WXIA 1NMDA 2NLXA 2Q0UA 2J4RA 3LDPA 3UE5A 4XH5A 3IUCA 4Z94A 3H45C 4CZIA 5FPMA 1TUYA 4EHTA 4H0PA 3LDQA 3HSCA 3W0LA 1GLBG 2YHWA 1XC3A 3LL3A 5AQSA 2GEMA 1GLCG 2V51B 4IWVA 3C7NB 1LCUA 2HOEA 1J6ZA 3QFPA 2QWPA 3S41A 3U8XA 3EKSA 5BREA 2ASMA 1YVNA 3C0BA 2CH6A 5EOYA 4PL7A 3D2FB 4FWQA 4XEIA 5AZIA 3TPQA 1RFQA 3LM9A 1SAZA 3F9MA 4BG9A 4H5RA 3DAWA 4EHUA 2NRHA 2Q36A 1Z6RA 4CZKA 3MDQA 1ZXOA 1E4GT 1JCEA 2YCHA 2OANA 5KPTA 3H1VX 3SLCA 3VESA 2P9NA 5FPEA 2H3GX 2I7PA 1H1VA 1HX1A 5E84A 3GL1A 1DEJA 4QS7A 2HF4A 1MWMA 4JHDA 3VEXA 3VERA 3B8AX 3A5NC 2Q31A 5BPLA 2GUPA 1NGBA 4BRQA 2BUPA 1NGHA 3VGMA 4K42A 3R9PA 2QM1A 2Q2RA 4RCHA 3FR0A 2AP1A 3O08A 1NWKA 4FWNA 2D0PA 2P9PB 4ISEA 1QZ5A 4WQ5C 4EFHA 2E2PA 3VF4A 1JCGA 5LY3A 3H46O 4H0TB 3D2EB 5AQJA 3HZ6A 2P9UB 1GLJO 1X9JA 1BUPA 1YUWA 3VEOA 4XH4A 4BC2A 5AFUH 2P9IB 4BR0A 3AARA 2ITMA 5BPNA 1K8KB 4BG8A 3CQYA 1KAYA 3FE1A 1TYQA 1R59O 3H6EA 3RSEB 3WQTA 1QQOA 4IZ9A 4CZEA 3M3ZA 5AQQA 4DQ8A 4H5VA 2FXUA 1HUXA 4QS8A 2IVPA 4FWRA 3R8EA 3WQUA 4BRAA 4CBWA 3ZX2A 4CZFA 4O8KA 4M7XA 4H0YB 3O6WA 2E2NA 3H3NO 3UKUA 3MN5A 4QS9A 4YDUA 5KPZA 3VGKA 2ZF5O 4BGBA 2P9SA 3HM8A 3G25A 3A5OC 4JAXA 4B1ZA 2ASPA 1X3NA 3SJHA 4CZLA 4FOEA 3BF1A 4MO5A 4BGAA 4JNEA 4CBXA 3M1FA 3ZEUA 3VEZA 4Y0WA 5AFUA 1NGGA 4BVPA 2FSJA 4CZMA 4KBOA 2F9TA 3CJ7A 5AQFA 4A61A 1XUPO 5TKYA 4BR7A 4EAHD 5AQPA 2D1KA 4K43A 3I33A 2P9KA 3ATVA 3WXLA 2QWRA 2NZTA 1JCFA 2UYTA 2V7YA 3UKRA 1CZAN 3AY9A 1BWFO 3BF3A 3OHRA 3ENOA 1T6CA 5EVZA 1QHAA 3R6MA 4FPBA 4J8FA 4PL8A 3LDOA 3W3DA 3A0IX 4F9OA 1GLEG 3L4IA 4H0OA 1DGKN 3MCPA 4H0XB 3CJBA 2Q1NA 4K25A 4I6MA 2P9NB 3WT0A 5BR9A 3VETA 4CZHA 3ZX0A 4FWKA 5JLHA 4IXCA 4WQ5A 3VF6A 1BG3A 3DXKB 4ISGA 3DXMB 1NGAA 5BN9A 1C0FA 3JXUA 3A8YA 2GWKA 2E1YA 4WQ4C 1WUAA 3EN9A 3GE1A 5AQUA 1GLAG 3FZHA 3WEEA 4BC3A 3DJCA 3VENA 4B1UB 4CBUA 1V4SA 1ATSA 4H5NA 4FWLA 3J8AA 4PKIA 3KZBA 5JMVA 3ID8A 4BRHA 5BPMA 1V4TA 1Z05A 3CJ1A 1NLVA 3IMXA 5AQKA 2Q97A 5F2RA 1EQYA 2VWBA 1KAZA 5AZJB 4AM6A 4B9QA 4BR5A 2I7NA 4JD2B 4MLEA 2YHXA 5B8HA 3C7NA 5EX5A 2YI1A 2A40A 3FFKB 4BRMA 4FWSA 3M6GA 2E20A 4IJNA 5AQTA 3AAPA 3O4WA 3QBWA 1G99A 3ZETB 2AA4A 3O5BA 3ULEB 4M7YA 3VPZA 4BRLA 4BVOA 3D2FA 2WUSA 5JLFA 2A41A 4RTFD 3SMSA 1KXPA 3EZWA 4L3QA 3HBTA 1D4XA 3H1QA 3LM2A 1C0GA 1WOQA 4BR9A 3CJCA 1NGDA 2GELA 2KHOA 5KPRA 1IG8A 3MN6A 3SK3A 1YAGA 1XQSC 4LC9B 3LDLA 1ATRA 3BUZB 3P4IA 5BRDA 1MWKA 4IO8A 3HTVA 3EO3A 5KQDA 2ZGZA 2E8AA 2VYPA 4H0VB 2D0OA 3EKUA 2P9PA 4CD3A 5BRHA 5AQOA 4MLHA 4WYBA 3UB5A 1ESVA 2P9LB 3QBXA 4FWOA 3SMPA 2E1ZA 2QWMA 3VOVA 3D2EA 3U9DA 3O1WA 4A2BA 1HKCA 4IJAA 1BA0A 2PAVA 4CJ7A 2F9WA 5AQRA 4WQ4A 5ELZA 2FF3B 2P9IA 3L0QA 3FZKA 5AQIA 5AQGA 5BRFA 2A42A 1K8KA 2ZWHA 4I6MB 2YHYA 5EXWA 4BQLA 4BQZA 5F0XA 1TUUA 3MK6A 4NO7A 3H3OB 4E1JA 3RSEA 3I8BA 5JICA 2QWQA 4BC4A 4GY2B 1ZBSA 4BRIA 3O80A 1YXQA 2QWOA 5AZIB 1BDGA 3LDNA 4BC5A 1SZ2A 2YJEA 4H5WA 3WXKA 5AQZA 3CIPA 5AQNA 5AQMA 5LJVA 3EL2A 1KAXA 2QW9A 4JN4A 4BRCA 5AQYA 1U2VA 3AAQA 1GLDG 2CGJA 1S22A 3FZMA 4B1XB 3CJAA 4JHDB 1IJJA 4HWIA 1NM1A 5AQVA 4AM7A 3QMLA 1NGIA 4CZJA 3CERA 4XH1A 2CH5A 3VF2A 3QICA 4CZGA 1HKBA 1MDUB 5I9EB 1SQKA 2D4WA 4PKGA 5E26A 1ZC6A 1DKGD 3IDHA 2W41A 1T6DA 1Q18A 4YDUC 4BRDA 4DHYA 1MA9B 4ISFA 4BRPA 4O5FA 3GG4A 4BREA 2E2QA 3HI0A 3VEVA 5ADXH 4MO4A 4B1YB 1BA1A 4FL9A 3QB0A 3ZX3A 4BRGA 1GLFO 5FPNA 4C23A 1ATNA 4NB4A 1NBWA 3U4LA 1NGFA 2ASOA 2IIRA 4BR4A 2FSKA 4FPAA 3CHWA 4GNIA 3MMVA 4CI6A 3GOIA 2PBDA 2V7ZA 4H5TA 4B1VA 5CE3A 2FLOA 1QZ6A 3O1BA 5EY4A 1HLUA 3CJ9A 3WUHA 4FWMA 5LJWA 4HTLA 3A5LC 4RWTA 3CETA 3MN9A 3FZFA 4BR2A 1RDWX 1TYQB 3MN7A 4FOIA 5BN8A 1OKJA 1BU6O 3DXKA 3DXMA 1GLLO 1HJOA 3IFRA 3GDQA 2YJFA 3VGLA 2GWJA 2QWNA 2W40A 2GTDA 3CQXA 1QQNA 1T44A 2A5XA 2V52B 2QWLA 5F1XA 3UKUB 1HPMA 1BO5O 5AQHA 3ATUA 5ADXA 2P9SB 1BOTO 3BP8A 1X3MA 2A3ZA 4PKHA 3FLCO 4H03B 3FGUA 5KQ8A 3ZEUB 2IVOA 3BEXA 4FO0A 3GBTA 3O8MA 5AQXA 5AZJA 3CI5A 4CD1A 1NGEA 4DB3A 2IVNA 3FZLA 3JS6A 4JD2A 1S3XA 2QXLA 4B1WB 2E2OA 1HKGA
chains in the Genus database with same CATH superfamily
3ZSWA 4Q5VA 4A3IK 1Y97A 4NLBA 3O9SA 2E88A 1CXUA 1XMQK 1S9GA 3UKRB 4CW7B 1Y1VA 1Y64A 1HR0K 3LAJA 4K41A 3ULEA 2HNDA 1T8EA 1O2AA 3OYCA 2FSNA 1D9FA 5AQLA 4Y52C 3MEDA 3VA7A 4C3HC 1C1BA 4A2AA 1BHLA 3PX0A 1VSDA 4O0JA 4OIOA 4M63C 4BE0A 4FJLA 4KN7A 3SUQA 2BTFA 2RE2A 4BDYA 3DOKA 3AA4A 4CEBA 1BCOA 4DMNA 3SJJA 3ZT0A 3HOUK 3DLEA 4C8LA 1QSSA 3OJUA 3AVHA 4FLTA 3GTPK 2OPSA 3VMFB 1J6WA 1RGIA 2NVQK 4IOAL 4KMUA 3DLGA 5JVGL 2FBVA 4LFCK 3T00A 3NH2A 5GINA 4Z94A 3FKIK 5M3MK 3H3VD 3T19A 4CZIA 5FPMA 1KCFA 4FJIA 3LDQA 2WB1L 1HNZK 5AQSA 2V51B 4IWVA 3CAGA 2E2HA 2HOEA 3VQ6A 1TKDA 4A57A 1NG9A 4P5AA 3VTHA 3S41A 4FZZA 3PIPL 4DR6K 3THWA 2R93A 2Y1IA 3B6PA 4DF4A 1EH1A 1I6HC 3DLBA 3CFPA 1SKSA 4XEIA 3ZT2A 3P1GA 1SAZA 4EHUA 4A3GK 2UXDK 2NRHA 2Q36A 3M5RA 1SMYA 4I9LA 1RILA 1JCEA 3AA2A 2O5IA 2OANA 2AJQA 1WSVA 4I2PA 4GVEA 3VESA 1KQSM 2JA6A 2H3GX 4FM2A 5C25A 2ZJRL 4JRPA 2E2IC 3SV3A 1RTHA 4G0WA 5E84A 3GL1A 4DFPA 1T03A 3CM5A 2IGIA 3CQZK 3B8AX 3DLLL 3PX4A 2GUPA 1NGBA 4BRQA 2BUPA 2HHTA 5FJ8K 1YHQN 2QM1A 1ZBFA 5C2FA 4HUFA 2AP1A 4N56A 4LJZA 4OIRA 4AILC 3TAGA 2D0PA 4A3DC 4ISEA 4I2QA 5DM6L 1QZ5A 1IBMK 2E2PA 4H8KA 3WXMB 4OGCA 1M90O 3D2EB 5AQJA 3L2RA 1JLEA 1IG9A 1VRTA 4DQRA 3RWUA 4RW9A 1WLJA 2QKKA 3M8RA 3LP2A 4LF8K 3VQBA 5C0YA 2P9IB 4BR0A 3V9XA 2VQFK 1VH2A 5BPNA 3VQEA 1K8KB 3RRHA 4B3TK 3M3YC 4PWDA 1TYQA 4KV8A 1OH6A 3WQTA 1QQOA 3J7ZO 3ASMA 1FKPA 1IW7A 5J2PA 1TWHA 4CFDA 4Q0BA 1Q81O 1IS1A 5IT9O 3CCLN 2KWAA 1R0AA 4FWRA 3R8EA 4DV7K 3G4AA 1UA1A 4CBWA 3M8SA 4CZFA 4CHYA 1NJYA 2HNZA 1VSEA 3HYFA 1XXAA 4Y7NC 3EEQA 2E2NA 3H3NO 3QEPA 1IBKK 4BGBA 4M3YA 3G25A 3A5OC 2R92C 4JKBA 2ASPA 4BBSC 3BF1A 2JA5C 5FROA 1R9TA 4JNEA 3KLEA 2VG6A 3VEZA 3HVTA 3VQPA 4DKWA 5AFUA 2OZMA 3J80O 5FLMK 1TWFC 1UA0A 4LF6K 2D0AA 2F9TA 4OINA 4QOZB 3AVMA 3IG1A 5CZ2A 3TAMA 4CJQA 5TKYA 1VQ4N 2R7YA 4A93C 3VA0A 2WFBA 3WXLA 1NJWA 4FW2A 3UKRA 5LMUK 4FK0A 4BXXK 3OHRA 3TAPA 2JA7A 1T6CA 4A3FK 5HL7L 4FPBA 4PL8A 3LDOA 1OH8A 4JYAK 3A0IX 3QNOA 4ZTJA 3TTCA 2JWKA 1DGKN 3HOZC 3H0GK 4CEAA 3QLHA 3WT0A 2F8TA 4ID5A 4CJVA 4IXCA 4LF4K 4WQ5A 3E1YA 1CXQA 3A2FA 2O4GA 2PY5A 5HRRA 3C65A 4FZBA 4C45A 4A3LC 1A5XA 2IAJA 4DR5K 3S1NK 3JXUA 2GWKA 4WQ4C 4GMJB 4C3JC 5AQUA 4KTQA 3CC4N 1JLAA 4U67L 1OH7A 1S1VA 4DV0K 3WNGA 4Z4HA 1U4BA 4PUOA 4B1UB 3KD1E 4NOIA 3J8AA 3GTKA 5E68A 1C1AA 1C6VA 4E7LA 5M1FA 2YKNA 1G15A 2A69A 3OBYA 5F2RA 3OYIA 2VWBA 1KAZA 2WBNA 5AZJB 3T69A 4FJ8A 5C3EK 4DTJA 2NRXA 4MLEA 2YHXA 5B8HA 4FM9A 4A3DK 5EX5A 3QNNA 1HYZA 4LR2A 2A40A 3T1YK 5M3FK 2VWKA 4FWSA 2E20A 1C0UA 1X31C 3S3MA 3QBWA 3PO5A 1BISA 4KTWA 1YT3A 2AA4A 3CM6A 4M7YA 3K59A 4DR1K 3WNHA 1HNXK 4RTFD 4CJPA 1F7VA 4YFNA 4LF9K 2XRIA 3HBTA 4K8ZA 3CF5L 3LM2A 3G10A 3CJCA 4DV3K 1ZYQA 4JI1K 4M3WA 1IG8A 4JS4A 4B3OA 3LDSA 1XQSC 1BQNA 3BUZB 3AD8C 1W7AA 5HRNA 1MWKA 4G0VA 2YU9C 4DU3A 1DCHA 3IRXA 2RH6A 3NF7A 4CGJA 3P83D 4H0VB 1HRHA 4Y7NK 1I50A 4UQGA 3TTFA 1VRQC 1W2BM 3EKUA 1RDCA 4AYBD 4JKHA 1S6QA 2P9LB 3SV4A 3EYZA 4ILJA 1VQ6N 3GTOA 2JA5K 2QWMA 3D2EA 4AHTA 3U9DA 1ZYRA 1TWFK 1NK9A 1BA0A 5TMFA 3Q3QA 3GTQC 2P9IA 4NYFA 3FZKA 5AQGA 2E2JK 3CG7A 4A93K 1WSJA 1K8KA 2ZWHA 4I6MB 3SQ2A 1RDDA 2IC3A 3GTLK 4NO7A 3H08A 3BDPA 4DUYK 3I8BA 4BWJA 3VQCA 2QEXN 1K73O 2E2IA 4BRIA 4CGFA 4FJ7A 3ZSQA 1RDBA 1Y1WA 1L0WA 4BC5A 1ISEA 3LWMA 5AQZA 1JXBA 1RNHA 1VAZA 3D0PA 5LJVA 4CHQA 5FLXO 3QEVA 5IP9K 1BQMA 1Y1VC 2CGJA 4C8OA 4XSXA 4CF2A 2YNFA 3SUPA 3KD5E 5GADP 3K57A 5AQVA 5C4XK 4GZYA 3QMLA 1NGIA 4C3JK 2NNWA 3KLFA 4J2BA 3ZSOA 3QICA 4CZGA 4LH4A 4DLEA 3BGRA 4RW8A 4LSNA 2P5GA 4O5FA 4NXMK 4EP5A 4RW6A 3ISNC 4XLNA 1NKBA 2ZUEA 4FLWA 4FK4A 3HJFA 5I42A 4LD0A 4FL9A 1VHXA 1YX2A 2E6LA 3C95A 5FPNA 1L5UA 2XY8A 1F21A 2BH1A 4O55A 3F5TA 3U4LA 2IIRA 5M1QA 3CXCM 3J7AP 3CHWA 3RVCA 3L2UA 2G8UA 3S16K 4DV5K 3NMUA 2V7ZA 4B1VA 3P38A 1VQKN 2FLOA 5EY4A 3CJ9A 2XCRB 5IYDC 4BR2A 3LAKA 3VA3A 3GTJK 2B4JA 4DS5A 3IFRA 3VGLA 4N47A 3LPTA 3SPZA 4KHPK 2GWJA 2QWNA 3CQXA 5KTQA 1O2BA 3ZSVA 4GFQA 2E2HC 3DMJA 2V52B 2QWLA 3I0RA 4ZH4A 2KFZA 1WOOA 2HBMA 3OYJA 3K0SA 3PLAA 3OYAA 1HPMA 3E9LA 1I3QA 4BY7K 2R93C 5ADXA 2P9SB 4GTBA 2NVXC 1X3MA 2B63K 1TL3A 2YNIA 3EQLA 1NK0A 3HT3A 1N36K 2G8HA 1F93A 5KQ8A 3ZEUB 3T01A 5HP1A 4IO9L 3O8MA 5AZJA 4CF1A 4C1NI 4OPKA 4JKEA 4F2RA 4CEDA 2JA6C 2QXLA 1QE1A 5MLCQ 4DSLA 3WXJA 2A6EA 3HRGA 1HNIA 2ZJPL 1IH7A 4BDZA 3F2KA 2V6SA 1TGOA 2Q0RA 2KFNA 5C2DA 2CW0A 4JI7K 4C3IC 1NGJA 4XLPA 4BROA 3GTQK 4A3EC 3L3VA 2X78A 1UOCA 2YNGA 2HF3A 2EWSA 1RBRA 4U7BA 3JYTA 3QDKA 3LZIA 3RZOC 4YORA 4IOXA 4LFAK 1VSIA 3ZSXA 3LALA 1WQGA 3LZJA 2G8VA 4X66K 4CHOA 1U2VB 1KTQA 4A3CK 3CCRN 5AQWA 2O8FA 1JL2A 4CJWA 1JXEA 4O2DA 1U6ZA 4CFAA 1T3VA 2DTUA 1WN7A 2FF6A 4FSVA 4OPJA 1NK4A 4Z4GA 4B9UA 4DU4A 3J81O 3SUNA 2W7VA 3V9WA 1P8ZA 1Q9YA 1YNJA 4TSXA 1VQ7N 3QFUA 2DPNA 1Y1VK 3VEWA 2P9LA 3HO1A 1NGCA 3AVGA 4B3RK 1YJ9N 3OREA 1WSGA 1NMDA 3LDPA 2DFHA 4X65K 3H45C 1BS2A 4JKAA 3NGIA 3DRPA 1X1PA 1WIHA 3KWGA 2VUMK 1U04A 4H0PA 2E5LK 1GLBG 3N3YA 2GEMA 5TJ3A 3CCSN 4C8NA 3KKRA 1N32K 2QWPA 1ZBLA 1S6PA 4H4OA 4AHSA 4E19A 2F8SA 5BREA 5CHIA 1R9TC 2HNYA 4KH5A 4CEOA 2R7ZA 3AD7C 5EOYA 1J9AA 4FWQA 3MX5A 3TPQA 3RMDA 1RT3A 3LM9A 4YFKA 1WCMA 2YU9A 3DAWA 4IKFA 4JI3K 4G1QA 3ZSYA 1Z6RA 3KKSA 2XY7A 2ZUFA 1VQON 1E4GT 1FW6A 4BACA 1XWLA 1O28A 2UUCK 2QXFA 4C8KA 3H1VX 4CJEA 3AQPA 1QTMA 2KW4A 4CF0A 2NVTK 1NJZA 3L2WA 4DR3K 3VEXA 3VERA 5BPLA 2E2HK 3O9UA 2LSNA 1S72N 3QX3A 3C6AA 1NGHA 1IBAA 4K42A 3GTMK 3OPFA 4M1XA 4ILGB 4RCHA 4FJGA 4A3KK 1VSKA 3S17C 4BY1K 4FJ9A 4JRQA 2R93K 5DK5A 1B4BA 5DM7L 4WQ5C 4IDHA 1RTJA 3IKMA 3VF4A 1EKEA 2P9UB 1S1UA 1YNNA 1IBLK 4P9SA 2NVYK 3V1QA 1GLJO 4MQ3A 1WSHA 2YHBA 2HSTA 3S1MC 4BC2A 1GOBA 5HBMA 1NK7A 1B4AA 2ITMA 3GTKC 4W5NA 3LWLA 4JLHA 4G0UA 4ELTA 3SNNA 3CQYA 1KAYA 3GEIA 3M8PA 3FE1A 3H6EA 1ASVA 3S1RK 4IZ9A 5HRPA 3M3ZA 4X64K 4DQ8A 4H5VA 4WF9L 4LF5K 2ITGA 1MU2A 2OPRA 3AVJA 4QS8A 1KSPA 3NCIA 3ZSZA 3CCVN 3NGZA 2O8CA 4BRAA 2EX3A 4N41A 4DV2K 1RBSA 3S15C 1RDUA 3OYHA 4A3MK 4KHUA 3MN5A 5CYQA 4KRFA 2ZF5O 3M4OK 2P9SA 2G8IA 3HM8A 4W5OA 2JGUA 1X9SA 1X3NA 3SJHA 1IKXA 1HNWK 2B5JA 3VQ4A 2GAHC 3G0ZA 3ZEUA 3S14K 4KREA 3K9KA 3SBGA 1NGGA 4DV1K 4OKJA 3S2DC 3AA5X 4AH6A 5AQFA 2YX6A 4B9TA 1WOSA 4BR7A 5AQPA 1TWHK 5A2QO 3K7AC 1J6VA 2NZTA 1JCFA 2UYTA 4OPAA 4CJ3A 1CZAN 1K83A 2A68A 4JI2K 1HQUA 5CHPA 4AHUA 5H1SQ 4IEIA 1WORA 1QHAA 1I50C 3R6MA 4IG3A 4KASA 1BIZA 3W3DA 1GLEG 4H0OA 3MCPA 4LY7A 5M1NA 3GTOC 3HOYK 1VQPN 1IE0A 3CJBA 1R9TK 2P9NB 4F8RA 4CJRA 4G7ZA 3VETA 4KATA 2RN2A 3KLHA 4V19S 4FWKA 2W6KA 4BY9C 1USOA 1BG3A 1V5VA 4ISGA 1S5JA 3AVBA 3AO2A 2OPPA 1Q7YO 3VQDA 2NVXA 1JLQA 5BN9A 1C0FA 3AVFA 2O8DB 1EETA 3M8QA 4OIPA 5IYBK 4CIGA 4KHSA 1ZBUA 4CBUA 1V4SA 4E3SA 4DQIA 3THVA 2JA7K 3FOFA 5JMVA 3ID8A 1ZBHA 4P5BA 4LF7K 2KTQA 4BRHA 4Q5SA 1Y1WC 5HOOA 4X6AC 3DRSA 4QJVB 3SZZA 1V4TA 3CJ1A 4HTUA 4KN4A 5JVOA 1EQYA 2WB1D 1HQMA 3TAEA 2P51A 2YI1A 1QQCA 3EE9A 4DWIA 3FFKB 1N33K 4BRMA 3M6GA 3MXIA 5C44C 2UU9K 1KD1O 1DLOA 4C2MC 1KC8O 3VPZA 4BVOA 3QESA 4CJKA 1VSHA 3AVAA 4E1NA 4DFMA 1WOPA 4DS4A 3O3GA 1JLCA 3H1QA 3BZCA 1C0GA 3GTKK 1LWFA 2GELA 2KHOA 1X9WA 5GIOA 3SK3A 3IPJA 3OTOK 1ATRA 3O4NA 2RPIA 4DSEA 3OYGA 4Y52K 4QIWL 4C3HK 3HTVA 3EO3A 5FRNA 3OBWA 1OVYA 4KI6A 4YOVA 4BWMA 2VYPA 2FBTA 3ULDA 3THYB 1HPZA 3CPEA 3KLGA 2NRZA 4Y1DA 3TABA 4AHVA 4CGHA 3NUHA 4WYBA 3UB5A 3QBXA 1S1WA 4KMDA 2E1ZA 4CGGA 1JJ2M 3VOVA 1NKEA 1LWEA 4FLXA 3CFRA 2HHHK 1XNQK 4O44A 4CJ7A 2F9WA 1EWRA 4DR7K 2FF3B 1I3QC 5M1OA 1IL2A 2A42A 1XNRK 5DMRA 4DTUA 3I8DA 4BQZA 4R79A 5F0XA 1BI4B 2DFEA 4FVUA 3K7AK 4JI0K 4FJJA 4YOWA 5LL6Z 1U47A 3P31A 5I3UA 3O80A 1YXQA 2QWOA 3HL8A 3OYFA 3OYKA 1BDGA 3LDNA 1VGXA 1JLFA 4E0DA 3AVIA 5CY4A 4H5WA 3GTOK 5AQNA 3SQ0A 4FJ5A 3N4PA 5D4DA 4JKGB 3EL2A 2QW9A 4BRCA 4KH6A 3LP3A 5AQYA 4KMHA 5IYCC 3AA3A 3QEIA 3CMAN 4OPHA 4CEZA 4BKWA 1J5OA 1I6HK 1S22A 4LK0A 3FZMA 4JHDB 3I4MC 1IJJA 4ZHRA 3TSUA 3CCJN 2ATQA 1WNSA 1YITN 3MAQA 4GKKK 1KFSA 3S1QC 1HKBA 2Z1GA 1SQKA 5E26A 3OYBA 1DKGD 3IDHA 1T6DA 4YDUC 2GSUA 4DHYA 5C10A 1VQ9N 3HP6A 3GG4A 2OPQA 2E2IK 4X6AK 3RZDC 1NK5A 1RT5A 2D5RA 1LAWA 1J5EK 1S1TA 4IEEA 3OYDA 4FM0A 3PX6A 4BR4A 2FSKA 1JOEA 4GNIA 3MMVA 4CI6A 2O8BB 3GOIA 4JK8A 3V4GA 2PBDA 4M3ZA 3HXAA 5JS2A 2WC9A 3O1BA 4QAGA 1HYVA 3KK2A 3WUHA 5LJWA 4RWTA 3CETA 3FZFA 1CZBA 3RRGA 5SWMA 1C0AA 1BU6O 1GLLO 1RBUA 3GDQA 3G6EN 3R3LA 2GTDA 4J3NA 4BBRC 2XY5A 1T44A 2KZMA 1O13A 4ILDA 5F1XA 4MFBA 4CK1A 4FJXA 3E9OA 4M42A 3UKUB 3O3FA 3M3YK 5AQHA 4CHZA 4MQ9A 4A3JC 2R7ZC 3HPHA 1EX4A 4HHTA 1O1WA 1WCMC 4QJVA 3AGKA 2IVOA 1YJNN 1JVIA 5M5YK 4BLBA 4CD1A 3C6UA 2P5OA 1NGEA 1VSJA 3OYMA 2GV9A 5GAHP 1EQRA 2VGNA 1RBTA 4B9LA 3S9HA 2R92K 1QQMA 1KVCA 1Q82O 4BBSK 3D7EO 2A6AA 4KM9A 1ASUA 4IFYA 5J2QA 3C94A 4BRNA 5IP7C 4HUEA 3NAEA 5K14A 4JI5K 4OLAA 1BGXT 4NYNA 3L6QA 3ZCMA 3SAFA 1XZPB 3KWIA 4BRKA 4CHPA 5HLFA 4LK1A 1TKZA 4KAWX 3N0BA 4Q4ZA 4CERA 3ERED 3U9ZA 1A5VA 4AF1A 2CGKA 4FWPA 4EIAA 3VQ8A 2A1RA 1E4FT 2VCPA 1TKXA 3NH0A 4I9QA 2OCEA 1N34K 4DCHA 3E9PA 3WEEB 1C0TA 3HOZK 4FYDA 4O5BA 3A8IA 2PMZL 4IOCL 5IOQA 1WQHA 3HM9A 2ZGYA 3VQ9A 4GV6A 3I4MK 4A3LK 2J4RA 4CIFA 3UE5A 4XH5A 4E7IA 4E1MA 3ENBA 4C1NK 4CE9A 1TUYA 3AGRA 4DTSA 3E66A 4B9MA 1EXQA 3ALYA 3HSCA 5M1PA 3LL3A 3HXMA 2O8EB 1GLCG 3AH5A 3C7NB 5SZTA 3JSMA 1LCUA 3SAGA 1TL1A 3MEEA 4Z4IA 3EKSA 2NRTA 2V6UA 3D6RA 2HHQA 2ASMA 1YVNA 3EY1A 2CH6A 1SV5A 2IOCA 3D2FB 3HOWC 1O24A 3RR8A 1RFQA 5M1KA 1L3UA 4M3RA 4H5RA 4LSLA 2B6AA 2JWLA 3MDQA 4KPYA 2HHUA 2YCHA 2QTDA 4JKGA 5KPTA 1EFWA 5FPEA 3N0CA 2F96A 2I7PA 4KM8A 1D8YA 2HMIA 1P90A 2NUBA 1HX1A 1K83C 3PO3C 2HF4A 1MWMA 4JHDA 3ZT1A 3PO4A 4M3XA 4CJ4A 2I5JA 4FZXC 2Q3SA 4NXNK 3KK3A 2VQEK 1OH5A 1Z26A 3CC7N 2Q2RA 2ZD1A 3LPXA 1NWKA 3F9KA 1XZQB 3IAYA 4N76A 1RT1A 1VRUA 2IS3A 3WNEA 2P9PB 5L46A 2DFFA 3S2HC 1XC9A 1JCGA 5LY3A 4O4GA 1WCMK 3C6HA 3H46O 2YU9K 2UUAK 3HZ6A 3ZSRA 5KRSA 3G4SN 2PA8L 4XSZA 2NRRA 1EO1A 4MEYA 1X9JA 5J2MA 3VEOA 4DFJA 4XH4A 3TAQA 3AO5A 3TWHA 2O8BA 4B9NA 1NJIO 3MWTA 2XY6A 1NNEA 3AV9A 5JFEA 4KB4A 3S3NA 4JEPA 3VTIA 1W9HA 3SZYA 5C12A 3AD9C 4DSIA 4DTPA 1R59O 2IDOA 3B6OA 3KIOA 1SFOC 3EE8A 4AHRA 1TWGA 2KZZA 5AQQA 2FXUA 3GTLA 1TWAA 3BZKA 2E4LA 4ID1A 3GSIA 1E3MA 4XCHA 1RT7A 3WQUA 2O4IA 3ZX2A 4PAAA 3CFOA 4O8KA 4Z4EA 4M7XA 4H0YB 3O6WA 4G9ZA 3UKUA 3SQ1A 4YDUA 1J53A 4OX9K 5KPZA 3VGKA 2RKIA 2GUIA 4B1ZA 1BGWA 4FOEA 3O9TA 4MO5A 4BGAA 3U6FA 4CBXA 3M1FA 2UUBK 1LWCA 5EGHA 3JAMO 3EZ5A 1NOZA 4BVPA 1M1KO 2FSJA 4CZMA 4L8RB 1DTTA 4ELVA 4CJSA 1TK8A 2BE2A 1FKOA 5C24A 2BDPA 3BP8C 4QCLA 3THWB 3I33A 3OS2A 4CJUA 4DV6K 2RGRA 2XO7A 1L3SA 4JS5A 4DR4K 3AY9A 2OYQA 1BWFO 4M45A 4FM1A 3ENOA 5EVZA 4K0KK 4FZYA 1UWBA 4LFBK 3GTPC 3IS9A 4KKOA 3HSTB 4F9OA 2YKMA 3BP3A 1DCPA 3F73A 1HNVA 3CQ8A 1J54A 5IOTA 4PY5A 3KLIA 4K25A 4I6MA 4CZHA 3ZX0A 3QETA 1LW0A 2G8KA 3MX2A 3DXKB 4R5PA 3DXMB 1UV7A 4DSJA 4M3UA 3NVKA 3FKIC 3A8YA 1I94K 2E1YA 1WUAA 3EN9A 3NGYA 3FZHA 3NF8A 3JSTA 3WEEA 4BC3A 3PIOL 3GDZA 3DJCA 2HB5A 1T05A 2QKBA 1W97L 2UXBK 3K58A 5IYDK 1DTQA 1C0MA 4A3BC 2OTJN 4H5NA 4HUGA 1WSRA 3SBTA 4MDBA 2FQTA 3PO3K 4PKIA 2CFAB 4FVMA 4B08A 3SQ4A 4PQUA 5BPMA 4CJFA 3CC2N 4NLCA 3IMXA 2Q97A 4B9QA 2B63A 3V1RA 1LW2A 2VG5A 2O8EA 2I7NA 3AVCA 4JD2B 2WTUA 4F3OA 1O29A 4A3GC 3C7NA 3QEWA 3V81A 1F9NA 4JK1A 4AHCA 4JI6K 4KB1A 2NVXK 4JKCA 5KRTA 1DT9A 1BCMA 3NHGA 3O4WA 1ZVUA 3ZETB 4BRLA 3D2FA 1HQEA 2WUSA 3AO1A 1KXPA 3KK7A 1KVAA 3EZWA 5AJ3K 2WONA 2JA6K 1D4XA 3U3GA 1YF5L 1NK8A 4BR9A 4CHNA 3L3UA 1RBVA 1VQ8N 2Y1JA 3T7ZA 2V6TA 4M41A 3HOVC 1USMA 3QIPA 2PZSA 1TK5A 3MN6A 1YAGA 4OLBA 1WB9A 2PYJA 3LDLA 3GTGA 4CF9A 3PUFA 1LV5A 4C3IK 2HBJA 4IO8A 3T1HK 4JI8K 4A3EK 3CYMA 3CMEN 4DU1A 3VN5A 3DM2A 3L8BA 3HK2A 1B9DA 2E8AA 3SAHA 3RZOK 2BANA 4LLGA 4YHHK 1XZQA 3GEHA 3QINA 1L3VA 3DXJA 5KGWA 2P9PA 4MLHA 3SCXA 1ESVA 1BDFA 2HHWA 2QA4N 3I0SA 1ASWA 3A8JA 1KLMA 4F2SA 1TV6A 3K5LA 1K6YA 4Z0UA 4IJAA 1S1XA 1JL1A 3OVNA 3DOLA 5ELZA 3L0QA 2VUMA 3N4QA 4FCYA 3CPWM 4KC6A 3L2QA 4G7OA 2YHYA 4BQLA 1ITGA 3H3OB 4CCHA 3PV8A 4NCGA 3I4NC 5JICA 3L2VA 5GAEP 4BC4A 3V9UA 1ZBSA 3THXB 3ID6A 1YIJN 5AZIB 3SPYA 2YHAA 2PHCB 1EWQA 4IFEA 5FLMC 3TARA 1RT6A 1FJGK 3DLKA 1KAXA 4JN4A 2JLEA 1RCHA 1U2VA 3AAQA 4CFCA 1GLDG 4FLZA 4FLVA 4DQQA 5KI6A 3VQAA 3VQ7A 3CCMN 2JA8C 4B1XB 3VQQA 4HWIA 4AM7A 3CERA 3TTGA 4BXXC 4A5AA 2CH5A 3NFAA 3VF2A 1TWCA 4DTMA 2D4WA 1KVBA 4N5SA 4A3FC 1Q18A 2O5JA 4A3BK 3GTMA 4BREA 3H0GC 4IDKA 4PA1A 2E2QA 3K5NA 1WBBA 3HI0A 1B9FA 3VEVA 4IG0A 1BA1A 1Z25A 4B1YB 3S3OA 1GE9A 3QB0A 3ZX3A 4BRGA 4KHWA 2GAGC 1GLFO 1SFOA 3FHZA 4C23A 1IV0A 3MXJA 4DLGA 1NBWA 5FRMA 2ASOA 3S1NC 4YFXA 3S17K 2NVYA 1SKRA 4H5TA 3NF6A 5BR8K 2HHXA 3D45A 4CGIA 1I39A 4GV3A 1HLUA 3A5LC 1F7UA 3MN9A 4YFUA 1RDWX 5GAGP 3MN7A 3ADAC 2KQ2A 2GBZA 4Z4FA 2QK9A 1OKJA 1RU0A 3DXKA 5C42A 1QSYA 1O26A 3DXMA 2YJFA 2FC0A 3S1MK 3OYNA 1A5WA 3SZ2A 1VSMA 1OVQA 4KHNA 2Y3PA 4GTFA 2A5XA 1QHTA 5C3EC 2ETJA 5TKWA 1IO2A 3HOVK 4DQSA 5M5XK 1RDAA 4RW4A 4W5RA 4KMAA 3G71N 3U3YA 4GTEA 3NDKA 3BP8A 2CFAA 1HJRA 4H03B 3KTQA 3FGUA 5HRSA 4GT9A 1EK8A 1AB4A 1WAFA 1IKYA 3OW2M 2GSNA 3GBTA 3S15K 3FZLA 1X9MA 4JD2A 2HHSA 5CZ1A 3L4JA 3GTPA 2DY4A 1VQLN 4B1WB 2E2OA 3O3HA 2JH3A 2P9KB 4JKFA 5JS1A 2F7TA 3P5JA 3ZETA 4NCBA 2P9UA 2KLAA 3MWPA 1KLNA 3S2DK 4GW6A 3TU5A 4BRFA 4WFBL 4FJKA 1O25A 4OIQA 4A62A 1U49A 1J6XA 5M5WK 4JK7A 3FKIA 2HBLA 1SUQA 3A5MC 2HMPA 4E89A 1KQ4A 5CYMA 4UY8O 3I4NK 2UXCK 5AR0A 4Z4CA 5FPDA 4LOWA 3VEYA 2ZQBA 4OO1J 1LOTB 2CGLA 2ZE2A 3ENHA 1TAUA 3PO2C 1I50K 3HOSA 4QIWD 4JKDA 4DTXA 2Z1IA 1YI2N 3HVRA 3T02A 3Q7CA 1PJ5A 5KGXA 3OS0A 3MECA 2OZSA 2E2JC 3KHYA 3DWLA 3KVGA 3GIRA 3WXIA 1TWGC 2JA8K 2Q0UA 2D0CA 2NLXA 2ZFZA 4FLYA 3GTLC 1TWAC 1W0HA 3DYAA 3IUCA 3CCQN 1JLGA 4EHTA 2W6LA 1CZ9A 4O8UA 3W0LA 2YHWA 4YNQA 3QO9A 1XC3A 4YOXA 3CQZA 2PYLA 4FW1A 1J6ZA 3VQ5A 3QFPA 4CK3A 3OYLA 4B3MK 3NVMA 1VJEA 3U8XA 2YNHA 5IP9C 1Y1WK 3LANA 3LP1A 3O4QA 3C0BA 1I6VA 2X6NA 3S0XA 3PSFA 5C4JC 4PL7A 3THXA 4JI4K 5AZIA 5C4XC 1DCOA 4BG9A 3F9MA 1WQFA 3NBPA 1QVGM 4FXDA 4CZKA 1ZXOA 3WNFA 1PJ7A 3DI6A 1QS4A 5C44K 1SL1A 3SLCA 2P9NA 4GTDA 3QERA 1ZQ1C 1H1VA 4C2MK 4DDQA 1DEJA 4QS7A 1INNA 4W5QA 3P39A 3A5NC 2Q31A 4DG1A 5J1EA 2EHGA 1TKTA 3VGMA 1WSFA 3R9PA 2O8DA 3FR0A 3O08A 3AO3A 3HPGA 4AYBL 1VQ5N 3CCUN 1T7PA 4FWNA 3S16C 1UAXA 3TFJA 4EFHA 1PJ6A 1L3TA 3LPUA 4H0TB 4OJRA 4GTAA 1VSFA 3BY5A 3GTJC 4YOTA 3RMCA 3AQOA 1BUPA 5FDLA 2XCOA 4B8CA 1YUWA 4WCEL 3OA9A 1JKHA 5AFUH 3RMAA 4RMFA 1KFDA 4M3TA 3AARA 4ICLA 3SUOA 3R1XA 5CJ9A 3FFIA 2VGMA 4CEQA 4BG8A 4WFNL 4BY7C 1LAVA 3RSEB 4AH9A 4CZEA 3RMBA 2O8FB 3AVLA 3MMLB 2B63C 2RHKA 4WJ4A 1HUXA 4DSFA 2IVPA 1I3QK 3I56N 4EP4A 1K8AO 4OKKA 4QS9A 3MXMA 1XPPA 1B92A 4FJHA 2ZM6K 4JAXA 4YY3K 3H0GA 5CR4A 4CZLA 3J7YP 1SS6A 3L4QA 3OS1A 2BGGA 3PO2K 3TTDA 3KK1A 1HI9A 5D3GA 1YTUA 1S9EA 4Y0WA 1GOAA 1XHXA 4KARA 4KBOA 3CCEN 3CJ7A 5EU7A 4O0IA 3THYA 2ZJQL 4DUZK 1SL2A 1BJTA 5IYCK 4A61A 1XUPO 4GV9A 4EAHD 4PABA 5C15A 3GTGC 1TWGK 2D1KA 4K43A 1IQ0A 1TWAK 2P9KA 3ATVA 1WBDA 4EZ9A 2QWRA 4E7JA 4B9VA 4JV5K 4KDDA 4CK2A 2V7YA 1O2FB 4A3CC 2G8FA 1NJXA 3BF3A 5GIPA 3QEXA 4MDAA 1VLOA 3S1QK 3I55N 2Z1JA 4GKJK 3OJSA 1JLBA 1FXXA 1YJWN 4GVMA 4J8FA 4Y1CA 2BE5A 3NH1A 4ZTFA 2X6SA 3L4IA 4A5BA 3V9ZA 1BIUA 3E01A 4H0XB 4CESA 2HW3A 3C6TA 5BR9A 2Q1NA 1U45A 4KAZA 1BI4A 1IKVA 3RZDK 2G8WA 5JLHA 3GEEA 4FLUA 5C4JK 4JK9A 3VF6A 2PFUA 3TFHA 1NGAA 4H4MA 2HVIA 1RT2A 1XXCA 2GX9A 1DD5A 4KO0A 5IORA 4CF8A 3GE1A 3NE6A 3G4CA 2VUMC 1TVRA 1GLAG 3NF9A 2D6FC 1VQNN 4CECA 2EBBA 1N8RO 2PMZD 3VENA 4WE1A 4I7FA 4DFKA 3BUEA 3OEPA 1ATSA 1C1CA 4GTCA 4FWLA 3KZBA 2HBKA 4OGEA 4A59A 4IBNA 1K9MO 3QIOA 1Z05A 4BBRK 1NLVA 5AQKA 4AM6A 4PHTX 3K2PA 4BR5A 2HHVA 4DF8A 2OA8A 4J2EA 1D9DA 4DTOA 4A3JK 2R7ZK 1VQMN 4IJNA 1WSIA 5AQTA 3HOXC 4HCCA 3AAPA 3TSPA 3ZT3A 3PY8A 2P5MA 2Y0SL 1G99A 3RR7A 1EP4A 2NVTC 4CGDA 3V1OA 4ILHA 3ULEB 3O5BA 3DLHA 1TWCC 2R92A 2P8TA 1N5YA 5JLFA 1O27A 2A41A 3SMSA 3FOEA 2W42A 1Q86O 4EZ6A 2JA5A 4X62K 4L3QA 2O8CB 2VG7A 4CJTA 3OY9A 1Q8IA 4E7HA 4C8MA 3GTMC 4BE1A 4DSKA 1WOQA 1TWFA 4KH4A 3O9QA 4A3KC 3HKZL 1NGDA 1VSLA 1ILYA 4BY1C 5LMNK 5KPRA 3MCAB 3TFIA 4LC9B 3SI6A 1RTDA 5IP7K 1NKCA 2A1SA 1G51A 3P4IA 3K5MA 5BRDA 2FQOA 4CEFA 2RF2A 2NVYC 4BLAA 5KQDA 3V6DA 4LQYA 2ZGZA 4LH5A 1NMNA 1NK6A 2D0OA 1D5AA 4ELUA 4OVLA 2FBXA 5BRHA 4CD3A 3LAPA 5AQOA 5JVHL 4FWOA 4BE2A 2E6MA 3LP0A 3SMPA 1YCLA 4KB2A 4A3IC 4IFVA 2Y0SD 3S1RC 3O1WA 4A2BA 2XHBA 5HROA 2PA8D 1HKCA 3ITHA 1YVUA 2KKZA 3O9RA 1WSEA 3AO4A 4HCBA 2PAVA 4B9SA 1YTAA 5AQRA 4YG2A 1XHZA 2GSOA 4WQ4A 2VWJA 4FJMA 5AQIA 4F4KA 5BRFA 4MEXA 3GTGK 2A6HA 3HKZD 4A3MC 5EXWA 3TAFA 2QI2A 1TUUA 3MK6A 2XCQA 4AQYK 4E1JA 4W5TA 3RSEA 4KHQA 3MEGA 3TR8A 3M4OC 1XMOK 2QWQA 5T7BA 4GY2B 4CEEA 3AVNA 4DTRA 5EGEA 3HOUC 3A8KA 4HVJA 5HL8A 3S14C 4WJ3M 1U48A 1SZ2A 2YJEA 4YOUA 3WXKA 2FBYA 4CIEA 4CVNE 3CIPA 1TK0A 3LAMA 4BDPA 1XZPA 5AQMA 3SYZA 4WILA 4G7HA 3UIQA 2NVQC 4CFBA 2WAQL 2WOMA 4E7KA 2Z1HA 1TWHC 4FK2A 4OKEA 2F4VK 5J2NA 3HPOA 1J98A 3CJAA 1QVFM 1JQWA 3HOWK 1NM1A 3DRRA 4J2AA 2OTLN 4CZJA 4NCAA 4XH1A 4KTZA 1MDUB 5I9EB 3GTJA 2NRWA 4PKGA 1ZC6A 2W41A 4B8AB 2PPBA 4BRDA 1MA9B 4ISFA 4BRPA 1NOYA 1RTIA 5IWAK 1K83K 3HOYC 1SL0A 2NRVA 5ADXH 4MO4A 5IOSA 1VK0A 4RW7A 3ZT4A 4GTLA 1N6QA 1XI1A 3HP9A 1ATNA 4NB4A 4J2DA 1NGFA 4FPAA 1CLQA 3ZYYX 5E41A 4WFAL 3V9SA 4RG8A 4KFBA 3S2HK 5CE3A 1QZ6A 5IYBC 3H3VL 3HOTA 4KHYA 3HOXK 4FWMA 3AVKA 4HTLA 1EI6A 2X74A 2HVHA 4FOIA 1TYQB 5BN8A 3T3FA 1HMVA 2WAQD 4K8XA 1TWCK 4DTNA 4DR2K 2JA7C 2P1JA 4DQPA 1HJOA 2YV0X 1TAQA 2W40A 3K5OA 4B3SK 4XIUA 3L4KA 3CQZC 1IKWA 1QQNA 3PSIA 1REVA 1QSLA 3KJVA 1XXBA 4YOYA 4CJLA 1GOCA 3CD6N 1Q9XA 3GTQA 3V4IA 1BO5O 3DLRA 3OYEA 3ATUA 1SFOK 1BOTO 2D0BA 1RT4A 5TMCA 1ZBIA 2A3ZA 4PKHA 3FLCO 4KI4A 3TSQA 4KB0A 1BL3A 3RTVA 1HYSA 3Q7BA 3BEXA 4FO0A 4DV4K 5AQXA 3CI5A 3TI0A 4DB3A 2IVNA 1FK9A 1SKWA 1KRPA 3WODA 3JS6A 3K9JA 1S3XA 4F3TA 1NU0A 3T1AA 4FJNA 4CJ5A 3ZLJA 3TANA 1I3AA 1WAJA 1HKGA
chains in the Genus database with same CATH topology
5MLCQ 1QQMA 1Q82O 2XCRB 2P9KB 3WXJA 3D7EO 4JKFA 4NLBA 2A6AA 3HRGA 3O9SA 2E88A 2F7TA 2ZJPL 4KM9A 3F2KA 3UKRB 1Y1VA 1Y64A 3ZETA 3LAJA 2P9UA 2Q0RA 2KLAA 4K41A 3ULEA 4BRNA 5C2DA 1O2AA 4C3IC 1NGJA 2FSNA 3MWPA 5AQLA 4BROA 3TU5A 3VA7A 4BRFA 4WFBL 4C3HC 1O25A 4A62A 4A2AA 3L6QA 4JK7A 3FKIA 2HF3A 2EWSA 3SAFA 4M63C 2HBLA 4U7BA 3KWIA 3QDKA 4BRKA 3A5MC 2HMPA 4KAWX 2BTFA 3N0BA 4YORA 4IOXA 1KQ4A 2RE2A 3ERED 3U9ZA 4AF1A 1WQGA 2CGKA 4FWPA 4EIAA 4UY8O 1U2VB 5AR0A 5FPDA 1E4FT 5AQWA 3CCRN 2VCPA 3VEYA 4OO1J 1LOTB 2CGLA 1U6ZA 3ENHA 1T3VA 3HOSA 2FF6A 4DCHA 4FSVA 3E9PA 3VMFB 3WEEB 4JKDA 1RGIA 1YI2N 1P8ZA 4IOAL 4IOCL 1VQ7N 5IOQA 3Q7CA 5JVGL 1WQHA 3QFUA 2DPNA 3KHYA 3VEWA 2ZGYA 2P9LA 4GV6A 3DWLA 1NGCA 3KVGA 1YJ9N 3OREA 3WXIA 1NMDA 2NLXA 2Q0UA 2J4RA 3LDPA 2ZFZA 5GINA 3UE5A 4XH5A 3IUCA 4Z94A 3CCQN 3H45C 3ENBA 4JKAA 4C1NK 1WIHA 4CZIA 5FPMA 3KWGA 1TUYA 4EHTA 3AGRA 3E66A 4H0PA 4O8UA 3LDQA 3HSCA 3W0LA 1GLBG 2YHWA 5M1PA 1XC3A 3LL3A 5AQSA 3N3YA 2GEMA 1GLCG 4YOXA 3CQZA 2V51B 4IWVA 3AH5A 3C7NB 3CAGA 3CCSN 5TJ3A 1LCUA 2HOEA 1J6ZA 2E2HA 3QFPA 4A57A 2QWPA 3SAGA 4P5AA 3NVMA 3VTHA 3S41A 3U8XA 3EKSA 3PIPL 5BREA 2NRTA 5CHIA 3D6RA 2R93A 1EH1A 2ASMA 1YVNA 4KH5A 3C0BA 2R7ZA 3S0XA 2CH6A 5EOYA 4PL7A 3D2FB 4FWQA 3MX5A 4XEIA 1O24A 5AZIA 3TPQA 1RFQA 5M1KA 3LM9A 1SAZA 3F9MA 4BG9A 1WCMA 4H5RA 3DAWA 1WQFA 2YU9A 4EHUA 1QVGM 2NRHA 2Q36A 1Z6RA 2JWLA 3M5RA 4CZKA 3MDQA 1ZXOA 1VQON 1E4GT 1JCEA 2YCHA 2QTDA 1O28A 2OANA 4JKGA 5KPTA 3H1VX 4GVEA 3SLCA 3VESA 2P9NA 5FPEA 2H3GX 1KQSM 3AQPA 3N0CA 2I7PA 4GTDA 2ZJRL 4KM8A 1H1VA 1P90A 1HX1A 4G0WA 5E84A 4DDQA 3GL1A 1DEJA 4QS7A 2HF4A 1MWMA 4JHDA 3VEXA 3P39A 3VERA 3B8AX 3A5NC 2Q31A 5BPLA 2GUPA 3DLLL 1NGBA 3O9UA 2BUPA 4BRQA 1S72N 3QX3A 3C6AA 1NGHA 3VGMA 4K42A 3R9PA 3OPFA 1YHQN 2QM1A 4ILGB 2Q2RA 4RCHA 3FR0A 5C2FA 3CC7N 2AP1A 3O08A 3LPXA 1NWKA 1VQ5N 3CCUN 4FWNA 2D0PA 2P9PB 4ISEA 1B4BA 5DM6L 1QZ5A 4WQ5C 4IDHA 5DM7L 4EFHA 3IKMA 2E2PA 3VF4A 1JCGA 3WXMB 5LY3A 3C6HA 3H46O 1M90O 4H0TB 3D2EB 5AQJA 3HZ6A 2P9UB 3G4SN 4GTAA 2NRRA 1GLJO 1EO1A 4YOTA 1X9JA 3AQOA 1BUPA 2XCOA 1YUWA 3VEOA 2HSTA 4XH4A 4WCEL 3OA9A 4BC2A 5AFUH 5C0YA 2P9IB 4BR0A 1B4AA 1NJIO 3MWTA 3AARA 5JFEA 2ITMA 3R1XA 4KB4A 5BPNA 5CJ9A 4JEPA 3VTIA 2VGMA 4G0UA 1K8KB 4BG8A 3CQYA 5C12A 1KAYA 4WFNL 1TYQA 1R59O 3FE1A 3H6EA 3RSEB 3WQTA 1QQOA 4IZ9A 4CZEA 3J7ZO 3M3ZA 3EE8A 1TWGA 3MMLB 2RHKA 5AQQA 4DQ8A 4H5VA 1TWHA 2FXUA 4WF9L 1TWAA 3GTLA 1Q81O 1IS1A 1HUXA 4QS8A 3CCLN 2IVPA 2KWAA 4FWRA 3CCVN 3R8EA 3WQUA 4BRAA 3I56N 3G4AA 4CBWA 3ZX2A 4CZFA 1K8AO 1RDUA 4O8KA 1XXAA 4M7XA 4H0YB 3O6WA 4G9ZA 2E2NA 3H3NO 3UKUA 3MN5A 4QS9A 4YDUA 5KPZA 3VGKA 2ZF5O 4BGBA 2P9SA 3HM8A 3G25A 3A5OC 4JAXA 4B1ZA 4JKBA 2ASPA 1X3NA 3SJHA 3H0GA 5CR4A 4CZLA 4FOEA 1SS6A 3L4QA 3O9TA 1BGWA 3BF1A 4MO5A 3TTDA 4BGAA 1R9TA 4JNEA 4CBXA 3M1FA 3ZEUA 3VEZA 5EGHA 4DKWA 3K9KA 4Y0WA 3SBGA 1NGGA 5AFUA 4BVPA 1M1KO 2FSJA 4CZMA 4KARA 4KBOA 2F9TA 3CCEN 3CJ7A 5AQFA 2YX6A 2ZJQL 1BJTA 4A61A 1XUPO 4GV9A 5TKYA 4BR7A 4EAHD 5C15A 1VQ4N 5AQPA 2D1KA 4K43A 3I33A 2P9KA 3ATVA 2WFBA 3WXLA 2RGRA 2QWRA 2NZTA 4KDDA 1JCFA 2UYTA 2V7YA 4OPAA 3UKRA 1CZAN 3AY9A 2JA6A 1BWFO 3BF3A 5GIPA 3OHRA 4MDAA 1K83A 3I55N 2JA7A 3ENOA 1T6CA 5CHPA 5EVZA 5H1SQ 4IEIA 1QHAA 1YJWN 5HL7L 3R6MA 4FPBA 4J8FA 4PL8A 3LDOA 4KASA 3W3DA 3A0IX 4F9OA 3TTCA 1GLEG 3L4IA 4H0OA 2JWKA 1DGKN 4A5BA 3MCPA 5M1NA 4H0XB 5IOTA 1VQPN 3CJBA 2Q1NA 4K25A 4I6MA 2P9NB 3WT0A 5BR9A 3VETA 4CZHA 4KATA 3ZX0A 4FWKA 5JLHA 4BY9C 4IXCA 4WQ5A 3E1YA 4JK9A 3VF6A 1BG3A 2PFUA 3MX2A 3DXKB 3C65A 4ISGA 4FZBA 3DXMB 1NGAA 1Q7YO 1XXCA 2NVXA 3NVKA 2GX9A 5BN9A 1DD5A 1C0FA 3JXUA 3A8YA 2GWKA 2E1YA 4WQ4C 5IORA 1WUAA 3EN9A 3GE1A 3G4CA 4C3JC 5AQUA 1GLAG 3FZHA 3CC4N 3WEEA 4BC3A 3PIOL 4U67L 3DJCA 1VQNN 1W97L 1N8RO 3VENA 4B1UB 4CBUA 3BUEA 3OEPA 1V4SA 1ATSA 2OTJN 4H5NA 4GTCA 4FWLA 3SBTA 3J8AA 4MDBA 3GTKA 4PKIA 3KZBA 2HBKA 5JMVA 3ID8A 2CFAB 4P5BA 3FOFA 4BRHA 5BPMA 4A59A 5HOOA 5M1FA 1V4TA 1K9MO 3CC2N 1Z05A 3CJ1A 1NLVA 3IMXA 3OBYA 4NLCA 2Q97A 5AQKA 1EQYA 2VWBA 1KAZA 2WBNA 5F2RA 5AZJB 3T69A 4AM6A 4B9QA 4PHTX 2B63A 4BR5A 5JVOA 2NRXA 2I7NA 4JD2B 4MLEA 2YHXA 1O29A 5B8HA 4FM9A 3C7NA 5EX5A 2YI1A 4LR2A 2A40A 3EE9A 1F9NA 3FFKB 4BRMA 4FWSA 3M6GA 2E20A 1VQMN 4JKCA 4IJNA 1DT9A 5AQTA 3AAPA 3TSPA 2P5MA 3O4WA 3QBWA 1G99A 1KD1O 1ZVUA 3ZETB 4ILHA 2AA4A 3O5BA 3ULEB 1KC8O 4M7YA 4C2MC 2R92A 3VPZA 4BRLA 4BVOA 3D2FA 2WUSA 5JLFA 1O27A 2A41A 4RTFD 3SMSA 1KXPA 3FOEA 1Q86O 2JA5A 3KK7A 3EZWA 4L3QA 3HBTA 1D4XA 3H1QA 3CF5L 1YF5L 3LM2A 1C0GA 1WOQA 4KH4A 4BR9A 1VQ8N 3O9QA 3CJCA 1TWFA 4M1XA 1NGDA 1ILYA 3T7ZA 2GELA 2KHOA 5GIOA 5KPRA 1IG8A 3MCAB 3MN6A 3SK3A 1YAGA 1XQSC 4LC9B 3LDLA 3GTGA 1ATRA 3BUZB 3P4IA 2HBJA 5BRDA 1MWKA 4IO8A 4G0VA 3CMEN 3HTVA 3EO3A 3OBWA 1OVYA 4BLAA 5KQDA 2RH6A 4LQYA 2ZGZA 4YOVA 2E8AA 3SAHA 2VYPA 4H0VB 2D0OA 1I50A 3TTFA 3CPEA 1W2BM 2NRZA 3EKUA 2P9PA 4CD3A 4JKHA 5AQOA 5BRHA 4MLHA 3LAPA 3NUHA 4WYBA 3UB5A 1ESVA 2P9LB 3QBXA 4FWOA 5JVHL 2QA4N 3GTOA 4ILJA 1VQ6N 3SMPA 4KMDA 2E1ZA 2QWMA 4KB2A 1JJ2M 3VOVA 3D2EA 3U9DA 3O1WA 4A2BA 1HKCA 4IJAA 2KKZA 3O9RA 1BA0A 2PAVA 4CJ7A 2F9WA 3Q3QA 5AQRA 2GSOA 4WQ4A 5ELZA 2FF3B 2P9IA 3L0QA 3FZKA 5AQIA 5AQGA 5M1OA 5BRFA 2VUMA 2A42A 3N4QA 3CPWM 4FVUA 1K8KA 2ZWHA 4I6MB 2YHYA 5EXWA 4BQLA 4BQZA 4R79A 2QI2A 1TUUA 3MK6A 5F0XA 4NO7A 3H3OB 4E1JA 2XCQA 3RSEA 3I8BA 5JICA 2QWQA 5GAEP 4YOWA 2QEXN 4BC4A 4GY2B 1K73O 1ZBSA 3P31A 3ID6A 4BRIA 1YIJN 2E2IA 3O80A 1YXQA 2QWOA 5AZIB 5EGEA 1Y1WA 1BDGA 3LDNA 4BC5A 1ISEA 2PHCB 4IFEA 1SZ2A 2YJEA 4H5WA 4YOUA 5AQZA 3WXKA 4KC6A 3CIPA 5AQNA 5AQMA 3N4PA 1VAZA 5LJVA 4JKGB 3EL2A 1KAXA 2QW9A 4JN4A 4BRCA 4KH6A 5AQYA 4KMHA 1U2VA 3AAQA 1GLDG 2CGJA 3CMAN 4OPHA 4BKWA 1S22A 3CCMN 3FZMA 4B1XB 3CJAA 4JHDB 1IJJA 4HWIA 1NM1A 5GADP 3TSUA 3CCJN 5AQVA 4AM7A 1QVFM 3QMLA 1NGIA 1YITN 4CZJA 2OTLN 2NNWA 3CERA 4XH1A 4A5AA 2CH5A 3VF2A 1TWCA 3QICA 4CZGA 1HKBA 1MDUB 5I9EB 3GTJA 1SQKA 2D4WA 2NRWA 4PKGA 5E26A 1ZC6A 1DKGD 3IDHA 2W41A 1T6DA 1Q18A 4YDUC 2GSUA 4BRDA 4DHYA 5C10A 1MA9B 4ISFA 1VQ9N 4BRPA 4O5FA 3GTMA 3GG4A 4BREA 2NRVA 2E2QA 3HI0A 3VEVA 5ADXH 4MO4A 5IOSA 4B1YB 1BA1A 1GE9A 4FL9A 3QB0A 3ZX3A 4BRGA 4GTLA 1GLFO 5FPNA 1SFOA 3FHZA 4C23A 2BH1A 1ATNA 4NB4A 3F5TA 1NBWA 4IEEA 3U4LA 1NGFA 2ASOA 2IIRA 5M1QA 2FSKA 4FPAA 4BR4A 3CHWA 4GNIA 3ZYYX 3RVCA 4WFAL 3MMVA 4CI6A 3GOIA 4JK8A 2NVYA 3V4GA 2PBDA 3NMUA 2V7ZA 4H5TA 4B1VA 3CXCM 3P38A 5CE3A 2FLOA 1QZ6A 1VQKN 2WC9A 3O1BA 5EY4A 3HOTA 4GV3A 1HLUA 3CJ9A 3WUHA 4FWMA 5LJWA 4HTLA 3A5LC 4RWTA 3CETA 3MN9A 3FZFA 4BR2A 1RDWX 1TYQB 3MN7A 4FOIA 5GAGP 5BN8A 1OKJA 1BU6O 3DXKA 1O26A 3DXMA 1GLLO 1HJOA 3IFRA 3GDQA 2YJFA 3VGLA 3G6EN 2GWJA 2QWNA 2W40A 2GTDA 3CQXA 3R3LA 3L4KA 1O2BA 4GFQA 4J3NA 2Y3PA 1QQNA 4GTFA 1T44A 2A5XA 2V52B 2QWLA 1O13A 4ILDA 5TKWA 1XXBA 4YOYA 5F1XA 3CD6N 3E9OA 3GTQA 2HBMA 3PLAA 3UKUB 1HPMA 3E9LA 1BO5O 1I3QA 5AQHA 3ATUA 4KMAA 3G71N 5ADXA 2P9SB 1BOTO 4GTBA 4GTEA 3BP8A 2CFAA 1X3MA 2A3ZA 4PKHA 3FLCO 4H03B 3TSQA 3FGUA 4GT9A 5KQ8A 1EK8A 3ZEUB 1AB4A 3AGKA 3OW2M 2IVOA 4IO9L 3Q7BA 3BEXA 4FO0A 1YJNN 2GSNA 3GBTA 3O8MA 5AQXA 5AZJA 3CI5A 4CD1A 4BLBA 4C1NI 1NGEA 4DB3A 4JKEA 2IVNA 3FZLA 3JS6A 3K9JA 1S3XA 4JD2A 3L4JA 5GAHP 3GTPA 2VGNA 2QXLA 1VQLN 4B1WB 2E2OA 2JH3A 1HKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQM A;  2P9K B;  3WXJ A;  3D7E O;  2A6A A;  2E88 A;  3UKR B;  1Y64 A;  3ZET A;  2P9U A;  2Q0R A;  4K41 A;  3ULE A;  4BRN A;  1NGJ A;  2FSN A;  5AQL A;  4BRO A;  3TU5 A;  4BRF A;  4A62 A;  4A2A A;  3L6Q A;  2HF3 A;  2EWS A;  4M63 C;  4BRK A;  3QDK A;  3A5M C;  2HMP A;  2BTF A;  3U9Z A;  2CGK A;  4FWP A;  4EIA A;  1U2V B;  5AR0 A;  5FPD A;  1E4F T;  5AQW A;  2VCP A;  3VEY A;  1LOT B;  2CGL A;  1U6Z A;  3ENH A;  2FF6 A;  4DCH A;  4FSV A;  3WEE B;  1RGI A;  1P8Z A;  3QFU A;  2DPN A;  3KHY A;  3VEW A;  2ZGY A;  2P9L A;  3DWL A;  1NGC A;  3KVG A;  3WXI A;  1NMD A;  2NLX A;  2Q0U A;  2J4R A;  3LDP A;  3UE5 A;  4XH5 A;  3IUC A;  4Z94 A;  3H45 C;  4CZI A;  5FPM A;  1TUY A;  4EHT A;  4H0P A;  3LDQ A;  3HSC A;  3W0L A;  1GLB G;  2YHW A;  1XC3 A;  3LL3 A;  5AQS A;  2GEM A;  1GLC G;  2V51 B;  4IWV A;  3C7N B;  1LCU A;  2HOE A;  1J6Z A;  3QFP A;  2QWP A;  3S41 A;  3U8X A;  3EKS A;  5BRE A;  2ASM A;  1YVN A;  3C0B A;  2CH6 A;  5EOY A;  4PL7 A;  3D2F B;  4FWQ A;  4XEI A;  5AZI A;  3TPQ A;  1RFQ A;  3LM9 A;  1SAZ A;  3F9M A;  4BG9 A;  4H5R A;  3DAW A;  4EHU A;  2NRH A;  2Q36 A;  1Z6R A;  4CZK A;  3MDQ A;  1ZXO A;  1E4G T;  1JCE A;  2YCH A;  2OAN A;  5KPT A;  3H1V X;  3SLC A;  3VES A;  2P9N A;  5FPE A;  2H3G X;  2I7P A;  1H1V A;  1HX1 A;  5E84 A;  3GL1 A;  1DEJ A;  4QS7 A;  2HF4 A;  1MWM A;  4JHD A;  3VEX A;  3VER A;  3B8A X;  3A5N C;  2Q31 A;  5BPL A;  2GUP A;  1NGB A;  4BRQ A;  2BUP A;  1NGH A;  3VGM A;  4K42 A;  3R9P A;  2QM1 A;  2Q2R A;  4RCH A;  3FR0 A;  2AP1 A;  3O08 A;  1NWK A;  4FWN A;  2D0P A;  2P9P B;  4ISE A;  1QZ5 A;  4WQ5 C;  4EFH A;  2E2P A;  3VF4 A;  1JCG A;  5LY3 A;  3H46 O;  4H0T B;  3D2E B;  5AQJ A;  3HZ6 A;  2P9U B;  1GLJ O;  1X9J A;  1BUP A;  1YUW A;  3VEO A;  4XH4 A;  4BC2 A;  5AFU H;  2P9I B;  4BR0 A;  3AAR A;  2ITM A;  5BPN A;  1K8K B;  4BG8 A;  3CQY A;  1KAY A;  3FE1 A;  1TYQ A;  1R59 O;  3H6E A;  3RSE B;  3WQT A;  1QQO A;  4IZ9 A;  4CZE A;  3M3Z A;  5AQQ A;  4DQ8 A;  4H5V A;  2FXU A;  1HUX A;  4QS8 A;  2IVP A;  4FWR A;  3R8E A;  3WQU A;  4BRA A;  4CBW A;  3ZX2 A;  4CZF A;  4O8K A;  4M7X A;  4H0Y B;  3O6W A;  2E2N A;  3H3N O;  3UKU A;  3MN5 A;  4QS9 A;  4YDU A;  5KPZ A;  3VGK A;  2ZF5 O;  4BGB A;  2P9S A;  3HM8 A;  3G25 A;  3A5O C;  4JAX A;  4B1Z A;  2ASP A;  1X3N A;  3SJH A;  4CZL A;  4FOE A;  3BF1 A;  4MO5 A;  4BGA A;  4JNE A;  4CBX A;  3M1F A;  3ZEU A;  3VEZ A;  4Y0W A;  5AFU A;  1NGG A;  4BVP A;  2FSJ A;  4CZM A;  4KBO A;  2F9T A;  3CJ7 A;  5AQF A;  4A61 A;  1XUP O;  5TKY A;  4BR7 A;  4EAH D;  5AQP A;  2D1K A;  4K43 A;  3I33 A;  2P9K A;  3ATV A;  3WXL A;  2QWR A;  2NZT A;  1JCF A;  2UYT A;  2V7Y A;  3UKR A;  1CZA N;  3AY9 A;  1BWF O;  3BF3 A;  3OHR A;  3ENO A;  1T6C A;  5EVZ A;  1QHA A;  3R6M A;  4FPB A;  4J8F A;  4PL8 A;  3LDO A;  3W3D A;  3A0I X;  4F9O A;  1GLE G;  3L4I A;  4H0O A;  1DGK N;  3MCP A;  4H0X B;  3CJB A;  2Q1N A;  4K25 A;  4I6M A;  2P9N B;  3WT0 A;  5BR9 A;  3VET A;  4CZH A;  3ZX0 A;  4FWK A;  5JLH A;  4IXC A;  4WQ5 A;  3VF6 A;  1BG3 A;  3DXK B;  4ISG A;  3DXM B;  1NGA A;  5BN9 A;  1C0F A;  3JXU A;  3A8Y A;  2GWK A;  2E1Y A;  4WQ4 C;  1WUA A;  3EN9 A;  3GE1 A;  5AQU A;  1GLA G;  3FZH A;  3WEE A;  4BC3 A;  3DJC A;  3VEN A;  4B1U B;  4CBU A;  1V4S A;  1ATS A;  4H5N A;  4FWL A;  3J8A A;  4PKI A;  3KZB A;  5JMV A;  3ID8 A;  4BRH A;  5BPM A;  1V4T A;  1Z05 A;  3CJ1 A;  1NLV A;  3IMX A;  5AQK A;  2Q97 A;  5F2R A;  1EQY A;  2VWB A;  1KAZ A;  5AZJ B;  4AM6 A;  4B9Q A;  4BR5 A;  2I7N A;  4JD2 B;  4MLE A;  2YHX A;  5B8H A;  3C7N A;  5EX5 A;  2YI1 A;  2A40 A;  3FFK B;  4BRM A;  4FWS A;  3M6G A;  2E20 A;  4IJN A;  5AQT A;  3AAP A;  3O4W A;  3QBW A;  1G99 A;  3ZET B;  2AA4 A;  3O5B A;  3ULE B;  4M7Y A;  3VPZ A;  4BRL A;  4BVO A;  3D2F A;  2WUS A;  5JLF A;  2A41 A;  4RTF D;  3SMS A;  1KXP A;  3EZW A;  4L3Q A;  3HBT A;  1D4X A;  3H1Q A;  3LM2 A;  1C0G A;  1WOQ A;  4BR9 A;  3CJC A;  1NGD A;  2GEL A;  2KHO A;  5KPR A;  1IG8 A;  3MN6 A;  3SK3 A;  1YAG A;  1XQS C;  4LC9 B;  3LDL A;  1ATR A;  3BUZ B;  3P4I A;  5BRD A;  1MWK A;  4IO8 A;  3HTV A;  3EO3 A;  5KQD A;  2ZGZ A;  2E8A A;  2VYP A;  4H0V B;  2D0O A;  3EKU A;  2P9P A;  4CD3 A;  5BRH A;  5AQO A;  4MLH A;  4WYB A;  3UB5 A;  1ESV A;  2P9L B;  3QBX A;  4FWO A;  3SMP A;  2E1Z A;  2QWM A;  3VOV A;  3D2E A;  3U9D A;  3O1W A;  4A2B A;  1HKC A;  4IJA A;  1BA0 A;  2PAV A;  4CJ7 A;  2F9W A;  5AQR A;  4WQ4 A;  5ELZ A;  2FF3 B;  2P9I A;  3L0Q A;  3FZK A;  5AQI A;  5AQG A;  5BRF A;  2A42 A;  1K8K A;  2ZWH A;  4I6M B;  2YHY A;  5EXW A;  4BQL A;  4BQZ A;  5F0X A;  1TUU A;  3MK6 A;  4NO7 A;  3H3O B;  4E1J A;  3RSE A;  3I8B A;  5JIC A;  2QWQ A;  4BC4 A;  4GY2 B;  1ZBS A;  4BRI A;  3O80 A;  1YXQ A;  2QWO A;  5AZI B;  1BDG A;  3LDN A;  4BC5 A;  1SZ2 A;  2YJE A;  4H5W A;  3WXK A;  5AQZ A;  3CIP A;  5AQN A;  5AQM A;  5LJV A;  3EL2 A;  1KAX A;  2QW9 A;  4JN4 A;  4BRC A;  5AQY A;  1U2V A;  3AAQ A;  1GLD G;  2CGJ A;  1S22 A;  3FZM A;  4B1X B;  3CJA A;  4JHD B;  1IJJ A;  4HWI A;  1NM1 A;  5AQV A;  4AM7 A;  3QML A;  1NGI A;  4CZJ A;  3CER A;  4XH1 A;  2CH5 A;  3VF2 A;  3QIC A;  4CZG A;  1HKB A;  1MDU B;  5I9E B;  1SQK A;  2D4W A;  4PKG A;  5E26 A;  1ZC6 A;  1DKG D;  3IDH A;  2W41 A;  1T6D A;  1Q18 A;  4YDU C;  4BRD A;  4DHY A;  1MA9 B;  4ISF A;  4BRP A;  4O5F A;  3GG4 A;  4BRE A;  2E2Q A;  3HI0 A;  3VEV A;  5ADX H;  4MO4 A;  4B1Y B;  1BA1 A;  4FL9 A;  3QB0 A;  3ZX3 A;  4BRG A;  1GLF O;  5FPN A;  4C23 A;  1ATN A;  4NB4 A;  1NBW A;  3U4L A;  1NGF A;  2ASO A;  2IIR A;  4BR4 A;  2FSK A;  4FPA A;  3CHW A;  4GNI A;  3MMV A;  4CI6 A;  3GOI A;  2PBD A;  2V7Z A;  4H5T A;  4B1V A;  5CE3 A;  2FLO A;  1QZ6 A;  3O1B A;  5EY4 A;  1HLU A;  3CJ9 A;  3WUH A;  4FWM A;  5LJW A;  4HTL A;  3A5L C;  4RWT A;  3CET A;  3MN9 A;  3FZF A;  4BR2 A;  1RDW X;  1TYQ B;  3MN7 A;  4FOI A;  5BN8 A;  1OKJ A;  1BU6 O;  3DXK A;  3DXM A;  1GLL O;  1HJO A;  3IFR A;  3GDQ A;  2YJF A;  3VGL A;  2GWJ A;  2QWN A;  2W40 A;  2GTD A;  3CQX A;  1QQN A;  1T44 A;  2A5X A;  2V52 B;  2QWL A;  5F1X A;  3UKU B;  1HPM A;  1BO5 O;  5AQH A;  3ATU A;  5ADX A;  2P9S B;  1BOT O;  3BP8 A;  1X3M A;  2A3Z A;  4PKH A;  3FLC O;  4H03 B;  3FGU A;  5KQ8 A;  3ZEU B;  2IVO A;  3BEX A;  4FO0 A;  3GBT A;  3O8M A;  5AQX A;  5AZJ A;  3CI5 A;  4CD1 A;  1NGE A;  4DB3 A;  2IVN A;  3FZL A;  3JS6 A;  4JD2 A;  1S3X A;  2QXL A;  4B1W B;  2E2O A;  1HKG A; 
#chains in the Genus database with same CATH topology
 3ZSW A;  4Q5V A;  4A3I K;  1Y97 A;  4NLB A;  3O9S A;  2E88 A;  1CXU A;  1XMQ K;  1S9G A;  3UKR B;  4CW7 B;  1Y1V A;  1Y64 A;  1HR0 K;  3LAJ A;  4K41 A;  3ULE A;  2HND A;  1T8E A;  1O2A A;  3OYC A;  2FSN A;  1D9F A;  5AQL A;  4Y52 C;  3MED A;  3VA7 A;  4C3H C;  1C1B A;  4A2A A;  1BHL A;  3PX0 A;  1VSD A;  4O0J A;  4OIO A;  4M63 C;  4BE0 A;  4FJL A;  4KN7 A;  3SUQ A;  2BTF A;  2RE2 A;  4BDY A;  3DOK A;  3AA4 A;  4CEB A;  1BCO A;  4DMN A;  3SJJ A;  3ZT0 A;  3HOU K;  3DLE A;  4C8L A;  1QSS A;  3OJU A;  3AVH A;  4FLT A;  3GTP K;  2OPS A;  3VMF B;  1J6W A;  1RGI A;  2NVQ K;  4IOA L;  4KMU A;  3DLG A;  5JVG L;  2FBV A;  4LFC K;  3T00 A;  3NH2 A;  5GIN A;  4Z94 A;  3FKI K;  5M3M K;  3H3V D;  3T19 A;  4CZI A;  5FPM A;  1KCF A;  4FJI A;  3LDQ A;  2WB1 L;  1HNZ K;  5AQS A;  2V51 B;  4IWV A;  3CAG A;  2E2H A;  2HOE A;  3VQ6 A;  1TKD A;  4A57 A;  1NG9 A;  4P5A A;  3VTH A;  3S41 A;  4FZZ A;  3PIP L;  4DR6 K;  3THW A;  2R93 A;  2Y1I A;  3B6P A;  4DF4 A;  1EH1 A;  1I6H C;  3DLB A;  3CFP A;  1SKS A;  4XEI A;  3ZT2 A;  3P1G A;  1SAZ A;  4EHU A;  4A3G K;  2UXD K;  2NRH A;  2Q36 A;  3M5R A;  1SMY A;  4I9L A;  1RIL A;  1JCE A;  3AA2 A;  2O5I A;  2OAN A;  2AJQ A;  1WSV A;  4I2P A;  4GVE A;  3VES A;  1KQS M;  2JA6 A;  2H3G X;  4FM2 A;  5C25 A;  2ZJR L;  4JRP A;  2E2I C;  3SV3 A;  1RTH A;  4G0W A;  5E84 A;  3GL1 A;  4DFP A;  1T03 A;  3CM5 A;  2IGI A;  3CQZ K;  3B8A X;  3DLL L;  3PX4 A;  2GUP A;  1NGB A;  4BRQ A;  2BUP A;  2HHT A;  5FJ8 K;  1YHQ N;  2QM1 A;  1ZBF A;  5C2F A;  4HUF A;  2AP1 A;  4N56 A;  4LJZ A;  4OIR A;  4AIL C;  3TAG A;  2D0P A;  4A3D C;  4ISE A;  4I2Q A;  5DM6 L;  1QZ5 A;  1IBM K;  2E2P A;  4H8K A;  3WXM B;  4OGC A;  1M90 O;  3D2E B;  5AQJ A;  3L2R A;  1JLE A;  1IG9 A;  1VRT A;  4DQR A;  3RWU A;  4RW9 A;  1WLJ A;  2QKK A;  3M8R A;  3LP2 A;  4LF8 K;  3VQB A;  5C0Y A;  2P9I B;  4BR0 A;  3V9X A;  2VQF K;  1VH2 A;  5BPN A;  3VQE A;  1K8K B;  3RRH A;  4B3T K;  3M3Y C;  4PWD A;  1TYQ A;  4KV8 A;  1OH6 A;  3WQT A;  1QQO A;  3J7Z O;  3ASM A;  1FKP A;  1IW7 A;  5J2P A;  1TWH A;  4CFD A;  4Q0B A;  1Q81 O;  1IS1 A;  5IT9 O;  3CCL N;  2KWA A;  1R0A A;  4FWR A;  3R8E A;  4DV7 K;  3G4A A;  1UA1 A;  4CBW A;  3M8S A;  4CZF A;  4CHY A;  1NJY A;  2HNZ A;  1VSE A;  3HYF A;  1XXA A;  4Y7N C;  3EEQ A;  2E2N A;  3H3N O;  3QEP A;  1IBK K;  4BGB A;  4M3Y A;  3G25 A;  3A5O C;  2R92 C;  4JKB A;  2ASP A;  4BBS C;  3BF1 A;  2JA5 C;  5FRO A;  1R9T A;  4JNE A;  3KLE A;  2VG6 A;  3VEZ A;  3HVT A;  3VQP A;  4DKW A;  5AFU A;  2OZM A;  3J80 O;  5FLM K;  1TWF C;  1UA0 A;  4LF6 K;  2D0A A;  2F9T A;  4OIN A;  4QOZ B;  3AVM A;  3IG1 A;  5CZ2 A;  3TAM A;  4CJQ A;  5TKY A;  1VQ4 N;  2R7Y A;  4A93 C;  3VA0 A;  2WFB A;  3WXL A;  1NJW A;  4FW2 A;  3UKR A;  5LMU K;  4FK0 A;  4BXX K;  3OHR A;  3TAP A;  2JA7 A;  1T6C A;  4A3F K;  5HL7 L;  4FPB A;  4PL8 A;  3LDO A;  1OH8 A;  4JYA K;  3A0I X;  3QNO A;  4ZTJ A;  3TTC A;  2JWK A;  1DGK N;  3HOZ C;  3H0G K;  4CEA A;  3QLH A;  3WT0 A;  2F8T A;  4ID5 A;  4CJV A;  4IXC A;  4LF4 K;  4WQ5 A;  3E1Y A;  1CXQ A;  3A2F A;  2O4G A;  2PY5 A;  5HRR A;  3C65 A;  4FZB A;  4C45 A;  4A3L C;  1A5X A;  2IAJ A;  4DR5 K;  3S1N K;  3JXU A;  2GWK A;  4WQ4 C;  4GMJ B;  4C3J C;  5AQU A;  4KTQ A;  3CC4 N;  1JLA A;  4U67 L;  1OH7 A;  1S1V A;  4DV0 K;  3WNG A;  4Z4H A;  1U4B A;  4PUO A;  4B1U B;  3KD1 E;  4NOI A;  3J8A A;  3GTK A;  5E68 A;  1C1A A;  1C6V A;  4E7L A;  5M1F A;  2YKN A;  1G15 A;  2A69 A;  3OBY A;  5F2R A;  3OYI A;  2VWB A;  1KAZ A;  2WBN A;  5AZJ B;  3T69 A;  4FJ8 A;  5C3E K;  4DTJ A;  2NRX A;  4MLE A;  2YHX A;  5B8H A;  4FM9 A;  4A3D K;  5EX5 A;  3QNN A;  1HYZ A;  4LR2 A;  2A40 A;  3T1Y K;  5M3F K;  2VWK A;  4FWS A;  2E20 A;  1C0U A;  1X31 C;  3S3M A;  3QBW A;  3PO5 A;  1BIS A;  4KTW A;  1YT3 A;  2AA4 A;  3CM6 A;  4M7Y A;  3K59 A;  4DR1 K;  3WNH A;  1HNX K;  4RTF D;  4CJP A;  1F7V A;  4YFN A;  4LF9 K;  2XRI A;  3HBT A;  4K8Z A;  3CF5 L;  3LM2 A;  3G10 A;  3CJC A;  4DV3 K;  1ZYQ A;  4JI1 K;  4M3W A;  1IG8 A;  4JS4 A;  4B3O A;  3LDS A;  1XQS C;  1BQN A;  3BUZ B;  3AD8 C;  1W7A A;  5HRN A;  1MWK A;  4G0V A;  2YU9 C;  4DU3 A;  1DCH A;  3IRX A;  2RH6 A;  3NF7 A;  4CGJ A;  3P83 D;  4H0V B;  1HRH A;  4Y7N K;  1I50 A;  4UQG A;  3TTF A;  1VRQ C;  1W2B M;  3EKU A;  1RDC A;  4AYB D;  4JKH A;  1S6Q A;  2P9L B;  3SV4 A;  3EYZ A;  4ILJ A;  1VQ6 N;  3GTO A;  2JA5 K;  2QWM A;  3D2E A;  4AHT A;  3U9D A;  1ZYR A;  1TWF K;  1NK9 A;  1BA0 A;  5TMF A;  3Q3Q A;  3GTQ C;  2P9I A;  4NYF A;  3FZK A;  5AQG A;  2E2J K;  3CG7 A;  4A93 K;  1WSJ A;  1K8K A;  2ZWH A;  4I6M B;  3SQ2 A;  1RDD A;  2IC3 A;  3GTL K;  4NO7 A;  3H08 A;  3BDP A;  4DUY K;  3I8B A;  4BWJ A;  3VQC A;  2QEX N;  1K73 O;  2E2I A;  4BRI A;  4CGF A;  4FJ7 A;  3ZSQ A;  1RDB A;  1Y1W A;  1L0W A;  4BC5 A;  1ISE A;  3LWM A;  5AQZ A;  1JXB A;  1RNH A;  1VAZ A;  3D0P A;  5LJV A;  4CHQ A;  5FLX O;  3QEV A;  5IP9 K;  1BQM A;  1Y1V C;  2CGJ A;  4C8O A;  4XSX A;  4CF2 A;  2YNF A;  3SUP A;  3KD5 E;  5GAD P;  3K57 A;  5AQV A;  5C4X K;  4GZY A;  3QML A;  1NGI A;  4C3J K;  2NNW A;  3KLF A;  4J2B A;  3ZSO A;  3QIC A;  4CZG A;  4LH4 A;  4DLE A;  3BGR A;  4RW8 A;  4LSN A;  2P5G A;  4O5F A;  4NXM K;  4EP5 A;  4RW6 A;  3ISN C;  4XLN A;  1NKB A;  2ZUE A;  4FLW A;  4FK4 A;  3HJF A;  5I42 A;  4LD0 A;  4FL9 A;  1VHX A;  1YX2 A;  2E6L A;  3C95 A;  5FPN A;  1L5U A;  2XY8 A;  1F21 A;  2BH1 A;  4O55 A;  3F5T A;  3U4L A;  2IIR A;  5M1Q A;  3CXC M;  3J7A P;  3CHW A;  3RVC A;  3L2U A;  2G8U A;  3S16 K;  4DV5 K;  3NMU A;  2V7Z A;  4B1V A;  3P38 A;  1VQK N;  2FLO A;  5EY4 A;  3CJ9 A;  2XCR B;  5IYD C;  4BR2 A;  3LAK A;  3VA3 A;  3GTJ K;  2B4J A;  4DS5 A;  3IFR A;  3VGL A;  4N47 A;  3LPT A;  3SPZ A;  4KHP K;  2GWJ A;  2QWN A;  3CQX A;  5KTQ A;  1O2B A;  3ZSV A;  4GFQ A;  2E2H C;  3DMJ A;  2V52 B;  2QWL A;  3I0R A;  4ZH4 A;  2KFZ A;  1WOO A;  2HBM A;  3OYJ A;  3K0S A;  3PLA A;  3OYA A;  1HPM A;  3E9L A;  1I3Q A;  4BY7 K;  2R93 C;  5ADX A;  2P9S B;  4GTB A;  2NVX C;  1X3M A;  2B63 K;  1TL3 A;  2YNI A;  3EQL A;  1NK0 A;  3HT3 A;  1N36 K;  2G8H A;  1F93 A;  5KQ8 A;  3ZEU B;  3T01 A;  5HP1 A;  4IO9 L;  3O8M A;  5AZJ A;  4CF1 A;  4C1N I;  4OPK A;  4JKE A;  4F2R A;  4CED A;  2JA6 C;  2QXL A;  1QE1 A;  5MLC Q;  4DSL A;  3WXJ A;  2A6E A;  3HRG A;  1HNI A;  2ZJP L;  1IH7 A;  4BDZ A;  3F2K A;  2V6S A;  1TGO A;  2Q0R A;  2KFN A;  5C2D A;  2CW0 A;  4JI7 K;  4C3I C;  1NGJ A;  4XLP A;  4BRO A;  3GTQ K;  4A3E C;  3L3V A;  2X78 A;  1UOC A;  2YNG A;  2HF3 A;  2EWS A;  1RBR A;  4U7B A;  3JYT A;  3QDK A;  3LZI A;  3RZO C;  4YOR A;  4IOX A;  4LFA K;  1VSI A;  3ZSX A;  3LAL A;  1WQG A;  3LZJ A;  2G8V A;  4X66 K;  4CHO A;  1U2V B;  1KTQ A;  4A3C K;  3CCR N;  5AQW A;  2O8F A;  1JL2 A;  4CJW A;  1JXE A;  4O2D A;  1U6Z A;  4CFA A;  1T3V A;  2DTU A;  1WN7 A;  2FF6 A;  4FSV A;  4OPJ A;  1NK4 A;  4Z4G A;  4B9U A;  4DU4 A;  3J81 O;  3SUN A;  2W7V A;  3V9W A;  1P8Z A;  1Q9Y A;  1YNJ A;  4TSX A;  1VQ7 N;  3QFU A;  2DPN A;  1Y1V K;  3VEW A;  2P9L A;  3HO1 A;  1NGC A;  3AVG A;  4B3R K;  1YJ9 N;  3ORE A;  1WSG A;  1NMD A;  3LDP A;  2DFH A;  4X65 K;  3H45 C;  1BS2 A;  4JKA A;  3NGI A;  3DRP A;  1X1P A;  1WIH A;  3KWG A;  2VUM K;  1U04 A;  4H0P A;  2E5L K;  1GLB G;  3N3Y A;  2GEM A;  5TJ3 A;  3CCS N;  4C8N A;  3KKR A;  1N32 K;  2QWP A;  1ZBL A;  1S6P A;  4H4O A;  4AHS A;  4E19 A;  2F8S A;  5BRE A;  5CHI A;  1R9T C;  2HNY A;  4KH5 A;  4CEO A;  2R7Z A;  3AD7 C;  5EOY A;  1J9A A;  4FWQ A;  3MX5 A;  3TPQ A;  3RMD A;  1RT3 A;  3LM9 A;  4YFK A;  1WCM A;  2YU9 A;  3DAW A;  4IKF A;  4JI3 K;  4G1Q A;  3ZSY A;  1Z6R A;  3KKS A;  2XY7 A;  2ZUF A;  1VQO N;  1E4G T;  1FW6 A;  4BAC A;  1XWL A;  1O28 A;  2UUC K;  2QXF A;  4C8K A;  3H1V X;  4CJE A;  3AQP A;  1QTM A;  2KW4 A;  4CF0 A;  2NVT K;  1NJZ A;  3L2W A;  4DR3 K;  3VEX A;  3VER A;  5BPL A;  2E2H K;  3O9U A;  2LSN A;  1S72 N;  3QX3 A;  3C6A A;  1NGH A;  1IBA A;  4K42 A;  3GTM K;  3OPF A;  4M1X A;  4ILG B;  4RCH A;  4FJG A;  4A3K K;  1VSK A;  3S17 C;  4BY1 K;  4FJ9 A;  4JRQ A;  2R93 K;  5DK5 A;  1B4B A;  5DM7 L;  4WQ5 C;  4IDH A;  1RTJ A;  3IKM A;  3VF4 A;  1EKE A;  2P9U B;  1S1U A;  1YNN A;  1IBL K;  4P9S A;  2NVY K;  3V1Q A;  1GLJ O;  4MQ3 A;  1WSH A;  2YHB A;  2HST A;  3S1M C;  4BC2 A;  1GOB A;  5HBM A;  1NK7 A;  1B4A A;  2ITM A;  3GTK C;  4W5N A;  3LWL A;  4JLH A;  4G0U A;  4ELT A;  3SNN A;  3CQY A;  1KAY A;  3GEI A;  3M8P A;  3FE1 A;  3H6E A;  1ASV A;  3S1R K;  4IZ9 A;  5HRP A;  3M3Z A;  4X64 K;  4DQ8 A;  4H5V A;  4WF9 L;  4LF5 K;  2ITG A;  1MU2 A;  2OPR A;  3AVJ A;  4QS8 A;  1KSP A;  3NCI A;  3ZSZ A;  3CCV N;  3NGZ A;  2O8C A;  4BRA A;  2EX3 A;  4N41 A;  4DV2 K;  1RBS A;  3S15 C;  1RDU A;  3OYH A;  4A3M K;  4KHU A;  3MN5 A;  5CYQ A;  4KRF A;  2ZF5 O;  3M4O K;  2P9S A;  2G8I A;  3HM8 A;  4W5O A;  2JGU A;  1X9S A;  1X3N A;  3SJH A;  1IKX A;  1HNW K;  2B5J A;  3VQ4 A;  2GAH C;  3G0Z A;  3ZEU A;  3S14 K;  4KRE A;  3K9K A;  3SBG A;  1NGG A;  4DV1 K;  4OKJ A;  3S2D C;  3AA5 X;  4AH6 A;  5AQF A;  2YX6 A;  4B9T A;  1WOS A;  4BR7 A;  5AQP A;  1TWH K;  5A2Q O;  3K7A C;  1J6V A;  2NZT A;  1JCF A;  2UYT A;  4OPA A;  4CJ3 A;  1CZA N;  1K83 A;  2A68 A;  4JI2 K;  1HQU A;  5CHP A;  4AHU A;  5H1S Q;  4IEI A;  1WOR A;  1QHA A;  1I50 C;  3R6M A;  4IG3 A;  4KAS A;  1BIZ A;  3W3D A;  1GLE G;  4H0O A;  3MCP A;  4LY7 A;  5M1N A;  3GTO C;  3HOY K;  1VQP N;  1IE0 A;  3CJB A;  1R9T K;  2P9N B;  4F8R A;  4CJR A;  4G7Z A;  3VET A;  4KAT A;  2RN2 A;  3KLH A;  4V19 S;  4FWK A;  2W6K A;  4BY9 C;  1USO A;  1BG3 A;  1V5V A;  4ISG A;  1S5J A;  3AVB A;  3AO2 A;  2OPP A;  1Q7Y O;  3VQD A;  2NVX A;  1JLQ A;  5BN9 A;  1C0F A;  3AVF A;  2O8D B;  1EET A;  3M8Q A;  4OIP A;  5IYB K;  4CIG A;  4KHS A;  1ZBU A;  4CBU A;  1V4S A;  4E3S A;  4DQI A;  3THV A;  2JA7 K;  3FOF A;  5JMV A;  3ID8 A;  1ZBH A;  4P5B A;  4LF7 K;  2KTQ A;  4BRH A;  4Q5S A;  1Y1W C;  5HOO A;  4X6A C;  3DRS A;  4QJV B;  3SZZ A;  1V4T A;  3CJ1 A;  4HTU A;  4KN4 A;  5JVO A;  1EQY A;  2WB1 D;  1HQM A;  3TAE A;  2P51 A;  2YI1 A;  1QQC A;  3EE9 A;  4DWI A;  3FFK B;  1N33 K;  4BRM A;  3M6G A;  3MXI A;  5C44 C;  2UU9 K;  1KD1 O;  1DLO A;  4C2M C;  1KC8 O;  3VPZ A;  4BVO A;  3QES A;  4CJK A;  1VSH A;  3AVA A;  4E1N A;  4DFM A;  1WOP A;  4DS4 A;  3O3G A;  1JLC A;  3H1Q A;  3BZC A;  1C0G A;  3GTK K;  1LWF A;  2GEL A;  2KHO A;  1X9W A;  5GIO A;  3SK3 A;  3IPJ A;  3OTO K;  1ATR A;  3O4N A;  2RPI A;  4DSE A;  3OYG A;  4Y52 K;  4QIW L;  4C3H K;  3HTV A;  3EO3 A;  5FRN A;  3OBW A;  1OVY A;  4KI6 A;  4YOV A;  4BWM A;  2VYP A;  2FBT A;  3ULD A;  3THY B;  1HPZ A;  3CPE A;  3KLG A;  2NRZ A;  4Y1D A;  3TAB A;  4AHV A;  4CGH A;  3NUH A;  4WYB A;  3UB5 A;  3QBX A;  1S1W A;  4KMD A;  2E1Z A;  4CGG A;  1JJ2 M;  3VOV A;  1NKE A;  1LWE A;  4FLX A;  3CFR A;  2HHH K;  1XNQ K;  4O44 A;  4CJ7 A;  2F9W A;  1EWR A;  4DR7 K;  2FF3 B;  1I3Q C;  5M1O A;  1IL2 A;  2A42 A;  1XNR K;  5DMR A;  4DTU A;  3I8D A;  4BQZ A;  4R79 A;  5F0X A;  1BI4 B;  2DFE A;  4FVU A;  3K7A K;  4JI0 K;  4FJJ A;  4YOW A;  5LL6 Z;  1U47 A;  3P31 A;  5I3U A;  3O80 A;  1YXQ A;  2QWO A;  3HL8 A;  3OYF A;  3OYK A;  1BDG A;  3LDN A;  1VGX A;  1JLF A;  4E0D A;  3AVI A;  5CY4 A;  4H5W A;  3GTO K;  5AQN A;  3SQ0 A;  4FJ5 A;  3N4P A;  5D4D A;  4JKG B;  3EL2 A;  2QW9 A;  4BRC A;  4KH6 A;  3LP3 A;  5AQY A;  4KMH A;  5IYC C;  3AA3 A;  3QEI A;  3CMA N;  4OPH A;  4CEZ A;  4BKW A;  1J5O A;  1I6H K;  1S22 A;  4LK0 A;  3FZM A;  4JHD B;  3I4M C;  1IJJ A;  4ZHR A;  3TSU A;  3CCJ N;  2ATQ A;  1WNS A;  1YIT N;  3MAQ A;  4GKK K;  1KFS A;  3S1Q C;  1HKB A;  2Z1G A;  1SQK A;  5E26 A;  3OYB A;  1DKG D;  3IDH A;  1T6D A;  4YDU C;  2GSU A;  4DHY A;  5C10 A;  1VQ9 N;  3HP6 A;  3GG4 A;  2OPQ A;  2E2I K;  4X6A K;  3RZD C;  1NK5 A;  1RT5 A;  2D5R A;  1LAW A;  1J5E K;  1S1T A;  4IEE A;  3OYD A;  4FM0 A;  3PX6 A;  4BR4 A;  2FSK A;  1JOE A;  4GNI A;  3MMV A;  4CI6 A;  2O8B B;  3GOI A;  4JK8 A;  3V4G A;  2PBD A;  4M3Z A;  3HXA A;  5JS2 A;  2WC9 A;  3O1B A;  4QAG A;  1HYV A;  3KK2 A;  3WUH A;  5LJW A;  4RWT A;  3CET A;  3FZF A;  1CZB A;  3RRG A;  5SWM A;  1C0A A;  1BU6 O;  1GLL O;  1RBU A;  3GDQ A;  3G6E N;  3R3L A;  2GTD A;  4J3N A;  4BBR C;  2XY5 A;  1T44 A;  2KZM A;  1O13 A;  4ILD A;  5F1X A;  4MFB A;  4CK1 A;  4FJX A;  3E9O A;  4M42 A;  3UKU B;  3O3F A;  3M3Y K;  5AQH A;  4CHZ A;  4MQ9 A;  4A3J C;  2R7Z C;  3HPH A;  1EX4 A;  4HHT A;  1O1W A;  1WCM C;  4QJV A;  3AGK A;  2IVO A;  1YJN N;  1JVI A;  5M5Y K;  4BLB A;  4CD1 A;  3C6U A;  2P5O A;  1NGE A;  1VSJ A;  3OYM A;  2GV9 A;  5GAH P;  1EQR A;  2VGN A;  1RBT A;  4B9L A;  3S9H A;  2R92 K;  1QQM A;  1KVC A;  1Q82 O;  4BBS K;  3D7E O;  2A6A A;  4KM9 A;  1ASU A;  4IFY A;  5J2Q A;  3C94 A;  4BRN A;  5IP7 C;  4HUE A;  3NAE A;  5K14 A;  4JI5 K;  4OLA A;  1BGX T;  4NYN A;  3L6Q A;  3ZCM A;  3SAF A;  1XZP B;  3KWI A;  4BRK A;  4CHP A;  5HLF A;  4LK1 A;  1TKZ A;  4KAW X;  3N0B A;  4Q4Z A;  4CER A;  3ERE D;  3U9Z A;  1A5V A;  4AF1 A;  2CGK A;  4FWP A;  4EIA A;  3VQ8 A;  2A1R A;  1E4F T;  2VCP A;  1TKX A;  3NH0 A;  4I9Q A;  2OCE A;  1N34 K;  4DCH A;  3E9P A;  3WEE B;  1C0T A;  3HOZ K;  4FYD A;  4O5B A;  3A8I A;  2PMZ L;  4IOC L;  5IOQ A;  1WQH A;  3HM9 A;  2ZGY A;  3VQ9 A;  4GV6 A;  3I4M K;  4A3L K;  2J4R A;  4CIF A;  3UE5 A;  4XH5 A;  4E7I A;  4E1M A;  3ENB A;  4C1N K;  4CE9 A;  1TUY A;  3AGR A;  4DTS A;  3E66 A;  4B9M A;  1EXQ A;  3ALY A;  3HSC A;  5M1P A;  3LL3 A;  3HXM A;  2O8E B;  1GLC G;  3AH5 A;  3C7N B;  5SZT A;  3JSM A;  1LCU A;  3SAG A;  1TL1 A;  3MEE A;  4Z4I A;  3EKS A;  2NRT A;  2V6U A;  3D6R A;  2HHQ A;  2ASM A;  1YVN A;  3EY1 A;  2CH6 A;  1SV5 A;  2IOC A;  3D2F B;  3HOW C;  1O24 A;  3RR8 A;  1RFQ A;  5M1K A;  1L3U A;  4M3R A;  4H5R A;  4LSL A;  2B6A A;  2JWL A;  3MDQ A;  4KPY A;  2HHU A;  2YCH A;  2QTD A;  4JKG A;  5KPT A;  1EFW A;  5FPE A;  3N0C A;  2F96 A;  2I7P A;  4KM8 A;  1D8Y A;  2HMI A;  1P90 A;  2NUB A;  1HX1 A;  1K83 C;  3PO3 C;  2HF4 A;  1MWM A;  4JHD A;  3ZT1 A;  3PO4 A;  4M3X A;  4CJ4 A;  2I5J A;  4FZX C;  2Q3S A;  4NXN K;  3KK3 A;  2VQE K;  1OH5 A;  1Z26 A;  3CC7 N;  2Q2R A;  2ZD1 A;  3LPX A;  1NWK A;  3F9K A;  1XZQ B;  3IAY A;  4N76 A;  1RT1 A;  1VRU A;  2IS3 A;  3WNE A;  2P9P B;  5L46 A;  2DFF A;  3S2H C;  1XC9 A;  1JCG A;  5LY3 A;  4O4G A;  1WCM K;  3C6H A;  3H46 O;  2YU9 K;  2UUA K;  3HZ6 A;  3ZSR A;  5KRS A;  3G4S N;  2PA8 L;  4XSZ A;  2NRR A;  1EO1 A;  4MEY A;  1X9J A;  5J2M A;  3VEO A;  4DFJ A;  4XH4 A;  3TAQ A;  3AO5 A;  3TWH A;  2O8B A;  4B9N A;  1NJI O;  3MWT A;  2XY6 A;  1NNE A;  3AV9 A;  5JFE A;  4KB4 A;  3S3N A;  4JEP A;  3VTI A;  1W9H A;  3SZY A;  5C12 A;  3AD9 C;  4DSI A;  4DTP A;  1R59 O;  2IDO A;  3B6O A;  3KIO A;  1SFO C;  3EE8 A;  4AHR A;  1TWG A;  2KZZ A;  5AQQ A;  2FXU A;  3GTL A;  1TWA A;  3BZK A;  2E4L A;  4ID1 A;  3GSI A;  1E3M A;  4XCH A;  1RT7 A;  3WQU A;  2O4I A;  3ZX2 A;  4PAA A;  3CFO A;  4O8K A;  4Z4E A;  4M7X A;  4H0Y B;  3O6W A;  4G9Z A;  3UKU A;  3SQ1 A;  4YDU A;  1J53 A;  4OX9 K;  5KPZ A;  3VGK A;  2RKI A;  2GUI A;  4B1Z A;  1BGW A;  4FOE A;  3O9T A;  4MO5 A;  4BGA A;  3U6F A;  4CBX A;  3M1F A;  2UUB K;  1LWC A;  5EGH A;  3JAM O;  3EZ5 A;  1NOZ A;  4BVP A;  1M1K O;  2FSJ A;  4CZM A;  4L8R B;  1DTT A;  4ELV A;  4CJS A;  1TK8 A;  2BE2 A;  1FKO A;  5C24 A;  2BDP A;  3BP8 C;  4QCL A;  3THW B;  3I33 A;  3OS2 A;  4CJU A;  4DV6 K;  2RGR A;  2XO7 A;  1L3S A;  4JS5 A;  4DR4 K;  3AY9 A;  2OYQ A;  1BWF O;  4M45 A;  4FM1 A;  3ENO A;  5EVZ A;  4K0K K;  4FZY A;  1UWB A;  4LFB K;  3GTP C;  3IS9 A;  4KKO A;  3HST B;  4F9O A;  2YKM A;  3BP3 A;  1DCP A;  3F73 A;  1HNV A;  3CQ8 A;  1J54 A;  5IOT A;  4PY5 A;  3KLI A;  4K25 A;  4I6M A;  4CZH A;  3ZX0 A;  3QET A;  1LW0 A;  2G8K A;  3MX2 A;  3DXK B;  4R5P A;  3DXM B;  1UV7 A;  4DSJ A;  4M3U A;  3NVK A;  3FKI C;  3A8Y A;  1I94 K;  2E1Y A;  1WUA A;  3EN9 A;  3NGY A;  3FZH A;  3NF8 A;  3JST A;  3WEE A;  4BC3 A;  3PIO L;  3GDZ A;  3DJC A;  2HB5 A;  1T05 A;  2QKB A;  1W97 L;  2UXB K;  3K58 A;  5IYD K;  1DTQ A;  1C0M A;  4A3B C;  2OTJ N;  4H5N A;  4HUG A;  1WSR A;  3SBT A;  4MDB A;  2FQT A;  3PO3 K;  4PKI A;  2CFA B;  4FVM A;  4B08 A;  3SQ4 A;  4PQU A;  5BPM A;  4CJF A;  3CC2 N;  4NLC A;  3IMX A;  2Q97 A;  4B9Q A;  2B63 A;  3V1R A;  1LW2 A;  2VG5 A;  2O8E A;  2I7N A;  3AVC A;  4JD2 B;  2WTU A;  4F3O A;  1O29 A;  4A3G C;  3C7N A;  3QEW A;  3V81 A;  1F9N A;  4JK1 A;  4AHC A;  4JI6 K;  4KB1 A;  2NVX K;  4JKC A;  5KRT A;  1DT9 A;  1BCM A;  3NHG A;  3O4W A;  1ZVU A;  3ZET B;  4BRL A;  3D2F A;  1HQE A;  2WUS A;  3AO1 A;  1KXP A;  3KK7 A;  1KVA A;  3EZW A;  5AJ3 K;  2WON A;  2JA6 K;  1D4X A;  3U3G A;  1YF5 L;  1NK8 A;  4BR9 A;  4CHN A;  3L3U A;  1RBV A;  1VQ8 N;  2Y1J A;  3T7Z A;  2V6T A;  4M41 A;  3HOV C;  1USM A;  3QIP A;  2PZS A;  1TK5 A;  3MN6 A;  1YAG A;  4OLB A;  1WB9 A;  2PYJ A;  3LDL A;  3GTG A;  4CF9 A;  3PUF A;  1LV5 A;  4C3I K;  2HBJ A;  4IO8 A;  3T1H K;  4JI8 K;  4A3E K;  3CYM A;  3CME N;  4DU1 A;  3VN5 A;  3DM2 A;  3L8B A;  3HK2 A;  1B9D A;  2E8A A;  3SAH A;  3RZO K;  2BAN A;  4LLG A;  4YHH K;  1XZQ A;  3GEH A;  3QIN A;  1L3V A;  3DXJ A;  5KGW A;  2P9P A;  4MLH A;  3SCX A;  1ESV A;  1BDF A;  2HHW A;  2QA4 N;  3I0S A;  1ASW A;  3A8J A;  1KLM A;  4F2S A;  1TV6 A;  3K5L A;  1K6Y A;  4Z0U A;  4IJA A;  1S1X A;  1JL1 A;  3OVN A;  3DOL A;  5ELZ A;  3L0Q A;  2VUM A;  3N4Q A;  4FCY A;  3CPW M;  4KC6 A;  3L2Q A;  4G7O A;  2YHY A;  4BQL A;  1ITG A;  3H3O B;  4CCH A;  3PV8 A;  4NCG A;  3I4N C;  5JIC A;  3L2V A;  5GAE P;  4BC4 A;  3V9U A;  1ZBS A;  3THX B;  3ID6 A;  1YIJ N;  5AZI B;  3SPY A;  2YHA A;  2PHC B;  1EWQ A;  4IFE A;  5FLM C;  3TAR A;  1RT6 A;  1FJG K;  3DLK A;  1KAX A;  4JN4 A;  2JLE A;  1RCH A;  1U2V A;  3AAQ A;  4CFC A;  1GLD G;  4FLZ A;  4FLV A;  4DQQ A;  5KI6 A;  3VQA A;  3VQ7 A;  3CCM N;  2JA8 C;  4B1X B;  3VQQ A;  4HWI A;  4AM7 A;  3CER A;  3TTG A;  4BXX C;  4A5A A;  2CH5 A;  3NFA A;  3VF2 A;  1TWC A;  4DTM A;  2D4W A;  1KVB A;  4N5S A;  4A3F C;  1Q18 A;  2O5J A;  4A3B K;  3GTM A;  4BRE A;  3H0G C;  4IDK A;  4PA1 A;  2E2Q A;  3K5N A;  1WBB A;  3HI0 A;  1B9F A;  3VEV A;  4IG0 A;  1BA1 A;  1Z25 A;  4B1Y B;  3S3O A;  1GE9 A;  3QB0 A;  3ZX3 A;  4BRG A;  4KHW A;  2GAG C;  1GLF O;  1SFO A;  3FHZ A;  4C23 A;  1IV0 A;  3MXJ A;  4DLG A;  1NBW A;  5FRM A;  2ASO A;  3S1N C;  4YFX A;  3S17 K;  2NVY A;  1SKR A;  4H5T A;  3NF6 A;  5BR8 K;  2HHX A;  3D45 A;  4CGI A;  1I39 A;  4GV3 A;  1HLU A;  3A5L C;  1F7U A;  3MN9 A;  4YFU A;  1RDW X;  5GAG P;  3MN7 A;  3ADA C;  2KQ2 A;  2GBZ A;  4Z4F A;  2QK9 A;  1OKJ A;  1RU0 A;  3DXK A;  5C42 A;  1QSY A;  1O26 A;  3DXM A;  2YJF A;  2FC0 A;  3S1M K;  3OYN A;  1A5W A;  3SZ2 A;  1VSM A;  1OVQ A;  4KHN A;  2Y3P A;  4GTF A;  2A5X A;  1QHT A;  5C3E C;  2ETJ A;  5TKW A;  1IO2 A;  3HOV K;  4DQS A;  5M5X K;  1RDA A;  4RW4 A;  4W5R A;  4KMA A;  3G71 N;  3U3Y A;  4GTE A;  3NDK A;  3BP8 A;  2CFA A;  1HJR A;  4H03 B;  3KTQ A;  3FGU A;  5HRS A;  4GT9 A;  1EK8 A;  1AB4 A;  1WAF A;  1IKY A;  3OW2 M;  2GSN A;  3GBT A;  3S15 K;  3FZL A;  1X9M A;  4JD2 A;  2HHS A;  5CZ1 A;  3L4J A;  3GTP A;  2DY4 A;  1VQL N;  4B1W B;  2E2O A;  3O3H A;  2JH3 A;  2P9K B;  4JKF A;  5JS1 A;  2F7T A;  3P5J A;  3ZET A;  4NCB A;  2P9U A;  2KLA A;  3MWP A;  1KLN A;  3S2D K;  4GW6 A;  3TU5 A;  4BRF A;  4WFB L;  4FJK A;  1O25 A;  4OIQ A;  4A62 A;  1U49 A;  1J6X A;  5M5W K;  4JK7 A;  3FKI A;  2HBL A;  1SUQ A;  3A5M C;  2HMP A;  4E89 A;  1KQ4 A;  5CYM A;  4UY8 O;  3I4N K;  2UXC K;  5AR0 A;  4Z4C A;  5FPD A;  4LOW A;  3VEY A;  2ZQB A;  4OO1 J;  1LOT B;  2CGL A;  2ZE2 A;  3ENH A;  1TAU A;  3PO2 C;  1I50 K;  3HOS A;  4QIW D;  4JKD A;  4DTX A;  2Z1I A;  1YI2 N;  3HVR A;  3T02 A;  3Q7C A;  1PJ5 A;  5KGX A;  3OS0 A;  3MEC A;  2OZS A;  2E2J C;  3KHY A;  3DWL A;  3KVG A;  3GIR A;  3WXI A;  1TWG C;  2JA8 K;  2Q0U A;  2D0C A;  2NLX A;  2ZFZ A;  4FLY A;  3GTL C;  1TWA C;  1W0H A;  3DYA A;  3IUC A;  3CCQ N;  1JLG A;  4EHT A;  2W6L A;  1CZ9 A;  4O8U A;  3W0L A;  2YHW A;  4YNQ A;  3QO9 A;  1XC3 A;  4YOX A;  3CQZ A;  2PYL A;  4FW1 A;  1J6Z A;  3VQ5 A;  3QFP A;  4CK3 A;  3OYL A;  4B3M K;  3NVM A;  1VJE A;  3U8X A;  2YNH A;  5IP9 C;  1Y1W K;  3LAN A;  3LP1 A;  3O4Q A;  3C0B A;  1I6V A;  2X6N A;  3S0X A;  3PSF A;  5C4J C;  4PL7 A;  3THX A;  4JI4 K;  5AZI A;  5C4X C;  1DCO A;  4BG9 A;  3F9M A;  1WQF A;  3NBP A;  1QVG M;  4FXD A;  4CZK A;  1ZXO A;  3WNF A;  1PJ7 A;  3DI6 A;  1QS4 A;  5C44 K;  1SL1 A;  3SLC A;  2P9N A;  4GTD A;  3QER A;  1ZQ1 C;  1H1V A;  4C2M K;  4DDQ A;  1DEJ A;  4QS7 A;  1INN A;  4W5Q A;  3P39 A;  3A5N C;  2Q31 A;  4DG1 A;  5J1E A;  2EHG A;  1TKT A;  3VGM A;  1WSF A;  3R9P A;  2O8D A;  3FR0 A;  3O08 A;  3AO3 A;  3HPG A;  4AYB L;  1VQ5 N;  3CCU N;  1T7P A;  4FWN A;  3S16 C;  1UAX A;  3TFJ A;  4EFH A;  1PJ6 A;  1L3T A;  3LPU A;  4H0T B;  4OJR A;  4GTA A;  1VSF A;  3BY5 A;  3GTJ C;  4YOT A;  3RMC A;  3AQO A;  1BUP A;  5FDL A;  2XCO A;  4B8C A;  1YUW A;  4WCE L;  3OA9 A;  1JKH A;  5AFU H;  3RMA A;  4RMF A;  1KFD A;  4M3T A;  3AAR A;  4ICL A;  3SUO A;  3R1X A;  5CJ9 A;  3FFI A;  2VGM A;  4CEQ A;  4BG8 A;  4WFN L;  4BY7 C;  1LAV A;  3RSE B;  4AH9 A;  4CZE A;  3RMB A;  2O8F B;  3AVL A;  3MML B;  2B63 C;  2RHK A;  4WJ4 A;  1HUX A;  4DSF A;  2IVP A;  1I3Q K;  3I56 N;  4EP4 A;  1K8A O;  4OKK A;  4QS9 A;  3MXM A;  1XPP A;  1B92 A;  4FJH A;  2ZM6 K;  4JAX A;  4YY3 K;  3H0G A;  5CR4 A;  4CZL A;  3J7Y P;  1SS6 A;  3L4Q A;  3OS1 A;  2BGG A;  3PO2 K;  3TTD A;  3KK1 A;  1HI9 A;  5D3G A;  1YTU A;  1S9E A;  4Y0W A;  1GOA A;  1XHX A;  4KAR A;  4KBO A;  3CCE N;  3CJ7 A;  5EU7 A;  4O0I A;  3THY A;  2ZJQ L;  4DUZ K;  1SL2 A;  1BJT A;  5IYC K;  4A61 A;  1XUP O;  4GV9 A;  4EAH D;  4PAB A;  5C15 A;  3GTG C;  1TWG K;  2D1K A;  4K43 A;  1IQ0 A;  1TWA K;  2P9K A;  3ATV A;  1WBD A;  4EZ9 A;  2QWR A;  4E7J A;  4B9V A;  4JV5 K;  4KDD A;  4CK2 A;  2V7Y A;  1O2F B;  4A3C C;  2G8F A;  1NJX A;  3BF3 A;  5GIP A;  3QEX A;  4MDA A;  1VLO A;  3S1Q K;  3I55 N;  2Z1J A;  4GKJ K;  3OJS A;  1JLB A;  1FXX A;  1YJW N;  4GVM A;  4J8F A;  4Y1C A;  2BE5 A;  3NH1 A;  4ZTF A;  2X6S A;  3L4I A;  4A5B A;  3V9Z A;  1BIU A;  3E01 A;  4H0X B;  4CES A;  2HW3 A;  3C6T A;  5BR9 A;  2Q1N A;  1U45 A;  4KAZ A;  1BI4 A;  1IKV A;  3RZD K;  2G8W A;  5JLH A;  3GEE A;  4FLU A;  5C4J K;  4JK9 A;  3VF6 A;  2PFU A;  3TFH A;  1NGA A;  4H4M A;  2HVI A;  1RT2 A;  1XXC A;  2GX9 A;  1DD5 A;  4KO0 A;  5IOR A;  4CF8 A;  3GE1 A;  3NE6 A;  3G4C A;  2VUM C;  1TVR A;  1GLA G;  3NF9 A;  2D6F C;  1VQN N;  4CEC A;  2EBB A;  1N8R O;  2PMZ D;  3VEN A;  4WE1 A;  4I7F A;  4DFK A;  3BUE A;  3OEP A;  1ATS A;  1C1C A;  4GTC A;  4FWL A;  3KZB A;  2HBK A;  4OGE A;  4A59 A;  4IBN A;  1K9M O;  3QIO A;  1Z05 A;  4BBR K;  1NLV A;  5AQK A;  4AM6 A;  4PHT X;  3K2P A;  4BR5 A;  2HHV A;  4DF8 A;  2OA8 A;  4J2E A;  1D9D A;  4DTO A;  4A3J K;  2R7Z K;  1VQM N;  4IJN A;  1WSI A;  5AQT A;  3HOX C;  4HCC A;  3AAP A;  3TSP A;  3ZT3 A;  3PY8 A;  2P5M A;  2Y0S L;  1G99 A;  3RR7 A;  1EP4 A;  2NVT C;  4CGD A;  3V1O A;  4ILH A;  3ULE B;  3O5B A;  3DLH A;  1TWC C;  2R92 A;  2P8T A;  1N5Y A;  5JLF A;  1O27 A;  2A41 A;  3SMS A;  3FOE A;  2W42 A;  1Q86 O;  4EZ6 A;  2JA5 A;  4X62 K;  4L3Q A;  2O8C B;  2VG7 A;  4CJT A;  3OY9 A;  1Q8I A;  4E7H A;  4C8M A;  3GTM C;  4BE1 A;  4DSK A;  1WOQ A;  1TWF A;  4KH4 A;  3O9Q A;  4A3K C;  3HKZ L;  1NGD A;  1VSL A;  1ILY A;  4BY1 C;  5LMN K;  5KPR A;  3MCA B;  3TFI A;  4LC9 B;  3SI6 A;  1RTD A;  5IP7 K;  1NKC A;  2A1S A;  1G51 A;  3P4I A;  3K5M A;  5BRD A;  2FQO A;  4CEF A;  2RF2 A;  2NVY C;  4BLA A;  5KQD A;  3V6D A;  4LQY A;  2ZGZ A;  4LH5 A;  1NMN A;  1NK6 A;  2D0O A;  1D5A A;  4ELU A;  4OVL A;  2FBX A;  5BRH A;  4CD3 A;  3LAP A;  5AQO A;  5JVH L;  4FWO A;  4BE2 A;  2E6M A;  3LP0 A;  3SMP A;  1YCL A;  4KB2 A;  4A3I C;  4IFV A;  2Y0S D;  3S1R C;  3O1W A;  4A2B A;  2XHB A;  5HRO A;  2PA8 D;  1HKC A;  3ITH A;  1YVU A;  2KKZ A;  3O9R A;  1WSE A;  3AO4 A;  4HCB A;  2PAV A;  4B9S A;  1YTA A;  5AQR A;  4YG2 A;  1XHZ A;  2GSO A;  4WQ4 A;  2VWJ A;  4FJM A;  5AQI A;  4F4K A;  5BRF A;  4MEX A;  3GTG K;  2A6H A;  3HKZ D;  4A3M C;  5EXW A;  3TAF A;  2QI2 A;  1TUU A;  3MK6 A;  2XCQ A;  4AQY K;  4E1J A;  4W5T A;  3RSE A;  4KHQ A;  3MEG A;  3TR8 A;  3M4O C;  1XMO K;  2QWQ A;  5T7B A;  4GY2 B;  4CEE A;  3AVN A;  4DTR A;  5EGE A;  3HOU C;  3A8K A;  4HVJ A;  5HL8 A;  3S14 C;  4WJ3 M;  1U48 A;  1SZ2 A;  2YJE A;  4YOU A;  3WXK A;  2FBY A;  4CIE A;  4CVN E;  3CIP A;  1TK0 A;  3LAM A;  4BDP A;  1XZP A;  5AQM A;  3SYZ A;  4WIL A;  4G7H A;  3UIQ A;  2NVQ C;  4CFB A;  2WAQ L;  2WOM A;  4E7K A;  2Z1H A;  1TWH C;  4FK2 A;  4OKE A;  2F4V K;  5J2N A;  3HPO A;  1J98 A;  3CJA A;  1QVF M;  1JQW A;  3HOW K;  1NM1 A;  3DRR A;  4J2A A;  2OTL N;  4CZJ A;  4NCA A;  4XH1 A;  4KTZ A;  1MDU B;  5I9E B;  3GTJ A;  2NRW A;  4PKG A;  1ZC6 A;  2W41 A;  4B8A B;  2PPB A;  4BRD A;  1MA9 B;  4ISF A;  4BRP A;  1NOY A;  1RTI A;  5IWA K;  1K83 K;  3HOY C;  1SL0 A;  2NRV A;  5ADX H;  4MO4 A;  5IOS A;  1VK0 A;  4RW7 A;  3ZT4 A;  4GTL A;  1N6Q A;  1XI1 A;  3HP9 A;  1ATN A;  4NB4 A;  4J2D A;  1NGF A;  4FPA A;  1CLQ A;  3ZYY X;  5E41 A;  4WFA L;  3V9S A;  4RG8 A;  4KFB A;  3S2H K;  5CE3 A;  1QZ6 A;  5IYB C;  3H3V L;  3HOT A;  4KHY A;  3HOX K;  4FWM A;  3AVK A;  4HTL A;  1EI6 A;  2X74 A;  2HVH A;  4FOI A;  1TYQ B;  5BN8 A;  3T3F A;  1HMV A;  2WAQ D;  4K8X A;  1TWC K;  4DTN A;  4DR2 K;  2JA7 C;  2P1J A;  4DQP A;  1HJO A;  2YV0 X;  1TAQ A;  2W40 A;  3K5O A;  4B3S K;  4XIU A;  3L4K A;  3CQZ C;  1IKW A;  1QQN A;  3PSI A;  1REV A;  1QSL A;  3KJV A;  1XXB A;  4YOY A;  4CJL A;  1GOC A;  3CD6 N;  1Q9X A;  3GTQ A;  3V4I A;  1BO5 O;  3DLR A;  3OYE A;  3ATU A;  1SFO K;  1BOT O;  2D0B A;  1RT4 A;  5TMC A;  1ZBI A;  2A3Z A;  4PKH A;  3FLC O;  4KI4 A;  3TSQ A;  4KB0 A;  1BL3 A;  3RTV A;  1HYS A;  3Q7B A;  3BEX A;  4FO0 A;  4DV4 K;  5AQX A;  3CI5 A;  3TI0 A;  4DB3 A;  2IVN A;  1FK9 A;  1SKW A;  1KRP A;  3WOD A;  3JS6 A;  3K9J A;  1S3X A;  4F3T A;  1NU0 A;  3T1A A;  4FJN A;  4CJ5 A;  3ZLJ A;  3TAN A;  1I3A A;  1WAJ A;  1HKG A; 
#chains in the Genus database with same CATH homology
 5MLC Q;  1QQM A;  1Q82 O;  2XCR B;  2P9K B;  3WXJ A;  3D7E O;  4JKF A;  4NLB A;  2A6A A;  3HRG A;  3O9S A;  2E88 A;  2F7T A;  2ZJP L;  4KM9 A;  3F2K A;  3UKR B;  1Y1V A;  1Y64 A;  3ZET A;  3LAJ A;  2P9U A;  2Q0R A;  2KLA A;  4K41 A;  3ULE A;  4BRN A;  5C2D A;  1O2A A;  4C3I C;  1NGJ A;  2FSN A;  3MWP A;  5AQL A;  4BRO A;  3TU5 A;  3VA7 A;  4BRF A;  4WFB L;  4C3H C;  1O25 A;  4A62 A;  4A2A A;  3L6Q A;  4JK7 A;  3FKI A;  2HF3 A;  2EWS A;  3SAF A;  4M63 C;  2HBL A;  4U7B A;  3KWI A;  3QDK A;  4BRK A;  3A5M C;  2HMP A;  4KAW X;  2BTF A;  3N0B A;  4YOR A;  4IOX A;  1KQ4 A;  2RE2 A;  3ERE D;  3U9Z A;  4AF1 A;  1WQG A;  2CGK A;  4FWP A;  4EIA A;  4UY8 O;  1U2V B;  5AR0 A;  5FPD A;  1E4F T;  5AQW A;  3CCR N;  2VCP A;  3VEY A;  4OO1 J;  1LOT B;  2CGL A;  1U6Z A;  3ENH A;  1T3V A;  3HOS A;  2FF6 A;  4DCH A;  4FSV A;  3E9P A;  3VMF B;  3WEE B;  4JKD A;  1RGI A;  1YI2 N;  1P8Z A;  4IOA L;  4IOC L;  1VQ7 N;  5IOQ A;  3Q7C A;  5JVG L;  1WQH A;  3QFU A;  2DPN A;  3KHY A;  3VEW A;  2ZGY A;  2P9L A;  4GV6 A;  3DWL A;  1NGC A;  3KVG A;  1YJ9 N;  3ORE A;  3WXI A;  1NMD A;  2NLX A;  2Q0U A;  2J4R A;  3LDP A;  2ZFZ A;  5GIN A;  3UE5 A;  4XH5 A;  3IUC A;  4Z94 A;  3CCQ N;  3H45 C;  3ENB A;  4JKA A;  4C1N K;  1WIH A;  4CZI A;  5FPM A;  3KWG A;  1TUY A;  4EHT A;  3AGR A;  3E66 A;  4H0P A;  4O8U A;  3LDQ A;  3HSC A;  3W0L A;  1GLB G;  2YHW A;  5M1P A;  1XC3 A;  3LL3 A;  5AQS A;  3N3Y A;  2GEM A;  1GLC G;  4YOX A;  3CQZ A;  2V51 B;  4IWV A;  3AH5 A;  3C7N B;  3CAG A;  3CCS N;  5TJ3 A;  1LCU A;  2HOE A;  1J6Z A;  2E2H A;  3QFP A;  4A57 A;  2QWP A;  3SAG A;  4P5A A;  3NVM A;  3VTH A;  3S41 A;  3U8X A;  3EKS A;  3PIP L;  5BRE A;  2NRT A;  5CHI A;  3D6R A;  2R93 A;  1EH1 A;  2ASM A;  1YVN A;  4KH5 A;  3C0B A;  2R7Z A;  3S0X A;  2CH6 A;  5EOY A;  4PL7 A;  3D2F B;  4FWQ A;  3MX5 A;  4XEI A;  1O24 A;  5AZI A;  3TPQ A;  1RFQ A;  5M1K A;  3LM9 A;  1SAZ A;  3F9M A;  4BG9 A;  1WCM A;  4H5R A;  3DAW A;  1WQF A;  2YU9 A;  4EHU A;  1QVG M;  2NRH A;  2Q36 A;  1Z6R A;  2JWL A;  3M5R A;  4CZK A;  3MDQ A;  1ZXO A;  1VQO N;  1E4G T;  1JCE A;  2YCH A;  2QTD A;  1O28 A;  2OAN A;  4JKG A;  5KPT A;  3H1V X;  4GVE A;  3SLC A;  3VES A;  2P9N A;  5FPE A;  2H3G X;  1KQS M;  3AQP A;  3N0C A;  2I7P A;  4GTD A;  2ZJR L;  4KM8 A;  1H1V A;  1P90 A;  1HX1 A;  4G0W A;  5E84 A;  4DDQ A;  3GL1 A;  1DEJ A;  4QS7 A;  2HF4 A;  1MWM A;  4JHD A;  3VEX A;  3P39 A;  3VER A;  3B8A X;  3A5N C;  2Q31 A;  5BPL A;  2GUP A;  3DLL L;  1NGB A;  3O9U A;  2BUP A;  4BRQ A;  1S72 N;  3QX3 A;  3C6A A;  1NGH A;  3VGM A;  4K42 A;  3R9P A;  3OPF A;  1YHQ N;  2QM1 A;  4ILG B;  2Q2R A;  4RCH A;  3FR0 A;  5C2F A;  3CC7 N;  2AP1 A;  3O08 A;  3LPX A;  1NWK A;  1VQ5 N;  3CCU N;  4FWN A;  2D0P A;  2P9P B;  4ISE A;  1B4B A;  5DM6 L;  1QZ5 A;  4WQ5 C;  4IDH A;  5DM7 L;  4EFH A;  3IKM A;  2E2P A;  3VF4 A;  1JCG A;  3WXM B;  5LY3 A;  3C6H A;  3H46 O;  1M90 O;  4H0T B;  3D2E B;  5AQJ A;  3HZ6 A;  2P9U B;  3G4S N;  4GTA A;  2NRR A;  1GLJ O;  1EO1 A;  4YOT A;  1X9J A;  3AQO A;  1BUP A;  2XCO A;  1YUW A;  3VEO A;  2HST A;  4XH4 A;  4WCE L;  3OA9 A;  4BC2 A;  5AFU H;  5C0Y A;  2P9I B;  4BR0 A;  1B4A A;  1NJI O;  3MWT A;  3AAR A;  5JFE A;  2ITM A;  3R1X A;  4KB4 A;  5BPN A;  5CJ9 A;  4JEP A;  3VTI A;  2VGM A;  4G0U A;  1K8K B;  4BG8 A;  3CQY A;  5C12 A;  1KAY A;  4WFN L;  1TYQ A;  1R59 O;  3FE1 A;  3H6E A;  3RSE B;  3WQT A;  1QQO A;  4IZ9 A;  4CZE A;  3J7Z O;  3M3Z A;  3EE8 A;  1TWG A;  3MML B;  2RHK A;  5AQQ A;  4DQ8 A;  4H5V A;  1TWH A;  2FXU A;  4WF9 L;  1TWA A;  3GTL A;  1Q81 O;  1IS1 A;  1HUX A;  4QS8 A;  3CCL N;  2IVP A;  2KWA A;  4FWR A;  3CCV N;  3R8E A;  3WQU A;  4BRA A;  3I56 N;  3G4A A;  4CBW A;  3ZX2 A;  4CZF A;  1K8A O;  1RDU A;  4O8K A;  1XXA A;  4M7X A;  4H0Y B;  3O6W A;  4G9Z A;  2E2N A;  3H3N O;  3UKU A;  3MN5 A;  4QS9 A;  4YDU A;  5KPZ A;  3VGK A;  2ZF5 O;  4BGB A;  2P9S A;  3HM8 A;  3G25 A;  3A5O C;  4JAX A;  4B1Z A;  4JKB A;  2ASP A;  1X3N A;  3SJH A;  3H0G A;  5CR4 A;  4CZL A;  4FOE A;  1SS6 A;  3L4Q A;  3O9T A;  1BGW A;  3BF1 A;  4MO5 A;  3TTD A;  4BGA A;  1R9T A;  4JNE A;  4CBX A;  3M1F A;  3ZEU A;  3VEZ A;  5EGH A;  4DKW A;  3K9K A;  4Y0W A;  3SBG A;  1NGG A;  5AFU A;  4BVP A;  1M1K O;  2FSJ A;  4CZM A;  4KAR A;  4KBO A;  2F9T A;  3CCE N;  3CJ7 A;  5AQF A;  2YX6 A;  2ZJQ L;  1BJT A;  4A61 A;  1XUP O;  4GV9 A;  5TKY A;  4BR7 A;  4EAH D;  5C15 A;  1VQ4 N;  5AQP A;  2D1K A;  4K43 A;  3I33 A;  2P9K A;  3ATV A;  2WFB A;  3WXL A;  2RGR A;  2QWR A;  2NZT A;  4KDD A;  1JCF A;  2UYT A;  2V7Y A;  4OPA A;  3UKR A;  1CZA N;  3AY9 A;  2JA6 A;  1BWF O;  3BF3 A;  5GIP A;  3OHR A;  4MDA A;  1K83 A;  3I55 N;  2JA7 A;  3ENO A;  1T6C A;  5CHP A;  5EVZ A;  5H1S Q;  4IEI A;  1QHA A;  1YJW N;  5HL7 L;  3R6M A;  4FPB A;  4J8F A;  4PL8 A;  3LDO A;  4KAS A;  3W3D A;  3A0I X;  4F9O A;  3TTC A;  1GLE G;  3L4I A;  4H0O A;  2JWK A;  1DGK N;  4A5B A;  3MCP A;  5M1N A;  4H0X B;  5IOT A;  1VQP N;  3CJB A;  2Q1N A;  4K25 A;  4I6M A;  2P9N B;  3WT0 A;  5BR9 A;  3VET A;  4CZH A;  4KAT A;  3ZX0 A;  4FWK A;  5JLH A;  4BY9 C;  4IXC A;  4WQ5 A;  3E1Y A;  4JK9 A;  3VF6 A;  1BG3 A;  2PFU A;  3MX2 A;  3DXK B;  3C65 A;  4ISG A;  4FZB A;  3DXM B;  1NGA A;  1Q7Y O;  1XXC A;  2NVX A;  3NVK A;  2GX9 A;  5BN9 A;  1DD5 A;  1C0F A;  3JXU A;  3A8Y A;  2GWK A;  2E1Y A;  4WQ4 C;  5IOR A;  1WUA A;  3EN9 A;  3GE1 A;  3G4C A;  4C3J C;  5AQU A;  1GLA G;  3FZH A;  3CC4 N;  3WEE A;  4BC3 A;  3PIO L;  4U67 L;  3DJC A;  1VQN N;  1W97 L;  1N8R O;  3VEN A;  4B1U B;  4CBU A;  3BUE A;  3OEP A;  1V4S A;  1ATS A;  2OTJ N;  4H5N A;  4GTC A;  4FWL A;  3SBT A;  3J8A A;  4MDB A;  3GTK A;  4PKI A;  3KZB A;  2HBK A;  5JMV A;  3ID8 A;  2CFA B;  4P5B A;  3FOF A;  4BRH A;  5BPM A;  4A59 A;  5HOO A;  5M1F A;  1V4T A;  1K9M O;  3CC2 N;  1Z05 A;  3CJ1 A;  1NLV A;  3IMX A;  3OBY A;  4NLC A;  2Q97 A;  5AQK A;  1EQY A;  2VWB A;  1KAZ A;  2WBN A;  5F2R A;  5AZJ B;  3T69 A;  4AM6 A;  4B9Q A;  4PHT X;  2B63 A;  4BR5 A;  5JVO A;  2NRX A;  2I7N A;  4JD2 B;  4MLE A;  2YHX A;  1O29 A;  5B8H A;  4FM9 A;  3C7N A;  5EX5 A;  2YI1 A;  4LR2 A;  2A40 A;  3EE9 A;  1F9N A;  3FFK B;  4BRM A;  4FWS A;  3M6G A;  2E20 A;  1VQM N;  4JKC A;  4IJN A;  1DT9 A;  5AQT A;  3AAP A;  3TSP A;  2P5M A;  3O4W A;  3QBW A;  1G99 A;  1KD1 O;  1ZVU A;  3ZET B;  4ILH A;  2AA4 A;  3O5B A;  3ULE B;  1KC8 O;  4M7Y A;  4C2M C;  2R92 A;  3VPZ A;  4BRL A;  4BVO A;  3D2F A;  2WUS A;  5JLF A;  1O27 A;  2A41 A;  4RTF D;  3SMS A;  1KXP A;  3FOE A;  1Q86 O;  2JA5 A;  3KK7 A;  3EZW A;  4L3Q A;  3HBT A;  1D4X A;  3H1Q A;  3CF5 L;  1YF5 L;  3LM2 A;  1C0G A;  1WOQ A;  4KH4 A;  4BR9 A;  1VQ8 N;  3O9Q A;  3CJC A;  1TWF A;  4M1X A;  1NGD A;  1ILY A;  3T7Z A;  2GEL A;  2KHO A;  5GIO A;  5KPR A;  1IG8 A;  3MCA B;  3MN6 A;  3SK3 A;  1YAG A;  1XQS C;  4LC9 B;  3LDL A;  3GTG A;  1ATR A;  3BUZ B;  3P4I A;  2HBJ A;  5BRD A;  1MWK A;  4IO8 A;  4G0V A;  3CME N;  3HTV A;  3EO3 A;  3OBW A;  1OVY A;  4BLA A;  5KQD A;  2RH6 A;  4LQY A;  2ZGZ A;  4YOV A;  2E8A A;  3SAH A;  2VYP A;  4H0V B;  2D0O A;  1I50 A;  3TTF A;  3CPE A;  1W2B M;  2NRZ A;  3EKU A;  2P9P A;  4CD3 A;  4JKH A;  5AQO A;  5BRH A;  4MLH A;  3LAP A;  3NUH A;  4WYB A;  3UB5 A;  1ESV A;  2P9L B;  3QBX A;  4FWO A;  5JVH L;  2QA4 N;  3GTO A;  4ILJ A;  1VQ6 N;  3SMP A;  4KMD A;  2E1Z A;  2QWM A;  4KB2 A;  1JJ2 M;  3VOV A;  3D2E A;  3U9D A;  3O1W A;  4A2B A;  1HKC A;  4IJA A;  2KKZ A;  3O9R A;  1BA0 A;  2PAV A;  4CJ7 A;  2F9W A;  3Q3Q A;  5AQR A;  2GSO A;  4WQ4 A;  5ELZ A;  2FF3 B;  2P9I A;  3L0Q A;  3FZK A;  5AQI A;  5AQG A;  5M1O A;  5BRF A;  2VUM A;  2A42 A;  3N4Q A;  3CPW M;  4FVU A;  1K8K A;  2ZWH A;  4I6M B;  2YHY A;  5EXW A;  4BQL A;  4BQZ A;  4R79 A;  2QI2 A;  1TUU A;  3MK6 A;  5F0X A;  4NO7 A;  3H3O B;  4E1J A;  2XCQ A;  3RSE A;  3I8B A;  5JIC A;  2QWQ A;  5GAE P;  4YOW A;  2QEX N;  4BC4 A;  4GY2 B;  1K73 O;  1ZBS A;  3P31 A;  3ID6 A;  4BRI A;  1YIJ N;  2E2I A;  3O80 A;  1YXQ A;  2QWO A;  5AZI B;  5EGE A;  1Y1W A;  1BDG A;  3LDN A;  4BC5 A;  1ISE A;  2PHC B;  4IFE A;  1SZ2 A;  2YJE A;  4H5W A;  4YOU A;  5AQZ A;  3WXK A;  4KC6 A;  3CIP A;  5AQN A;  5AQM A;  3N4P A;  1VAZ A;  5LJV A;  4JKG B;  3EL2 A;  1KAX A;  2QW9 A;  4JN4 A;  4BRC A;  4KH6 A;  5AQY A;  4KMH A;  1U2V A;  3AAQ A;  1GLD G;  2CGJ A;  3CMA N;  4OPH A;  4BKW A;  1S22 A;  3CCM N;  3FZM A;  4B1X B;  3CJA A;  4JHD B;  1IJJ A;  4HWI A;  1NM1 A;  5GAD P;  3TSU A;  3CCJ N;  5AQV A;  4AM7 A;  1QVF M;  3QML A;  1NGI A;  1YIT N;  4CZJ A;  2OTL N;  2NNW A;  3CER A;  4XH1 A;  4A5A A;  2CH5 A;  3VF2 A;  1TWC A;  3QIC A;  4CZG A;  1HKB A;  1MDU B;  5I9E B;  3GTJ A;  1SQK A;  2D4W A;  2NRW A;  4PKG A;  5E26 A;  1ZC6 A;  1DKG D;  3IDH A;  2W41 A;  1T6D A;  1Q18 A;  4YDU C;  2GSU A;  4BRD A;  4DHY A;  5C10 A;  1MA9 B;  4ISF A;  1VQ9 N;  4BRP A;  4O5F A;  3GTM A;  3GG4 A;  4BRE A;  2NRV A;  2E2Q A;  3HI0 A;  3VEV A;  5ADX H;  4MO4 A;  5IOS A;  4B1Y B;  1BA1 A;  1GE9 A;  4FL9 A;  3QB0 A;  3ZX3 A;  4BRG A;  4GTL A;  1GLF O;  5FPN A;  1SFO A;  3FHZ A;  4C23 A;  2BH1 A;  1ATN A;  4NB4 A;  3F5T A;  1NBW A;  4IEE A;  3U4L A;  1NGF A;  2ASO A;  2IIR A;  5M1Q A;  2FSK A;  4FPA A;  4BR4 A;  3CHW A;  4GNI A;  3ZYY X;  3RVC A;  4WFA L;  3MMV A;  4CI6 A;  3GOI A;  4JK8 A;  2NVY A;  3V4G A;  2PBD A;  3NMU A;  2V7Z A;  4H5T A;  4B1V A;  3CXC M;  3P38 A;  5CE3 A;  2FLO A;  1QZ6 A;  1VQK N;  2WC9 A;  3O1B A;  5EY4 A;  3HOT A;  4GV3 A;  1HLU A;  3CJ9 A;  3WUH A;  4FWM A;  5LJW A;  4HTL A;  3A5L C;  4RWT A;  3CET A;  3MN9 A;  3FZF A;  4BR2 A;  1RDW X;  1TYQ B;  3MN7 A;  4FOI A;  5GAG P;  5BN8 A;  1OKJ A;  1BU6 O;  3DXK A;  1O26 A;  3DXM A;  1GLL O;  1HJO A;  3IFR A;  3GDQ A;  2YJF A;  3VGL A;  3G6E N;  2GWJ A;  2QWN A;  2W40 A;  2GTD A;  3CQX A;  3R3L A;  3L4K A;  1O2B A;  4GFQ A;  4J3N A;  2Y3P A;  1QQN A;  4GTF A;  1T44 A;  2A5X A;  2V52 B;  2QWL A;  1O13 A;  4ILD A;  5TKW A;  1XXB A;  4YOY A;  5F1X A;  3CD6 N;  3E9O A;  3GTQ A;  2HBM A;  3PLA A;  3UKU B;  1HPM A;  3E9L A;  1BO5 O;  1I3Q A;  5AQH A;  3ATU A;  4KMA A;  3G71 N;  5ADX A;  2P9S B;  1BOT O;  4GTB A;  4GTE A;  3BP8 A;  2CFA A;  1X3M A;  2A3Z A;  4PKH A;  3FLC O;  4H03 B;  3TSQ A;  3FGU A;  4GT9 A;  5KQ8 A;  1EK8 A;  3ZEU B;  1AB4 A;  3AGK A;  3OW2 M;  2IVO A;  4IO9 L;  3Q7B A;  3BEX A;  4FO0 A;  1YJN N;  2GSN A;  3GBT A;  3O8M A;  5AQX A;  5AZJ A;  3CI5 A;  4CD1 A;  4BLB A;  4C1N I;  1NGE A;  4DB3 A;  4JKE A;  2IVN A;  3FZL A;  3JS6 A;  3K9J A;  1S3X A;  4JD2 A;  3L4J A;  5GAH P;  3GTP A;  2VGN A;  2QXL A;  1VQL N;  4B1W B;  2E2O A;  2JH3 A;  1HKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...