1ZXOA

X-ray crystal structure of protein q8a1p1 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr25.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
265
Chain Sequence
LIADSGSTKTDWCVVLNGAVIKRLGTKGINPFFQSEEEIQQKLTAVYFYGAGCTPEKAPVLRRAIADSLPVIGNIKANSDMLAAAHGLCGQKAGIACILGTGSNSCFYNGKEIVSNISPLGFILGDEGSGAVLGKLLVGDILKNQLPATLKEEFLKQFDLTPPEIIDRVYRQPFPNRFLASLSPFIAQHLEEPAIRQLVMNSFIAFFRRNVMQYDYKQYPVHFIGSIAYCYKEILQDAARQTGIQIGKILQSPMEGLIQYHSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein Q8A1P1
publication title X-Ray structure of the hypothetical protein Q8A1P1 at the resolution 3.2A. Northeast Structural Genomics Consortium target BtR25.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 43
structure length 265
sequence length 278
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zxoA03
3VEYA 3QICA 4JN4A 3MCPA 3HZ6A 3R6MA 4H03B 5AQKA 4AM6A 5AQZA 3SMPA 3SLCA 3O6WA 4CZLA 4ISGA 2D0PA 4B1VA 3ZETB 1RFQA 5LY3A 2QWRA 2QWQA 5AQRA 3CJBA 3G25A 3SK3A 3U9ZA 4M7XA 4PL8A 3A5MC 1KXPA 1G99A 3EO3A 3EZWA 5FPNA 4B1XB 2DPNA 3C7NA 2A42A 3O1BA 3MMVA 2P9LB 2W40A 5EXWA 2QXLA 5FPDA 4K43A 1QQOA 4BC4A 4CBXA 2Q0RA 2E88A 4WQ4C 3QFUA 4A62A 3R9PA 3LM2A 4ISEA 3DJCA 1TYQB 3S41A 2YHYA 4BRKA 3WXKA 3FZFA 4IO8A 4K41A 3QBXA 2Q0UA 4FWRA 1BA1A 3ATVA 4EHTA 2V52B 3H3NO 2P9IA 2CH6A 1NGCA 3KHYA 4FWSA 3IUCA 2IVNA 1ZBSA 2CH5A 4CZMA 2Q97A 3O80A 3VEVA 2HF4A 3AAPA 1NGEA 4B1UB 5B8HA 3AAQA 3A8YA 2D1KA 4GNIA 2YHXA 2QW9A 1TUYA 4BQLA 1MA9B 3CERA 1BO5O 1Y64A 2VCPA 3QBWA 1RDWX 3CJ9A 4H5TA 5AQFA 3RSEA 5ADXA 5EY4A 3C0BA 5I9EB 3C7NB 1WOQA 3LDQA 2YJEA 1X9JA 4IJAA 5AQLA 4RCHA 5AZIA 2E2OA 1K8KB 1GLCG 2NRHA 2NLXA 5AFUH 4DHYA 4MO4A 4BR7A 5JMVA 1DEJA 3IDHA 4CZJA 3FZKA 3VGKA 4F9OA 3ENOA 2ASOA 2P9IB 5F2RA 2E20A 4A2AA 4LC9B 4B1ZA 3GDQA 4BRGA 3QB0A 5EVZA 1HKBA 3O1WA 1JCFA 3FFKB 1V4SA 3WEEA 4H0YB 1GLDG 3ZETA 1QZ5A 3VF6A 2HMPA 3ZX2A 4DQ8A 5BPNA 4FOEA 3A5OC 3CQYA 5AQHA 3VEZA 2P9KA 4DB3A 2P9LA 1RGIA 2V51B 4BR2A 5AQIA 3CQXA 5BREA 2E1ZA 3MN7A 4BC5A 3TU5A 3GL1A 4M7YA 4BC3A 1GLAG 3LDNA 3ATUA 2V7ZA 3WXLA 2P9SB 3AY9A 2P9NA 3VEWA 3VENA 3VPZA 3FGUA 1SZ2A 3ZEUA 4BVOA 3H1QA 2A40A 1BWFO 2FSNA 3FE1A 1T6CA 4MLHA 4EIAA 3UKRA 5AQTA 4BC2A 4M63C 1GLFO 2A6AA 1MWKA 2IVPA 4PKGA 5AQOA 4CBUA 3WEEB 1BUPA 3JXUA 4BRQA 3ID8A 1YVNA 1S3XA 3EKSA 4BG9A 1X3MA 2AA4A 4H5RA 1NGDA 3CJAA 4BRPA 2P9KB 4CZEA 2CGLA 1BA0A 1HKCA 2QWMA 3CJ7A 3L4IA 1XUPO 5BPMA 4BR0A 1ZC6A 3BUZB 4NB4A 5ADXH 3J8AA 4JHDB 4K42A 2PAVA 1GLEG 4QS9A 1QQMA 1K8KA 5BRHA 4EFHA 2W41A 2V7YA 1GLJO 2P9NB 5E84A 4MO5A 1HUXA 3D2EA 3I8BA 3ZEUB 2FSJA 1QHAA 3EKUA 3M1FA 1P8ZA 4FWNA 1HX1A 1V4TA 3UKRB 4PL7A 1DKGD 2PBDA 3L0QA 2IVOA 3QDKA 4IZ9A 3R8EA 4B1YB 2ZWHA 2IIRA 3ULEA 5BRDA 3EL2A 1CZAN 4EHUA 3FZMA 2Q36A 3UKUA 4CZIA 2GWKA 5AQXA 3O8MA 1MDUB 4GY2B 2E2QA 5AQMA 1QZ6A 5JICA 5FPMA 3LDOA 4CZHA 4O8KA 3U4LA 1IJJA 1JCEA 4E1JA 3HTVA 3BP8A 3O5BA 4FWQA 1HJOA 4H5NA 1WUAA 4BROA 2BTFA 3OHRA 4YDUA 4L3QA 4IXCA 2P9SA 3D2FB 3BF3A 3D2EB 1KAZA 4FL9A 1YUWA 5BR9A 5AQNA 4JAXA 3O4WA 4I6MA 3TPQA 3UE5A 5KPZA 2Q31A 4BR9A 5ELZA 1T44A 4BRHA 2FLOA 2E2NA 1NLVA 4B1WB 3CHWA 3ULEB 4MLEA 4BGAA 4YDUC 4HWIA 3UKUB 3MDQA 3VOVA 2J4RA 2KHOA 3ENHA 1GLBG 4HTLA 2HF3A 4CJ7A 2GELA 3HBTA 5TKYA 4H5WA 4QS8A 5AQUA 4BRFA 2WUSA 3LDLA 3W0LA 2A5XA 4XEIA 1Z05A 4H0PA 5AQQA 4CD3A 1EQYA 3P4IA 3LL3A 3SJHA 4JHDA 2QWNA 4IWVA 4DCHA 1H1VA 1J6ZA 2UYTA 1YAGA 4BRMA 1XC3A 3D7EO 2F9WA 4CBWA 4I6MB 3H6EA 3MK6A 1NBWA 3H45C 4H0TB 4BRNA 2OANA 3M3ZA 4CZFA 1NGAA 3VESA 2ASMA 3VEXA 3WQUA 2YI1A 2YHWA 1U2VA 5BN8A 1LOTB 2HOEA 1C0FA 1U6ZA 3M6GA 4JNEA 5AQPA 4BRDA 4RTFD 2FSKA 3H46O 3DXMA 1IG8A 2BUPA 2H3GX 2QM1A 3FR0A 4XH4A 5BN9A 3VF4A 3B8AX 1ATSA 2ASPA 4BRIA 2ZGZA 2FF6A 3GBTA 3O08A 4CD1A 1NMDA 1R59O 3DXKA 5AR0A 3IMXA 1C0GA 4FSVA 3A5NC 2GUPA 4A61A 1HPMA 4NO7A 5AQGA 5AQJA 3WT0A 5AQYA 1HLUA 4WQ4A 3A0IX 3F9MA 3DAWA 4PKIA 3D2FA 2E8AA 4FWMA 5FPEA 5AZJA 1DGKN 1MWMA 5AQWA 1OKJA 2I7PA 4FWOA 3HI0A 4RWTA 3KVGA 3MN5A 4H0OA 1HKGA 3FLCO 1NM1A 4BREA 4BVPA 2P9UA 5KQDA 1Z6RA 4FOIA 1U2VB 2QWLA 1QQNA 2A41A 4H5VA 3CJ1A 5BPLA 1KAYA 4BRCA 5E26A 3DXMB 1BU6O 2QWPA 4FO0A 2CGKA 2E1YA 2VWBA 3HSCA 3VERA 2D4WA 2GEMA 3VETA 1E4GT 3HM8A 4KBOA 5AQVA 4BG8A 4O5FA 1SAZA 3A5LC 4BRLA 3JS6A 1LCUA 3DXKB 4H0VB 4PKHA 5KPRA 4B9QA 3QFPA 4AM7A 3ZX3A 3MN6A 2ZF5O 4BGBA 3I33A 3LM9A 5AZJB 4C23A 3BEXA 3CIPA 3W3DA 3SMSA 3QMLA 4FWPA 3WUHA 4CZGA 3IFRA 4CI6A 4FPAA 2GWJA 2Q2RA 5KQ8A 1NGIA 2FXUA 2P9UB 4FPBA 5EX5A 4IJNA 4Z94A 1NGJA 1NGGA 5KPTA 1GLLO 5F0XA 5LJWA 1XQSC 2ITMA 2E2PA 1ATRA 3GOIA 4QS7A 2QWOA 2P9PA 4K25A 4JD2A 4H0XB 4WYBA 3CJCA 4A2BA 1ESVA 1YXQA 1KAXA 1NGHA 3FZLA 5JLFA 2GTDA 2AP1A 4XH5A 5AQSA 5CE3A 3ZX0A 3U8XA 5BRFA 1S22A 2YJFA 3VGMA 3VEOA 3VGLA 4J8FA 4BR4A 4WQ5A 3KZBA 3DWLA 4FWLA 1Q18A 2YCHA 3CI5A 1JCGA 3WQTA 3RSEB 2NZTA 3LDPA 2EWSA 4EAHD 3GE1A 4BRAA 1X3NA 2D0OA 3AARA 2I7NA 3BF1A 3WXIA 2F9TA 2CGJA 1BG3A 5AFUA 1ATNA 1E4FT 5EOYA 1TUUA 5LJVA 1D4XA 3GG4A 4WQ5C 3MN9A 3H1VX 4XH1A 5AZIB 1NGFA 5JLHA 4Y0WA 2FF3B 4BQZA 3WXJA 4CZKA 2P9PB 1TYQA 2ZGYA 4JD2B 3VF2A 1NWKA 3FZHA 2A3ZA 3L6QA 4BR5A 3UB5A 1SQKA 1T6DA 2VYPA 3EN9A 4ISFA 5F1XA 3CETA 4FWKA 1BDGA 3U9DA 1BOTO 1NGBA 1ZXOA 2Q1NA 3H3OB
chains in the Genus database with same CATH superfamily
2PYJA 3VEYA 4XSZA 1UOCA 1RDAA 1Q9YA 2O8CB 3TSPA 4BE1A 1YVUA 2QKBA 3SLCA 3O6WA 4CZLA 2PFUA 1J6VA 3AD7C 3MEGA 2G8VA 1RFQA 5D4DA 3NH1A 3CJBA 3SK3A 3DLHA 4CHNA 3L4JA 1BHLA 4G0UA 1KXPA 3CCSN 5FPNA 3PIPL 1RT1A 2DPNA 4M41A 5CYMA 2W40A 3NCIA 4CEOA 1M1KO 4GTLA 3HOUK 1I3QK 4DV5K 2BE5A 2A6EA 4C2MC 2ZE2A 1O24A 4OX9K 3LM2A 1XMOK 1TWHK 3S41A 3RMBA 2WONA 4BRKA 2VG6A 3S16K 3QBXA 3T19A 3SZZA 5M1FA 4B8AB 1HNXK 4QCLA 1ZYRA 2XRIA 2RH6A 4EHTA 3H3NO 3K9KA 1OH7A 4JK7A 4OKEA 2X6NA 5C10A 3GTOK 1Y97A 4GTAA 5JFEA 1ZBSA 1EKEA 2Q97A 4FLTA 1C0AA 2ZJRL 4JK9A 3OREA 3VEVA 1CZ9A 3V9SA 1NGEA 4CK2A 5DM6L 3H08A 4MDAA 4A3EC 4GNIA 2YHXA 4BQLA 1TUYA 4IO9L 1MA9B 3ULDA 3RSEA 1IE0A 3FKIC 4YFKA 3T1HK 3S2HC 1J53A 1WOQA 5C12A 1VQKN 1SMYA 3S14C 1WSVA 1ZYQA 2NUBA 3CCMN 3DOLA 2V6SA 4BE2A 2NLXA 2IDOA 5AFUH 4DHYA 4BR7A 5JMVA 5HL8A 3S2DC 4CZJA 4HUGA 3TARA 4F9OA 3ENOA 3K5OA 3V4IA 3GEHA 4BBRC 1Q82O 3THYB 2RGRA 2B5JA 4B1ZA 3NUHA 5KGXA 4HCCA 3WNFA 3GDQA 5HBMA 2E2HK 4Y1DA 1YX2A 2HNYA 2JA7A 1V4SA 5IP7K 4MDBA 2QXFA 4H0YB 1KVCA 3ZX2A 4DQ8A 3NF8A 4EZ9A 2JA5A 3A5OC 4C8NA 2HBLA 4MQ3A 4DB3A 4FJ8A 3G4SN 2P9LA 3AVGA 3AQPA 2R93C 4DKWA 4CJTA 5BREA 2UU9K 3DRRA 2GV9A 1GLAG 2RN2A 1YJWN 3WXLA 3M3YC 4LF4K 4ZTFA 3VPZA 4GW6A 3ZEUA 3V81A 1HYSA 3IS9A 3NE6A 3OEPA 4G9ZA 4ICLA 2KKZA 4LSNA 1BWFO 3DI6A 4MLHA 1T6CA 3CQZA 5AQTA 2WB1L 5A2QO 2VG7A 3LANA 5TKWA 1U04A 2A6AA 3MXIA 3LP1A 4GV6A 2IAJA 3OBWA 4O44A 1QE1A 3OYHA 3S1MK 1XHXA 1YVNA 4FZBA 4DSJA 2CFAB 4H4MA 1WSIA 1NGDA 2R92K 2Z1IA 1J5EK 2D5RA 4LJZA 2P9KB 3OYMA 3L4IA 3CJ7A 3TABA 3A8KA 4K8ZA 3OS0A 1NK9A 4DUZK 1VQLN 3S17K 3F73A 4DFJA 1Y1VC 3K0SA 1GLEG 4EFHA 2W41A 2V7YA 1W0HA 2NVQC 2DY4A 3D2EA 5C25A 5AJ3K 3S1QC 3HKZL 5IYDC 4FLUA 3I55N 1JLBA 5HRRA 1TWGA 3UKRB 1C0TA 1DKGD 2PBDA 3SYZA 4IZ9A 3R8EA 4B1YB 2KWAA 2A69A 3HOWK 4JI4K 1CZAN 4CZIA 1TK5A 3O8MA 1WBDA 1XZQA 1PJ6A 3C65A 3SV3A 2NRRA 4WE1A 1QZ6A 5JICA 2WTUA 4A3GK 1WSJA 1KLNA 4CZHA 4O8KA 1BI4B 3BY5A 1IJJA 2XY5A 1SFOA 2D0CA 4GTEA 1X9WA 2ZQBA 3MCAB 4Z4CA 3H0GA 1WUAA 4DTSA 2OZSA 3TTDA 2O8FB 4YDUA 4L3QA 1S1XA 2OPPA 3NGYA 1YUWA 3S1RC 3OYNA 4DR3K 3O4WA 2FQTA 3G4AA 3LAJA 4C8LA 3WODA 5M1PA 1QVFM 1T44A 1GE9A 1W9HA 1FW6A 3CHWA 5IWAK 3N0BA 3CFOA 4MLEA 4JKGB 3CCUN 4J2BA 3VOVA 2RF2A 5SZTA 4DLGA 5TMCA 4OKKA 4HUEA 3H3VD 1VQNN 4HTLA 3SUPA 3HP6A 2P5MA 3I0SA 2WUSA 4JI5K 2NVXC 2JA6C 4FJIA 4XEIA 4GVEA 4KHNA 4AHRA 1RT6A 4AHVA 3NAEA 4F3OA 4A57A 2VUMA 3T02A 1SV5A 3L2WA 3GTGC 5J2NA 4DTOA 4JHDA 4Z4EA 3ISNC 1WQHA 4B3SK 1IW7A 3PX6A 4CJLA 4I6MB 1CXQA 3SQ1A 3HJFA 3C6UA 4A5AA 3ZT4A 4BRNA 1JKHA 4JI6K 4O55A 4CZFA 2EBBA 4O8UA 2A68A 4QIWL 2YHWA 3BZCA 1I50A 2HOEA 2HVIA 4KI6A 1J6XA 1YIJN 4FJLA 5EGEA 4JNEA 2FSKA 3OA9A 5BN9A 3JSMA 2G8HA 1ATSA 4BRIA 4FJ5A 4CF2A 4FZYA 3GTJC 3GBTA 1HNZK 3DM2A 1A5XA 1NMDA 5AR0A 4CIGA 3MXMA 1QSSA 3IMXA 3U3GA 2R7ZA 4FJ7A 1O25A 4H4OA 5AQGA 3OBYA 3WT0A 1HLUA 1NK6A 4CJWA 3F9MA 2YKNA 1BGXT 2WBNA 1TWCA 3T3FA 1BGWA 5FPEA 1WSEA 4IFYA 2A6HA 1REVA 4MEXA 5AQWA 4FM0A 1OKJA 4E0DA 4RWTA 4FVUA 4DV7K 4XLPA 4CEBA 4I7FA 3ZT0A 3LAPA 4BVPA 3U6FA 1L3TA 3HOZC 1UWBA 4LLGA 2NVYA 3K5LA 3QETA 4RW9A 4H5VA 4P9SA 4WCEL 5E26A 4B3MK 3DXMB 1BU6O 2E1YA 2VWBA 3LP2A 3HM8A 2KW4A 4BG8A 4KPYA 4CEAA 3R3LA 5E41A 4B8CA 1HNVA 3GTPK 3DXKB 4PKHA 3O3GA 4U7BA 4P5BA 3G6EN 3TFHA 3RWUA 2GBZA 4B9QA 3HXAA 1BIUA 4AM7A 1O29A 1O13A 2PPBA 3HOYC 3HL8A 4KFBA 4E89A 4C3IK 4W5QA 3MN6A 4M3XA 1I3QA 2ZF5O 4DSFA 1HJRA 2GUIA 4BGBA 1JLEA 3I8DA 4M42A 1TWHA 5AZJB 4CGJA 1FK9A 3BEXA 4I9QA 3GTMC 3QMLA 3OS2A 4HTUA 1TKDA 3M8SA 4LY7A 4RW8A 3GTQC 1DCOA 1RT7A 2R7YA 4KRFA 2Q2RA 4A3LK 1FXXA 5KQ8A 3AA3A 5IP9C 4NYFA 2HW3A 4IOCL 3VQAA 3TAMA 1SKSA 4Z94A 4DFPA 1NGJA 4JRQA 4YOVA 2PZSA 3GTOA 2JWLA 1XQSC 3AO3A 2ITMA 4DTRA 4DG1A 3I4MC 2P9PA 3AVCA 4H0XB 4AYBD 1U47A 3CJCA 5HROA 4A2BA 4ZHRA 1ESVA 1NGHA 3FZLA 2VG5A 4Z0UA 4DWIA 5AQSA 5CE3A 3ZX0A 2NVTK 3U8XA 3VGMA 4DR4K 3AGKA 3VGLA 1SS6A 2E5LK 3HPHA 4WQ5A 3HVRA 2VWJA 4JS5A 3DWLA 5C4XC 4Q5SA 4PWDA 1PJ5A 4LH4A 2YCHA 1OH5A 4A3FC 1JCGA 4CHQA 2EWSA 5C42A 1X3NA 4CESA 3AARA 1S5JA 2UXCK 1YCLA 2F9TA 1KC8O 4A3JC 2P5OA 3OW2M 1ATNA 5EOYA 3MN9A 3BUEA 3H1VX 5IYCK 5AZIB 4Y0WA 2HNDA 3WXJA 3F2KA 4JKAA 2E2HA 2O8EA 1JLQA 2ZGYA 3DMJA 4JD2B 2E2JC 4G0VA 4YOWA 3FZHA 2A3ZA 3L6QA 1A5VA 1YHQN 3EN9A 4ISFA 1BQNA 3DYAA 1QS4A 1TKZA 4DU3A 5J2QA 3U9DA 1BOTO 3G4CA 4ILGB 4KB1A 2Q1NA 1XZPB 5IYBK 5BR8K 3MCPA 3V1QA 3R6MA 4DQPA 1EH1A 3SMPA 5KGWA 1Y1WK 4FJNA 1WAFA 2QWRA 3HOVK 5AQRA 2Y1JA 4M7XA 4B9NA 3FKIK 3SV4A 3A5MC 2KZMA 3VQPA 3HOTA 3I4NC 5M5YK 3MMVA 1WNSA 4FZZA 5EXWA 5FPDA 4K43A 2UXBK 3O3HA 1VSHA 2E88A 4WQ4C 2VQFK 3QFUA 2FBXA 1I6VA 1NK8A 4ISEA 3VQQA 3THXA 3DJCA 2OZMA 2YHYA 1C1AA 3WXKA 4DQRA 4FJXA 4Z4GA 3S2DK 3P5JA 4IO8A 2IOCA 2DFEA 3O3FA 3THYA 2V52B 5CHIA 5M1QA 3SAHA 1NGCA 4FCYA 3A2FA 5FLMC 3E1YA 2R92A 4IEIA 3KHYA 4FWSA 3VQCA 1SL1A 3UIQA 3HPOA 3ZT3A 3AD8C 4B1UB 5B8HA 4NLCA 1OH8A 4Q0BA 4O2DA 3A8YA 1JJ2M 4LD0A 2B4JA 1INNA 1VAZA 3PO3C 2HBKA 2Z1JA 4H5TA 4OGEA 5AQFA 1S1WA 1NKEA 4Z4FA 3C0BA 3THWB 1RTJA 4LH5A 2RHKA 4I2QA 1XC9A 2A1SA 4H8KA 4HCBA 1TV6A 4OVLA 3L2UA 1VSDA 4CJEA 2HHUA 5GINA 3QNNA 3WNHA 3SCXA 1GLCG 2GSNA 2NRHA 4K0KK 4JKBA 1ZQ1C 4MO4A 4JI8K 2WB1D 3IDHA 4N41A 4DSEA 1VQ7N 3SBGA 5F2RA 2E20A 1JLAA 4LC9B 4X64K 2KZZA 5C44K 2ZUEA 1HKBA 1I3AA 1S6QA 5EU7A 1JCFA 3GTKK 3E01A 4IDHA 3FFKB 3A8JA 4NOIA 3ZETA 1GLDG 1E3MA 1QZ5A 4GTFA 5KRTA 1QVGM 1LV5A 1VQ5N 3DLBA 5BPNA 4U67L 3NH0A 4DF4A 3EZ5A 2HSTA 2P9KA 4F3TA 4KAWX 1VHXA 4DQQA 1RGIA 2V51B 4E7JA 4KB4A 3C6HA 2GSUA 1L3VA 4KMAA 1ASVA 3MN7A 4BC5A 3TU5A 5KTQA 3K58A 2JA7C 4FLWA 1O2AA 3IPJA 4DTPA 1JL2A 3HKZD 3ATUA 2V7ZA 2G8IA 2P9SB 4B9VA 3AY9A 4J2EA 4E19A 3O9RA 5LMUK 2JA5C 4AF1A 1K73O 1F21A 5HP1A 3LPUA 3H1QA 3J81O 5IYDK 1LWEA 2FSNA 4YORA 4EIAA 4PUOA 3M5RA 3UKRA 1WB9A 4BC2A 4M63C 1U49A 4DR6K 2O8BB 4Q4ZA 5AQOA 4F8RA 1NK0A 3ERED 3JXUA 4BRQA 3ID8A 2I5JA 3KKSA 1X3MA 5D3GA 5J1EA 1OH6A 4B3TK 2WAQL 4ILDA 1BA0A 1BI4A 1HKCA 1XUPO 4CEEA 2QKKA 1UA0A 5BPMA 4BR0A 5GAGP 1DT9A 4NB4A 1V5VA 4KTZA 4DTXA 4CGFA 2UUBK 2PAVA 4LF6K 1N32K 4AH6A 1K8KA 2YKMA 3THVA 1Z25A 2O8FA 1GLJO 2P9NB 5E84A 4WJ3M 4FK4A 2G8WA 3S1RK 3VN5A 3HO1A 2FSJA 1S6PA 4DTMA 4DF8A 3LZJA 1WSGA 4ID5A 4LOWA 1HX1A 3HOXC 4LK1A 3ASMA 1TAQA 4JI7K 4PL7A 2PA8D 4YFNA 3L0QA 4KH4A 3OYBA 4RMFA 3VQ5A 2ZWHA 2IIRA 3I56N 5BRDA 3QEVA 1KD1O 5CJ9A 5GADP 2W6KA 4JKGA 4EHUA 3FZMA 2Q36A 4YG2A 3NFAA 3PSFA 4IKFA 4FLYA 3SAFA 4CJSA 3AA5X 1Q9XA 3DLLL 4CF1A 3AGRA 3Q7CA 4O4GA 4NCBA 4FLZA 3NF9A 2Y1IA 5IOSA 5HLFA 3RZDK 3TAGA 1JCEA 4BDPA 4E1JA 3HTVA 4DR5K 1R9TC 3AQOA 3BP8A 3O5BA 2YHBA 4I2PA 4X66K 4OLAA 1WOOA 4H5NA 4JI0K 2BTFA 4E7IA 3OHRA 3OYCA 2Y0SL 4KH6A 4AILC 3BF3A 4JK1A 1KAZA 4PA1A 2HHQA 4QJVB 5AQNA 4JAXA 3SPYA 3NHGA 4I6MA 3ADAC 2Q31A 4BR9A 1SFOC 4DV4K 4CHYA 4BRHA 4BBSC 3C6TA 3H0GC 3GTPA 1HQEA 1RDCA 4YDUC 3GDZA 2J4RA 4CEQA 1YNJA 1NOYA 1T05A 3GTLK 1JLFA 3ENHA 1C6VA 3VQ8A 4KN4A 3VQ6A 1BJTA 3OYIA 2HF3A 4PQUA 3HBTA 5TKYA 3O9UA 4H5WA 3LWLA 4LF8K 4QS8A 5AQUA 4BRFA 4A3BK 3KK7A 2A5XA 1WIHA 3L4QA 4H0PA 1NJIO 2RKIA 3QO9A 1BQMA 1XI1A 1CZBA 3ZYYX 3MWPA 1QTMA 3O9SA 1OVYA 4LR2A 3SJHA 1VJEA 1D5AA 2QWNA 4M45A 4CK1A 4NCAA 2WOMA 3G10A 3KWGA 1CXUA 4CF8A 1TK8A 1WQGA 4BRMA 2BH1A 3MMLB 1JLCA 4WILA 4Y7NK 3OYDA 4CJFA 4BLBA 3D0PA 2PHCB 3H45C 4CFDA 4RG8A 2CW0A 2E2IK 2OANA 1NGAA 1VSFA 2O4GA 4G1QA 1B4AA 1WCMC 4CJPA 4CK3A 5TMFA 1HYZA 2YI1A 3ZSXA 1LOTB 4KATA 2D0AA 3L2QA 3JYTA 4OIQA 2XY7A 1S1TA 4J2AA 4KB0A 3H46O 3DXMA 3K59A 2QM1A 3OYFA 4XH4A 2HBJA 3K7AK 3VF4A 2ASPA 3CC4N 3TTGA 3CCQN 5FRMA 3N0CA 3O08A 3P31A 1WQFA 4CD1A 1R59O 3DXKA 5C2FA 4C45A 4FSVA 1I50C 1W2BM 1IO2A 4A61A 1HPMA 4C3HC 3ALYA 3O9QA 2NVXK 5AQYA 5FDLA 4YOTA 1O2BA 4PKIA 3D2FA 3CFPA 4FWMA 3GTMK 1RDUA 5AZJA 1IV0A 3OYEA 4A3MK 4KN7A 2I7PA 2ZFZA 5IP9K 3GSIA 3SNNA 1XWLA 1HKGA 3FLCO 4BXXK 4A3CC 1NJWA 1LAWA 2R7ZC 3PO5A 5KQDA 4LFAK 4GT9A 3S15C 3WXMB 1U2VB 2QWLA 3N4QA 4RW6A 3KLFA 2A41A 3RZOK 2WC9A 3CJ1A 1RBSA 2BE2A 1TWCC 3V4GA 3O4QA 3SI6A 1RBRA 4YNQA 4CCHA 3O9TA 4FO0A 3CM5A 4WF9L 2D4WA 2GEMA 5M3FK 4DLEA 1Y1WA 3AV9A 4BACA 4DR2K 4HHTA 2A1RA 1T03A 3FKIA 4XLNA 1JOEA 1SAZA 3A5LC 3M4OC 1RNHA 1YF5L 1LCUA 4ELUA 1I6HC 2NVYC 1S1UA 2E4LA 3CCVN 4KASA 1VQ8N 4FZXC 1VSLA 3ZSRA 4PABA 3G71N 3DRPA 3W3DA 3TANA 4CZGA 3OY9A 3SUOA 4G7HA 1WLJA 2GWJA 4PHTX 4A3JK 4BY7C 3EE9A 3T00A 1SKWA 1N6QA 1NGIA 2FXUA 3Q7BA 2P9UB 4IJNA 3MEDA 4FVMA 1TWFC 1GLLO 5F0XA 3DOKA 1WBBA 3CC7N 4DQIA 1I3QC 3GOIA 4A3KC 2YU9K 1TWHC 3C6AA 3PLAA 1KLMA 4LF9K 2NRXA 2EX3A 3BZKA 4GV9A 4JD2A 1BIZA 1WSHA 2FBYA 3VQDA 2Z1HA 1N34K 2VWKA 3SUNA 5JLFA 4XH5A 1YITN 1S22A 3AO2A 3LPTA 1DCHA 2P1JA 1LAVA 3TTFA 3GTOC 1XZPA 5DK5A 2X6SA 4CFCA 4FWLA 4CEZA 1Q18A 1HI9A 3PO2K 3WQTA 3A8IA 1RBUA 5J2PA 2OCEA 3RSEB 2NZTA 4EAHD 4A3IC 3GE1A 1S72N 5FJ8K 3E66A 4DQSA 4C8MA 1G15A 4DUYK 4E7LA 3HP9A 1E4FT 5GIPA 5LJVA 3GG4A 4FK0A 4WQ5C 1RILA 4Y52C 1VSKA 3K9JA 3SJJA 4N76A 3V9ZA 4Z4HA 2BANA 3K5MA 2HHHK 5M5WK 5CYQA 2NRTA 1K83K 1IL2A 3ZT2A 1NWKA 3GTKA 5JVHL 3T69A 1SQKA 1T6DA 3VQ4A 5LMNK 4AH9A 4BWMA 5C3EK 4FWKA 1XXBA 4GTDA 5CZ2A 3NBPA 4E7HA 1BCOA 1EQRA 1L5UA 2PY5A 3BP3A 4B9UA 2B63K 1Q7YO 4AM6A 4H03B 3LP3A 2XCOA 1VSEA 1LWFA 4M3ZA 1WN7A 5JS2A 4BY9C 3RRGA 5IP7C 3G25A 4ILJA 3QESA 3IAYA 3MEEA 4NYNA 1HNIA 3VA0A 3EO3A 4B1XB 3EZWA 4CFBA 3ZSVA 2P9LB 1PJ7A 4JV5K 4X6AK 1QQOA 2B6AA 4BC4A 4L8RB 3SQ4A 3MWTA 2XCQA 5C2DA 1IKWA 3ZCMA 2E6MA 3R9PA 3IG1A 1IKVA 3SBTA 4JYAK 3FZFA 4K41A 1RCHA 4CEFA 5E68A 3S1NK 4NXMK 1BA1A 2OTLN 2G8FA 3ATVA 3I0RA 2CH6A 3TAFA 1TWAK 4OPHA 1YJ9N 3IUCA 2IVNA 2GX9A 1DCPA 4DFMA 3O80A 4TSXA 3OYLA 1Q86O 2HF4A 4DTUA 5I42A 2O8DB 1JQWA 1GOBA 3AAQA 4IEEA 3EY1A 2D1KA 4DU1A 2QW9A 3S1MC 3CERA 1BO5O 3PSIA 3P1GA 3QBWA 3CJ9A 4KHPK 4KARA 5EY4A 4J3NA 1UA1A 5I9EB 2R92C 3C7NB 5J2MA 3CF5L 1T7PA 1W97L 3LDQA 2YJEA 2OPQA 1X9JA 4AHSA 4CJRA 5AQLA 1N36K 2FQOA 3S17C 4A93K 4RCHA 4CGDA 4X62K 2E2OA 4IG3A 2PMZL 4C3JC 3HM9A 1DEJA 2YV0X 3FZKA 3VGKA 3P39A 2ASOA 2XO7A 4V19S 1F7UA 2P5GA 2P9IB 5M1KA 4LFBK 5FRNA 2XY6A 4OO1J 4KM8A 3L2RA 2ATQA 4JRPA 3HYFA 1EWRA 3QB0A 4RW4A 2D0BA 3O1WA 4ZH4A 3HOWC 2O8BA 2O8CA 1VRTA 1ZVUA 2G8KA 3EE8A 4KHUA 1XMQK 2WAQD 4BKWA 3CCLN 1ASUA 4O0JA 4CHPA 3MX2A 3L3UA 2HMPA 4YOXA 2IS3A 2KLAA 1BISA 5AQHA 3CQYA 3ZSZA 1DD5A 2BGGA 4YOUA 4BR2A 3PX4A 1VRQC 3GL1A 4M7YA 4LF7K 2KTQA 2X78A 3CMAN 4C2MK 4IFEA 3LDNA 4XSXA 4HVJA 4CJ5A 1IBAA 2P9NA 3VENA 3R1XA 1RDBA 3OJUA 1EXQA 1QHTA 1J98A 3FGUA 3AD9C 1SZ2A 3OYAA 3GTLA 4GMJB 3SAGA 4BVOA 4GV3A 3QIPA 2A40A 3AVFA 3LZIA 1RT3A 4E3SA 2JA8C 3AO1A 3NGZA 2AJQA 1GLFO 4EP4A 3AA2A 3TSQA 4CJQA 5M3MK 1HPZA 2HNZA 5C4JC 4CBUA 3WEEB 4A3EK 2HHSA 2RE2A 4G7OA 3VA7A 1XHZA 4DV2K 4BG9A 3T01A 1KFSA 3F5TA 2AA4A 4H5RA 3CJAA 4BRPA 3S2HK 1YT3A 4JS4A 1JXEA 4A59A 4R5PA 2QWMA 4YHHK 3E9OA 4RW7A 2E2IA 3B6OA 1R9TK 1DLOA 1ZC6A 3BUZB 4YFUA 3J8AA 2QK9A 4GKJK 3S14K 3AA4A 4JHDB 3CQ8A 3QEXA 4K42A 4QS9A 1IKYA 1TGOA 1TL1A 4MO5A 1HUXA 1VSJA 2JLEA 3V9UA 3I8BA 4X65K 4M3WA 4QJVA 4BBRK 3HT3A 3V9XA 4C8KA 1EO1A 1KSPA 4FWNA 1C0UA 3M8RA 4EP5A 3KTQA 5C15A 3EL2A 1VQ6N 1DTQA 3ZSWA 3KD5E 2Q3SA 4DR1K 2OYQA 4YY3K 3B6PA 1MDUB 1OVQA 5AQMA 3DLKA 4IFVA 4CIEA 3GTMA 3LDOA 5C24A 4W5OA 3EEQA 2WFBA 3U4LA 3BDPA 5M1NA 3TR8A 2R93K 4DS5A 4FWQA 1HJOA 4BROA 1F9NA 2FC0A 4B9LA 3M3YK 4IXCA 3WNGA 2VGMA 4FL9A 4CECA 2F4VK 5BR9A 3KK1A 1HQMA 3KD1E 4W5TA 3O4NA 3TPQA 5KPZA 4JKCA 2RPIA 1WCMK 1B92A 3GIRA 2JH3A 2FLOA 3K2PA 2E2NA 4B1WB 3PIOL 3ULEB 4F2RA 2W42A 1VH2A 4BGAA 3UKUB 3MDQA 3VTIA 1Z26A 1NMNA 2KHOA 4KAZA 4OIPA 2ZJPL 3FHZA 2V6TA 3HRGA 4CJ7A 4F2SA 4C1NK 2CFAA 4FJ9A 1TAUA 1NNEA 3AVMA 3LDLA 3CD6N 2ZD1A 1KRPA 3GTPC 1L3SA 1EQYA 3QEWA 3P4IA 1SUQA 3PV8A 3LL3A 1Y1VK 3KLIA 4C3IC 3RVCA 1EFWA 3N4PA 4OIRA 4ID1A 4LQYA 4BLAA 1YAGA 2NVQK 1NKCA 2YU9A 3VTHA 4DU4A 2F9WA 4O5BA 4CJVA 3S1QK 3H6EA 1NBWA 4IOXA 4JKEA 4H0TB 4A3LC 4ELTA 3ITHA 4CFAA 3HSTB 2HHVA 2P51A 4JI1K 3M3ZA 3ZSQA 2ASMA 4I9LA 3VEXA 2QEXN 3WQUA 4ILHA 1VQ9N 2FBTA 1U2VA 5BN8A 2HMIA 1C0FA 4ELVA 3VQBA 3T1YK 1KQ4A 5AQPA 3ZSYA 1MU2A 4DTJA 4N47A 2BUPA 1NJYA 3FR0A 3KWIA 3B8AX 1EK8A 3CQZC 2ZGZA 3OS1A 1RTDA 3M4OK 1RTIA 2HHTA 1P90A 4KREA 1C0GA 3A5NC 1EP4A 4FK2A 1EETA 2ITGA 1VQ4N 5AQJA 3J80O 4WQ4A 1RBVA 3DAWA 3JAMO 1DGKN 5HRNA 4BY1C 1K83A 3CMEN 1MWMA 4BDZA 4FWOA 4BY7K 1D8YA 3KVGA 3ZT1A 4XIUA 4H0OA 1N5YA 5IORA 4KHSA 4BREA 2P9UA 3HK2A 1Z6RA 4FOIA 1TWFK 4KTQA 3QERA 3KIOA 1NOZA 3AVKA 3K5NA 1QQNA 3CYMA 3RRHA 4NLBA 3KJVA 5IYCC 4B9TA 4A3KK 2B63A 2O8EB 1W7AA 3LAMA 3DRSA 2QWPA 3VERA 3HSCA 4UY8O 1XNRK 4Z4IA 4KBOA 5AQVA 4KI4A 1RU0A 2XHBA 1TWGC 4CJKA 4KMHA 1B9DA 3AVNA 4B3RK 4GTCA 3VA3A 3KLEA 4KMDA 2JA6K 1J5OA 4BRLA 4YFXA 4KC6A 3BGRA 4H0VB 5LL6Z 5KPRA 5IYBC 3NGIA 3GTGK 1WSRA 1YTUA 3TI0A 4NXNK 1O27A 3I33A 4F4KA 1Y1WC 4KKOA 3CPEA 3T1AA 1RT4A 3CIPA 4C23A 4A3IK 4GZYA 3HOVC 5TJ3A 4MFBA 3C94A 3WUHA 1KFDA 4QIWD 4CI6A 4FPAA 5CHPA 1VSMA 5HOOA 3AO4A 4CJ4A 2YHAA 4Q5VA 1USOA 3FFIA 1S1VA 4Y52K 5KPTA 1TWAA 3S3OA 5LJWA 4GFQA 4DSLA 1NJXA 1ATRA 3THXB 3AVHA 3TFIA 4OLBA 4WYBA 3AVJA 2GAHC 1QSYA 4JKFA 3F9KA 4FLXA 1WOSA 1KAXA 3GTJK 2GTDA 1HNWK 2AP1A 1NU0A 1RTHA 3VQ7A 5BRFA 2NRWA 2YJFA 4C1NI 3VEOA 1YI2N 1IKXA 5I3UA 4J8FA 3KLGA 5CR4A 3TTCA 3KZBA 4B9MA 4CEDA 4AHTA 1TL3A 3CI5A 3J7AP 3HXMA 1AB4A 4QAGA 3LDSA 4GVMA 1EX4A 3LDPA 4E1NA 3ZLJA 2D0OA 2QI2A 2I7NA 1YJNN 3QIOA 4W5RA 2OPRA 3L3VA 2CGJA 3OJSA 3EYZA 2VUMC 1IBLK 3L2VA 3HOZK 1BL3A 2OTJN 5KI6A 2F8TA 4JEPA 4XH1A 1NGFA 2O4IA 4CJUA 1RBTA 3VF2A 4CF9A 4BR5A 3UB5A 2VYPA 2V6UA 4KM9A 4UQGA 4YOYA 4CERA 3H3OB 2HHWA 3QICA 4JN4A 1D9DA 3HOYK 3HZ6A 5C44C 5AQKA 2G8UA 5AQZA 4OKJA 2UUCK 5GAEP 3GTKC 3NDKA 3SPZA 1ZBHA 4ISGA 2D0PA 4B1VA 2O8DA 3ZETB 3HPGA 5LY3A 2QWQA 4OIOA 3U9ZA 1A5WA 1VQON 2JWKA 3GEIA 4PL8A 1ZBFA 3OPFA 3GTQK 2QA4N 3MAQA 1G99A 2KFNA 2PMZD 3C7NA 4DSKA 2A42A 3O1BA 1IS1A 2QXLA 2NNWA 1HQUA 3NVMA 4CBXA 3S3MA 1L3UA 1NK4A 2Q0RA 1K9MO 5K14A 1SL2A 4A62A 4C3JK 2OPSA 4N5SA 1TYQB 3CM6A 3I4MK 3OTOK 1KTQA 3IRXA 1FJGK 2HVHA 4JLHA 1VQMN 1BCMA 2Q0UA 2VQEK 4FWRA 1LW2A 3DLRA 2P9IA 1O1WA 3ID6A 3L8BA 1HR0K 4K8XA 4A3DC 3N3YA 1SL0A 1O28A 2CH5A 4CZMA 3V9WA 4DS4A 1X1PA 3E9LA 4DR7K 1R9TA 1GOCA 5C4XK 3AAPA 1VSIA 3VMFB 4A3FK 4IBNA 3RMCA 1Y64A 4CW7B 2KQ2A 4KTWA 2VCPA 1RDWX 5ADXA 3KKRA 4KH5A 2QTDA 4WFAL 2HBMA 3KK3A 4FJHA 3K57A 1VRUA 3CC2N 3DLGA 1ITGA 4IJAA 3HOUC 3E9PA 5AZIA 4CGGA 1K8KB 2E2JK 1X31C 5IT9O 1Q8IA 3S16C 4M3RA 5T7BA 4FW2A 1Q81O 4A2AA 2JA8K 1RDDA 4FJKA 4BE0A 3FOEA 3HVTA 2R93A 4BRGA 1VQPN 5EVZA 3CPWM 3S3NA 4LFCK 2DTUA 5HRSA 5C4JK 4OPKA 4MEYA 3WEEA 2PA8L 4JI2K 3S9HA 4IOAL 3VF6A 1QSLA 5IOTA 3PY8A 3AVLA 1ASWA 4B08A 3PO4A 4FXDA 3HOSA 4FOEA 3VEZA 4WFBL 3KK2A 3AH5A 1IQ0A 1R0AA 4FYDA 3I4NK 3NF6A 3RZDC 5AQIA 5JS1A 3CQXA 3LPXA 3CCJN 2E1ZA 3C95A 4ZTJA 4FJGA 4W5NA 1WCMA 2DFFA 4BC3A 4CVNE 4BDYA 3Q3QA 4JKHA 2Y3PA 4DMNA 3VEWA 3NMUA 4DSIA 5JVOA 3MX5A 1S9EA 3QX3A 3FE1A 4PAAA 4A5BA 1KCFA 5FLMK 2W6LA 2DFHA 3MECA 2O5JA 4Y1CA 4FJMA 2YX6A 5L46A 1MWKA 2IVPA 2E2HC 4PKGA 1L0WA 1BUPA 4DV0K 1Y1VA 3GTLC 2D6FC 3PO3K 4M1XA 1S3XA 3EKSA 1J54A 4OJRA 1IBMK 1U48A 1NKBA 3WNEA 4A3BC 3THWA 4CZEA 2UXDK 2CGLA 2LSNA 5JVGL 1N33K 4FM9A 4GKKK 5ADXH 1XPPA 1JVIA 3PX0A 1ZBUA 1QQMA 5BRHA 4E1MA 3ZEUB 3CAGA 4Y7NC 1QHAA 1G51A 3EKUA 3M1FA 1VK0A 1D9FA 1P8ZA 3AVAA 4LSLA 1V4TA 2E2IC 1XXAA 3QNOA 2IVOA 3QDKA 3GEEA 5FROA 3P38A 4QOZB 1X9SA 3ULEA 3J7ZO 3NF7A 1TKTA 3OYKA 1O2FB 4AHUA 1J9AA 3UKUA 1USMA 2GWKA 5H1SQ 5AQXA 1FKPA 3M8PA 4MQ9A 4GY2B 2E2QA 3NH2A 1I94K 4O0IA 3K7AC 3EQLA 4KMUA 5FPMA 3LWMA 3D6RA 5FLXO 1U4BA 1FKOA 1YTAA 2X74A 3P83D 2JA7K 4CJ3A 1I6HK 1TWFA 2GSOA 4J2DA 1ZBIA 2P9SA 3D2FB 4CE9A 1B4BA 3D2EB 3LP0A 4AQYK 4FM2A 2FBVA 1TVRA 2JA5K 2ZJQL 3OYJA 3U3YA 4LK0A 3NVKA 4A3MC 3UE5A 5HL7L 5CY4A 1HMVA 1DTTA 1KQSM 4DV3K 5ELZA 5KRSA 2NVXA 3CG7A 4LF5K 4PY5A 2JA6A 2GAGC 4KHYA 4BXXC 3AVBA 1NLVA 4DV1K 3L4KA 3M8QA 4HWIA 3RZOC 3GTGA 1VLOA 4G7ZA 1XZQB 5GIOA 1GLBG 1WOPA 4KV8A 2W7VA 2GELA 3TFJA 3CQZK 4C8OA 1RT5A 1BDFA 4FW1A 4A3GC 1RT2A 1T8EA 1KVBA 4JI3K 3W0LA 2IGIA 2NRZA 1Z05A 1K6YA 5AQQA 3CXCM 1IG9A 4CD3A 1VGXA 4FJJA 5M1OA 5HRPA 4N56A 4IWVA 4DCHA 1H1VA 1J6ZA 2UYTA 2YNFA 4M3YA 1WSFA 1XC3A 3D7EO 1XNQK 4BY1K 4GTBA 3ZSOA 4CBWA 1JL1A 3MK6A 1ILYA 4M3UA 4OINA 1SKRA 3HOXK 1N8RO 1NG9A 3VESA 3GTJA 3AO5A 1I39A 1K8AO 1C0MA 1LW0A 4JKDA 4KHQA 4AHCA 5EGHA 3J7YP 1U6ZA 3M6GA 1KVAA 2EHGA 2YU9C 4BRDA 3RR7A 3CCRN 4RTFD 3CCEN 1UAXA 4B3OA 1IG8A 2H3GX 3QEPA 4OPAA 1TWGK 3AVIA 3CFRA 3TAEA 1IH7A 2FF6A 1ZBLA 3JSTA 4CF0A 2JGUA 4IDKA 1EI6A 2Y0SD 3H3VL 2IC3A 1WORA 2YNGA 3VQ9A 2GUPA 4OGCA 1O26A 2XY8A 4NO7A 4KDDA 3A0IX 4CHZA 3SQ0A 4P5AA 3PO2C 2E8AA 4BWJA 3V6DA 4CHOA 2F8SA 1C1BA 3HI0A 1J6WA 1F93A 2XCRB 4FM1A 2UUAK 1SFOK 3T7ZA 4WJ4A 3MN5A 4BBSK 1NM1A 1JXBA 4KHWA 5DM7L 4JK8A 4E7KA 3H0GK 4WFNL 1LWCA 1M90O 1TKXA 5BPLA 4OPJA 1KAYA 4B9SA 1C1CA 4BRCA 3IKMA 1K83C 1NJZA 1B9FA 4EZ6A 2CGKA 3RR8A 3VETA 1E4GT 5C3EC 1BS2A 4O5FA 3GTQA 4CGHA 3JS6A 1NK5A 3V1OA 1X9MA 3QFPA 1U45A 2B63C 3ZX3A 3SUQA 3TAQA 3MXJA 3KLHA 3SZYA 3FOFA 2P8TA 1GOAA 2Z1GA 3LM9A 3V1RA 2BDPA 3SMSA 4FWPA 3IFRA 4IG0A 3DLEA 2VGNA 3SQ2A 4KO0A 2VUMK 4DV6K 1HRHA 5CZ1A 2PYLA 3BP8C 3QLHA 4FPBA 5EX5A 4X6AC 5C0YA 1NGGA 5SWMA 3OVNA 3TAPA 1JLGA 2F7TA 4FLVA 2ZM6K 2E2PA 1UV7A 4QS7A 4G0WA 2QWOA 1S9GA 4K25A 2YNHA 3S0XA 2OA8A 1YXQA 3S1NC 3LALA 4DFKA 1TWAC 1I50K 4BR4A 4HUFA 1QQCA 3G0ZA 4C3HK 1ISEA 4DTNA 3OYGA 5GAHP 3DXJA 2HHXA 5M5XK 3QINA 1IBKK 2ZUFA 3LAKA 3RMAA 4DDQA 4BRAA 2ETJA 3D45A 3WXIA 3BF1A 3QEIA 3RMDA 1XXCA 1BG3A 5AFUA 5DMRA 4A3CK 4M3TA 2R7ZK 3S15K 1TUUA 1D4XA 2HB5A 2KFZA 1TK0A 1YNNA 4A93C 5JLHA 3RTVA 3PUFA 2FF3B 1TWCK 1F7VA 4BQZA 4CIFA 4CZKA 2F96A 2P9PB 1TYQA 4NCGA 3SZ2A 1WAJA 3VQEA 5IOQA 3ENBA 5F1XA 4CGIA 4R79A 3CETA 1EWQA 1CLQA 4KB2A 2O5IA 4XCHA 1T3VA 2YNIA 1BDGA 1NK7A 4A3DK 2E6LA 2NRVA 2NVTC 1HYVA 4AYBL 1NGBA 3TWHA 1ZXOA 2NVYK 5MLCQ 3TSUA
chains in the Genus database with same CATH topology
3VEYA 3QICA 4JN4A 3MCPA 3HZ6A 1Q7YO 3R6MA 4H03B 5AQKA 4AM6A 3TSPA 2XCOA 1EH1A 5AQZA 3SMPA 3SLCA 5GAEP 3O6WA 4CZLA 2PFUA 2D0PA 4ISGA 4B1VA 3ZETB 4BY9C 1RFQA 1WIHA 5LY3A 2QWRA 2QWQA 5AQRA 3CJBA 3G25A 4ILJA 3SK3A 4M7XA 3U9ZA 1VQON 2JWKA 4PL8A 3OPFA 3L4JA 2QA4N 4G0UA 3A5MC 1KXPA 1G99A 3EO3A 3EZWA 5FPNA 4B1XB 3PIPL 3CCSN 2DPNA 3C7NA 3HOTA 2A42A 3O1BA 3MMVA 2P9LB 2W40A 1IS1A 5EXWA 2QXLA 5FPDA 2NNWA 4K43A 1QQOA 3NVMA 4BC4A 4CBXA 1M1KO 3MWTA 4GTLA 2XCQA 5C2DA 2Q0RA 2E88A 1K9MO 4WQ4C 3QFUA 4C2MC 4A62A 1O24A 3R9PA 3LM2A 4ISEA 3DJCA 1TYQB 3S41A 2YHYA 4BRKA 3WXKA 3SBTA 3FZFA 4IO8A 4K41A 3QBXA 1VQMN 2Q0UA 5M1FA 4FWRA 1BA1A 2OTLN 2RH6A 3ATVA 4EHTA 2V52B 5CHIA 3H3NO 5M1QA 2P9IA 2CH6A 3ID6A 3K9KA 3SAHA 1NGCA 4JK7A 3E1YA 2R92A 4IEIA 3KHYA 4FWSA 5C10A 4OPHA 1YJ9N 3N3YA 3IUCA 4GTAA 2IVNA 2GX9A 1ZBSA 2CH5A 4CZMA 1O28A 2Q97A 5JFEA 2ZJRL 3E9LA 3O80A 4JK9A 3VEVA 1Q86O 3OREA 1R9TA 2HF4A 3AAPA 1NGEA 4B1UB 5B8HA 4NLCA 5DM6L 4MDAA 3AAQA 3A8YA 4IEEA 3VMFB 2D1KA 4GNIA 1JJ2M 2YHXA 2QW9A 1TUYA 4BQLA 1MA9B 1VAZA 1BO5O 1Y64A 3CERA 4IO9L 2VCPA 3QBWA 1RDWX 2HBKA 3CJ9A 4H5TA 5AQFA 3RSEA 5ADXA 4KH5A 4KARA 2QTDA 5EY4A 4J3NA 3C0BA 4WFAL 5I9EB 2HBMA 3C7NB 1WOQA 2RHKA 5C12A 3CF5L 1W97L 1VQKN 3LDQA 2YJEA 3CC2N 1X9JA 4IJAA 5AQLA 3E9PA 4RCHA 5GINA 5AZIA 2E2OA 1K8KB 3CCMN 4C3JC 1GLCG 2GSNA 2NRHA 4JKBA 2NLXA 5AFUH 4DHYA 4MO4A 4BR7A 5JMVA 1DEJA 3IDHA 4CZJA 3FZKA 3VGKA 3P39A 4F9OA 3ENOA 2ASOA 1VQ7N 3SBGA 1Q82O 2RGRA 2P9IB 5M1KA 5F2RA 2E20A 1Q81O 4A2AA 4OO1J 4KM8A 4LC9B 4B1ZA 3NUHA 3FOEA 3GDQA 2R93A 4BRGA 1VQPN 3QB0A 5EVZA 1HKBA 3O1WA 3CPWM 1JCFA 1ZVUA 4IDHA 2JA7A 3FFKB 1V4SA 3EE8A 3WEEA 4BKWA 4MDBA 3CCLN 4H0YB 1GLDG 3ZETA 4IOAL 1QZ5A 3VF6A 1QVGM 3MX2A 4GTFA 5IOTA 2HMPA 4YOXA 1VQ5N 3ZX2A 4DQ8A 2KLAA 3HOSA 5BPNA 2JA5A 4FOEA 3A5OC 3CQYA 5AQHA 3VEZA 4U67L 4WFBL 1DD5A 3AH5A 4YOUA 2HSTA 2P9KA 4KAWX 2HBLA 4DB3A 3G4SN 2P9LA 1RGIA 2V51B 4BR2A 5AQIA 3AQPA 3CQXA 4DKWA 3LPXA 4KB4A 3C6HA 5BREA 3CCJN 2E1ZA 1WCMA 2GSUA 3MN7A 4BC5A 3TU5A 3GL1A 4M7YA 4BC3A 3Q3QA 3CMAN 1O2AA 4JKHA 4IFEA 1GLAG 3LDNA 2Y3PA 3ATUA 2V7ZA 3WXLA 1YJWN 2P9SB 3AY9A 2P9NA 3VEWA 3R1XA 3VENA 3VPZA 3NMUA 3O9RA 3GTLA 3FGUA 1SZ2A 4AF1A 3ZEUA 5JVOA 3SAGA 1K73O 4BVOA 3MX5A 3H1QA 4GV3A 3OEPA 4G9ZA 3QX3A 2A40A 2KKZA 1BWFO 2FSNA 3FE1A 1T6CA 4MLHA 4YORA 4A5BA 4EIAA 3M5RA 3CQZA 3UKRA 5AQTA 4BC2A 5TKWA 4M63C 1GLFO 2A6AA 3TSQA 2YX6A 1MWKA 2IVPA 4PKGA 5AQOA 4CBUA 4GV6A 3WEEB 1BUPA 3ERED 3JXUA 3OBWA 3ID8A 4BRQA 1Y1VA 2RE2A 4M1XA 3VA7A 1YVNA 4FZBA 1S3XA 3EKSA 4BG9A 1X3MA 2CFAB 3F5TA 2AA4A 4H5RA 1NGDA 3CJAA 4BRPA 2P9KB 4A59A 4CZEA 4ILDA 2CGLA 1BA0A 1HKCA 2QWMA 3CJ7A 3L4IA 1XUPO 3E9OA 5JVGL 4FM9A 2E2IA 5BPMA 4BR0A 1ZC6A 1DT9A 3BUZB 4NB4A 5GAGP 1VQLN 5ADXH 3J8AA 4JHDB 4K42A 2PAVA 1GLEG 4QS9A 1QQMA 1K8KA 5BRHA 4EFHA 2W41A 2V7YA 1GLJO 2P9NB 5E84A 4MO5A 1HUXA 3D2EA 3I8BA 3ZEUB 3CAGA 2FSJA 1QHAA 3EKUA 3M1FA 1EO1A 3I55N 1P8ZA 4FWNA 1HX1A 1TWGA 1V4TA 3UKRB 1XXAA 4PL7A 1DKGD 2PBDA 3L0QA 2IVOA 3QDKA 4IZ9A 4KH4A 3R8EA 4B1YB 2KWAA 2ZWHA 3P38A 2IIRA 3I56N 3ULEA 5BRDA 3J7ZO 1KD1O 5CJ9A 5C15A 3EL2A 1CZAN 5GADP 4JKGA 4EHUA 1VQ6N 3FZMA 2Q36A 3UKUA 4CZIA 2GWKA 5H1SQ 5AQXA 3O8MA 3SAFA 1MDUB 4GY2B 2E2QA 3C65A 2NRRA 3DLLL 5AQMA 1QZ6A 5JICA 3AGRA 3Q7CA 5FPMA 3GTMA 3D6RA 3LDOA 2WFBA 4CZHA 5IOSA 4O8KA 3U4LA 5M1NA 1IJJA 1JCEA 4E1JA 1SFOA 3HTVA 4GTEA 3AQOA 3BP8A 3O5BA 3MCAB 4FWQA 1HJOA 4H5NA 3H0GA 1WUAA 4BROA 1F9NA 1TWFA 2GSOA 2BTFA 3TTDA 3OHRA 4YDUA 4KH6A 4IXCA 4L3QA 2P9SA 3D2FB 2VGMA 3BF3A 3D2EB 1KAZA 1B4BA 4FL9A 1YUWA 5BR9A 5AQNA 4JAXA 3O4WA 2ZJQL 3G4AA 3LAJA 3NVKA 4I6MA 5M1PA 3TPQA 3UE5A 5KPZA 5HL7L 2Q31A 4BR9A 1QVFM 4JKCA 1KQSM 5ELZA 2NVXA 1T44A 1GE9A 2JA6A 4BRHA 2JH3A 2FLOA 2E2NA 1NLVA 4B1WB 3PIOL 3GTPA 3CHWA 3ULEB 3L4KA 3N0BA 4MLEA 4JKGB 4BGAA 4YDUC 4HWIA 3UKUB 3MDQA 3VOVA 3CCUN 3VTIA 3GTGA 2J4RA 2KHOA 3ENHA 5GIOA 1GLBG 3FHZA 2ZJPL 1VQNN 4HTLA 1BJTA 3HRGA 2HF3A 4CJ7A 2GELA 3HBTA 4C1NK 5TKYA 2CFAA 3O9UA 4H5WA 2P5MA 4QS8A 5AQUA 4BRFA 2WUSA 3LDLA 3CD6N 3W0LA 3KK7A 2A5XA 2NRZA 1Z05A 4GVEA 3L4QA 4H0PA 4XEIA 5AQQA 3CXCM 4CD3A 1NJIO 1EQYA 4A57A 2VUMA 5M1OA 3ZYYX 3P4IA 3MWPA 3O9SA 1OVYA 3LL3A 3SJHA 4LR2A 4C3IC 3RVCA 4JHDA 2QWNA 3N4PA 4IWVA 1WQHA 3KWGA 1H1VA 1J6ZA 4DCHA 1WQGA 2UYTA 1YAGA 4BRMA 4LQYA 4BLAA 1XC3A 2BH1A 3D7EO 3MMLB 2YU9A 3VTHA 2F9WA 4GTBA 4CBWA 4I6MB 3H6EA 4BLBA 3MK6A 1NBWA 1ILYA 4IOXA 4JKEA 4A5AA 3H45C 2PHCB 4H0TB 4BRNA 2OANA 1N8RO 3M3ZA 4CZFA 1NGAA 3VESA 2ASMA 3VEXA 3GTJA 1B4AA 2QEXN 4O8UA 4ILHA 3WQUA 1K8AO 4JKDA 1VQ9N 2YI1A 2YHWA 1U2VA 5EGHA 5BN8A 4C3HC 1I50A 1LOTB 2HOEA 1C0FA 4KATA 1U6ZA 3M6GA 1YIJN 1KQ4A 5EGEA 4JNEA 5AQPA 4BRDA 3CCRN 4RTFD 3CCEN 2FSKA 3H46O 3OA9A 3DXMA 1IG8A 2BUPA 2H3GX 2QM1A 2HBJA 3FR0A 3KWIA 4XH4A 3B8AX 4OPAA 5BN9A 3VF4A 1ATSA 2ASPA 3CC4N 1EK8A 4BRIA 2ZGZA 3CCQN 2FF6A 3N0CA 3GBTA 3O08A 3P31A 1WQFA 4CD1A 1P90A 1NMDA 1R59O 3DXKA 5AR0A 5C2FA 3IMXA 1C0GA 4FSVA 3A5NC 1W2BM 2R7ZA 1O25A 2GUPA 4A61A 1HPMA 1O26A 1VQ4N 4NO7A 3O9QA 5AQGA 5AQJA 3OBYA 5AQYA 4YOTA 3WT0A 4KDDA 1HLUA 4WQ4A 3A0IX 3F9MA 3DAWA 1O2BA 2WBNA 3D2FA 4PKIA 2E8AA 4FWMA 1BGWA 1TWCA 5FPEA 1RDUA 5AZJA 4P5AA 1DGKN 1K83A 3CMEN 1MWMA 5AQWA 1OKJA 2I7PA 4FWOA 3HI0A 2ZFZA 2XCRB 4RWTA 4FVUA 3KVGA 3T7ZA 3MN5A 4H0OA 1HKGA 3FLCO 3LAPA 1NM1A 5IORA 4BREA 4BVPA 2P9UA 5DM7L 4JK8A 5KQDA 1Z6RA 4FOIA 4GT9A 3WXMB 1U2VB 2QWLA 3N4QA 4WFNL 2NVYA 1QQNA 2A41A 4H5VA 2WC9A 4NLBA 3CJ1A 5BPLA 1M90O 2B63A 1KAYA 3V4GA 4BRCA 3IKMA 4WCEL 5E26A 3DXMB 1BU6O 3O9TA 2QWPA 4FO0A 2CGKA 2E1YA 2VWBA 3HSCA 3VERA 2D4WA 2GEMA 3VETA 1E4GT 4WF9L 4UY8O 3HM8A 1Y1WA 4KBOA 5AQVA 4KMHA 4BG8A 4KMDA 4GTCA 4O5FA 3FKIA 3R3LA 3GTQA 1SAZA 3A5LC 4BRLA 1YF5L 3JS6A 4KC6A 1LCUA 3DXKB 4H0VB 4PKHA 4U7BA 3G6EN 4P5BA 5KPRA 4B9QA 3QFPA 4AM7A 1O29A 1O13A 3CCVN 3ZX3A 4KASA 1VQ8N 3MN6A 1I3QA 2ZF5O 3FOFA 1O27A 4BGBA 3I33A 3G71N 1TWHA 3LM9A 5AZJB 3CPEA 4C23A 3BEXA 3CIPA 3W3DA 3SMSA 3QMLA 5TJ3A 4FWPA 3WUHA 4CZGA 3IFRA 4CI6A 4FPAA 5CHPA 2GWJA 2Q2RA 2VGNA 4PHTX 5HOOA 3EE9A 5KQ8A 1NGIA 2FXUA 3Q7BA 4IOCL 2P9UB 4FPBA 5EX5A 4IJNA 4Z94A 5C0YA 1NGJA 1NGGA 4YOVA 5KPTA 1TWAA 1GLLO 5F0XA 2JWLA 1XQSC 2F7TA 2ITMA 5LJWA 3CC7N 4GFQA 3GTOA 2E2PA 1ATRA 3GOIA 4QS7A 4G0WA 3C6AA 3PLAA 2QWOA 2NRXA 2P9PA 4K25A 4GV9A 4JD2A 4H0XB 4WYBA 4JKFA 3CJCA 3S0XA 4A2BA 1ESVA 1YXQA 1KAXA 1NGHA 3FZLA 5JLFA 2GTDA 2AP1A 4XH5A 5AQSA 1YITN 5CE3A 3ZX0A 3U8XA 5BRFA 1S22A 2NRWA 2YJFA 3VGMA 3VEOA 3TTFA 4C1NI 3AGKA 1YI2N 3VGLA 4J8FA 5CR4A 1SS6A 4BR4A 4WQ5A 1ISEA 3TTCA 3KZBA 5GAHP 3DWLA 4FWLA 1Q18A 2YCHA 3CI5A 1AB4A 1JCGA 3WQTA 3RSEB 2NZTA 3LDPA 2EWSA 4EAHD 3GE1A 4DDQA 4BRAA 1X3NA 2D0OA 2QI2A 3AARA 2I7NA 3BF1A 3WXIA 3E66A 1YJNN 1S72N 2F9TA 1KC8O 2CGJA 1XXCA 1BG3A 5AFUA 3OW2M 1ATNA 1E4FT 5EOYA 1TUUA 5LJVA 1D4XA 3GG4A 5GIPA 4WQ5C 3MN9A 3BUEA 2OTJN 3K9JA 3H1VX 4JEPA 4XH1A 5AZIB 1NGFA 5JLHA 4Y0WA 2FF3B 4BQZA 3WXJA 3F2KA 4JKAA 4CZKA 2E2HA 2NRTA 1TYQA 2P9PB 2ZGYA 4JD2B 4G0VA 3VF2A 3GTKA 1NWKA 4YOWA 3FZHA 2A3ZA 3L6QA 5JVHL 4BR5A 3UB5A 1YHQN 3T69A 1SQKA 1T6DA 2VYPA 3ENBA 5IOQA 3EN9A 4ISFA 5F1XA 4R79A 3CETA 4KB2A 4FWKA 1XXBA 1T3VA 4GTDA 4KM9A 1BDGA 3U9DA 1BOTO 2NRVA 4YOYA 3G4CA 4KMAA 1NGBA 4ILGB 1ZXOA 2Q1NA 5MLCQ 3H3OB 3TSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEY A;  3QIC A;  4JN4 A;  3MCP A;  3HZ6 A;  3R6M A;  4H03 B;  5AQK A;  4AM6 A;  5AQZ A;  3SMP A;  3SLC A;  3O6W A;  4CZL A;  4ISG A;  2D0P A;  4B1V A;  3ZET B;  1RFQ A;  5LY3 A;  2QWR A;  2QWQ A;  5AQR A;  3CJB A;  3G25 A;  3SK3 A;  3U9Z A;  4M7X A;  4PL8 A;  3A5M C;  1KXP A;  1G99 A;  3EO3 A;  3EZW A;  5FPN A;  4B1X B;  2DPN A;  3C7N A;  2A42 A;  3O1B A;  3MMV A;  2P9L B;  2W40 A;  5EXW A;  2QXL A;  5FPD A;  4K43 A;  1QQO A;  4BC4 A;  4CBX A;  2Q0R A;  2E88 A;  4WQ4 C;  3QFU A;  4A62 A;  3R9P A;  3LM2 A;  4ISE A;  3DJC A;  1TYQ B;  3S41 A;  2YHY A;  4BRK A;  3WXK A;  3FZF A;  4IO8 A;  4K41 A;  3QBX A;  2Q0U A;  4FWR A;  1BA1 A;  3ATV A;  4EHT A;  2V52 B;  3H3N O;  2P9I A;  2CH6 A;  1NGC A;  3KHY A;  4FWS A;  3IUC A;  2IVN A;  1ZBS A;  2CH5 A;  4CZM A;  2Q97 A;  3O80 A;  3VEV A;  2HF4 A;  3AAP A;  1NGE A;  4B1U B;  5B8H A;  3AAQ A;  3A8Y A;  2D1K A;  4GNI A;  2YHX A;  2QW9 A;  1TUY A;  4BQL A;  1MA9 B;  3CER A;  1BO5 O;  1Y64 A;  2VCP A;  3QBW A;  1RDW X;  3CJ9 A;  4H5T A;  5AQF A;  3RSE A;  5ADX A;  5EY4 A;  3C0B A;  5I9E B;  3C7N B;  1WOQ A;  3LDQ A;  2YJE A;  1X9J A;  4IJA A;  5AQL A;  4RCH A;  5AZI A;  2E2O A;  1K8K B;  1GLC G;  2NRH A;  2NLX A;  5AFU H;  4DHY A;  4MO4 A;  4BR7 A;  5JMV A;  1DEJ A;  3IDH A;  4CZJ A;  3FZK A;  3VGK A;  4F9O A;  3ENO A;  2ASO A;  2P9I B;  5F2R A;  2E20 A;  4A2A A;  4LC9 B;  4B1Z A;  3GDQ A;  4BRG A;  3QB0 A;  5EVZ A;  1HKB A;  3O1W A;  1JCF A;  3FFK B;  1V4S A;  3WEE A;  4H0Y B;  1GLD G;  3ZET A;  1QZ5 A;  3VF6 A;  2HMP A;  3ZX2 A;  4DQ8 A;  5BPN A;  4FOE A;  3A5O C;  3CQY A;  5AQH A;  3VEZ A;  2P9K A;  4DB3 A;  2P9L A;  1RGI A;  2V51 B;  4BR2 A;  5AQI A;  3CQX A;  5BRE A;  2E1Z A;  3MN7 A;  4BC5 A;  3TU5 A;  3GL1 A;  4M7Y A;  4BC3 A;  1GLA G;  3LDN A;  3ATU A;  2V7Z A;  3WXL A;  2P9S B;  3AY9 A;  2P9N A;  3VEW A;  3VEN A;  3VPZ A;  3FGU A;  1SZ2 A;  3ZEU A;  4BVO A;  3H1Q A;  2A40 A;  1BWF O;  2FSN A;  3FE1 A;  1T6C A;  4MLH A;  4EIA A;  3UKR A;  5AQT A;  4BC2 A;  4M63 C;  1GLF O;  2A6A A;  1MWK A;  2IVP A;  4PKG A;  5AQO A;  4CBU A;  3WEE B;  1BUP A;  3JXU A;  4BRQ A;  3ID8 A;  1YVN A;  1S3X A;  3EKS A;  4BG9 A;  1X3M A;  2AA4 A;  4H5R A;  1NGD A;  3CJA A;  4BRP A;  2P9K B;  4CZE A;  2CGL A;  1BA0 A;  1HKC A;  2QWM A;  3CJ7 A;  3L4I A;  1XUP O;  5BPM A;  4BR0 A;  1ZC6 A;  3BUZ B;  4NB4 A;  5ADX H;  3J8A A;  4JHD B;  4K42 A;  2PAV A;  1GLE G;  4QS9 A;  1QQM A;  1K8K A;  5BRH A;  4EFH A;  2W41 A;  2V7Y A;  1GLJ O;  2P9N B;  5E84 A;  4MO5 A;  1HUX A;  3D2E A;  3I8B A;  3ZEU B;  2FSJ A;  1QHA A;  3EKU A;  3M1F A;  1P8Z A;  4FWN A;  1HX1 A;  1V4T A;  3UKR B;  4PL7 A;  1DKG D;  2PBD A;  3L0Q A;  2IVO A;  3QDK A;  4IZ9 A;  3R8E A;  4B1Y B;  2ZWH A;  2IIR A;  3ULE A;  5BRD A;  3EL2 A;  1CZA N;  4EHU A;  3FZM A;  2Q36 A;  3UKU A;  4CZI A;  2GWK A;  5AQX A;  3O8M A;  1MDU B;  4GY2 B;  2E2Q A;  5AQM A;  1QZ6 A;  5JIC A;  5FPM A;  3LDO A;  4CZH A;  4O8K A;  3U4L A;  1IJJ A;  1JCE A;  4E1J A;  3HTV A;  3BP8 A;  3O5B A;  4FWQ A;  1HJO A;  4H5N A;  1WUA A;  4BRO A;  2BTF A;  3OHR A;  4YDU A;  4L3Q A;  4IXC A;  2P9S A;  3D2F B;  3BF3 A;  3D2E B;  1KAZ A;  4FL9 A;  1YUW A;  5BR9 A;  5AQN A;  4JAX A;  3O4W A;  4I6M A;  3TPQ A;  3UE5 A;  5KPZ A;  2Q31 A;  4BR9 A;  5ELZ A;  1T44 A;  4BRH A;  2FLO A;  2E2N A;  1NLV A;  4B1W B;  3CHW A;  3ULE B;  4MLE A;  4BGA A;  4YDU C;  4HWI A;  3UKU B;  3MDQ A;  3VOV A;  2J4R A;  2KHO A;  3ENH A;  1GLB G;  4HTL A;  2HF3 A;  4CJ7 A;  2GEL A;  3HBT A;  5TKY A;  4H5W A;  4QS8 A;  5AQU A;  4BRF A;  2WUS A;  3LDL A;  3W0L A;  2A5X A;  4XEI A;  1Z05 A;  4H0P A;  5AQQ A;  4CD3 A;  1EQY A;  3P4I A;  3LL3 A;  3SJH A;  4JHD A;  2QWN A;  4IWV A;  4DCH A;  1H1V A;  1J6Z A;  2UYT A;  1YAG A;  4BRM A;  1XC3 A;  3D7E O;  2F9W A;  4CBW A;  4I6M B;  3H6E A;  3MK6 A;  1NBW A;  3H45 C;  4H0T B;  4BRN A;  2OAN A;  3M3Z A;  4CZF A;  1NGA A;  3VES A;  2ASM A;  3VEX A;  3WQU A;  2YI1 A;  2YHW A;  1U2V A;  5BN8 A;  1LOT B;  2HOE A;  1C0F A;  1U6Z A;  3M6G A;  4JNE A;  5AQP A;  4BRD A;  4RTF D;  2FSK A;  3H46 O;  3DXM A;  1IG8 A;  2BUP A;  2H3G X;  2QM1 A;  3FR0 A;  4XH4 A;  5BN9 A;  3VF4 A;  3B8A X;  1ATS A;  2ASP A;  4BRI A;  2ZGZ A;  2FF6 A;  3GBT A;  3O08 A;  4CD1 A;  1NMD A;  1R59 O;  3DXK A;  5AR0 A;  3IMX A;  1C0G A;  4FSV A;  3A5N C;  2GUP A;  4A61 A;  1HPM A;  4NO7 A;  5AQG A;  5AQJ A;  3WT0 A;  5AQY A;  1HLU A;  4WQ4 A;  3A0I X;  3F9M A;  3DAW A;  4PKI A;  3D2F A;  2E8A A;  4FWM A;  5FPE A;  5AZJ A;  1DGK N;  1MWM A;  5AQW A;  1OKJ A;  2I7P A;  4FWO A;  3HI0 A;  4RWT A;  3KVG A;  3MN5 A;  4H0O A;  1HKG A;  3FLC O;  1NM1 A;  4BRE A;  4BVP A;  2P9U A;  5KQD A;  1Z6R A;  4FOI A;  1U2V B;  2QWL A;  1QQN A;  2A41 A;  4H5V A;  3CJ1 A;  5BPL A;  1KAY A;  4BRC A;  5E26 A;  3DXM B;  1BU6 O;  2QWP A;  4FO0 A;  2CGK A;  2E1Y A;  2VWB A;  3HSC A;  3VER A;  2D4W A;  2GEM A;  3VET A;  1E4G T;  3HM8 A;  4KBO A;  5AQV A;  4BG8 A;  4O5F A;  1SAZ A;  3A5L C;  4BRL A;  3JS6 A;  1LCU A;  3DXK B;  4H0V B;  4PKH A;  5KPR A;  4B9Q A;  3QFP A;  4AM7 A;  3ZX3 A;  3MN6 A;  2ZF5 O;  4BGB A;  3I33 A;  3LM9 A;  5AZJ B;  4C23 A;  3BEX A;  3CIP A;  3W3D A;  3SMS A;  3QML A;  4FWP A;  3WUH A;  4CZG A;  3IFR A;  4CI6 A;  4FPA A;  2GWJ A;  2Q2R A;  5KQ8 A;  1NGI A;  2FXU A;  2P9U B;  4FPB A;  5EX5 A;  4IJN A;  4Z94 A;  1NGJ A;  1NGG A;  5KPT A;  1GLL O;  5F0X A;  5LJW A;  1XQS C;  2ITM A;  2E2P A;  1ATR A;  3GOI A;  4QS7 A;  2QWO A;  2P9P A;  4K25 A;  4JD2 A;  4H0X B;  4WYB A;  3CJC A;  4A2B A;  1ESV A;  1YXQ A;  1KAX A;  1NGH A;  3FZL A;  5JLF A;  2GTD A;  2AP1 A;  4XH5 A;  5AQS A;  5CE3 A;  3ZX0 A;  3U8X A;  5BRF A;  1S22 A;  2YJF A;  3VGM A;  3VEO A;  3VGL A;  4J8F A;  4BR4 A;  4WQ5 A;  3KZB A;  3DWL A;  4FWL A;  1Q18 A;  2YCH A;  3CI5 A;  1JCG A;  3WQT A;  3RSE B;  2NZT A;  3LDP A;  2EWS A;  4EAH D;  3GE1 A;  4BRA A;  1X3N A;  2D0O A;  3AAR A;  2I7N A;  3BF1 A;  3WXI A;  2F9T A;  2CGJ A;  1BG3 A;  5AFU A;  1ATN A;  1E4F T;  5EOY A;  1TUU A;  5LJV A;  1D4X A;  3GG4 A;  4WQ5 C;  3MN9 A;  3H1V X;  4XH1 A;  5AZI B;  1NGF A;  5JLH A;  4Y0W A;  2FF3 B;  4BQZ A;  3WXJ A;  4CZK A;  2P9P B;  1TYQ A;  2ZGY A;  4JD2 B;  3VF2 A;  1NWK A;  3FZH A;  2A3Z A;  3L6Q A;  4BR5 A;  3UB5 A;  1SQK A;  1T6D A;  2VYP A;  3EN9 A;  4ISF A;  5F1X A;  3CET A;  4FWK A;  1BDG A;  3U9D A;  1BOT O;  1NGB A;  1ZXO A;  2Q1N A;  3H3O B; 
#chains in the Genus database with same CATH topology
 2PYJ A;  3VEY A;  4XSZ A;  1UOC A;  1RDA A;  1Q9Y A;  2O8C B;  3TSP A;  4BE1 A;  1YVU A;  2QKB A;  3SLC A;  3O6W A;  4CZL A;  2PFU A;  1J6V A;  3AD7 C;  3MEG A;  2G8V A;  1RFQ A;  5D4D A;  3NH1 A;  3CJB A;  3SK3 A;  3DLH A;  4CHN A;  3L4J A;  1BHL A;  4G0U A;  1KXP A;  3CCS N;  5FPN A;  3PIP L;  1RT1 A;  2DPN A;  4M41 A;  5CYM A;  2W40 A;  3NCI A;  4CEO A;  1M1K O;  4GTL A;  3HOU K;  1I3Q K;  4DV5 K;  2BE5 A;  2A6E A;  4C2M C;  2ZE2 A;  1O24 A;  4OX9 K;  3LM2 A;  1XMO K;  1TWH K;  3S41 A;  3RMB A;  2WON A;  4BRK A;  2VG6 A;  3S16 K;  3QBX A;  3T19 A;  3SZZ A;  5M1F A;  4B8A B;  1HNX K;  4QCL A;  1ZYR A;  2XRI A;  2RH6 A;  4EHT A;  3H3N O;  3K9K A;  1OH7 A;  4JK7 A;  4OKE A;  2X6N A;  5C10 A;  3GTO K;  1Y97 A;  4GTA A;  5JFE A;  1ZBS A;  1EKE A;  2Q97 A;  4FLT A;  1C0A A;  2ZJR L;  4JK9 A;  3ORE A;  3VEV A;  1CZ9 A;  3V9S A;  1NGE A;  4CK2 A;  5DM6 L;  3H08 A;  4MDA A;  4A3E C;  4GNI A;  2YHX A;  4BQL A;  1TUY A;  4IO9 L;  1MA9 B;  3ULD A;  3RSE A;  1IE0 A;  3FKI C;  4YFK A;  3T1H K;  3S2H C;  1J53 A;  1WOQ A;  5C12 A;  1VQK N;  1SMY A;  3S14 C;  1WSV A;  1ZYQ A;  2NUB A;  3CCM N;  3DOL A;  2V6S A;  4BE2 A;  2NLX A;  2IDO A;  5AFU H;  4DHY A;  4BR7 A;  5JMV A;  5HL8 A;  3S2D C;  4CZJ A;  4HUG A;  3TAR A;  4F9O A;  3ENO A;  3K5O A;  3V4I A;  3GEH A;  4BBR C;  1Q82 O;  3THY B;  2RGR A;  2B5J A;  4B1Z A;  3NUH A;  5KGX A;  4HCC A;  3WNF A;  3GDQ A;  5HBM A;  2E2H K;  4Y1D A;  1YX2 A;  2HNY A;  2JA7 A;  1V4S A;  5IP7 K;  4MDB A;  2QXF A;  4H0Y B;  1KVC A;  3ZX2 A;  4DQ8 A;  3NF8 A;  4EZ9 A;  2JA5 A;  3A5O C;  4C8N A;  2HBL A;  4MQ3 A;  4DB3 A;  4FJ8 A;  3G4S N;  2P9L A;  3AVG A;  3AQP A;  2R93 C;  4DKW A;  4CJT A;  5BRE A;  2UU9 K;  3DRR A;  2GV9 A;  1GLA G;  2RN2 A;  1YJW N;  3WXL A;  3M3Y C;  4LF4 K;  4ZTF A;  3VPZ A;  4GW6 A;  3ZEU A;  3V81 A;  1HYS A;  3IS9 A;  3NE6 A;  3OEP A;  4G9Z A;  4ICL A;  2KKZ A;  4LSN A;  1BWF O;  3DI6 A;  4MLH A;  1T6C A;  3CQZ A;  5AQT A;  2WB1 L;  5A2Q O;  2VG7 A;  3LAN A;  5TKW A;  1U04 A;  2A6A A;  3MXI A;  3LP1 A;  4GV6 A;  2IAJ A;  3OBW A;  4O44 A;  1QE1 A;  3OYH A;  3S1M K;  1XHX A;  1YVN A;  4FZB A;  4DSJ A;  2CFA B;  4H4M A;  1WSI A;  1NGD A;  2R92 K;  2Z1I A;  1J5E K;  2D5R A;  4LJZ A;  2P9K B;  3OYM A;  3L4I A;  3CJ7 A;  3TAB A;  3A8K A;  4K8Z A;  3OS0 A;  1NK9 A;  4DUZ K;  1VQL N;  3S17 K;  3F73 A;  4DFJ A;  1Y1V C;  3K0S A;  1GLE G;  4EFH A;  2W41 A;  2V7Y A;  1W0H A;  2NVQ C;  2DY4 A;  3D2E A;  5C25 A;  5AJ3 K;  3S1Q C;  3HKZ L;  5IYD C;  4FLU A;  3I55 N;  1JLB A;  5HRR A;  1TWG A;  3UKR B;  1C0T A;  1DKG D;  2PBD A;  3SYZ A;  4IZ9 A;  3R8E A;  4B1Y B;  2KWA A;  2A69 A;  3HOW K;  4JI4 K;  1CZA N;  4CZI A;  1TK5 A;  3O8M A;  1WBD A;  1XZQ A;  1PJ6 A;  3C65 A;  3SV3 A;  2NRR A;  4WE1 A;  1QZ6 A;  5JIC A;  2WTU A;  4A3G K;  1WSJ A;  1KLN A;  4CZH A;  4O8K A;  1BI4 B;  3BY5 A;  1IJJ A;  2XY5 A;  1SFO A;  2D0C A;  4GTE A;  1X9W A;  2ZQB A;  3MCA B;  4Z4C A;  3H0G A;  1WUA A;  4DTS A;  2OZS A;  3TTD A;  2O8F B;  4YDU A;  4L3Q A;  1S1X A;  2OPP A;  3NGY A;  1YUW A;  3S1R C;  3OYN A;  4DR3 K;  3O4W A;  2FQT A;  3G4A A;  3LAJ A;  4C8L A;  3WOD A;  5M1P A;  1QVF M;  1T44 A;  1GE9 A;  1W9H A;  1FW6 A;  3CHW A;  5IWA K;  3N0B A;  3CFO A;  4MLE A;  4JKG B;  3CCU N;  4J2B A;  3VOV A;  2RF2 A;  5SZT A;  4DLG A;  5TMC A;  4OKK A;  4HUE A;  3H3V D;  1VQN N;  4HTL A;  3SUP A;  3HP6 A;  2P5M A;  3I0S A;  2WUS A;  4JI5 K;  2NVX C;  2JA6 C;  4FJI A;  4XEI A;  4GVE A;  4KHN A;  4AHR A;  1RT6 A;  4AHV A;  3NAE A;  4F3O A;  4A57 A;  2VUM A;  3T02 A;  1SV5 A;  3L2W A;  3GTG C;  5J2N A;  4DTO A;  4JHD A;  4Z4E A;  3ISN C;  1WQH A;  4B3S K;  1IW7 A;  3PX6 A;  4CJL A;  4I6M B;  1CXQ A;  3SQ1 A;  3HJF A;  3C6U A;  4A5A A;  3ZT4 A;  4BRN A;  1JKH A;  4JI6 K;  4O55 A;  4CZF A;  2EBB A;  4O8U A;  2A68 A;  4QIW L;  2YHW A;  3BZC A;  1I50 A;  2HOE A;  2HVI A;  4KI6 A;  1J6X A;  1YIJ N;  4FJL A;  5EGE A;  4JNE A;  2FSK A;  3OA9 A;  5BN9 A;  3JSM A;  2G8H A;  1ATS A;  4BRI A;  4FJ5 A;  4CF2 A;  4FZY A;  3GTJ C;  3GBT A;  1HNZ K;  3DM2 A;  1A5X A;  1NMD A;  5AR0 A;  4CIG A;  3MXM A;  1QSS A;  3IMX A;  3U3G A;  2R7Z A;  4FJ7 A;  1O25 A;  4H4O A;  5AQG A;  3OBY A;  3WT0 A;  1HLU A;  1NK6 A;  4CJW A;  3F9M A;  2YKN A;  1BGX T;  2WBN A;  1TWC A;  3T3F A;  1BGW A;  5FPE A;  1WSE A;  4IFY A;  2A6H A;  1REV A;  4MEX A;  5AQW A;  4FM0 A;  1OKJ A;  4E0D A;  4RWT A;  4FVU A;  4DV7 K;  4XLP A;  4CEB A;  4I7F A;  3ZT0 A;  3LAP A;  4BVP A;  3U6F A;  1L3T A;  3HOZ C;  1UWB A;  4LLG A;  2NVY A;  3K5L A;  3QET A;  4RW9 A;  4H5V A;  4P9S A;  4WCE L;  5E26 A;  4B3M K;  3DXM B;  1BU6 O;  2E1Y A;  2VWB A;  3LP2 A;  3HM8 A;  2KW4 A;  4BG8 A;  4KPY A;  4CEA A;  3R3L A;  5E41 A;  4B8C A;  1HNV A;  3GTP K;  3DXK B;  4PKH A;  3O3G A;  4U7B A;  4P5B A;  3G6E N;  3TFH A;  3RWU A;  2GBZ A;  4B9Q A;  3HXA A;  1BIU A;  4AM7 A;  1O29 A;  1O13 A;  2PPB A;  3HOY C;  3HL8 A;  4KFB A;  4E89 A;  4C3I K;  4W5Q A;  3MN6 A;  4M3X A;  1I3Q A;  2ZF5 O;  4DSF A;  1HJR A;  2GUI A;  4BGB A;  1JLE A;  3I8D A;  4M42 A;  1TWH A;  5AZJ B;  4CGJ A;  1FK9 A;  3BEX A;  4I9Q A;  3GTM C;  3QML A;  3OS2 A;  4HTU A;  1TKD A;  3M8S A;  4LY7 A;  4RW8 A;  3GTQ C;  1DCO A;  1RT7 A;  2R7Y A;  4KRF A;  2Q2R A;  4A3L K;  1FXX A;  5KQ8 A;  3AA3 A;  5IP9 C;  4NYF A;  2HW3 A;  4IOC L;  3VQA A;  3TAM A;  1SKS A;  4Z94 A;  4DFP A;  1NGJ A;  4JRQ A;  4YOV A;  2PZS A;  3GTO A;  2JWL A;  1XQS C;  3AO3 A;  2ITM A;  4DTR A;  4DG1 A;  3I4M C;  2P9P A;  3AVC A;  4H0X B;  4AYB D;  1U47 A;  3CJC A;  5HRO A;  4A2B A;  4ZHR A;  1ESV A;  1NGH A;  3FZL A;  2VG5 A;  4Z0U A;  4DWI A;  5AQS A;  5CE3 A;  3ZX0 A;  2NVT K;  3U8X A;  3VGM A;  4DR4 K;  3AGK A;  3VGL A;  1SS6 A;  2E5L K;  3HPH A;  4WQ5 A;  3HVR A;  2VWJ A;  4JS5 A;  3DWL A;  5C4X C;  4Q5S A;  4PWD A;  1PJ5 A;  4LH4 A;  2YCH A;  1OH5 A;  4A3F C;  1JCG A;  4CHQ A;  2EWS A;  5C42 A;  1X3N A;  4CES A;  3AAR A;  1S5J A;  2UXC K;  1YCL A;  2F9T A;  1KC8 O;  4A3J C;  2P5O A;  3OW2 M;  1ATN A;  5EOY A;  3MN9 A;  3BUE A;  3H1V X;  5IYC K;  5AZI B;  4Y0W A;  2HND A;  3WXJ A;  3F2K A;  4JKA A;  2E2H A;  2O8E A;  1JLQ A;  2ZGY A;  3DMJ A;  4JD2 B;  2E2J C;  4G0V A;  4YOW A;  3FZH A;  2A3Z A;  3L6Q A;  1A5V A;  1YHQ N;  3EN9 A;  4ISF A;  1BQN A;  3DYA A;  1QS4 A;  1TKZ A;  4DU3 A;  5J2Q A;  3U9D A;  1BOT O;  3G4C A;  4ILG B;  4KB1 A;  2Q1N A;  1XZP B;  5IYB K;  5BR8 K;  3MCP A;  3V1Q A;  3R6M A;  4DQP A;  1EH1 A;  3SMP A;  5KGW A;  1Y1W K;  4FJN A;  1WAF A;  2QWR A;  3HOV K;  5AQR A;  2Y1J A;  4M7X A;  4B9N A;  3FKI K;  3SV4 A;  3A5M C;  2KZM A;  3VQP A;  3HOT A;  3I4N C;  5M5Y K;  3MMV A;  1WNS A;  4FZZ A;  5EXW A;  5FPD A;  4K43 A;  2UXB K;  3O3H A;  1VSH A;  2E88 A;  4WQ4 C;  2VQF K;  3QFU A;  2FBX A;  1I6V A;  1NK8 A;  4ISE A;  3VQQ A;  3THX A;  3DJC A;  2OZM A;  2YHY A;  1C1A A;  3WXK A;  4DQR A;  4FJX A;  4Z4G A;  3S2D K;  3P5J A;  4IO8 A;  2IOC A;  2DFE A;  3O3F A;  3THY A;  2V52 B;  5CHI A;  5M1Q A;  3SAH A;  1NGC A;  4FCY A;  3A2F A;  5FLM C;  3E1Y A;  2R92 A;  4IEI A;  3KHY A;  4FWS A;  3VQC A;  1SL1 A;  3UIQ A;  3HPO A;  3ZT3 A;  3AD8 C;  4B1U B;  5B8H A;  4NLC A;  1OH8 A;  4Q0B A;  4O2D A;  3A8Y A;  1JJ2 M;  4LD0 A;  2B4J A;  1INN A;  1VAZ A;  3PO3 C;  2HBK A;  2Z1J A;  4H5T A;  4OGE A;  5AQF A;  1S1W A;  1NKE A;  4Z4F A;  3C0B A;  3THW B;  1RTJ A;  4LH5 A;  2RHK A;  4I2Q A;  1XC9 A;  2A1S A;  4H8K A;  4HCB A;  1TV6 A;  4OVL A;  3L2U A;  1VSD A;  4CJE A;  2HHU A;  5GIN A;  3QNN A;  3WNH A;  3SCX A;  1GLC G;  2GSN A;  2NRH A;  4K0K K;  4JKB A;  1ZQ1 C;  4MO4 A;  4JI8 K;  2WB1 D;  3IDH A;  4N41 A;  4DSE A;  1VQ7 N;  3SBG A;  5F2R A;  2E20 A;  1JLA A;  4LC9 B;  4X64 K;  2KZZ A;  5C44 K;  2ZUE A;  1HKB A;  1I3A A;  1S6Q A;  5EU7 A;  1JCF A;  3GTK K;  3E01 A;  4IDH A;  3FFK B;  3A8J A;  4NOI A;  3ZET A;  1GLD G;  1E3M A;  1QZ5 A;  4GTF A;  5KRT A;  1QVG M;  1LV5 A;  1VQ5 N;  3DLB A;  5BPN A;  4U67 L;  3NH0 A;  4DF4 A;  3EZ5 A;  2HST A;  2P9K A;  4F3T A;  4KAW X;  1VHX A;  4DQQ A;  1RGI A;  2V51 B;  4E7J A;  4KB4 A;  3C6H A;  2GSU A;  1L3V A;  4KMA A;  1ASV A;  3MN7 A;  4BC5 A;  3TU5 A;  5KTQ A;  3K58 A;  2JA7 C;  4FLW A;  1O2A A;  3IPJ A;  4DTP A;  1JL2 A;  3HKZ D;  3ATU A;  2V7Z A;  2G8I A;  2P9S B;  4B9V A;  3AY9 A;  4J2E A;  4E19 A;  3O9R A;  5LMU K;  2JA5 C;  4AF1 A;  1K73 O;  1F21 A;  5HP1 A;  3LPU A;  3H1Q A;  3J81 O;  5IYD K;  1LWE A;  2FSN A;  4YOR A;  4EIA A;  4PUO A;  3M5R A;  3UKR A;  1WB9 A;  4BC2 A;  4M63 C;  1U49 A;  4DR6 K;  2O8B B;  4Q4Z A;  5AQO A;  4F8R A;  1NK0 A;  3ERE D;  3JXU A;  4BRQ A;  3ID8 A;  2I5J A;  3KKS A;  1X3M A;  5D3G A;  5J1E A;  1OH6 A;  4B3T K;  2WAQ L;  4ILD A;  1BA0 A;  1BI4 A;  1HKC A;  1XUP O;  4CEE A;  2QKK A;  1UA0 A;  5BPM A;  4BR0 A;  5GAG P;  1DT9 A;  4NB4 A;  1V5V A;  4KTZ A;  4DTX A;  4CGF A;  2UUB K;  2PAV A;  4LF6 K;  1N32 K;  4AH6 A;  1K8K A;  2YKM A;  3THV A;  1Z25 A;  2O8F A;  1GLJ O;  2P9N B;  5E84 A;  4WJ3 M;  4FK4 A;  2G8W A;  3S1R K;  3VN5 A;  3HO1 A;  2FSJ A;  1S6P A;  4DTM A;  4DF8 A;  3LZJ A;  1WSG A;  4ID5 A;  4LOW A;  1HX1 A;  3HOX C;  4LK1 A;  3ASM A;  1TAQ A;  4JI7 K;  4PL7 A;  2PA8 D;  4YFN A;  3L0Q A;  4KH4 A;  3OYB A;  4RMF A;  3VQ5 A;  2ZWH A;  2IIR A;  3I56 N;  5BRD A;  3QEV A;  1KD1 O;  5CJ9 A;  5GAD P;  2W6K A;  4JKG A;  4EHU A;  3FZM A;  2Q36 A;  4YG2 A;  3NFA A;  3PSF A;  4IKF A;  4FLY A;  3SAF A;  4CJS A;  3AA5 X;  1Q9X A;  3DLL L;  4CF1 A;  3AGR A;  3Q7C A;  4O4G A;  4NCB A;  4FLZ A;  3NF9 A;  2Y1I A;  5IOS A;  5HLF A;  3RZD K;  3TAG A;  1JCE A;  4BDP A;  4E1J A;  3HTV A;  4DR5 K;  1R9T C;  3AQO A;  3BP8 A;  3O5B A;  2YHB A;  4I2P A;  4X66 K;  4OLA A;  1WOO A;  4H5N A;  4JI0 K;  2BTF A;  4E7I A;  3OHR A;  3OYC A;  2Y0S L;  4KH6 A;  4AIL C;  3BF3 A;  4JK1 A;  1KAZ A;  4PA1 A;  2HHQ A;  4QJV B;  5AQN A;  4JAX A;  3SPY A;  3NHG A;  4I6M A;  3ADA C;  2Q31 A;  4BR9 A;  1SFO C;  4DV4 K;  4CHY A;  4BRH A;  4BBS C;  3C6T A;  3H0G C;  3GTP A;  1HQE A;  1RDC A;  4YDU C;  3GDZ A;  2J4R A;  4CEQ A;  1YNJ A;  1NOY A;  1T05 A;  3GTL K;  1JLF A;  3ENH A;  1C6V A;  3VQ8 A;  4KN4 A;  3VQ6 A;  1BJT A;  3OYI A;  2HF3 A;  4PQU A;  3HBT A;  5TKY A;  3O9U A;  4H5W A;  3LWL A;  4LF8 K;  4QS8 A;  5AQU A;  4BRF A;  4A3B K;  3KK7 A;  2A5X A;  1WIH A;  3L4Q A;  4H0P A;  1NJI O;  2RKI A;  3QO9 A;  1BQM A;  1XI1 A;  1CZB A;  3ZYY X;  3MWP A;  1QTM A;  3O9S A;  1OVY A;  4LR2 A;  3SJH A;  1VJE A;  1D5A A;  2QWN A;  4M45 A;  4CK1 A;  4NCA A;  2WOM A;  3G10 A;  3KWG A;  1CXU A;  4CF8 A;  1TK8 A;  1WQG A;  4BRM A;  2BH1 A;  3MML B;  1JLC A;  4WIL A;  4Y7N K;  3OYD A;  4CJF A;  4BLB A;  3D0P A;  2PHC B;  3H45 C;  4CFD A;  4RG8 A;  2CW0 A;  2E2I K;  2OAN A;  1NGA A;  1VSF A;  2O4G A;  4G1Q A;  1B4A A;  1WCM C;  4CJP A;  4CK3 A;  5TMF A;  1HYZ A;  2YI1 A;  3ZSX A;  1LOT B;  4KAT A;  2D0A A;  3L2Q A;  3JYT A;  4OIQ A;  2XY7 A;  1S1T A;  4J2A A;  4KB0 A;  3H46 O;  3DXM A;  3K59 A;  2QM1 A;  3OYF A;  4XH4 A;  2HBJ A;  3K7A K;  3VF4 A;  2ASP A;  3CC4 N;  3TTG A;  3CCQ N;  5FRM A;  3N0C A;  3O08 A;  3P31 A;  1WQF A;  4CD1 A;  1R59 O;  3DXK A;  5C2F A;  4C45 A;  4FSV A;  1I50 C;  1W2B M;  1IO2 A;  4A61 A;  1HPM A;  4C3H C;  3ALY A;  3O9Q A;  2NVX K;  5AQY A;  5FDL A;  4YOT A;  1O2B A;  4PKI A;  3D2F A;  3CFP A;  4FWM A;  3GTM K;  1RDU A;  5AZJ A;  1IV0 A;  3OYE A;  4A3M K;  4KN7 A;  2I7P A;  2ZFZ A;  5IP9 K;  3GSI A;  3SNN A;  1XWL A;  1HKG A;  3FLC O;  4BXX K;  4A3C C;  1NJW A;  1LAW A;  2R7Z C;  3PO5 A;  5KQD A;  4LFA K;  4GT9 A;  3S15 C;  3WXM B;  1U2V B;  2QWL A;  3N4Q A;  4RW6 A;  3KLF A;  2A41 A;  3RZO K;  2WC9 A;  3CJ1 A;  1RBS A;  2BE2 A;  1TWC C;  3V4G A;  3O4Q A;  3SI6 A;  1RBR A;  4YNQ A;  4CCH A;  3O9T A;  4FO0 A;  3CM5 A;  4WF9 L;  2D4W A;  2GEM A;  5M3F K;  4DLE A;  1Y1W A;  3AV9 A;  4BAC A;  4DR2 K;  4HHT A;  2A1R A;  1T03 A;  3FKI A;  4XLN A;  1JOE A;  1SAZ A;  3A5L C;  3M4O C;  1RNH A;  1YF5 L;  1LCU A;  4ELU A;  1I6H C;  2NVY C;  1S1U A;  2E4L A;  3CCV N;  4KAS A;  1VQ8 N;  4FZX C;  1VSL A;  3ZSR A;  4PAB A;  3G71 N;  3DRP A;  3W3D A;  3TAN A;  4CZG A;  3OY9 A;  3SUO A;  4G7H A;  1WLJ A;  2GWJ A;  4PHT X;  4A3J K;  4BY7 C;  3EE9 A;  3T00 A;  1SKW A;  1N6Q A;  1NGI A;  2FXU A;  3Q7B A;  2P9U B;  4IJN A;  3MED A;  4FVM A;  1TWF C;  1GLL O;  5F0X A;  3DOK A;  1WBB A;  3CC7 N;  4DQI A;  1I3Q C;  3GOI A;  4A3K C;  2YU9 K;  1TWH C;  3C6A A;  3PLA A;  1KLM A;  4LF9 K;  2NRX A;  2EX3 A;  3BZK A;  4GV9 A;  4JD2 A;  1BIZ A;  1WSH A;  2FBY A;  3VQD A;  2Z1H A;  1N34 K;  2VWK A;  3SUN A;  5JLF A;  4XH5 A;  1YIT N;  1S22 A;  3AO2 A;  3LPT A;  1DCH A;  2P1J A;  1LAV A;  3TTF A;  3GTO C;  1XZP A;  5DK5 A;  2X6S A;  4CFC A;  4FWL A;  4CEZ A;  1Q18 A;  1HI9 A;  3PO2 K;  3WQT A;  3A8I A;  1RBU A;  5J2P A;  2OCE A;  3RSE B;  2NZT A;  4EAH D;  4A3I C;  3GE1 A;  1S72 N;  5FJ8 K;  3E66 A;  4DQS A;  4C8M A;  1G15 A;  4DUY K;  4E7L A;  3HP9 A;  1E4F T;  5GIP A;  5LJV A;  3GG4 A;  4FK0 A;  4WQ5 C;  1RIL A;  4Y52 C;  1VSK A;  3K9J A;  3SJJ A;  4N76 A;  3V9Z A;  4Z4H A;  2BAN A;  3K5M A;  2HHH K;  5M5W K;  5CYQ A;  2NRT A;  1K83 K;  1IL2 A;  3ZT2 A;  1NWK A;  3GTK A;  5JVH L;  3T69 A;  1SQK A;  1T6D A;  3VQ4 A;  5LMN K;  4AH9 A;  4BWM A;  5C3E K;  4FWK A;  1XXB A;  4GTD A;  5CZ2 A;  3NBP A;  4E7H A;  1BCO A;  1EQR A;  1L5U A;  2PY5 A;  3BP3 A;  4B9U A;  2B63 K;  1Q7Y O;  4AM6 A;  4H03 B;  3LP3 A;  2XCO A;  1VSE A;  1LWF A;  4M3Z A;  1WN7 A;  5JS2 A;  4BY9 C;  3RRG A;  5IP7 C;  3G25 A;  4ILJ A;  3QES A;  3IAY A;  3MEE A;  4NYN A;  1HNI A;  3VA0 A;  3EO3 A;  4B1X B;  3EZW A;  4CFB A;  3ZSV A;  2P9L B;  1PJ7 A;  4JV5 K;  4X6A K;  1QQO A;  2B6A A;  4BC4 A;  4L8R B;  3SQ4 A;  3MWT A;  2XCQ A;  5C2D A;  1IKW A;  3ZCM A;  2E6M A;  3R9P A;  3IG1 A;  1IKV A;  3SBT A;  4JYA K;  3FZF A;  4K41 A;  1RCH A;  4CEF A;  5E68 A;  3S1N K;  4NXM K;  1BA1 A;  2OTL N;  2G8F A;  3ATV A;  3I0R A;  2CH6 A;  3TAF A;  1TWA K;  4OPH A;  1YJ9 N;  3IUC A;  2IVN A;  2GX9 A;  1DCP A;  4DFM A;  3O80 A;  4TSX A;  3OYL A;  1Q86 O;  2HF4 A;  4DTU A;  5I42 A;  2O8D B;  1JQW A;  1GOB A;  3AAQ A;  4IEE A;  3EY1 A;  2D1K A;  4DU1 A;  2QW9 A;  3S1M C;  3CER A;  1BO5 O;  3PSI A;  3P1G A;  3QBW A;  3CJ9 A;  4KHP K;  4KAR A;  5EY4 A;  4J3N A;  1UA1 A;  5I9E B;  2R92 C;  3C7N B;  5J2M A;  3CF5 L;  1T7P A;  1W97 L;  3LDQ A;  2YJE A;  2OPQ A;  1X9J A;  4AHS A;  4CJR A;  5AQL A;  1N36 K;  2FQO A;  3S17 C;  4A93 K;  4RCH A;  4CGD A;  4X62 K;  2E2O A;  4IG3 A;  2PMZ L;  4C3J C;  3HM9 A;  1DEJ A;  2YV0 X;  3FZK A;  3VGK A;  3P39 A;  2ASO A;  2XO7 A;  4V19 S;  1F7U A;  2P5G A;  2P9I B;  5M1K A;  4LFB K;  5FRN A;  2XY6 A;  4OO1 J;  4KM8 A;  3L2R A;  2ATQ A;  4JRP A;  3HYF A;  1EWR A;  3QB0 A;  4RW4 A;  2D0B A;  3O1W A;  4ZH4 A;  3HOW C;  2O8B A;  2O8C A;  1VRT A;  1ZVU A;  2G8K A;  3EE8 A;  4KHU A;  1XMQ K;  2WAQ D;  4BKW A;  3CCL N;  1ASU A;  4O0J A;  4CHP A;  3MX2 A;  3L3U A;  2HMP A;  4YOX A;  2IS3 A;  2KLA A;  1BIS A;  5AQH A;  3CQY A;  3ZSZ A;  1DD5 A;  2BGG A;  4YOU A;  4BR2 A;  3PX4 A;  1VRQ C;  3GL1 A;  4M7Y A;  4LF7 K;  2KTQ A;  2X78 A;  3CMA N;  4C2M K;  4IFE A;  3LDN A;  4XSX A;  4HVJ A;  4CJ5 A;  1IBA A;  2P9N A;  3VEN A;  3R1X A;  1RDB A;  3OJU A;  1EXQ A;  1QHT A;  1J98 A;  3FGU A;  3AD9 C;  1SZ2 A;  3OYA A;  3GTL A;  4GMJ B;  3SAG A;  4BVO A;  4GV3 A;  3QIP A;  2A40 A;  3AVF A;  3LZI A;  1RT3 A;  4E3S A;  2JA8 C;  3AO1 A;  3NGZ A;  2AJQ A;  1GLF O;  4EP4 A;  3AA2 A;  3TSQ A;  4CJQ A;  5M3M K;  1HPZ A;  2HNZ A;  5C4J C;  4CBU A;  3WEE B;  4A3E K;  2HHS A;  2RE2 A;  4G7O A;  3VA7 A;  1XHZ A;  4DV2 K;  4BG9 A;  3T01 A;  1KFS A;  3F5T A;  2AA4 A;  4H5R A;  3CJA A;  4BRP A;  3S2H K;  1YT3 A;  4JS4 A;  1JXE A;  4A59 A;  4R5P A;  2QWM A;  4YHH K;  3E9O A;  4RW7 A;  2E2I A;  3B6O A;  1R9T K;  1DLO A;  1ZC6 A;  3BUZ B;  4YFU A;  3J8A A;  2QK9 A;  4GKJ K;  3S14 K;  3AA4 A;  4JHD B;  3CQ8 A;  3QEX A;  4K42 A;  4QS9 A;  1IKY A;  1TGO A;  1TL1 A;  4MO5 A;  1HUX A;  1VSJ A;  2JLE A;  3V9U A;  3I8B A;  4X65 K;  4M3W A;  4QJV A;  4BBR K;  3HT3 A;  3V9X A;  4C8K A;  1EO1 A;  1KSP A;  4FWN A;  1C0U A;  3M8R A;  4EP5 A;  3KTQ A;  5C15 A;  3EL2 A;  1VQ6 N;  1DTQ A;  3ZSW A;  3KD5 E;  2Q3S A;  4DR1 K;  2OYQ A;  4YY3 K;  3B6P A;  1MDU B;  1OVQ A;  5AQM A;  3DLK A;  4IFV A;  4CIE A;  3GTM A;  3LDO A;  5C24 A;  4W5O A;  3EEQ A;  2WFB A;  3U4L A;  3BDP A;  5M1N A;  3TR8 A;  2R93 K;  4DS5 A;  4FWQ A;  1HJO A;  4BRO A;  1F9N A;  2FC0 A;  4B9L A;  3M3Y K;  4IXC A;  3WNG A;  2VGM A;  4FL9 A;  4CEC A;  2F4V K;  5BR9 A;  3KK1 A;  1HQM A;  3KD1 E;  4W5T A;  3O4N A;  3TPQ A;  5KPZ A;  4JKC A;  2RPI A;  1WCM K;  1B92 A;  3GIR A;  2JH3 A;  2FLO A;  3K2P A;  2E2N A;  4B1W B;  3PIO L;  3ULE B;  4F2R A;  2W42 A;  1VH2 A;  4BGA A;  3UKU B;  3MDQ A;  3VTI A;  1Z26 A;  1NMN A;  2KHO A;  4KAZ A;  4OIP A;  2ZJP L;  3FHZ A;  2V6T A;  3HRG A;  4CJ7 A;  4F2S A;  4C1N K;  2CFA A;  4FJ9 A;  1TAU A;  1NNE A;  3AVM A;  3LDL A;  3CD6 N;  2ZD1 A;  1KRP A;  3GTP C;  1L3S A;  1EQY A;  3QEW A;  3P4I A;  1SUQ A;  3PV8 A;  3LL3 A;  1Y1V K;  3KLI A;  4C3I C;  3RVC A;  1EFW A;  3N4P A;  4OIR A;  4ID1 A;  4LQY A;  4BLA A;  1YAG A;  2NVQ K;  1NKC A;  2YU9 A;  3VTH A;  4DU4 A;  2F9W A;  4O5B A;  4CJV A;  3S1Q K;  3H6E A;  1NBW A;  4IOX A;  4JKE A;  4H0T B;  4A3L C;  4ELT A;  3ITH A;  4CFA A;  3HST B;  2HHV A;  2P51 A;  4JI1 K;  3M3Z A;  3ZSQ A;  2ASM A;  4I9L A;  3VEX A;  2QEX N;  3WQU A;  4ILH A;  1VQ9 N;  2FBT A;  1U2V A;  5BN8 A;  2HMI A;  1C0F A;  4ELV A;  3VQB A;  3T1Y K;  1KQ4 A;  5AQP A;  3ZSY A;  1MU2 A;  4DTJ A;  4N47 A;  2BUP A;  1NJY A;  3FR0 A;  3KWI A;  3B8A X;  1EK8 A;  3CQZ C;  2ZGZ A;  3OS1 A;  1RTD A;  3M4O K;  1RTI A;  2HHT A;  1P90 A;  4KRE A;  1C0G A;  3A5N C;  1EP4 A;  4FK2 A;  1EET A;  2ITG A;  1VQ4 N;  5AQJ A;  3J80 O;  4WQ4 A;  1RBV A;  3DAW A;  3JAM O;  1DGK N;  5HRN A;  4BY1 C;  1K83 A;  3CME N;  1MWM A;  4BDZ A;  4FWO A;  4BY7 K;  1D8Y A;  3KVG A;  3ZT1 A;  4XIU A;  4H0O A;  1N5Y A;  5IOR A;  4KHS A;  4BRE A;  2P9U A;  3HK2 A;  1Z6R A;  4FOI A;  1TWF K;  4KTQ A;  3QER A;  3KIO A;  1NOZ A;  3AVK A;  3K5N A;  1QQN A;  3CYM A;  3RRH A;  4NLB A;  3KJV A;  5IYC C;  4B9T A;  4A3K K;  2B63 A;  2O8E B;  1W7A A;  3LAM A;  3DRS A;  2QWP A;  3VER A;  3HSC A;  4UY8 O;  1XNR K;  4Z4I A;  4KBO A;  5AQV A;  4KI4 A;  1RU0 A;  2XHB A;  1TWG C;  4CJK A;  4KMH A;  1B9D A;  3AVN A;  4B3R K;  4GTC A;  3VA3 A;  3KLE A;  4KMD A;  2JA6 K;  1J5O A;  4BRL A;  4YFX A;  4KC6 A;  3BGR A;  4H0V B;  5LL6 Z;  5KPR A;  5IYB C;  3NGI A;  3GTG K;  1WSR A;  1YTU A;  3TI0 A;  4NXN K;  1O27 A;  3I33 A;  4F4K A;  1Y1W C;  4KKO A;  3CPE A;  3T1A A;  1RT4 A;  3CIP A;  4C23 A;  4A3I K;  4GZY A;  3HOV C;  5TJ3 A;  4MFB A;  3C94 A;  3WUH A;  1KFD A;  4QIW D;  4CI6 A;  4FPA A;  5CHP A;  1VSM A;  5HOO A;  3AO4 A;  4CJ4 A;  2YHA A;  4Q5V A;  1USO A;  3FFI A;  1S1V A;  4Y52 K;  5KPT A;  1TWA A;  3S3O A;  5LJW A;  4GFQ A;  4DSL A;  1NJX A;  1ATR A;  3THX B;  3AVH A;  3TFI A;  4OLB A;  4WYB A;  3AVJ A;  2GAH C;  1QSY A;  4JKF A;  3F9K A;  4FLX A;  1WOS A;  1KAX A;  3GTJ K;  2GTD A;  1HNW K;  2AP1 A;  1NU0 A;  1RTH A;  3VQ7 A;  5BRF A;  2NRW A;  2YJF A;  4C1N I;  3VEO A;  1YI2 N;  1IKX A;  5I3U A;  4J8F A;  3KLG A;  5CR4 A;  3TTC A;  3KZB A;  4B9M A;  4CED A;  4AHT A;  1TL3 A;  3CI5 A;  3J7A P;  3HXM A;  1AB4 A;  4QAG A;  3LDS A;  4GVM A;  1EX4 A;  3LDP A;  4E1N A;  3ZLJ A;  2D0O A;  2QI2 A;  2I7N A;  1YJN N;  3QIO A;  4W5R A;  2OPR A;  3L3V A;  2CGJ A;  3OJS A;  3EYZ A;  2VUM C;  1IBL K;  3L2V A;  3HOZ K;  1BL3 A;  2OTJ N;  5KI6 A;  2F8T A;  4JEP A;  4XH1 A;  1NGF A;  2O4I A;  4CJU A;  1RBT A;  3VF2 A;  4CF9 A;  4BR5 A;  3UB5 A;  2VYP A;  2V6U A;  4KM9 A;  4UQG A;  4YOY A;  4CER A;  3H3O B;  2HHW A;  3QIC A;  4JN4 A;  1D9D A;  3HOY K;  3HZ6 A;  5C44 C;  5AQK A;  2G8U A;  5AQZ A;  4OKJ A;  2UUC K;  5GAE P;  3GTK C;  3NDK A;  3SPZ A;  1ZBH A;  4ISG A;  2D0P A;  4B1V A;  2O8D A;  3ZET B;  3HPG A;  5LY3 A;  2QWQ A;  4OIO A;  3U9Z A;  1A5W A;  1VQO N;  2JWK A;  3GEI A;  4PL8 A;  1ZBF A;  3OPF A;  3GTQ K;  2QA4 N;  3MAQ A;  1G99 A;  2KFN A;  2PMZ D;  3C7N A;  4DSK A;  2A42 A;  3O1B A;  1IS1 A;  2QXL A;  2NNW A;  1HQU A;  3NVM A;  4CBX A;  3S3M A;  1L3U A;  1NK4 A;  2Q0R A;  1K9M O;  5K14 A;  1SL2 A;  4A62 A;  4C3J K;  2OPS A;  4N5S A;  1TYQ B;  3CM6 A;  3I4M K;  3OTO K;  1KTQ A;  3IRX A;  1FJG K;  2HVH A;  4JLH A;  1VQM N;  1BCM A;  2Q0U A;  2VQE K;  4FWR A;  1LW2 A;  3DLR A;  2P9I A;  1O1W A;  3ID6 A;  3L8B A;  1HR0 K;  4K8X A;  4A3D C;  3N3Y A;  1SL0 A;  1O28 A;  2CH5 A;  4CZM A;  3V9W A;  4DS4 A;  1X1P A;  3E9L A;  4DR7 K;  1R9T A;  1GOC A;  5C4X K;  3AAP A;  1VSI A;  3VMF B;  4A3F K;  4IBN A;  3RMC A;  1Y64 A;  4CW7 B;  2KQ2 A;  4KTW A;  2VCP A;  1RDW X;  5ADX A;  3KKR A;  4KH5 A;  2QTD A;  4WFA L;  2HBM A;  3KK3 A;  4FJH A;  3K57 A;  1VRU A;  3CC2 N;  3DLG A;  1ITG A;  4IJA A;  3HOU C;  3E9P A;  5AZI A;  4CGG A;  1K8K B;  2E2J K;  1X31 C;  5IT9 O;  1Q8I A;  3S16 C;  4M3R A;  5T7B A;  4FW2 A;  1Q81 O;  4A2A A;  2JA8 K;  1RDD A;  4FJK A;  4BE0 A;  3FOE A;  3HVT A;  2R93 A;  4BRG A;  1VQP N;  5EVZ A;  3CPW M;  3S3N A;  4LFC K;  2DTU A;  5HRS A;  5C4J K;  4OPK A;  4MEY A;  3WEE A;  2PA8 L;  4JI2 K;  3S9H A;  4IOA L;  3VF6 A;  1QSL A;  5IOT A;  3PY8 A;  3AVL A;  1ASW A;  4B08 A;  3PO4 A;  4FXD A;  3HOS A;  4FOE A;  3VEZ A;  4WFB L;  3KK2 A;  3AH5 A;  1IQ0 A;  1R0A A;  4FYD A;  3I4N K;  3NF6 A;  3RZD C;  5AQI A;  5JS1 A;  3CQX A;  3LPX A;  3CCJ N;  2E1Z A;  3C95 A;  4ZTJ A;  4FJG A;  4W5N A;  1WCM A;  2DFF A;  4BC3 A;  4CVN E;  4BDY A;  3Q3Q A;  4JKH A;  2Y3P A;  4DMN A;  3VEW A;  3NMU A;  4DSI A;  5JVO A;  3MX5 A;  1S9E A;  3QX3 A;  3FE1 A;  4PAA A;  4A5B A;  1KCF A;  5FLM K;  2W6L A;  2DFH A;  3MEC A;  2O5J A;  4Y1C A;  4FJM A;  2YX6 A;  5L46 A;  1MWK A;  2IVP A;  2E2H C;  4PKG A;  1L0W A;  1BUP A;  4DV0 K;  1Y1V A;  3GTL C;  2D6F C;  3PO3 K;  4M1X A;  1S3X A;  3EKS A;  1J54 A;  4OJR A;  1IBM K;  1U48 A;  1NKB A;  3WNE A;  4A3B C;  3THW A;  4CZE A;  2UXD K;  2CGL A;  2LSN A;  5JVG L;  1N33 K;  4FM9 A;  4GKK K;  5ADX H;  1XPP A;  1JVI A;  3PX0 A;  1ZBU A;  1QQM A;  5BRH A;  4E1M A;  3ZEU B;  3CAG A;  4Y7N C;  1QHA A;  1G51 A;  3EKU A;  3M1F A;  1VK0 A;  1D9F A;  1P8Z A;  3AVA A;  4LSL A;  1V4T A;  2E2I C;  1XXA A;  3QNO A;  2IVO A;  3QDK A;  3GEE A;  5FRO A;  3P38 A;  4QOZ B;  1X9S A;  3ULE A;  3J7Z O;  3NF7 A;  1TKT A;  3OYK A;  1O2F B;  4AHU A;  1J9A A;  3UKU A;  1USM A;  2GWK A;  5H1S Q;  5AQX A;  1FKP A;  3M8P A;  4MQ9 A;  4GY2 B;  2E2Q A;  3NH2 A;  1I94 K;  4O0I A;  3K7A C;  3EQL A;  4KMU A;  5FPM A;  3LWM A;  3D6R A;  5FLX O;  1U4B A;  1FKO A;  1YTA A;  2X74 A;  3P83 D;  2JA7 K;  4CJ3 A;  1I6H K;  1TWF A;  2GSO A;  4J2D A;  1ZBI A;  2P9S A;  3D2F B;  4CE9 A;  1B4B A;  3D2E B;  3LP0 A;  4AQY K;  4FM2 A;  2FBV A;  1TVR A;  2JA5 K;  2ZJQ L;  3OYJ A;  3U3Y A;  4LK0 A;  3NVK A;  4A3M C;  3UE5 A;  5HL7 L;  5CY4 A;  1HMV A;  1DTT A;  1KQS M;  4DV3 K;  5ELZ A;  5KRS A;  2NVX A;  3CG7 A;  4LF5 K;  4PY5 A;  2JA6 A;  2GAG C;  4KHY A;  4BXX C;  3AVB A;  1NLV A;  4DV1 K;  3L4K A;  3M8Q A;  4HWI A;  3RZO C;  3GTG A;  1VLO A;  4G7Z A;  1XZQ B;  5GIO A;  1GLB G;  1WOP A;  4KV8 A;  2W7V A;  2GEL A;  3TFJ A;  3CQZ K;  4C8O A;  1RT5 A;  1BDF A;  4FW1 A;  4A3G C;  1RT2 A;  1T8E A;  1KVB A;  4JI3 K;  3W0L A;  2IGI A;  2NRZ A;  1Z05 A;  1K6Y A;  5AQQ A;  3CXC M;  1IG9 A;  4CD3 A;  1VGX A;  4FJJ A;  5M1O A;  5HRP A;  4N56 A;  4IWV A;  4DCH A;  1H1V A;  1J6Z A;  2UYT A;  2YNF A;  4M3Y A;  1WSF A;  1XC3 A;  3D7E O;  1XNQ K;  4BY1 K;  4GTB A;  3ZSO A;  4CBW A;  1JL1 A;  3MK6 A;  1ILY A;  4M3U A;  4OIN A;  1SKR A;  3HOX K;  1N8R O;  1NG9 A;  3VES A;  3GTJ A;  3AO5 A;  1I39 A;  1K8A O;  1C0M A;  1LW0 A;  4JKD A;  4KHQ A;  4AHC A;  5EGH A;  3J7Y P;  1U6Z A;  3M6G A;  1KVA A;  2EHG A;  2YU9 C;  4BRD A;  3RR7 A;  3CCR N;  4RTF D;  3CCE N;  1UAX A;  4B3O A;  1IG8 A;  2H3G X;  3QEP A;  4OPA A;  1TWG K;  3AVI A;  3CFR A;  3TAE A;  1IH7 A;  2FF6 A;  1ZBL A;  3JST A;  4CF0 A;  2JGU A;  4IDK A;  1EI6 A;  2Y0S D;  3H3V L;  2IC3 A;  1WOR A;  2YNG A;  3VQ9 A;  2GUP A;  4OGC A;  1O26 A;  2XY8 A;  4NO7 A;  4KDD A;  3A0I X;  4CHZ A;  3SQ0 A;  4P5A A;  3PO2 C;  2E8A A;  4BWJ A;  3V6D A;  4CHO A;  2F8S A;  1C1B A;  3HI0 A;  1J6W A;  1F93 A;  2XCR B;  4FM1 A;  2UUA K;  1SFO K;  3T7Z A;  4WJ4 A;  3MN5 A;  4BBS K;  1NM1 A;  1JXB A;  4KHW A;  5DM7 L;  4JK8 A;  4E7K A;  3H0G K;  4WFN L;  1LWC A;  1M90 O;  1TKX A;  5BPL A;  4OPJ A;  1KAY A;  4B9S A;  1C1C A;  4BRC A;  3IKM A;  1K83 C;  1NJZ A;  1B9F A;  4EZ6 A;  2CGK A;  3RR8 A;  3VET A;  1E4G T;  5C3E C;  1BS2 A;  4O5F A;  3GTQ A;  4CGH A;  3JS6 A;  1NK5 A;  3V1O A;  1X9M A;  3QFP A;  1U45 A;  2B63 C;  3ZX3 A;  3SUQ A;  3TAQ A;  3MXJ A;  3KLH A;  3SZY A;  3FOF A;  2P8T A;  1GOA A;  2Z1G A;  3LM9 A;  3V1R A;  2BDP A;  3SMS A;  4FWP A;  3IFR A;  4IG0 A;  3DLE A;  2VGN A;  3SQ2 A;  4KO0 A;  2VUM K;  4DV6 K;  1HRH A;  5CZ1 A;  2PYL A;  3BP8 C;  3QLH A;  4FPB A;  5EX5 A;  4X6A C;  5C0Y A;  1NGG A;  5SWM A;  3OVN A;  3TAP A;  1JLG A;  2F7T A;  4FLV A;  2ZM6 K;  2E2P A;  1UV7 A;  4QS7 A;  4G0W A;  2QWO A;  1S9G A;  4K25 A;  2YNH A;  3S0X A;  2OA8 A;  1YXQ A;  3S1N C;  3LAL A;  4DFK A;  1TWA C;  1I50 K;  4BR4 A;  4HUF A;  1QQC A;  3G0Z A;  4C3H K;  1ISE A;  4DTN A;  3OYG A;  5GAH P;  3DXJ A;  2HHX A;  5M5X K;  3QIN A;  1IBK K;  2ZUF A;  3LAK A;  3RMA A;  4DDQ A;  4BRA A;  2ETJ A;  3D45 A;  3WXI A;  3BF1 A;  3QEI A;  3RMD A;  1XXC A;  1BG3 A;  5AFU A;  5DMR A;  4A3C K;  4M3T A;  2R7Z K;  3S15 K;  1TUU A;  1D4X A;  2HB5 A;  2KFZ A;  1TK0 A;  1YNN A;  4A93 C;  5JLH A;  3RTV A;  3PUF A;  2FF3 B;  1TWC K;  1F7V A;  4BQZ A;  4CIF A;  4CZK A;  2F96 A;  2P9P B;  1TYQ A;  4NCG A;  3SZ2 A;  1WAJ A;  3VQE A;  5IOQ A;  3ENB A;  5F1X A;  4CGI A;  4R79 A;  3CET A;  1EWQ A;  1CLQ A;  4KB2 A;  2O5I A;  4XCH A;  1T3V A;  2YNI A;  1BDG A;  1NK7 A;  4A3D K;  2E6L A;  2NRV A;  2NVT C;  1HYV A;  4AYB L;  1NGB A;  3TWH A;  1ZXO A;  2NVY K;  5MLC Q;  3TSU A; 
#chains in the Genus database with same CATH homology
 3VEY A;  3QIC A;  4JN4 A;  3MCP A;  3HZ6 A;  1Q7Y O;  3R6M A;  4H03 B;  5AQK A;  4AM6 A;  3TSP A;  2XCO A;  1EH1 A;  5AQZ A;  3SMP A;  3SLC A;  5GAE P;  3O6W A;  4CZL A;  2PFU A;  2D0P A;  4ISG A;  4B1V A;  3ZET B;  4BY9 C;  1RFQ A;  1WIH A;  5LY3 A;  2QWR A;  2QWQ A;  5AQR A;  3CJB A;  3G25 A;  4ILJ A;  3SK3 A;  4M7X A;  3U9Z A;  1VQO N;  2JWK A;  4PL8 A;  3OPF A;  3L4J A;  2QA4 N;  4G0U A;  3A5M C;  1KXP A;  1G99 A;  3EO3 A;  3EZW A;  5FPN A;  4B1X B;  3PIP L;  3CCS N;  2DPN A;  3C7N A;  3HOT A;  2A42 A;  3O1B A;  3MMV A;  2P9L B;  2W40 A;  1IS1 A;  5EXW A;  2QXL A;  5FPD A;  2NNW A;  4K43 A;  1QQO A;  3NVM A;  4BC4 A;  4CBX A;  1M1K O;  3MWT A;  4GTL A;  2XCQ A;  5C2D A;  2Q0R A;  2E88 A;  1K9M O;  4WQ4 C;  3QFU A;  4C2M C;  4A62 A;  1O24 A;  3R9P A;  3LM2 A;  4ISE A;  3DJC A;  1TYQ B;  3S41 A;  2YHY A;  4BRK A;  3WXK A;  3SBT A;  3FZF A;  4IO8 A;  4K41 A;  3QBX A;  1VQM N;  2Q0U A;  5M1F A;  4FWR A;  1BA1 A;  2OTL N;  2RH6 A;  3ATV A;  4EHT A;  2V52 B;  5CHI A;  3H3N O;  5M1Q A;  2P9I A;  2CH6 A;  3ID6 A;  3K9K A;  3SAH A;  1NGC A;  4JK7 A;  3E1Y A;  2R92 A;  4IEI A;  3KHY A;  4FWS A;  5C10 A;  4OPH A;  1YJ9 N;  3N3Y A;  3IUC A;  4GTA A;  2IVN A;  2GX9 A;  1ZBS A;  2CH5 A;  4CZM A;  1O28 A;  2Q97 A;  5JFE A;  2ZJR L;  3E9L A;  3O80 A;  4JK9 A;  3VEV A;  1Q86 O;  3ORE A;  1R9T A;  2HF4 A;  3AAP A;  1NGE A;  4B1U B;  5B8H A;  4NLC A;  5DM6 L;  4MDA A;  3AAQ A;  3A8Y A;  4IEE A;  3VMF B;  2D1K A;  4GNI A;  1JJ2 M;  2YHX A;  2QW9 A;  1TUY A;  4BQL A;  1MA9 B;  1VAZ A;  1BO5 O;  1Y64 A;  3CER A;  4IO9 L;  2VCP A;  3QBW A;  1RDW X;  2HBK A;  3CJ9 A;  4H5T A;  5AQF A;  3RSE A;  5ADX A;  4KH5 A;  4KAR A;  2QTD A;  5EY4 A;  4J3N A;  3C0B A;  4WFA L;  5I9E B;  2HBM A;  3C7N B;  1WOQ A;  2RHK A;  5C12 A;  3CF5 L;  1W97 L;  1VQK N;  3LDQ A;  2YJE A;  3CC2 N;  1X9J A;  4IJA A;  5AQL A;  3E9P A;  4RCH A;  5GIN A;  5AZI A;  2E2O A;  1K8K B;  3CCM N;  4C3J C;  1GLC G;  2GSN A;  2NRH A;  4JKB A;  2NLX A;  5AFU H;  4DHY A;  4MO4 A;  4BR7 A;  5JMV A;  1DEJ A;  3IDH A;  4CZJ A;  3FZK A;  3VGK A;  3P39 A;  4F9O A;  3ENO A;  2ASO A;  1VQ7 N;  3SBG A;  1Q82 O;  2RGR A;  2P9I B;  5M1K A;  5F2R A;  2E20 A;  1Q81 O;  4A2A A;  4OO1 J;  4KM8 A;  4LC9 B;  4B1Z A;  3NUH A;  3FOE A;  3GDQ A;  2R93 A;  4BRG A;  1VQP N;  3QB0 A;  5EVZ A;  1HKB A;  3O1W A;  3CPW M;  1JCF A;  1ZVU A;  4IDH A;  2JA7 A;  3FFK B;  1V4S A;  3EE8 A;  3WEE A;  4BKW A;  4MDB A;  3CCL N;  4H0Y B;  1GLD G;  3ZET A;  4IOA L;  1QZ5 A;  3VF6 A;  1QVG M;  3MX2 A;  4GTF A;  5IOT A;  2HMP A;  4YOX A;  1VQ5 N;  3ZX2 A;  4DQ8 A;  2KLA A;  3HOS A;  5BPN A;  2JA5 A;  4FOE A;  3A5O C;  3CQY A;  5AQH A;  3VEZ A;  4U67 L;  4WFB L;  1DD5 A;  3AH5 A;  4YOU A;  2HST A;  2P9K A;  4KAW X;  2HBL A;  4DB3 A;  3G4S N;  2P9L A;  1RGI A;  2V51 B;  4BR2 A;  5AQI A;  3AQP A;  3CQX A;  4DKW A;  3LPX A;  4KB4 A;  3C6H A;  5BRE A;  3CCJ N;  2E1Z A;  1WCM A;  2GSU A;  3MN7 A;  4BC5 A;  3TU5 A;  3GL1 A;  4M7Y A;  4BC3 A;  3Q3Q A;  3CMA N;  1O2A A;  4JKH A;  4IFE A;  1GLA G;  3LDN A;  2Y3P A;  3ATU A;  2V7Z A;  3WXL A;  1YJW N;  2P9S B;  3AY9 A;  2P9N A;  3VEW A;  3R1X A;  3VEN A;  3VPZ A;  3NMU A;  3O9R A;  3GTL A;  3FGU A;  1SZ2 A;  4AF1 A;  3ZEU A;  5JVO A;  3SAG A;  1K73 O;  4BVO A;  3MX5 A;  3H1Q A;  4GV3 A;  3OEP A;  4G9Z A;  3QX3 A;  2A40 A;  2KKZ A;  1BWF O;  2FSN A;  3FE1 A;  1T6C A;  4MLH A;  4YOR A;  4A5B A;  4EIA A;  3M5R A;  3CQZ A;  3UKR A;  5AQT A;  4BC2 A;  5TKW A;  4M63 C;  1GLF O;  2A6A A;  3TSQ A;  2YX6 A;  1MWK A;  2IVP A;  4PKG A;  5AQO A;  4CBU A;  4GV6 A;  3WEE B;  1BUP A;  3ERE D;  3JXU A;  3OBW A;  3ID8 A;  4BRQ A;  1Y1V A;  2RE2 A;  4M1X A;  3VA7 A;  1YVN A;  4FZB A;  1S3X A;  3EKS A;  4BG9 A;  1X3M A;  2CFA B;  3F5T A;  2AA4 A;  4H5R A;  1NGD A;  3CJA A;  4BRP A;  2P9K B;  4A59 A;  4CZE A;  4ILD A;  2CGL A;  1BA0 A;  1HKC A;  2QWM A;  3CJ7 A;  3L4I A;  1XUP O;  3E9O A;  5JVG L;  4FM9 A;  2E2I A;  5BPM A;  4BR0 A;  1ZC6 A;  1DT9 A;  3BUZ B;  4NB4 A;  5GAG P;  1VQL N;  5ADX H;  3J8A A;  4JHD B;  4K42 A;  2PAV A;  1GLE G;  4QS9 A;  1QQM A;  1K8K A;  5BRH A;  4EFH A;  2W41 A;  2V7Y A;  1GLJ O;  2P9N B;  5E84 A;  4MO5 A;  1HUX A;  3D2E A;  3I8B A;  3ZEU B;  3CAG A;  2FSJ A;  1QHA A;  3EKU A;  3M1F A;  1EO1 A;  3I55 N;  1P8Z A;  4FWN A;  1HX1 A;  1TWG A;  1V4T A;  3UKR B;  1XXA A;  4PL7 A;  1DKG D;  2PBD A;  3L0Q A;  2IVO A;  3QDK A;  4IZ9 A;  4KH4 A;  3R8E A;  4B1Y B;  2KWA A;  2ZWH A;  3P38 A;  2IIR A;  3I56 N;  3ULE A;  5BRD A;  3J7Z O;  1KD1 O;  5CJ9 A;  5C15 A;  3EL2 A;  1CZA N;  5GAD P;  4JKG A;  4EHU A;  1VQ6 N;  3FZM A;  2Q36 A;  3UKU A;  4CZI A;  2GWK A;  5H1S Q;  5AQX A;  3O8M A;  3SAF A;  1MDU B;  4GY2 B;  2E2Q A;  3C65 A;  2NRR A;  3DLL L;  5AQM A;  1QZ6 A;  5JIC A;  3AGR A;  3Q7C A;  5FPM A;  3GTM A;  3D6R A;  3LDO A;  2WFB A;  4CZH A;  5IOS A;  4O8K A;  3U4L A;  5M1N A;  1IJJ A;  1JCE A;  4E1J A;  1SFO A;  3HTV A;  4GTE A;  3AQO A;  3BP8 A;  3O5B A;  3MCA B;  4FWQ A;  1HJO A;  4H5N A;  3H0G A;  1WUA A;  4BRO A;  1F9N A;  1TWF A;  2GSO A;  2BTF A;  3TTD A;  3OHR A;  4YDU A;  4KH6 A;  4IXC A;  4L3Q A;  2P9S A;  3D2F B;  2VGM A;  3BF3 A;  3D2E B;  1KAZ A;  1B4B A;  4FL9 A;  1YUW A;  5BR9 A;  5AQN A;  4JAX A;  3O4W A;  2ZJQ L;  3G4A A;  3LAJ A;  3NVK A;  4I6M A;  5M1P A;  3TPQ A;  3UE5 A;  5KPZ A;  5HL7 L;  2Q31 A;  4BR9 A;  1QVF M;  4JKC A;  1KQS M;  5ELZ A;  2NVX A;  1T44 A;  1GE9 A;  2JA6 A;  4BRH A;  2JH3 A;  2FLO A;  2E2N A;  1NLV A;  4B1W B;  3PIO L;  3GTP A;  3CHW A;  3ULE B;  3L4K A;  3N0B A;  4MLE A;  4JKG B;  4BGA A;  4YDU C;  4HWI A;  3UKU B;  3MDQ A;  3VOV A;  3CCU N;  3VTI A;  3GTG A;  2J4R A;  2KHO A;  3ENH A;  5GIO A;  1GLB G;  3FHZ A;  2ZJP L;  1VQN N;  4HTL A;  1BJT A;  3HRG A;  2HF3 A;  4CJ7 A;  2GEL A;  3HBT A;  4C1N K;  5TKY A;  2CFA A;  3O9U A;  4H5W A;  2P5M A;  4QS8 A;  5AQU A;  4BRF A;  2WUS A;  3LDL A;  3CD6 N;  3W0L A;  3KK7 A;  2A5X A;  2NRZ A;  1Z05 A;  4GVE A;  3L4Q A;  4H0P A;  4XEI A;  5AQQ A;  3CXC M;  4CD3 A;  1NJI O;  1EQY A;  4A57 A;  2VUM A;  5M1O A;  3ZYY X;  3P4I A;  3MWP A;  3O9S A;  1OVY A;  3LL3 A;  3SJH A;  4LR2 A;  4C3I C;  3RVC A;  4JHD A;  2QWN A;  3N4P A;  4IWV A;  1WQH A;  3KWG A;  1H1V A;  1J6Z A;  4DCH A;  1WQG A;  2UYT A;  1YAG A;  4BRM A;  4LQY A;  4BLA A;  1XC3 A;  2BH1 A;  3D7E O;  3MML B;  2YU9 A;  3VTH A;  2F9W A;  4GTB A;  4CBW A;  4I6M B;  3H6E A;  4BLB A;  3MK6 A;  1NBW A;  1ILY A;  4IOX A;  4JKE A;  4A5A A;  3H45 C;  2PHC B;  4H0T B;  4BRN A;  2OAN A;  1N8R O;  3M3Z A;  4CZF A;  1NGA A;  3VES A;  2ASM A;  3VEX A;  3GTJ A;  1B4A A;  2QEX N;  4O8U A;  4ILH A;  3WQU A;  1K8A O;  4JKD A;  1VQ9 N;  2YI1 A;  2YHW A;  1U2V A;  5EGH A;  5BN8 A;  4C3H C;  1I50 A;  1LOT B;  2HOE A;  1C0F A;  4KAT A;  1U6Z A;  3M6G A;  1YIJ N;  1KQ4 A;  5EGE A;  4JNE A;  5AQP A;  4BRD A;  3CCR N;  4RTF D;  3CCE N;  2FSK A;  3H46 O;  3OA9 A;  3DXM A;  1IG8 A;  2BUP A;  2H3G X;  2QM1 A;  2HBJ A;  3FR0 A;  3KWI A;  4XH4 A;  3B8A X;  4OPA A;  5BN9 A;  3VF4 A;  1ATS A;  2ASP A;  3CC4 N;  1EK8 A;  4BRI A;  2ZGZ A;  3CCQ N;  2FF6 A;  3N0C A;  3GBT A;  3O08 A;  3P31 A;  1WQF A;  4CD1 A;  1P90 A;  1NMD A;  1R59 O;  3DXK A;  5AR0 A;  5C2F A;  3IMX A;  1C0G A;  4FSV A;  3A5N C;  1W2B M;  2R7Z A;  1O25 A;  2GUP A;  4A61 A;  1HPM A;  1O26 A;  1VQ4 N;  4NO7 A;  3O9Q A;  5AQG A;  5AQJ A;  3OBY A;  5AQY A;  4YOT A;  3WT0 A;  4KDD A;  1HLU A;  4WQ4 A;  3A0I X;  3F9M A;  3DAW A;  1O2B A;  2WBN A;  3D2F A;  4PKI A;  2E8A A;  4FWM A;  1BGW A;  1TWC A;  5FPE A;  1RDU A;  5AZJ A;  4P5A A;  1DGK N;  1K83 A;  3CME N;  1MWM A;  5AQW A;  1OKJ A;  2I7P A;  4FWO A;  3HI0 A;  2ZFZ A;  2XCR B;  4RWT A;  4FVU A;  3KVG A;  3T7Z A;  3MN5 A;  4H0O A;  1HKG A;  3FLC O;  3LAP A;  1NM1 A;  5IOR A;  4BRE A;  4BVP A;  2P9U A;  5DM7 L;  4JK8 A;  5KQD A;  1Z6R A;  4FOI A;  4GT9 A;  3WXM B;  1U2V B;  2QWL A;  3N4Q A;  4WFN L;  2NVY A;  1QQN A;  2A41 A;  4H5V A;  2WC9 A;  4NLB A;  3CJ1 A;  5BPL A;  1M90 O;  2B63 A;  1KAY A;  3V4G A;  4BRC A;  3IKM A;  4WCE L;  5E26 A;  3DXM B;  1BU6 O;  3O9T A;  2QWP A;  4FO0 A;  2CGK A;  2E1Y A;  2VWB A;  3HSC A;  3VER A;  2D4W A;  2GEM A;  3VET A;  1E4G T;  4WF9 L;  4UY8 O;  3HM8 A;  1Y1W A;  4KBO A;  5AQV A;  4KMH A;  4BG8 A;  4KMD A;  4GTC A;  4O5F A;  3FKI A;  3R3L A;  3GTQ A;  1SAZ A;  3A5L C;  4BRL A;  1YF5 L;  3JS6 A;  4KC6 A;  1LCU A;  3DXK B;  4H0V B;  4PKH A;  4U7B A;  3G6E N;  4P5B A;  5KPR A;  4B9Q A;  3QFP A;  4AM7 A;  1O29 A;  1O13 A;  3CCV N;  3ZX3 A;  4KAS A;  1VQ8 N;  3MN6 A;  1I3Q A;  2ZF5 O;  3FOF A;  1O27 A;  4BGB A;  3I33 A;  3G71 N;  1TWH A;  3LM9 A;  5AZJ B;  3CPE A;  4C23 A;  3BEX A;  3CIP A;  3W3D A;  3SMS A;  3QML A;  5TJ3 A;  4FWP A;  3WUH A;  4CZG A;  3IFR A;  4CI6 A;  4FPA A;  5CHP A;  2GWJ A;  2Q2R A;  2VGN A;  4PHT X;  5HOO A;  3EE9 A;  5KQ8 A;  1NGI A;  2FXU A;  3Q7B A;  4IOC L;  2P9U B;  4FPB A;  5EX5 A;  4IJN A;  4Z94 A;  5C0Y A;  1NGJ A;  1NGG A;  4YOV A;  5KPT A;  1TWA A;  1GLL O;  5F0X A;  2JWL A;  1XQS C;  2F7T A;  2ITM A;  5LJW A;  3CC7 N;  4GFQ A;  3GTO A;  2E2P A;  1ATR A;  3GOI A;  4QS7 A;  4G0W A;  3C6A A;  3PLA A;  2QWO A;  2NRX A;  2P9P A;  4K25 A;  4GV9 A;  4JD2 A;  4H0X B;  4WYB A;  4JKF A;  3CJC A;  3S0X A;  4A2B A;  1ESV A;  1YXQ A;  1KAX A;  1NGH A;  3FZL A;  5JLF A;  2GTD A;  2AP1 A;  4XH5 A;  5AQS A;  1YIT N;  5CE3 A;  3ZX0 A;  3U8X A;  5BRF A;  1S22 A;  2NRW A;  2YJF A;  3VGM A;  3VEO A;  3TTF A;  4C1N I;  3AGK A;  1YI2 N;  3VGL A;  4J8F A;  5CR4 A;  1SS6 A;  4BR4 A;  4WQ5 A;  1ISE A;  3TTC A;  3KZB A;  5GAH P;  3DWL A;  4FWL A;  1Q18 A;  2YCH A;  3CI5 A;  1AB4 A;  1JCG A;  3WQT A;  3RSE B;  2NZT A;  3LDP A;  2EWS A;  4EAH D;  3GE1 A;  4DDQ A;  4BRA A;  1X3N A;  2D0O A;  2QI2 A;  3AAR A;  2I7N A;  3BF1 A;  3WXI A;  3E66 A;  1YJN N;  1S72 N;  2F9T A;  1KC8 O;  2CGJ A;  1XXC A;  1BG3 A;  5AFU A;  3OW2 M;  1ATN A;  1E4F T;  5EOY A;  1TUU A;  5LJV A;  1D4X A;  3GG4 A;  5GIP A;  4WQ5 C;  3MN9 A;  3BUE A;  2OTJ N;  3K9J A;  3H1V X;  4JEP A;  4XH1 A;  5AZI B;  1NGF A;  5JLH A;  4Y0W A;  2FF3 B;  4BQZ A;  3WXJ A;  3F2K A;  4JKA A;  4CZK A;  2E2H A;  2NRT A;  1TYQ A;  2P9P B;  2ZGY A;  4JD2 B;  4G0V A;  3VF2 A;  3GTK A;  1NWK A;  4YOW A;  3FZH A;  2A3Z A;  3L6Q A;  5JVH L;  4BR5 A;  3UB5 A;  1YHQ N;  3T69 A;  1SQK A;  1T6D A;  2VYP A;  3ENB A;  5IOQ A;  3EN9 A;  4ISF A;  5F1X A;  4R79 A;  3CET A;  4KB2 A;  4FWK A;  1XXB A;  1T3V A;  4GTD A;  4KM9 A;  1BDG A;  3U9D A;  1BOT O;  2NRV A;  4YOY A;  3G4C A;  4KMA A;  1NGB A;  4ILG B;  1ZXO A;  2Q1N A;  5MLC Q;  3H3O B;  3TSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...