1ZXOA

X-ray crystal structure of protein q8a1p1 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr25.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
265
Chain Sequence
LIADSGSTKTDWCVVLNGAVIKRLGTKGINPFFQSEEEIQQKLTAVYFYGAGCTPEKAPVLRRAIADSLPVIGNIKANSDMLAAAHGLCGQKAGIACILGTGSNSCFYNGKEIVSNISPLGFILGDEGSGAVLGKLLVGDILKNQLPATLKEEFLKQFDLTPPEIIDRVYRQPFPNRFLASLSPFIAQHLEEPAIRQLVMNSFIAFFRRNVMQYDYKQYPVHFIGSIAYCYKEILQDAARQTGIQIGKILQSPMEGLIQYHSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the hypothetical protein Q8A1P1 at the resolution 3.2A. Northeast Structural Genomics Consortium target BtR25.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
molecule keywords conserved hypothetical protein Q8A1P1
total genus 43
structure length 265
sequence length 278
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zxoA03
4IJNA 3FZHA 3AAQA 1NGBA 5AQHA 2P9IA 4BR4A 3GE1A 5ADXA 4BRKA 4BRPA 1BUPA 3D2FA 4DHYA 5JLHA 3JXUA 3CJ7A 4MLEA 2ZGZA 1GLDG 3O1BA 2BUPA 1V4SA 4CZLA 3LM2A 3S41A 3UE5A 4I6MA 5F2RA 5BREA 2QWQA 3MK6A 3D7EO 4B1YB 3WXJA 1J6ZA 4M7XA 3D2EB 3SMSA 2FXUA 4YDUA 3MN6A 5AQJA 3TPQA 4DQ8A 3AAPA 1ATSA 2H3GX 4E1JA 1LOTB 3A8YA 1HJOA 4PL8A 3LM9A 2HF3A 2YI1A 3FZFA 1CZAN 5AZIB 5KPRA 4FWRA 4XH4A 5AQIA 3WUHA 1X3NA 1DGKN 5EX5A 3BUZB 3FFKB 1YAGA 3A5MC 3P4IA 3MN7A 4FWNA 5I9EB 4BRHA 2Q97A 4BR5A 3GOIA 1ATNA 1XQSC 2QWMA 5FPEA 4CZIA 4BRFA 3HI0A 4BGBA 5AQSA 3RSEA 2P9LB 4FWQA 3VEOA 4WYBA 2P9SB 3WXKA 1NGFA 1NGJA 1DEJA 4FL9A 1KXPA 5AQGA 4EHUA 2GTDA 4JHDA 3B8AX 1YXQA 3LDNA 3ENHA 4CJ7A 2DPNA 1BA1A 1NGDA 5BRHA 3DJCA 2CH6A 1P8ZA 3I8BA 4CZHA 2D0OA 3DWLA 3OHRA 4K43A 4PKIA 2A6AA 2E1YA 3O8MA 1NGIA 1MA9B 4BRAA 3O80A 5AQXA 1Y64A 4CZJA 1H1VA 4WQ5C 3VEXA 2QXLA 4PKHA 4C23A 4K25A 4NO7A 4FWLA 4BRQA 1K8KA 4L3QA 3MN5A 1GLFO 4BG8A 1ATRA 4BG9A 3DXMA 3DXKB 3ZETA 3GBTA 4FWKA 3BF1A 5FPDA 3O6WA 3WEEB 2OANA 4FOIA 3H45C 4H03B 3UKRB 4H0YB 2FSKA 1T6DA 1BO5O 2A5XA 1NM1A 4BR0A 4B1ZA 4ISEA 3CERA 1IG8A 5EVZA 2WUSA 3C7NB 4FPBA 3WEEA 2PAVA 3ID8A 2IIRA 4H0OA 3DXMB 2YHYA 3ZETB 1X9JA 4CBWA 4BROA 3QFUA 3H1VX 3SK3A 5AQTA 1Z6RA 2ZF5O 5AQUA 3CIPA 3MMVA 2HMPA 3FZLA 4K41A 5EOYA 3FLCO 3VGKA 4JHDB 1Q18A 3WXIA 3KHYA 4CI6A 1RGIA 3D2FB 3GDQA 4H5VA 4DCHA 2E2PA 2Q31A 4Z94A 5BR9A 5AFUA 2ZWHA 3H6EA 4RTFD 4EIAA 3J8AA 5KQ8A 3L6QA 3VEYA 4M63C 5AQFA 1U2VB 4BRMA 2Q0RA 2YHWA 5JMVA 3WXLA 4EFHA 3R9PA 3L4IA 3VEWA 4CBUA 3IUCA 5BN9A 1YUWA 2V52B 3HSCA 3DXKA 3U9DA 3L0QA 2ASPA 3KVGA 4O8KA 4CZFA 3VESA 1MWKA 2P9PB 3EL2A 3QBWA 3U8XA 5AQPA 2YJFA 5AQRA 2E20A 3VEZA 4JNEA 3O5BA 1WOQA 1HUXA 3MCPA 5ELZA 1QQNA 5B8HA 1HLUA 5TKYA 1ZXOA 2P9KA 4F9OA 2V7ZA 1IJJA 1SQKA 4FWSA 3QB0A 3ENOA 2CGJA 1ZC6A 3VF6A 5FPMA 4B9QA 3QMLA 1TYQA 2AA4A 4HTLA 1TYQB 4BC3A 1NGCA 3H3NO 2P9KB 4M7YA 4H5WA 2YHXA 3IMXA 3H3OB 4AM6A 1E4GT 1G99A 3UB5A 2E2NA 1NGEA 4WQ4A 3ULEB 4CD3A 2VYPA 3HZ6A 1SZ2A 3CJ9A 4EHTA 4BC5A 1JCEA 2VWBA 5JLFA 3VF2A 2HF4A 1T44A 2CH5A 1RDWX 3FZKA 1D4XA 2J4RA 2CGLA 3CQXA 4DB3A 1HPMA 1MWMA 4B1WB 1GLJO 4J8FA 2FLOA 3CJBA 5AQYA 4A61A 3U9ZA 5BRFA 5AQOA 3UKRA 3ATVA 3ZEUA 1S3XA 3ZX3A 5KQDA 5F1XA 2NRHA 2A42A 2AP1A 2ASMA 3M1FA 2E8AA 1S22A 2QW9A 3TU5A 1KAZA 3FZMA 3O4WA 5BPNA 3VGMA 1U2VA 3ULEA 3CQYA 4KBOA 1DKGD 5FPNA 1TUUA 4IO8A 4FO0A 3FGUA 4CZGA 2QWLA 3U4LA 1SAZA 3EN9A 2QWNA 4FWPA 5CE3A 4B1VA 1JCGA 3A5NC 5BPLA 5ADXH 2ASOA 1NGAA 5LJWA 4JN4A 2P9UB 3LDQA 4BQLA 2FF6A 3CJCA 3A5LC 1KAYA 4FOEA 4JD2A 1QZ5A 2QWRA 5AZJB 1NLVA 4BRIA 3O08A 1HKGA 3F9MA 1XUPO 4XH1A 5KPTA 5KPZA 1LCUA 4BREA 3W3DA 3QBXA 5AR0A 1GLEG 4XH5A 4MLHA 4AM7A 4BQZA 2A41A 2Q36A 4FPAA 3CHWA 1C0FA 3QDKA 2UYTA 3UKUB 1JCFA 4BRLA 5EY4A 3VENA 3EKUA 5AQZA 4RCHA 1QHAA 3VPZA 5LY3A 4LC9B 3LL3A 4H0VB 3SJHA 3IFRA 1NGHA 2Q0UA 2E88A 3HM8A 3UKUA 3VETA 4CZMA 2IVPA 2W41A 5LJVA 3BEXA 3R6MA 1ZBSA 2FSNA 3CJAA 4PKGA 4BC2A 1RFQA 4BR2A 4GNIA 3D2EA 2QWOA 1NBWA 2E1ZA 4CZKA 1V4TA 5AQLA 5BRDA 4BC4A 5AZJA 2GELA 3MN9A 2D1KA 4BRGA 4B1XB 3BP8A 2E2OA 3H1QA 3I33A 1NGGA 3ZX2A 4BR7A 3MDQA 3LDOA 1GLBG 5AQWA 3C7NA 2FF3B 2GWJA 2P9NA 2P9IB 4H0PA 4BRCA 1OKJA 3QFPA 1GLLO 3A5OC 4NB4A 4EAHD 1U6ZA 5JICA 1YVNA 1MDUB 3SLCA 2NLXA 3ZEUB 2P9PA 3ATUA 1HKCA 3CJ1A 1R59O 2QM1A 3FE1A 1X3MA 2V7YA 1BA0A 2IVNA 3VGLA 1XC3A 5AZIA 4WQ4C 1K8KB 5AQNA 4MO5A 2P9NB 3H46O 1EQYA 4PL7A 3M6GA 3W0LA 1BWFO 4BR9A 4BVPA 3HTVA 4K42A 1BU6O 2A40A 3JS6A 4MO4A 3M3ZA 4H0TB 4JD2B 4IXCA 1C0GA 4BGAA 2Q2RA 2IVOA 4ISGA 2KHOA 2QWPA 3WQUA 4I6MB 4CBXA 4A2AA 2E2QA 4Y0WA 3VOVA 3VERA 4CD1A 2V51B 1Z05A 3G25A 3A0IX 2CGKA 4H5TA 3EO3A 2P9SA 2ITMA 2D4WA 4BRDA 3CI5A 2P9LA 4BRNA 1BDGA 1BG3A 4H5NA 4B1UB 5AQMA 4CZEA 1KAXA 2BTFA 4A2BA 4H0XB 4H5RA 3R8EA 4QS8A 3DAWA 3GL1A 2PBDA 5BPMA 3QICA 4JAXA 2GUPA 4HWIA 1BOTO 3LDLA 1GLCG 3EKSA 1NMDA 4WQ5A 3HBTA 2FSJA 2W40A 2YJEA 3CETA 1QQOA 4XEIA 1TUYA 3KZBA 4IJAA 1QZ6A 2F9WA 1HX1A 2GEMA 4BVOA 5EXWA 4FWMA 3O1WA 1HKBA 1NWKA 4IWVA 5AQKA 2P9UA 5BN8A 3VEVA 2GWKA 3C0BA 1QQMA 2NZTA 3EZWA 1E4FT 3ZX0A 2YCHA 5AFUH 1GLAG 4ISFA 2Q1NA 3SMPA 3AARA 4GY2B 4O5FA 3AY9A 3IDHA 5F0XA 2EWSA 2A3ZA 3VF4A 1ESVA 5E26A 2F9TA 4IZ9A 5E84A 3RSEB 3WQTA 2VCPA 2I7NA 2I7PA 3WT0A 4FWOA 5AQVA 4FSVA 2D0PA 3FR0A 4QS7A 2HOEA 2ZGYA 1T6CA 1WUAA 3GG4A 4QS9A 4RWTA 3BF3A 4A62A 5AQQA 3LDPA 4YDUC
chains in the Genus database with same CATH superfamily
3AAQA 4A3LC 3DLLL 3AVCA 3S1QK 1ZBHA 4M1XA 2G8HA 1Q82O 2ZUFA 3MWPA 3GE1A 4BRKA 4BRPA 2R7YA 5IP7C 4O5BA 4KB1A 4YHHK 1JLEA 2A69A 4KHQA 3MMLB 3O1BA 2BUPA 1V4SA 2VGMA 3L4QA 5IYCK 1OH8A 1O27A 3PO2K 3J81O 3K7AK 4DS4A 1JXEA 5IYCC 4Z4IA 1VQKN 3SMSA 3T7ZA 2FXUA 4CJVA 2BH1A 4DQRA 3O3GA 3OYHA 3JSTA 3GTPC 2GSNA 1VQMN 3S1QC 1LOTB 2HBLA 5TMCA 4PWDA 3LM9A 3VA3A 1CZAN 5AZIB 1TWGK 5KI6A 4BDPA 4FWRA 4XH4A 2GBZA 4C1NI 1VSIA 1X3NA 4OIOA 5EX5A 1DCPA 4FLXA 3DLEA 3ISNC 1K83A 3A5MC 4KH5A 5I9EB 4CEEA 4QIWD 5GADP 3E9OA 4YFUA 1WSRA 1O28A 2QWMA 2V6TA 1U47A 4FJJA 3GTOA 5AQSA 3KIOA 4PA1A 3DOKA 2P9LB 2WC9A 2WB1L 3AO4A 1R9TA 2P9SB 4O55A 4M3ZA 4C3HC 3OBYA 1KXPA 4EHUA 1IKYA 2GTDA 2JA5C 3LDNA 4BY9C 4BE1A 2YV0X 3HXMA 3ENHA 4Z0UA 1BA1A 3CFOA 5BRHA 3QLHA 1YJWN 2X78A 4C8KA 3HRGA 1I6VA 3I8BA 4CZHA 5IORA 3HOXK 2WB1D 2KFZA 4U67L 2PMZL 5FLMK 1LWFA 2OYQA 4A3JK 3NF7A 1ZQ1C 3O80A 4IOAL 1K83C 3S14K 1Y64A 4CZJA 4JRQA 4WQ5C 3RMCA 3WNEA 4FJLA 3P83D 3VEXA 2QXLA 4K25A 4JKCA 3T19A 1WIHA 1K8KA 4GTAA 3AQOA 3MN5A 3DXMA 3GBTA 3BF1A 3L3UA 3ZT3A 3LP3A 4H03B 1B9FA 3AA4A 4KMDA 4DV1K 5KRSA 1Y1VA 3HPOA 3KKSA 2HHHK 3FKIC 3AVIA 4BR0A 4BY1C 3CERA 4JK8A 4GTLA 3LDSA 1WQHA 1SKRA 3VQ5A 3VQ8A 3GTQA 3G6EN 4E19A 4O44A 5FROA 3WNHA 1WAFA 1U49A 4H0OA 4J2DA 2XRIA 1X9JA 4J2AA 4BROA 4C3IC 1I3QA 3LZIA 3H1VX 2IAJA 4X66K 4FZXC 3TFIA 3AO5A 1VQ6N 3MMVA 2HMPA 2JA5A 3TTFA 1O2FB 1NK0A 4KH4A 5EOYA 1RT5A 3RZDC 4IBNA 3SI6A 4CECA 1XNRK 3WXIA 1HMVA 4CEFA 3GTQK 2X6SA 3E1YA 4HVJA 3D2FB 4IEEA 4X65K 4AHVA 3GDQA 3GTPK 3CPEA 2OZMA 1DLOA 4CF1A 4DCHA 2E2PA 4N56A 1TK5A 4CGIA 5BR9A 5IOQA 1EX4A 1VQLN 2JH3A 1NKEA 1IBMK 1KQ4A 3THXA 3L6QA 4C3IK 2G8KA 4M63C 1U2VB 4M3YA 4BRMA 1XMOK 2I5JA 4A3MK 4CBUA 3IUCA 3SV3A 3JAMO 4F8RA 2V52B 3AO2A 3HSCA 2O8BB 2ASPA 1O13A 4WFAL 4CZFA 3S15K 1BQMA 3U8XA 2G8WA 2QEXN 3O5BA 2PYLA 4KN4A 3K59A 3GEHA 1YJ9N 2E5LK 4G0UA 4CHNA 3MCPA 1C6VA 1HLUA 2A6HA 5GINA 3OS2A 1IJJA 3K5LA 3M8RA 2O8DA 4GVEA 3VA7A 4BXXK 2RF2A 3ENOA 3VF6A 4E7KA 2KFNA 3QMLA 1TYQA 3H3NO 2P9KB 3OS1A 4CJUA 1T8EA 3BZCA 1BL3A 3V9WA 1C0TA 4JRPA 2E2NA 2VYPA 1SZ2A 5JLFA 3I4NK 3N3YA 3AA5X 4IOCL 1RDWX 1REVA 3HOUK 3KWGA 4DV7K 2E4LA 1GLJO 1NKBA 1EFWA 4A61A 3LP1A 3U9ZA 1VQON 4FJMA 4KATA 1I3QC 3ZEUA 4WE1A 3DYAA 4XLNA 2NRHA 4KHYA 1HJRA 4KTZA 1J5EK 2JA7A 1S22A 3TU5A 3FZMA 1U2VA 4C8OA 4KBOA 1DKGD 2UU9K 3RZOK 3NH1A 5FPNA 1NK8A 4FXDA 1TUUA 1SKSA 4A3GC 3NGYA 4FO0A 4BBSC 4O0IA 4DQSA 1SAZA 3EN9A 3NVKA 1R0AA 5I42A 2QWNA 2YNFA 4FWPA 4IEIA 1WOPA 4PY5A 4CGHA 5BPLA 4C3HK 3VQ9A 5LJWA 3LDQA 4BQLA 4E3SA 3K2PA 1KAYA 3C94A 3GTJA 4JD2A 3R3LA 5C4XC 4Y1DA 5IP9K 3CCLN 1NJWA 4BRIA 2B63K 3F9MA 3IG1A 4XH1A 3VQDA 4CF2A 5KPZA 2O8FB 1N32K 3W3DA 3SQ0A 3OBWA 4YNQA 4MLHA 3DRRA 4DTSA 2Q36A 3QIPA 4HTUA 3CHWA 3BP3A 3RRHA 3GTQC 4C8MA 1KLNA 4KHNA 3TAGA 3THWB 3SJHA 3IFRA 4DR5K 3AD8C 3HM8A 4JS5A 4RG8A 4I9QA 4JKGA 1YTAA 1TVRA 3BEXA 1LW2A 1YNJA 4LFBK 1ZBSA 3CJAA 2Y1IA 3ADAC 4WJ4A 1RFQA 4DWIA 3S16K 3NHGA 4HCCA 2PY5A 3OYEA 4CZKA 4KM9A 5M3MK 4B9VA 4B08A 4ILJA 1I50K 2GELA 3WODA 3MN9A 2O8CB 1VQPN 4B1XB 1NOYA 2HBMA 2NRWA 4NLCA 2R93A 3ZX2A 2NVYC 4KC6A 4PAAA 2NVTC 3VQCA 2A6EA 3PIPL 1OVYA 3ZSVA 2GWJA 1OKJA 1Y1VC 1SL0A 3A5OC 1TKZA 5JICA 3KLHA 3S2HK 3HYFA 1J54A 4N5SA 1WCMA 4O8UA 3AO3A 5C44K 1C1BA 3S3OA 1R59O 3CJ1A 1RDUA 3EYZA 4CJKA 2IVNA 1U4BA 2Z1GA 5C25A 1WSGA 4WQ4C 3GTPA 4MO5A 3H46O 4DFKA 4PL7A 4EP5A 4DTPA 4LFCK 2E2IK 2Z1HA 3W0LA 1BWFO 2YX6A 1W7AA 2HHUA 2JA5K 4OKJA 3DLHA 2E2IC 1EETA 1RT2A 1HNVA 4K42A 4CESA 2E2JK 1C0AA 4IOXA 3OYAA 2BGGA 5CHPA 1BU6O 3I0SA 4BWJA 1TWCA 3DI6A 1EQRA 1C0GA 2NVXC 2IVOA 1QTMA 4ISGA 3GTOC 2KHOA 3NF6A 4WF9L 1FK9A 3QO9A 3WQUA 4BLBA 4A2AA 4A3CK 2R93C 4GVMA 3VERA 1F93A 5DM6L 2V51B 1Z05A 5LMUK 3HK2A 3SZ2A 4H5TA 4QJVA 2RHKA 4DFJA 4FZZA 1RBUA 3SZYA 1JOEA 1BDGA 4A3EC 4H5NA 4WFNL 2QK9A 3EE9A 5AQMA 3S1NC 1KAXA 2BTFA 1WSIA 4H0XB 4H5RA 3QEXA 2GUIA 4DTNA 4JI7K 4CFBA 3V1OA 1NNEA 1BOTO 2WBNA 5KRTA 1D9FA 4JK1A 3CQZK 3CETA 1N8RO 3EEQA 3TSPA 1QZ6A 3HPGA 1IKVA 3L3VA 2F9WA 2GEMA 4FWMA 2OA8A 4CGFA 4M3TA 1HKBA 4IWVA 5AQKA 2HNZA 3SCXA 4JKEA 5KGXA 4DSIA 3C0BA 4GTEA 2YKMA 2FBXA 4O2DA 3AVKA 3ZX0A 1IG9A 5L46A 1UA1A 1GLAG 4ISFA 3DLRA 2PHCB 1JLBA 4YOWA 1ZBFA 3AVHA 1BDFA 4IFYA 1O2BA 2A3ZA 3ID6A 1ESVA 2F9TA 4FJIA 3KJVA 1KVCA 5M1FA 4MEYA 2QKKA 1LWEA 3THWA 1U04A 4FWOA 2B63C 3HOYC 3A2FA 1O1WA 4C2MK 1O29A 4J2EA 4KM8A 4Y52K 1T6CA 3RZDK 2D6FC 4EZ9A 1BJTA 2OZSA 3T02A 1GE9A 2OPQA 4YDUC 3H0GC 3FZHA 5EGEA 4AHRA 1NGBA 4JI5K 2D5RA 2P1JA 1JLCA 1NG9A 4V19S 1S1WA 2Y1JA 4NOIA 5GIPA 3RWUA 4OO1J 1BUPA 4P5BA 3D2FA 4DHYA 1JQWA 3V81A 5A2QO 4GV6A 3OYBA 2ITGA 4NXMK 4CFCA 4CZLA 2HSTA 5F2RA 5BREA 2KLAA 3GTLC 1W97L 4CF0A 1FXXA 1B4AA 1KC8O 3F5TA 4BKWA 3OREA 2D0AA 3D7EO 3MK6A 4ELUA 3IRXA 3HOXC 3TWHA 4CFDA 4FK2A 4C3JC 5HL7L 1RT6A 4DU1A 1WBDA 3ULDA 2XY8A 3O9SA 4HUFA 3ALYA 1WQFA 1SFOC 5AQJA 1I50C 2H3GX 5C3EC 3FHZA 5CY4A 3LAKA 2PYJA 1U45A 4PL8A 4F2SA 2NVYK 1XNQK 4A3IK 4JKGB 5DM7L 5FRNA 4J3NA 4BBRC 4HUGA 5GAEP 1I3QK 1EI6A 2RGRA 1YAGA 3FKIK 4BR5A 3M3YC 4K8XA 3SJJA 4FW1A 1XQSC 5JS2A 4PQUA 3WNFA 1SFOK 4FWQA 5K14A 4WYBA 4DS5A 4QJVB 4NYFA 5CR4A 4CHZA 4FL9A 4I7FA 4CHPA 2OPPA 2VG7A 4JHDA 4LF5K 3B8AX 4JK7A 4GV9A 2CW0A 4DUYK 3D6RA 4E7LA 2XY6A 5J2MA 1O26A 4DV2K 1NGDA 3K9JA 4C8LA 3DJCA 3NBPA 4GTDA 4BE0A 3TAPA 4FJ8A 4PKIA 3L2RA 2PZSA 3S1MK 4FLZA 4DLEA 2WAQD 1MA9B 4BRAA 3AGKA 4E0DA 3S9HA 3LALA 1ZYRA 1ASWA 4IG0A 4I2PA 4BRQA 4L3QA 3SQ4A 3VN5A 1GLFO 3MXMA 3ZETA 2E6MA 5FPDA 4RW7A 4X64K 1TWAC 2NNWA 1FKPA 3CC7N 3O6WA 3WEEB 2OANA 3TAFA 2NRZA 4H0YB 2R7ZA 3I56N 1BO5O 5C42A 2A5XA 3A8KA 1NM1A 1VSDA 1SMYA 1SFOA 3G4CA 2OCEA 3ZSQA 3GTGA 4YOYA 3TFJA 3C7NB 3IAYA 3ID8A 5J2QA 2B6AA 4XLPA 1W9HA 3O4QA 4MFBA 3GTMC 3SK3A 4DSFA 5JFEA 4K8ZA 5SWMA 5M1KA 3BZKA 1LV5A 4LOWA 1Z6RA 4B9UA 1TWGA 1W0HA 1F9NA 3ERED 3QETA 1TKTA 4KH6A 4OIRA 4K41A 3VQAA 1T05A 3CCVN 1FJGK 4G1QA 1EH1A 1Q18A 2JA6C 1B4BA 1RNHA 3HM9A 4DFMA 2XY5A 1VSJA 4Z4CA 4JV5K 2WOMA 1VRTA 4Z94A 1Y1VK 3RMAA 5HRSA 4A3IC 2KZMA 1WORA 1VQ7N 4EIAA 5KQ8A 3TAEA 3F2KA 3L4KA 2WFBA 5AQFA 5C44C 3HVTA 4DTJA 4DSLA 4EFHA 3SPYA 2IOCA 3L4IA 5BN9A 4DR4K 4AILC 3L0QA 3T01A 4O8KA 1O24A 2VUMA 4A3CC 2R93K 2JA6A 1MWKA 3QBWA 4ID1A 3EY1A 3OVNA 3H0GK 3J80O 4P5AA 1WOQA 1HUXA 5ELZA 1QQNA 1WLJA 4WILA 5TKYA 1RBTA 3I4MC 4OGCA 1WB9A 4GT9A 4F9OA 3S17C 3OTOK 1RILA 1G15A 5MLCQ 1S1VA 3DMJA 3QB0A 2CGJA 3L2QA 4B9QA 3S0XA 1RTIA 4CHQA 2DFEA 1NGCA 2XHBA 3M8SA 2UXCK 2YHXA 1BGWA 4AM6A 4A3GK 4ILHA 4KAZA 3UB5A 3ULEB 3HZ6A 3CJ9A 3GEIA 4KHUA 4BC5A 4WJ3M 4E1MA 3VF2A 3THVA 1TL3A 1A5VA 3FZKA 4WCEL 1D4XA 3CQXA 1XI1A 1WSFA 1MWMA 4OINA 4J8FA 4MDAA 5AQYA 4W5TA 1ZBIA 5AQOA 3KD5E 3S17K 3ATVA 4RW8A 1WAJA 1S3XA 5KQDA 4AH6A 2XO7A 2O4GA 4E7IA 4FJHA 4BY1K 3KLGA 4DDQA 4RW9A 1I50A 4JEPA 4CHYA 1VQ5N 4B9TA 4DV0K 5BPNA 4A5BA 2IDOA 3ULEA 5E41A 2VG6A 2X74A 2G8IA 1TGOA 4IO8A 1IKWA 2BANA 3AVJA 3V9XA 1Y1WC 1DD5A 2QWLA 4NCBA 1X9SA 4MDBA 3ZT4A 5CE3A 4N76A 1JCGA 1CLQA 2F8TA 3NDKA 4HUEA 1IBAA 2ASOA 1NGAA 3SAHA 4JN4A 2P9UB 2HHSA 3QNOA 3RRGA 3QNNA 4FLUA 4OLAA 4FOEA 3CG7A 2QWRA 5AZJB 3PLAA 2O8EA 1U48A 3MEEA 3NH2A 1XUPO 5KPTA 3HO1A 4LK1A 3SAGA 4O4GA 1CXQA 1USMA 4XH5A 3KWIA 4ID5A 3VMFB 4BQZA 1Y1WK 1L3TA 4FPAA 3QDKA 3ZSWA 3CD6N 2UYTA 3UKUB 1ZVUA 3GTKA 5C0YA 4L8RB 1N6QA 3GTJK 4X6AC 4CVNE 1C1CA 3E9LA 4F2RA 4RW4A 4CERA 2OPSA 1QHAA 5LY3A 5IYDK 5JVHL 4LC9B 1VSKA 1YNNA 1SV5A 3LPXA 3GTJC 3NGIA 2GX9A 4DF4A 2Q0UA 2JA8K 2E88A 2D0CA 4CGGA 2IVPA 4P9SA 3V4IA 5LJVA 3P1GA 3A8IA 4GW6A 3P38A 2FSNA 4BE2A 3BUEA 1KRPA 4BR2A 3CCQN 5C24A 3E01A 3D2EA 4DF8A 2E1ZA 2FQOA 3GTKK 2WONA 4OIPA 1V4TA 4NLBA 5AQLA 5BRDA 3OYFA 4BC4A 1NU0A 4DV5K 3GDZA 3SBTA 3OY9A 1RT7A 4JKBA 4BBSK 4OPHA 4FJ5A 1T3VA 1J53A 3T1YK 4JKFA 3QEPA 5C4JC 3H1QA 4BLAA 3I33A 5M1OA 4LK0A 4BR7A 3TFHA 2DY4A 4CJWA 1I94K 3LDOA 1GLBG 1RCHA 3C7NA 4JS4A 1TAQA 1KSPA 1BCOA 3QFPA 1GLLO 2PPBA 4NB4A 2DFHA 4A3MC 3QEVA 1YVNA 1QSYA 5KGWA 4JI6K 1BISA 3ZSOA 2Z1JA 3QINA 1TK0A 3ATUA 4YY3K 1SUQA 1WSJA 2VWKA 4Z4HA 3CC4N 2VQFK 2V7YA 1XXBA 3U3YA 1CZ9A 1KFDA 1RT4A 4CJPA 1XC3A 1S9EA 3TABA 2UUCK 2JGUA 2P9NB 4CK1A 1HNWK 2NVYA 1V5VA 1LAWA 1TWGC 3LAJA 3AVLA 3O3HA 4F4KA 4IDKA 2RPIA 4CK3A 3OYLA 1LW0A 4BVPA 1IS1A 2JLEA 4CIFA 3HTVA 1DTQA 4DSJA 2A40A 3M3ZA 1ZBLA 4H0TB 3C95A 4IXCA 4JD2B 5J2PA 2QA4N 3S1RC 2GV9A 4QAGA 1ZYQA 1WNSA 2Q2RA 3PV8A 4FVMA 3OA9A 2O5JA 1M90O 1ISEA 4KDDA 4KHSA 3S2DC 1JLQA 4I6MB 4CBXA 4LQYA 4MEXA 5CZ2A 1K9MO 2B4JA 2ETJA 4KARA 4QCLA 5IT9O 2VUMC 3VOVA 3JSMA 1IE0A 3T1AA 4BDYA 4TSXA 2P9LA 1BG3A 3AH5A 4B1UB 1VSFA 3NF8A 4CZEA 4A2BA 4FM0A 4KHPK 1R9TC 1OH6A 1ILYA 3CQZC 4QS8A 1K6YA 3DAWA 4MQ9A 2PBDA 3N4QA 5GIOA 3QICA 4LF6K 4HWIA 2OTJN 3LDLA 4JI2K 3M8QA 2NVXA 4YOXA 4WQ5A 4XEIA 3DM2A 5DMRA 1TUYA 3KZBA 5JS1A 1NJIO 1RBRA 5GAGP 4FYDA 4CJQA 3AVNA 5EXWA 4DG1A 1VRQC 1NWKA 2P8TA 4LF7K 3SPZA 3J7ZO 3VEVA 5HBMA 3Q7BA 1YIJN 2KZZA 3LANA 1M1KO 1R9TK 3SMPA 3T69A 3S1RK 3I4NC 3AY9A 4FJ7A 1YJNN 3RTVA 3LPUA 2HHXA 3VA0A 3NGZA 5E84A 3RSEB 3WQTA 4IFVA 3NVMA 4Y52C 2I7NA 2I7PA 2HHWA 2ATQA 1EO1A 1VQNN 2W7VA 1KVAA 2VQEK 4CJ5A 1JXBA 2G8FA 4QS7A 4CW7B 1RDCA 4A3DC 1XHXA 4YOVA 3GG4A 1S5JA 3AV9A 3BF3A 5C2DA 4A62A 3AQPA 4CEDA 4AQYK 2Y0SL 1TWHA 4A57A 4JKDA 3CAGA 4CHOA 2P9IA 1MU2A 3RMDA 3LAPA 4BR4A 1JLFA 1ASUA 4CEAA 3JXUA 1S1XA 3NE6A 2ZGZA 1GLDG 3KK2A 3HSTB 3OYCA 2OPRA 3N4PA 3CCRN 4CJSA 5J2NA 4FZYA 3PO2C 4OKEA 4B1YB 1YX2A 4M7XA 3D2EB 4ILGB 1RBVA 4YDUA 3MN6A 3HKZL 3TPQA 4DQ8A 4YOUA 1ATSA 3JYTA 1BS2A 5IYBK 4H4MA 4OLBA 4C2MC 2NVQK 3CCSN 1KLMA 3A8YA 1TWHC 4M3UA 2YI1A 3SZZA 3FZFA 1T03A 1JKHA 1TWAK 1VSMA 4YG2A 4NCAA 4ZH4A 3MEGA 3EQLA 1DGKN 4CJ4A 4LR2A 3BUZB 3FFKB 2HMIA 4A3DK 3P4IA 3MN7A 4Q0BA 4DTOA 1INNA 3GTOK 1RU0A 1ATNA 5HOOA 2A68A 5FPEA 4DLGA 4CZIA 3PX4A 1TWFK 3HI0A 4BGBA 4DR7K 3RSEA 4FLWA 5GAHP 3GTMK 1JVIA 4A3KK 4M42A 1TWCC 4FLTA 2ZJQL 1KFSA 1XPPA 5SZTA 1EP4A 2QKBA 3J7AP 5C3EK 4Q4ZA 3TTGA 4DR1K 2CH6A 3G4AA 2D0OA 3HP6A 3DWLA 4B9SA 4K43A 2O8CA 2A6AA 2E1YA 4DQPA 2IS3A 3GTLK 1KD1O 3FOFA 5AQXA 1H1VA 1J6VA 4C23A 4KREA 4NO7A 3BDPA 3L2WA 4BG8A 4BG9A 5M5WK 1DCHA 2QI2A 1L3VA 1XMQK 4KTQA 4YFNA 4FOIA 4LY7A 3H45C 4KFBA 2FSKA 3MXIA 1S6QA 2F96A 3C6TA 3HOWK 1XWLA 4ISEA 5EVZA 3M4OC 2GSUA 4JI8K 1YF5L 3C6AA 1X31C 3PY8A 3MX2A 2IC3A 1HNIA 2E2JC 1HQMA 3NFAA 5M5YK 4R79A 4CFAA 2IIRA 4DQIA 3DXMB 4RMFA 1VAZA 4CBWA 4CF9A 4JKAA 3S16C 4AHCA 1OVQA 2HNYA 3HVRA 4ZHRA 4FCYA 4X62K 4X6AK 3AVFA 3V6DA 1A5XA 4LF4K 2JWKA 3CIPA 3TSUA 3FZLA 4C3JK 3FLCO 4N47A 3VGKA 4CEZA 4ICLA 1YTUA 3PO5A 3ZT1A 1B92A 3KHYA 4OKKA 1E3MA 5IYBC 2VG5A 4CJFA 4BXXC 2W42A 1N5YA 4CF8A 1USOA 5D3GA 2Q31A 1BGXT 4PUOA 2E2HA 1WCMK 3G10A 2UUAK 1J6WA 4DTRA 4W5OA 2W6KA 4RTFD 3FOEA 4E7HA 5C12A 4IO9L 3AVBA 1BHLA 5JMVA 4EZ6A 3R9PA 3ZT2A 3DXKA 3U9DA 3KVGA 3M4OK 3VESA 2P9PB 1BCMA 1IBLK 4DMNA 4BY7K 5AQRA 1HYSA 4YFXA 1RTDA 3PO3C 3CYMA 4DUZK 4FM2A 1HRHA 4DU4A 4FVUA 4B9NA 4LF8K 4A3FK 1ZXOA 2P9KA 4JI3K 1EWQA 3E66A 3P5JA 2RN2A 3LWMA 1WCMC 3T00A 1WQGA 3PUFA 1SQKA 3LZJA 3G0ZA 3GTMA 3M8PA 1L0WA 1Z25A 3F9KA 5FPMA 5JVOA 3I8DA 2ZUEA 3R1XA 1W2BM 3HOVK 1VHXA 1TYQB 1YCLA 4M7YA 3H3OB 3AVMA 1E4GT 5M1QA 1JL2A 4WQ4A 4CD3A 1S1TA 1K8AO 2F4VK 1D5AA 4EHTA 3HXAA 4A3BK 3MCAB 3HOUC 4GKJK 2J4RA 2CGLA 4DB3A 1HPMA 2RH6A 1TKXA 4AYBD 1KTQA 5HRPA 4XIUA 1UAXA 4IG3A 5BRFA 2FBTA 3UKRA 4GZYA 3PIOL 3ZX3A 5F1XA 2WTUA 3MECA 2D0BA 2AP1A 2KWAA 3M1FA 4M45A 2O8BA 2E8AA 2ZFZA 4KB0A 2QW9A 3SUQA 3O4WA 4ILDA 1YI2N 4CEQA 4IFEA 3VGMA 5KTQA 1PJ6A 3L4JA 3CQYA 4E7JA 4W5RA 5CJ9A 3J7YP 3WXMB 3FGUA 2F7TA 4CZGA 4OVLA 3HJFA 2B5JA 5CHIA 3HP9A 3AGRA 1VSEA 3D45A 1NK5A 4B1VA 3P39A 4MQ3A 3DOLA 2HVHA 3CJCA 4GV3A 1KVBA 5C10A 1YITN 1BI4B 3UIQA 2QXFA 2NRRA 1NLVA 4LSNA 3O08A 3K7AC 3ZSZA 3NAEA 1LCUA 4BREA 4LFAK 4XSZA 5AR0A 1GLEG 4KO0A 4KB4A 2O4IA 4AM7A 1K73O 2R92K 2A41A 3L8BA 4JI4K 1C0FA 1JCFA 4ELVA 3CC2N 2BE5A 4BRLA 2VUMK 1HPZA 5EY4A 5FJ8K 1EWRA 2YHBA 5IOSA 1EXQA 1AB4A 1BIUA 5TMFA 3KLEA 4H0VB 2NVQC 3TANA 3VETA 4HHTA 2W41A 3R6MA 5IOTA 4PKGA 1N34K 4A93C 2E2HK 4GNIA 3KLIA 3V4GA 4DQQA 1Y1WA 2NUBA 3V1RA 5C4XK 2YHAA 4ELTA 2R92A 3TTCA 2KQ2A 2D1KA 4UY8O 3KTQA 4BRGA 3OYGA 4YORA 3BP8A 1TK8A 3CFRA 2ZM6K 2P5MA 4A3EK 1IKXA 3TAMA 3MDQA 4CJTA 1Q7YO 3NH0A 2NRXA 1GOBA 4BRCA 4H0PA 2P9NA 2ZQBA 1FKOA 3IS9A 2CFAB 1U6ZA 4JKHA 3RVCA 4AF1A 2EBBA 1VQ8N 2NLXA 1HYZA 3ZEUB 1J5OA 2FC0A 3AVAA 3KKRA 4IKFA 4BY7C 4Z4GA 1X3MA 1SL2A 1CZBA 1BA0A 2RE2A 3BGRA 3THYB 2EX3A 5AZIA 1K8KB 5AQNA 3S3MA 4OPJA 3ZSXA 1PJ5A 4CJLA 1WOSA 3O9QA 2G8UA 4JI1K 1BIZA 1XHZA 5TJ3A 1TWCK 3RR8A 2GAGC 2JA6K 4ZTFA 1QQCA 1VSHA 3HKZD 2O8EB 2KTQA 3JS6A 4DSKA 4MO4A 4E89A 2BDPA 4AHUA 3D0PA 4BGAA 1TWFC 4Y7NK 4B9MA 4H4OA 1YHQN 1P90A 1NJZA 1S1UA 2E2QA 3HOZC 4Y0WA 4HCBA 1WN7A 3OJUA 3A0IX 4JI0K 4W5NA 3THYA 2ITMA 3H3VD 3RZOC 2D4WA 1SS6A 4BRNA 4F3TA 3KLFA 2NVTK 1TWHK 4CIEA 1Q81O 3KK7A 3R8EA 2Y0SD 5M3FK 4CK2A 5BPMA 4JAXA 1J9AA 2GUPA 2F8SA 1B9DA 2CFAA 5TKWA 3ZLJA 3I4MK 3CM5A 1GLCG 3EKSA 1NMDA 4A5AA 2FSJA 2W40A 2YJEA 4I2QA 4B3MK 3GEEA 3ZSRA 2JA7K 3DXJA 2YU9K 3L2VA 3PX0A 4JYAK 4A93K 2ZE2A 4DTUA 4B9LA 4BVOA 2ZJPL 4QIWL 1XXAA 3O1WA 2GAHC 3SBGA 2P9UA 4KHWA 2NRVA 1QQMA 5IP7K 1E4FT 4FLVA 2Q1NA 4Y1CA 1EK8A 4GY2B 4O5FA 1QVGM 1XZQB 1A5WA 3KD1E 1WBBA 5C4JK 4AHTA 3IDHA 5F0XA 1ASVA 1YVUA 1NK4A 4FJKA 1TWAA 1C0UA 2A1RA 3H08A 3VF4A 4IZ9A 3CCUN 4A3FC 3HOZK 5HL8A 5DK5A 3GTKC 3WT0A 1NJYA 5AQVA 4FSVA 2D0PA 3FR0A 1WSVA 1JL1A 2HOEA 2ZGYA 1L3UA 1ITGA 3VQ6A 1WUAA 3ZSYA 1HYVA 4QS9A 4RWTA 3O3FA 3OS0A 3THXB 2KKZA 2E6LA 5BR8K 4IJNA 3C65A 3OYKA 1RDBA 5AQHA 3S1NK 1NK6A 1NJXA 2YNIA 1UA0A 1RTHA 5CYQA 5M1PA 5ADXA 3AD7C 3DRSA 5JLHA 3VQ4A 3V9SA 3CJ7A 2DTUA 4MLEA 4FM1A 3QEIA 3GTGK 3LM2A 3S41A 3UE5A 4I6MA 1LWCA 3A8JA 3O9TA 1K83K 3S14C 4GMJB 4R5PA 2QWQA 3WXJA 1J6ZA 3GTGC 2PMZD 4KTWA 3SNNA 4B3OA 4J2BA 3N0BA 1RT1A 3AAPA 3S2DK 3ZCMA 3FFIA 4DKWA 4CJEA 5H1SQ 4E1JA 1F7VA 1HJOA 4QOZB 1C1AA 2HF3A 1I6HC 4KMUA 4NXNK 3AO1A 5KPRA 3S1MC 3AD9C 5AQIA 3WUHA 3OEPA 3U3GA 2P5OA 2HHTA 4G7OA 1DCOA 3MEDA 1S9GA 4FWNA 4B3RK 4BRHA 5LMNK 4G0VA 2Q97A 4LF9K 2O5IA 3GOIA 3K5MA 1HNZK 3LPTA 5D4DA 2NRTA 3CMAN 4BRFA 2Y3PA 4C45A 1RDDA 3T1HK 1C0MA 3VEOA 3CQ8A 2R92C 1D9DA 3WXKA 1NGFA 1NGJA 1WSEA 4XCHA 1IV0A 1DEJA 5AQGA 3S3NA 1YXQA 2OTLN 4Y7NC 4M41A 4CJ7A 4KI6A 2DPNA 4CEBA 4BACA 2HW3A 4M3RA 3QX3A 4FM9A 2O8DB 4Z4FA 1P8ZA 1WOOA 4YFKA 5JVGL 3OHRA 3AA2A 4Q5SA 4DR2K 3NMUA 5CZ1A 3O8MA 1GOCA 1NGIA 2YU9C 4FK0A 2QTDA 2P51A 1RDAA 4DV3K 1IH7A 2UXDK 5I3UA 3ENBA 4PKHA 3SV4A 1XZPA 4FWLA 2RKIA 4ZTJA 2HBKA 3PX6A 3SQ1A 1ATRA 4BDZA 4K0KK 3DXKB 4FWKA 1NK9A 4CGJA 1VRUA 1RBSA 3HOWC 3TAQA 3QERA 3Q7CA 3UKRB 1T6DA 5J1EA 3L2UA 2PA8L 1VK0A 1D8YA 4B1ZA 3K5NA 1IG8A 3U6FA 4KMHA 4E1NA 3T3FA 2WUSA 1IO2A 2YKNA 3SQ2A 2XY7A 1LAVA 4FPBA 2PAVA 3WEEA 4IDHA 4PABA 3ZETB 2YHYA 3FKIA 1O25A 4LJZA 2Z1IA 2ZJRL 3M3YK 1HQEA 3CQZA 2P5GA 1HR0K 3QFUA 2A1SA 2NVXK 3B6PA 1ZBUA 5AQTA 4AH9A 1DT9A 2ZF5O 5AQUA 3MAQA 4U7BA 4A59A 4CIGA 3F73A 3OYMA 4JHDB 3KK1A 3VQ7A 1S6PA 4CI6A 3DLKA 1L3SA 1RGIA 2VWJA 2V6UA 1HNXK 4DV4K 3TI0A 4H5VA 4JK9A 1N33K 3AA3A 1IBKK 2VGNA 5AFUA 2ZWHA 3V9UA 4FZBA 3H6EA 1QSSA 1O2AA 3CM6A 3J8AA 4GTFA 3VEYA 4I9LA 2Q0RA 2YHWA 5HRNA 3WXLA 1VJEA 2V6SA 2KW4A 3VEWA 3MX5A 3S2HC 1YUWA 3NF9A 3CCJN 4C1NK 3K58A 1L5UA 2YU9A 4G7ZA 3DLBA 3EL2A 1YT3A 3KK3A 4M3XA 2AJQA 5AQPA 2YJFA 1IL2A 2E20A 3VEZA 4OIQA 4JNEA 4NYNA 5C15A 4Q5VA 5HLFA 5B8HA 4Z4EA 3S15C 4B8CA 4CJ3A 1I39A 3SUNA 2DFFA 1VLOA 2V7ZA 2HNDA 3MXJA 4FWSA 1ZC6A 4OJRA 1KQSM 4CCHA 2AA4A 4HTLA 4BC3A 3TSQA 4AHSA 4DU3A 1NKCA 2GSOA 4H5WA 2EHGA 4KB2A 3IMXA 1G99A 1NGEA 4FK4A 1J6XA 4RW6A 1JCEA 2VWBA 2HF4A 1T44A 2CH5A 4FJ9A 3G71N 3OPFA 3OYIA 5E68A 1TL1A 2W6LA 5IP9C 4B1WB 1WSHA 2FLOA 5C2FA 3CJBA 3OYDA 3QEWA 4BBRK 2XCOA 2UXBK 4CGDA 3WNGA 4CEOA 2A42A 3G4SN 3VQBA 4GTCA 2ASMA 3K9KA 3LP2A 1OH5A 1RTJA 4DR6K 1KAZA 3BP8C 3SUOA 3K57A 3ASMA 4W5QA 1OH7A 1F7UA 2HBJA 5IWAK 1IQ0A 3ITHA 3CXCM 4KAWX 3SAFA 4B3TK 4WFBL 4FJXA 4KI4A 3GIRA 5AJ3K 4GKKK 3K0SA 4GFQA 1X9MA 2R7ZC 3IKMA 3M5RA 3U4LA 3CF5L 3I0RA 5M5XK 1QVFM 1TKDA 3P31A 3SUPA 4G0WA 3A5NC 3MWTA 4A3LK 5ADXH 4DV6K 4OX9K 2FF6A 3A5LC 1I3AA 4OPAA 1QZ5A 1HQUA 4KASA 1HKGA 3PSIA 2X6NA 4G7HA 3LP0A 4KPYA 3QBXA 5HP1A 4EP4A 2BE2A 2HVIA 5FLMC 1DTTA 1RT3A 4YOTA 3AVGA 1X1PA 1VQ9N 1JLGA 1TAUA 2WAQL 4AYBL 1XXCA 4LH5A 4B8AB 3HOTA 3VENA 4F3OA 3EZ5A 3EKUA 3HOYK 5AQZA 4RCHA 3VPZA 3LL3A 5IYDC 2YNGA 3QIOA 4A3KC 3I55N 1NGHA 4C8NA 4LSLA 3UKUA 4CZMA 1Q86O 1N36K 2HHVA 1IW7A 2FBVA 3HPHA 3TR8A 4BC2A 3E9PA 4KV8A 4NCGA 5FDLA 2QWOA 4DR3K 1NBWA 3LWLA 3CCEN 1NOZA 1JLAA 1Y97A 3IPJA 3DLGA 5AZJA 5HRRA 3VQEA 3OJSA 1X9WA 1FW6A 1S72N 1Z26A 1QS4A 3NCIA 2E2OA 1CXUA 3B6OA 1NGGA 3PO3K 1KCFA 2UUBK 3VTHA 1TV6A 3V1QA 5AQWA 1NK7A 2FF3B 2P9IB 3C6UA 3CMEN 5FRMA 2E2IA 4EAHD 4KMAA 3CFPA 1MDUB 2ZD1A 3SLCA 3CPWM 1SL1A 3RMBA 2P9PA 1HI9A 3PO4A 1HKCA 4CJRA 4XSXA 2QM1A 4FLYA 5HROA 3CCMN 3FE1A 2E2HC 3VGLA 5LL6Z 4PHTX 3OYJA 4M3WA 3VTIA 3ZT0A 1XZPB 4LH4A 1EQYA 1SKWA 3M6GA 3DRPA 4BR9A 2LSNA 1QE1A 1UV7A 4OPKA 3V9ZA 4JLHA 2PA8D 2YNHA 4LD0A 1VGXA 2PFUA 4KN7A 5FLXO 5M1NA 1XC9A 3N0CA 3O4NA 4H8KA 3VQPA 1F21A 4B3SK 3O9UA 3NUHA 1T7PA 1QHTA 1BQNA 4DSEA 4DTMA 1GOAA 1PJ7A 1VH2A 2JA7C 2QWPA 1UWBA 4KRFA 3K5OA 1Q9XA 2Q3SA 2R7ZK 4CD1A 4FJGA 4G9ZA 3G25A 5EGHA 2CGKA 5EU7A 3EO3A 2P9SA 2XCQA 3O9RA 3TTDA 4BRDA 3CI5A 1G51A 1EKEA 3LAMA 4N41A 1JJ2M 3GL1A 5T7BA 3Q3QA 4DTXA 2HHQA 3HBTA 3OW2M 1QQOA 3C6HA 4IJAA 4A3JC 5CYMA 4LLGA 4FJNA 1BI4A 1HX1A 1UOCA 2IGIA 2B63A 3HT3A 3PSFA 2O8FA 3GSIA 5BN8A 2GWKA 4FW2A 2NZTA 1Q8IA 3EZWA 3TARA 4CE9A 2YCHA 5AFUH 1XZQA 3AARA 4A3BC 2HB5A 2FQTA 3BY5A 3HL8A 1J98A 3H3VL 2EWSA 4O0JA 3ZYYX 4DFPA 3HOSA 1TWFA 1VSLA 2G8VA 5E26A 3H0GA 4OGEA 2VCPA 1NMNA 2JA8C 3EE8A 3HOVC 1I6HK 3VQQA 2XCRB 3OYNA 1VQ4N 1QSLA 4BWMA 3SYZA 3GTLA 4KKOA 1Q9YA 3QESA 4UQGA 3RR7A 5AQQA 2JWLA 4GTBA 2FBYA 3LDPA
chains in the Genus database with same CATH topology
4IJNA 3FZHA 3C65A 3AAQA 4A57A 4JKDA 1NGBA 5EGEA 5AQHA 3DLLL 3CAGA 2P9IA 4M1XA 1GE9A 1Q82O 3LAPA 3MWPA 3GE1A 4BR4A 5GIPA 4OO1J 5M1PA 5ADXA 4BRKA 4BRPA 1BUPA 4P5BA 3D2FA 4DHYA 5JLHA 3JXUA 3CJ7A 4GV6A 4MLEA 2ZGZA 3MMLB 1GLDG 3O1BA 2BUPA 1V4SA 2VGMA 3L4QA 4CZLA 3LM2A 3S41A 3UE5A 4I6MA 2HSTA 5F2RA 5BREA 2KLAA 1O27A 1W97L 3N4PA 3O9TA 3CCRN 1KC8O 1B4AA 3F5TA 4BKWA 3OREA 2QWQA 3MK6A 3D7EO 4B1YB 3WXJA 1J6ZA 4M7XA 4C3JC 1VQKN 5HL7L 3D2EB 4ILGB 3SMSA 3O9SA 2FXUA 3T7ZA 4YDUA 3MN6A 1WQFA 2BH1A 5AQJA 3TPQA 4DQ8A 3AAPA 4YOUA 3N0BA 1ATSA 4DKWA 2H3GX 4C2MC 5H1SQ 3CCSN 3FHZA 2GSNA 4E1JA 1VQMN 1LOTB 3A8YA 2HBLA 1HJOA 4PL8A 3LM9A 2HF3A 2YI1A 3FZFA 1CZAN 5AZIB 5KPRA 4FWRA 4XH4A 5AQIA 3WUHA 4C1NI 4JKGB 3OEPA 5DM7L 1X3NA 4J3NA 5GAEP 1DGKN 5EX5A 4LR2A 3BUZB 3FFKB 2RGRA 1K83A 1YAGA 3A5MC 3P4IA 3MN7A 4FWNA 4KH5A 4BRHA 5I9EB 4G0VA 2Q97A 4BR5A 5GADP 3GOIA 3E9OA 1ATNA 5HOOA 1O28A 2NRTA 1XQSC 2QWMA 5FPEA 3CMAN 4CZIA 4BRFA 2Y3PA 3HI0A 4BGBA 3GTOA 5AQSA 3RSEA 2P9LB 2WC9A 4FWQA 4WYBA 3VEOA 5GAHP 1R9TA 2P9SB 5CR4A 3WXKA 1NGFA 1NGJA 4C3HC 1DEJA 3OBYA 1KXPA 4FL9A 5AQGA 2GTDA 4JHDA 4EHUA 3B8AX 1YXQA 3LDNA 4JK7A 2OTLN 4BY9C 2ZJQL 4GV9A 3ENHA 4CJ7A 3D6RA 2DPNA 1O26A 3QX3A 1BA1A 4FM9A 1NGDA 3K9JA 5BRHA 1YJWN 3DJCA 2CH6A 1P8ZA 3HRGA 3G4AA 3I8BA 4CZHA 5JVGL 4GTDA 2D0OA 5IORA 3DWLA 3OHRA 4K43A 3NMUA 4PKIA 4U67L 2A6AA 2E1YA 3O8MA 1NGIA 1MA9B 4BRAA 3AGKA 2QTDA 3O80A 1KD1O 4IOAL 5AQXA 3FOFA 1Y64A 4CZJA 1H1VA 4WQ5C 3VEXA 2QXLA 3ENBA 4PKHA 4C23A 4K25A 4NO7A 4FWLA 4JKCA 4BRQA 1K8KA 2HBKA 1WIHA 4L3QA 4GTAA 3AQOA 3MN5A 1GLFO 4BG8A 1ATRA 4BG9A 3DXMA 3DXKB 3ZETA 3GBTA 4FWKA 3BF1A 2QI2A 5FPDA 2NNWA 3CC7N 3O6WA 3WEEB 2OANA 4FOIA 3H45C 3Q7CA 4H03B 2NRZA 3UKRB 4H0YB 4KMDA 2R7ZA 2FSKA 3I56N 1T6DA 1BO5O 1Y1VA 2A5XA 1NM1A 4BR0A 4B1ZA 1SFOA 4ISEA 3CERA 1IG8A 4JK8A 5EVZA 1WQHA 1YF5L 2GSUA 3C6AA 3G4CA 4GTLA 4KMHA 2WUSA 3MX2A 3GTGA 4YOYA 3GTQA 3C7NB 4FPBA 3WEEA 2PAVA 4IDHA 3G6EN 3ID8A 4R79A 2IIRA 4H0OA 3DXMB 2YHYA 3ZETB 3FKIA 1O25A 1VAZA 1X9JA 4CBWA 2ZJRL 4BROA 4JKAA 3CQZA 4C3IC 1I3QA 3QFUA 3H1VX 3SK3A 5JFEA 5M1KA 5AQTA 1DT9A 1Z6RA 2ZF5O 5AQUA 1TWGA 1VQ6N 2JWKA 3CIPA 3TSUA 1F9NA 3ERED 3MMVA 2HMPA 4KH6A 2JA5A 3FZLA 3TTFA 4K41A 4KH4A 5EOYA 4A59A 4U7BA 3FLCO 3VGKA 3CCVN 1EH1A 4JHDB 1Q18A 1B4BA 3WXIA 3KHYA 4CI6A 3E1YA 1RGIA 3D2FB 4IEEA 3GDQA 3CPEA 4H5VA 4JK9A 4DCHA 2E2PA 2Q31A 4Z94A 5BR9A 2E2HA 2VGNA 5AFUA 2ZWHA 1VQLN 2JH3A 5IOQA 4FZBA 3H6EA 1O2AA 1VQ7N 4RTFD 4EIAA 3J8AA 1KQ4A 5KQ8A 3L6QA 3F2KA 4GTFA 2WFBA 3VEYA 3FOEA 3L4KA 4M63C 5AQFA 1U2VB 5C12A 4IO9L 4BRMA 2Q0RA 2YHWA 5JMVA 3WXLA 4EFHA 3R9PA 3L4IA 3VEWA 4CBUA 3IUCA 3MX5A 5BN9A 1YUWA 2V52B 3HSCA 3DXKA 3U9DA 3L0QA 3CCJN 2ASPA 4C1NK 2YU9A 1O13A 3KVGA 4O8KA 4WFAL 4CZFA 1O24A 2VUMA 3VESA 1MWKA 2P9PB 2JA6A 3EL2A 3QBWA 3U8XA 5AQPA 2YJFA 5AQRA 2E20A 3VEZA 2QEXN 4JNEA 5C15A 3O5BA 1YJ9N 4P5AA 4G0UA 1WOQA 1HUXA 3MCPA 5ELZA 1QQNA 5B8HA 4FVUA 1HLUA 5TKYA 5GINA 1ZXOA 2P9KA 4GT9A 4F9OA 3E66A 1WQGA 2V7ZA 1IJJA 1SQKA 5MLCQ 4FWSA 4GVEA 3VA7A 3GTMA 3QB0A 3ENOA 2CGJA 1ZC6A 3VF6A 5FPMA 4B9QA 5JVOA 3S0XA 3QMLA 1TYQA 3R1XA 1W2BM 1KQSM 2AA4A 4HTLA 1TYQB 4BC3A 1NGCA 3H3NO 2P9KB 3TSQA 4M7YA 2GSOA 4H5WA 4KB2A 2YHXA 3IMXA 3H3OB 1BGWA 4AM6A 1E4GT 4ILHA 1G99A 5M1QA 3UB5A 2E2NA 1NGEA 4WQ4A 3ULEB 4CD3A 2VYPA 1SZ2A 3CJ9A 3HZ6A 4EHTA 4BC5A 1JCEA 2VWBA 5JLFA 3VF2A 2HF4A 3MCAB 1T44A 2CH5A 3N3YA 4IOCL 1RDWX 3FZKA 4WCEL 3G71N 3OPFA 1D4XA 2J4RA 2CGLA 3CQXA 3KWGA 1HPMA 4DB3A 2RH6A 1MWMA 4B1WB 1GLJO 4J8FA 2FLOA 5C2FA 3CJBA 4MDAA 5AQYA 4A61A 3U9ZA 5BRFA 5AQOA 3UKRA 1VQON 3ATVA 2XCOA 4KATA 3ZEUA 1S3XA 3ZX3A 5KQDA 5F1XA 3PIOL 2NRHA 3G4SN 2A42A 2KWAA 2AP1A 4GTCA 2ASMA 3M1FA 2E8AA 3K9KA 2ZFZA 2JA7A 4DDQA 1S22A 1I50A 2QW9A 4JEPA 3TU5A 1KAZA 1VQ5N 3FZMA 3O4WA 4ILDA 1YI2N 5BPNA 4IFEA 3VGMA 4A5BA 1U2VA 3ULEA 3CQYA 3L4JA 2HBJA 4KBOA 1DKGD 5FPNA 5CJ9A 3CXCM 4KAWX 1TUUA 4IO8A 3SAFA 4WFBL 4FO0A 3WXMB 1DD5A 3FGUA 2F7TA 2QWLA 4CZGA 4GFQA 3IKMA 3M5RA 3U4LA 3CF5L 1SAZA 5CHIA 3EN9A 1QVFM 3NVKA 3AGRA 2QWNA 4MDBA 3P31A 4FWPA 4IEIA 5CE3A 4B1VA 1JCGA 4G0WA 3A5NC 5BPLA 3MWTA 3P39A 5ADXH 2ASOA 1NGAA 5LJWA 4JN4A 2P9UB 3LDQA 4BQLA 3SAHA 2FF6A 3CJCA 3A5LC 1KAYA 4FOEA 5C10A 4GV3A 4JD2A 1YITN 3GTJA 4OPAA 1QZ5A 3R3LA 2NRRA 2QWRA 5AZJB 1NLVA 3CCLN 3PLAA 4BRIA 4KASA 3O08A 1HKGA 3F9MA 1XUPO 4XH1A 5KPTA 5KPZA 1LCUA 4BREA 3W3DA 3QBXA 3SAGA 3OBWA 5AR0A 1GLEG 4XH5A 4KB4A 3KWIA 4MLHA 4YOTA 4AM7A 1K73O 3VMFB 2A41A 4BQZA 2Q36A 1VQ9N 4FPAA 3CHWA 1C0FA 3QDKA 2UYTA 3UKUB 1JCFA 1K8AO 3CD6N 3CC2N 5C0YA 4BRLA 1XXCA 1ZVUA 5EY4A 3HOTA 3E9LA 3VENA 3EKUA 5IOSA 5AQZA 4RCHA 1QHAA 3VPZA 5LY3A 5JVHL 4LC9B 3LL3A 1AB4A 4H0VB 3I55N 3SJHA 3IFRA 3LPXA 1NGHA 2GX9A 2Q0UA 2E88A 3HM8A 3UKUA 3VETA 4CZMA 1Q86O 2IVPA 2W41A 5LJVA 4JKGA 3BEXA 3R6MA 5IOTA 3P38A 1ZBSA 2FSNA 3CJAA 3E9PA 4PKGA 4BC2A 3BUEA 1RFQA 4BR2A 3CCQN 4GNIA 3D2EA 2QWOA 3V4GA 1NBWA 3CCEN 2E1ZA 4CZKA 1V4TA 4NLBA 5AQLA 5BRDA 4KM9A 4BC4A 5AZJA 1Y1WA 2R92A 4ILJA 2GELA 3TTCA 3SBTA 3MN9A 4JKBA 2D1KA 4OPHA 4UY8O 1T3VA 4BRGA 1VQPN 1S72N 4YORA 3BP8A 4B1XB 2HBMA 2NRWA 4NLCA 4JKFA 2R93A 2E2OA 3H1QA 4BLAA 3I33A 1NGGA 5M1OA 3ZX2A 2P5MA 4KC6A 4BR7A 3GTKA 3MDQA 3VTHA 1Q7YO 3LDOA 1GLBG 3PIPL 2NRXA 1OVYA 5AQWA 3C7NA 2FF3B 2GWJA 2P9NA 2P9IB 4H0PA 4BRCA 3CMEN 1OKJA 3QFPA 1GLLO 3A5OC 4NB4A 2E2IA 4EAHD 1U6ZA 2CFAB 5JICA 4KMAA 4JKHA 3RVCA 1YVNA 1MDUB 4AF1A 1VQ8N 3SLCA 2NLXA 3CPWM 1WCMA 3ZEUB 4O8UA 2P9PA 3ATUA 1HKCA 3CJ1A 2QM1A 1R59O 3CCMN 3CC4N 1RDUA 1X3MA 3FE1A 2V7YA 1XXBA 1BA0A 2IVNA 2RE2A 3VGLA 4PHTX 1XC3A 5AZIA 3VTIA 4WQ4C 1K8KB 5AQNA 3GTPA 4MO5A 2P9NB 3H46O 1EQYA 4PL7A 2NVYA 3LAJA 3M6GA 3O9QA 3W0LA 1BWFO 4BR9A 2YX6A 5TJ3A 4BVPA 1IS1A 2PFUA 3HTVA 4K42A 4IOXA 5CHPA 1BU6O 2A40A 3JS6A 5M1NA 1TWCA 4MO4A 3M3ZA 4H0TB 4JD2B 4IXCA 1C0GA 2QA4N 3N0CA 4BGAA 2Q2RA 2IVOA 3O9UA 3OA9A 4ISGA 3NUHA 1YHQN 2KHOA 1M90O 1P90A 4WF9L 1ISEA 4KDDA 2QWPA 3WQUA 4I6MB 4CBXA 4LQYA 4BLBA 1K9MO 4A2AA 2E2QA 4Y0WA 4KARA 3VOVA 3VERA 4CD1A 5DM6L 2V51B 1Z05A 3G25A 4G9ZA 3A0IX 2CGKA 5EGHA 4H5TA 3EO3A 2P9SA 2ITMA 2XCQA 2D4WA 3O9RA 2RHKA 3TTDA 3CI5A 4BRDA 1SS6A 2P9LA 4BRNA 1BDGA 1BG3A 3AH5A 4H5NA 4WFNL 4B1UB 3EE9A 5AQMA 4CZEA 1KAXA 2BTFA 4A2BA 4H0XB 1Q81O 4H5RA 3KK7A 3R8EA 1ILYA 1JJ2M 4QS8A 3DAWA 3GL1A 2PBDA 3N4QA 5BPMA 3QICA 5GIOA 3Q3QA 4JAXA 2GUPA 4HWIA 1BOTO 2OTJN 3LDLA 5TKWA 2CFAA 2WBNA 2NVXA 1GLCG 4YOXA 3EKSA 1NMDA 4WQ5A 4A5AA 3HBTA 2FSJA 2W40A 2YJEA 3CETA 1QQOA 3C6HA 4XEIA 3OW2M 1N8RO 3TSPA 1TUYA 3KZBA 4IJAA 1QZ6A 1NJIO 2F9WA 5GAGP 1HX1A 2GEMA 2B63A 4BVOA 5EXWA 4FWMA 2ZJPL 1XXAA 3O1WA 1HKBA 1NWKA 4IWVA 5AQKA 3SBGA 2P9UA 5BN8A 3J7ZO 4JKEA 2GWKA 3VEVA 2NRVA 3C0BA 4GTEA 1QQMA 2NZTA 3EZWA 1E4FT 3Q7BA 1YIJN 3ZX0A 2YCHA 5AFUH 1GLAG 1M1KO 4ISFA 2Q1NA 3SMPA 1EK8A 3AARA 3T69A 2PHCB 4GY2B 4O5FA 1QVGM 4YOWA 3AY9A 3IDHA 5F0XA 1YJNN 2EWSA 3ZYYX 1O2BA 2A3ZA 3HOSA 1TWAA 1TWFA 3ID6A 3VF4A 1ESVA 5E26A 2F9TA 4IZ9A 5E84A 3RSEB 3WQTA 3CCUN 2VCPA 3H0GA 5M1FA 3EE8A 3NVMA 2I7NA 2I7PA 2XCRB 3WT0A 1EO1A 1VQNN 4FWOA 1VQ4N 5AQVA 4FSVA 2D0PA 3FR0A 3GTLA 4QS7A 1O29A 2HOEA 4KM8A 2ZGYA 1T6CA 1WUAA 4YOVA 3GG4A 4QS9A 4RWTA 3BF3A 5C2DA 4A62A 5AQQA 1BJTA 3AQPA 2JWLA 4GTBA 2KKZA 3LDPA 4YDUC 1TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJN A;  3FZH A;  3AAQ A;  1NGB A;  5AQH A;  2P9I A;  4BR4 A;  3GE1 A;  5ADX A;  4BRK A;  4BRP A;  1BUP A;  3D2F A;  4DHY A;  5JLH A;  3JXU A;  3CJ7 A;  4MLE A;  2ZGZ A;  1GLD G;  3O1B A;  2BUP A;  1V4S A;  4CZL A;  3LM2 A;  3S41 A;  3UE5 A;  4I6M A;  5F2R A;  5BRE A;  2QWQ A;  3MK6 A;  3D7E O;  4B1Y B;  3WXJ A;  1J6Z A;  4M7X A;  3D2E B;  3SMS A;  2FXU A;  4YDU A;  3MN6 A;  5AQJ A;  3TPQ A;  4DQ8 A;  3AAP A;  1ATS A;  2H3G X;  4E1J A;  1LOT B;  3A8Y A;  1HJO A;  4PL8 A;  3LM9 A;  2HF3 A;  2YI1 A;  3FZF A;  1CZA N;  5AZI B;  5KPR A;  4FWR A;  4XH4 A;  5AQI A;  3WUH A;  1X3N A;  1DGK N;  5EX5 A;  3BUZ B;  3FFK B;  1YAG A;  3A5M C;  3P4I A;  3MN7 A;  4FWN A;  5I9E B;  4BRH A;  2Q97 A;  4BR5 A;  3GOI A;  1ATN A;  1XQS C;  2QWM A;  5FPE A;  4CZI A;  4BRF A;  3HI0 A;  4BGB A;  5AQS A;  3RSE A;  2P9L B;  4FWQ A;  3VEO A;  4WYB A;  2P9S B;  3WXK A;  1NGF A;  1NGJ A;  1DEJ A;  4FL9 A;  1KXP A;  5AQG A;  4EHU A;  2GTD A;  4JHD A;  3B8A X;  1YXQ A;  3LDN A;  3ENH A;  4CJ7 A;  2DPN A;  1BA1 A;  1NGD A;  5BRH A;  3DJC A;  2CH6 A;  1P8Z A;  3I8B A;  4CZH A;  2D0O A;  3DWL A;  3OHR A;  4K43 A;  4PKI A;  2A6A A;  2E1Y A;  3O8M A;  1NGI A;  1MA9 B;  4BRA A;  3O80 A;  5AQX A;  1Y64 A;  4CZJ A;  1H1V A;  4WQ5 C;  3VEX A;  2QXL A;  4PKH A;  4C23 A;  4K25 A;  4NO7 A;  4FWL A;  4BRQ A;  1K8K A;  4L3Q A;  3MN5 A;  1GLF O;  4BG8 A;  1ATR A;  4BG9 A;  3DXM A;  3DXK B;  3ZET A;  3GBT A;  4FWK A;  3BF1 A;  5FPD A;  3O6W A;  3WEE B;  2OAN A;  4FOI A;  3H45 C;  4H03 B;  3UKR B;  4H0Y B;  2FSK A;  1T6D A;  1BO5 O;  2A5X A;  1NM1 A;  4BR0 A;  4B1Z A;  4ISE A;  3CER A;  1IG8 A;  5EVZ A;  2WUS A;  3C7N B;  4FPB A;  3WEE A;  2PAV A;  3ID8 A;  2IIR A;  4H0O A;  3DXM B;  2YHY A;  3ZET B;  1X9J A;  4CBW A;  4BRO A;  3QFU A;  3H1V X;  3SK3 A;  5AQT A;  1Z6R A;  2ZF5 O;  5AQU A;  3CIP A;  3MMV A;  2HMP A;  3FZL A;  4K41 A;  5EOY A;  3FLC O;  3VGK A;  4JHD B;  1Q18 A;  3WXI A;  3KHY A;  4CI6 A;  1RGI A;  3D2F B;  3GDQ A;  4H5V A;  4DCH A;  2E2P A;  2Q31 A;  4Z94 A;  5BR9 A;  5AFU A;  2ZWH A;  3H6E A;  4RTF D;  4EIA A;  3J8A A;  5KQ8 A;  3L6Q A;  3VEY A;  4M63 C;  5AQF A;  1U2V B;  4BRM A;  2Q0R A;  2YHW A;  5JMV A;  3WXL A;  4EFH A;  3R9P A;  3L4I A;  3VEW A;  4CBU A;  3IUC A;  5BN9 A;  1YUW A;  2V52 B;  3HSC A;  3DXK A;  3U9D A;  3L0Q A;  2ASP A;  3KVG A;  4O8K A;  4CZF A;  3VES A;  1MWK A;  2P9P B;  3EL2 A;  3QBW A;  3U8X A;  5AQP A;  2YJF A;  5AQR A;  2E20 A;  3VEZ A;  4JNE A;  3O5B A;  1WOQ A;  1HUX A;  3MCP A;  5ELZ A;  1QQN A;  5B8H A;  1HLU A;  5TKY A;  1ZXO A;  2P9K A;  4F9O A;  2V7Z A;  1IJJ A;  1SQK A;  4FWS A;  3QB0 A;  3ENO A;  2CGJ A;  1ZC6 A;  3VF6 A;  5FPM A;  4B9Q A;  3QML A;  1TYQ A;  2AA4 A;  4HTL A;  1TYQ B;  4BC3 A;  1NGC A;  3H3N O;  2P9K B;  4M7Y A;  4H5W A;  2YHX A;  3IMX A;  3H3O B;  4AM6 A;  1E4G T;  1G99 A;  3UB5 A;  2E2N A;  1NGE A;  4WQ4 A;  3ULE B;  4CD3 A;  2VYP A;  3HZ6 A;  1SZ2 A;  3CJ9 A;  4EHT A;  4BC5 A;  1JCE A;  2VWB A;  5JLF A;  3VF2 A;  2HF4 A;  1T44 A;  2CH5 A;  1RDW X;  3FZK A;  1D4X A;  2J4R A;  2CGL A;  3CQX A;  4DB3 A;  1HPM A;  1MWM A;  4B1W B;  1GLJ O;  4J8F A;  2FLO A;  3CJB A;  5AQY A;  4A61 A;  3U9Z A;  5BRF A;  5AQO A;  3UKR A;  3ATV A;  3ZEU A;  1S3X A;  3ZX3 A;  5KQD A;  5F1X A;  2NRH A;  2A42 A;  2AP1 A;  2ASM A;  3M1F A;  2E8A A;  1S22 A;  2QW9 A;  3TU5 A;  1KAZ A;  3FZM A;  3O4W A;  5BPN A;  3VGM A;  1U2V A;  3ULE A;  3CQY A;  4KBO A;  1DKG D;  5FPN A;  1TUU A;  4IO8 A;  4FO0 A;  3FGU A;  4CZG A;  2QWL A;  3U4L A;  1SAZ A;  3EN9 A;  2QWN A;  4FWP A;  5CE3 A;  4B1V A;  1JCG A;  3A5N C;  5BPL A;  5ADX H;  2ASO A;  1NGA A;  5LJW A;  4JN4 A;  2P9U B;  3LDQ A;  4BQL A;  2FF6 A;  3CJC A;  3A5L C;  1KAY A;  4FOE A;  4JD2 A;  1QZ5 A;  2QWR A;  5AZJ B;  1NLV A;  4BRI A;  3O08 A;  1HKG A;  3F9M A;  1XUP O;  4XH1 A;  5KPT A;  5KPZ A;  1LCU A;  4BRE A;  3W3D A;  3QBX A;  5AR0 A;  1GLE G;  4XH5 A;  4MLH A;  4AM7 A;  4BQZ A;  2A41 A;  2Q36 A;  4FPA A;  3CHW A;  1C0F A;  3QDK A;  2UYT A;  3UKU B;  1JCF A;  4BRL A;  5EY4 A;  3VEN A;  3EKU A;  5AQZ A;  4RCH A;  1QHA A;  3VPZ A;  5LY3 A;  4LC9 B;  3LL3 A;  4H0V B;  3SJH A;  3IFR A;  1NGH A;  2Q0U A;  2E88 A;  3HM8 A;  3UKU A;  3VET A;  4CZM A;  2IVP A;  2W41 A;  5LJV A;  3BEX A;  3R6M A;  1ZBS A;  2FSN A;  3CJA A;  4PKG A;  4BC2 A;  1RFQ A;  4BR2 A;  4GNI A;  3D2E A;  2QWO A;  1NBW A;  2E1Z A;  4CZK A;  1V4T A;  5AQL A;  5BRD A;  4BC4 A;  5AZJ A;  2GEL A;  3MN9 A;  2D1K A;  4BRG A;  4B1X B;  3BP8 A;  2E2O A;  3H1Q A;  3I33 A;  1NGG A;  3ZX2 A;  4BR7 A;  3MDQ A;  3LDO A;  1GLB G;  5AQW A;  3C7N A;  2FF3 B;  2GWJ A;  2P9N A;  2P9I B;  4H0P A;  4BRC A;  1OKJ A;  3QFP A;  1GLL O;  3A5O C;  4NB4 A;  4EAH D;  1U6Z A;  5JIC A;  1YVN A;  1MDU B;  3SLC A;  2NLX A;  3ZEU B;  2P9P A;  3ATU A;  1HKC A;  3CJ1 A;  1R59 O;  2QM1 A;  3FE1 A;  1X3M A;  2V7Y A;  1BA0 A;  2IVN A;  3VGL A;  1XC3 A;  5AZI A;  4WQ4 C;  1K8K B;  5AQN A;  4MO5 A;  2P9N B;  3H46 O;  1EQY A;  4PL7 A;  3M6G A;  3W0L A;  1BWF O;  4BR9 A;  4BVP A;  3HTV A;  4K42 A;  1BU6 O;  2A40 A;  3JS6 A;  4MO4 A;  3M3Z A;  4H0T B;  4JD2 B;  4IXC A;  1C0G A;  4BGA A;  2Q2R A;  2IVO A;  4ISG A;  2KHO A;  2QWP A;  3WQU A;  4I6M B;  4CBX A;  4A2A A;  2E2Q A;  4Y0W A;  3VOV A;  3VER A;  4CD1 A;  2V51 B;  1Z05 A;  3G25 A;  3A0I X;  2CGK A;  4H5T A;  3EO3 A;  2P9S A;  2ITM A;  2D4W A;  4BRD A;  3CI5 A;  2P9L A;  4BRN A;  1BDG A;  1BG3 A;  4H5N A;  4B1U B;  5AQM A;  4CZE A;  1KAX A;  2BTF A;  4A2B A;  4H0X B;  4H5R A;  3R8E A;  4QS8 A;  3DAW A;  3GL1 A;  2PBD A;  5BPM A;  3QIC A;  4JAX A;  2GUP A;  4HWI A;  1BOT O;  3LDL A;  1GLC G;  3EKS A;  1NMD A;  4WQ5 A;  3HBT A;  2FSJ A;  2W40 A;  2YJE A;  3CET A;  1QQO A;  4XEI A;  1TUY A;  3KZB A;  4IJA A;  1QZ6 A;  2F9W A;  1HX1 A;  2GEM A;  4BVO A;  5EXW A;  4FWM A;  3O1W A;  1HKB A;  1NWK A;  4IWV A;  5AQK A;  2P9U A;  5BN8 A;  3VEV A;  2GWK A;  3C0B A;  1QQM A;  2NZT A;  3EZW A;  1E4F T;  3ZX0 A;  2YCH A;  5AFU H;  1GLA G;  4ISF A;  2Q1N A;  3SMP A;  3AAR A;  4GY2 B;  4O5F A;  3AY9 A;  3IDH A;  5F0X A;  2EWS A;  2A3Z A;  3VF4 A;  1ESV A;  5E26 A;  2F9T A;  4IZ9 A;  5E84 A;  3RSE B;  3WQT A;  2VCP A;  2I7N A;  2I7P A;  3WT0 A;  4FWO A;  5AQV A;  4FSV A;  2D0P A;  3FR0 A;  4QS7 A;  2HOE A;  2ZGY A;  1T6C A;  1WUA A;  3GG4 A;  4QS9 A;  4RWT A;  3BF3 A;  4A62 A;  5AQQ A;  3LDP A;  4YDU C; 
#chains in the Genus database with same CATH topology
 3AAQ A;  4A3L C;  3DLL L;  3AVC A;  3S1Q K;  1ZBH A;  4M1X A;  2G8H A;  1Q82 O;  2ZUF A;  3MWP A;  3GE1 A;  4BRK A;  4BRP A;  2R7Y A;  5IP7 C;  4O5B A;  4KB1 A;  4YHH K;  1JLE A;  2A69 A;  4KHQ A;  3MML B;  3O1B A;  2BUP A;  1V4S A;  2VGM A;  3L4Q A;  5IYC K;  1OH8 A;  1O27 A;  3PO2 K;  3J81 O;  3K7A K;  4DS4 A;  1JXE A;  5IYC C;  4Z4I A;  1VQK N;  3SMS A;  3T7Z A;  2FXU A;  4CJV A;  2BH1 A;  4DQR A;  3O3G A;  3OYH A;  3JST A;  3GTP C;  2GSN A;  1VQM N;  3S1Q C;  1LOT B;  2HBL A;  5TMC A;  4PWD A;  3LM9 A;  3VA3 A;  1CZA N;  5AZI B;  1TWG K;  5KI6 A;  4BDP A;  4FWR A;  4XH4 A;  2GBZ A;  4C1N I;  1VSI A;  1X3N A;  4OIO A;  5EX5 A;  1DCP A;  4FLX A;  3DLE A;  3ISN C;  1K83 A;  3A5M C;  4KH5 A;  5I9E B;  4CEE A;  4QIW D;  5GAD P;  3E9O A;  4YFU A;  1WSR A;  1O28 A;  2QWM A;  2V6T A;  1U47 A;  4FJJ A;  3GTO A;  5AQS A;  3KIO A;  4PA1 A;  3DOK A;  2P9L B;  2WC9 A;  2WB1 L;  3AO4 A;  1R9T A;  2P9S B;  4O55 A;  4M3Z A;  4C3H C;  3OBY A;  1KXP A;  4EHU A;  1IKY A;  2GTD A;  2JA5 C;  3LDN A;  4BY9 C;  4BE1 A;  2YV0 X;  3HXM A;  3ENH A;  4Z0U A;  1BA1 A;  3CFO A;  5BRH A;  3QLH A;  1YJW N;  2X78 A;  4C8K A;  3HRG A;  1I6V A;  3I8B A;  4CZH A;  5IOR A;  3HOX K;  2WB1 D;  2KFZ A;  4U67 L;  2PMZ L;  5FLM K;  1LWF A;  2OYQ A;  4A3J K;  3NF7 A;  1ZQ1 C;  3O80 A;  4IOA L;  1K83 C;  3S14 K;  1Y64 A;  4CZJ A;  4JRQ A;  4WQ5 C;  3RMC A;  3WNE A;  4FJL A;  3P83 D;  3VEX A;  2QXL A;  4K25 A;  4JKC A;  3T19 A;  1WIH A;  1K8K A;  4GTA A;  3AQO A;  3MN5 A;  3DXM A;  3GBT A;  3BF1 A;  3L3U A;  3ZT3 A;  3LP3 A;  4H03 B;  1B9F A;  3AA4 A;  4KMD A;  4DV1 K;  5KRS A;  1Y1V A;  3HPO A;  3KKS A;  2HHH K;  3FKI C;  3AVI A;  4BR0 A;  4BY1 C;  3CER A;  4JK8 A;  4GTL A;  3LDS A;  1WQH A;  1SKR A;  3VQ5 A;  3VQ8 A;  3GTQ A;  3G6E N;  4E19 A;  4O44 A;  5FRO A;  3WNH A;  1WAF A;  1U49 A;  4H0O A;  4J2D A;  2XRI A;  1X9J A;  4J2A A;  4BRO A;  4C3I C;  1I3Q A;  3LZI A;  3H1V X;  2IAJ A;  4X66 K;  4FZX C;  3TFI A;  3AO5 A;  1VQ6 N;  3MMV A;  2HMP A;  2JA5 A;  3TTF A;  1O2F B;  1NK0 A;  4KH4 A;  5EOY A;  1RT5 A;  3RZD C;  4IBN A;  3SI6 A;  4CEC A;  1XNR K;  3WXI A;  1HMV A;  4CEF A;  3GTQ K;  2X6S A;  3E1Y A;  4HVJ A;  3D2F B;  4IEE A;  4X65 K;  4AHV A;  3GDQ A;  3GTP K;  3CPE A;  2OZM A;  1DLO A;  4CF1 A;  4DCH A;  2E2P A;  4N56 A;  1TK5 A;  4CGI A;  5BR9 A;  5IOQ A;  1EX4 A;  1VQL N;  2JH3 A;  1NKE A;  1IBM K;  1KQ4 A;  3THX A;  3L6Q A;  4C3I K;  2G8K A;  4M63 C;  1U2V B;  4M3Y A;  4BRM A;  1XMO K;  2I5J A;  4A3M K;  4CBU A;  3IUC A;  3SV3 A;  3JAM O;  4F8R A;  2V52 B;  3AO2 A;  3HSC A;  2O8B B;  2ASP A;  1O13 A;  4WFA L;  4CZF A;  3S15 K;  1BQM A;  3U8X A;  2G8W A;  2QEX N;  3O5B A;  2PYL A;  4KN4 A;  3K59 A;  3GEH A;  1YJ9 N;  2E5L K;  4G0U A;  4CHN A;  3MCP A;  1C6V A;  1HLU A;  2A6H A;  5GIN A;  3OS2 A;  1IJJ A;  3K5L A;  3M8R A;  2O8D A;  4GVE A;  3VA7 A;  4BXX K;  2RF2 A;  3ENO A;  3VF6 A;  4E7K A;  2KFN A;  3QML A;  1TYQ A;  3H3N O;  2P9K B;  3OS1 A;  4CJU A;  1T8E A;  3BZC A;  1BL3 A;  3V9W A;  1C0T A;  4JRP A;  2E2N A;  2VYP A;  1SZ2 A;  5JLF A;  3I4N K;  3N3Y A;  3AA5 X;  4IOC L;  1RDW X;  1REV A;  3HOU K;  3KWG A;  4DV7 K;  2E4L A;  1GLJ O;  1NKB A;  1EFW A;  4A61 A;  3LP1 A;  3U9Z A;  1VQO N;  4FJM A;  4KAT A;  1I3Q C;  3ZEU A;  4WE1 A;  3DYA A;  4XLN A;  2NRH A;  4KHY A;  1HJR A;  4KTZ A;  1J5E K;  2JA7 A;  1S22 A;  3TU5 A;  3FZM A;  1U2V A;  4C8O A;  4KBO A;  1DKG D;  2UU9 K;  3RZO K;  3NH1 A;  5FPN A;  1NK8 A;  4FXD A;  1TUU A;  1SKS A;  4A3G C;  3NGY A;  4FO0 A;  4BBS C;  4O0I A;  4DQS A;  1SAZ A;  3EN9 A;  3NVK A;  1R0A A;  5I42 A;  2QWN A;  2YNF A;  4FWP A;  4IEI A;  1WOP A;  4PY5 A;  4CGH A;  5BPL A;  4C3H K;  3VQ9 A;  5LJW A;  3LDQ A;  4BQL A;  4E3S A;  3K2P A;  1KAY A;  3C94 A;  3GTJ A;  4JD2 A;  3R3L A;  5C4X C;  4Y1D A;  5IP9 K;  3CCL N;  1NJW A;  4BRI A;  2B63 K;  3F9M A;  3IG1 A;  4XH1 A;  3VQD A;  4CF2 A;  5KPZ A;  2O8F B;  1N32 K;  3W3D A;  3SQ0 A;  3OBW A;  4YNQ A;  4MLH A;  3DRR A;  4DTS A;  2Q36 A;  3QIP A;  4HTU A;  3CHW A;  3BP3 A;  3RRH A;  3GTQ C;  4C8M A;  1KLN A;  4KHN A;  3TAG A;  3THW B;  3SJH A;  3IFR A;  4DR5 K;  3AD8 C;  3HM8 A;  4JS5 A;  4RG8 A;  4I9Q A;  4JKG A;  1YTA A;  1TVR A;  3BEX A;  1LW2 A;  1YNJ A;  4LFB K;  1ZBS A;  3CJA A;  2Y1I A;  3ADA C;  4WJ4 A;  1RFQ A;  4DWI A;  3S16 K;  3NHG A;  4HCC A;  2PY5 A;  3OYE A;  4CZK A;  4KM9 A;  5M3M K;  4B9V A;  4B08 A;  4ILJ A;  1I50 K;  2GEL A;  3WOD A;  3MN9 A;  2O8C B;  1VQP N;  4B1X B;  1NOY A;  2HBM A;  2NRW A;  4NLC A;  2R93 A;  3ZX2 A;  2NVY C;  4KC6 A;  4PAA A;  2NVT C;  3VQC A;  2A6E A;  3PIP L;  1OVY A;  3ZSV A;  2GWJ A;  1OKJ A;  1Y1V C;  1SL0 A;  3A5O C;  1TKZ A;  5JIC A;  3KLH A;  3S2H K;  3HYF A;  1J54 A;  4N5S A;  1WCM A;  4O8U A;  3AO3 A;  5C44 K;  1C1B A;  3S3O A;  1R59 O;  3CJ1 A;  1RDU A;  3EYZ A;  4CJK A;  2IVN A;  1U4B A;  2Z1G A;  5C25 A;  1WSG A;  4WQ4 C;  3GTP A;  4MO5 A;  3H46 O;  4DFK A;  4PL7 A;  4EP5 A;  4DTP A;  4LFC K;  2E2I K;  2Z1H A;  3W0L A;  1BWF O;  2YX6 A;  1W7A A;  2HHU A;  2JA5 K;  4OKJ A;  3DLH A;  2E2I C;  1EET A;  1RT2 A;  1HNV A;  4K42 A;  4CES A;  2E2J K;  1C0A A;  4IOX A;  3OYA A;  2BGG A;  5CHP A;  1BU6 O;  3I0S A;  4BWJ A;  1TWC A;  3DI6 A;  1EQR A;  1C0G A;  2NVX C;  2IVO A;  1QTM A;  4ISG A;  3GTO C;  2KHO A;  3NF6 A;  4WF9 L;  1FK9 A;  3QO9 A;  3WQU A;  4BLB A;  4A2A A;  4A3C K;  2R93 C;  4GVM A;  3VER A;  1F93 A;  5DM6 L;  2V51 B;  1Z05 A;  5LMU K;  3HK2 A;  3SZ2 A;  4H5T A;  4QJV A;  2RHK A;  4DFJ A;  4FZZ A;  1RBU A;  3SZY A;  1JOE A;  1BDG A;  4A3E C;  4H5N A;  4WFN L;  2QK9 A;  3EE9 A;  5AQM A;  3S1N C;  1KAX A;  2BTF A;  1WSI A;  4H0X B;  4H5R A;  3QEX A;  2GUI A;  4DTN A;  4JI7 K;  4CFB A;  3V1O A;  1NNE A;  1BOT O;  2WBN A;  5KRT A;  1D9F A;  4JK1 A;  3CQZ K;  3CET A;  1N8R O;  3EEQ A;  3TSP A;  1QZ6 A;  3HPG A;  1IKV A;  3L3V A;  2F9W A;  2GEM A;  4FWM A;  2OA8 A;  4CGF A;  4M3T A;  1HKB A;  4IWV A;  5AQK A;  2HNZ A;  3SCX A;  4JKE A;  5KGX A;  4DSI A;  3C0B A;  4GTE A;  2YKM A;  2FBX A;  4O2D A;  3AVK A;  3ZX0 A;  1IG9 A;  5L46 A;  1UA1 A;  1GLA G;  4ISF A;  3DLR A;  2PHC B;  1JLB A;  4YOW A;  1ZBF A;  3AVH A;  1BDF A;  4IFY A;  1O2B A;  2A3Z A;  3ID6 A;  1ESV A;  2F9T A;  4FJI A;  3KJV A;  1KVC A;  5M1F A;  4MEY A;  2QKK A;  1LWE A;  3THW A;  1U04 A;  4FWO A;  2B63 C;  3HOY C;  3A2F A;  1O1W A;  4C2M K;  1O29 A;  4J2E A;  4KM8 A;  4Y52 K;  1T6C A;  3RZD K;  2D6F C;  4EZ9 A;  1BJT A;  2OZS A;  3T02 A;  1GE9 A;  2OPQ A;  4YDU C;  3H0G C;  3FZH A;  5EGE A;  4AHR A;  1NGB A;  4JI5 K;  2D5R A;  2P1J A;  1JLC A;  1NG9 A;  4V19 S;  1S1W A;  2Y1J A;  4NOI A;  5GIP A;  3RWU A;  4OO1 J;  1BUP A;  4P5B A;  3D2F A;  4DHY A;  1JQW A;  3V81 A;  5A2Q O;  4GV6 A;  3OYB A;  2ITG A;  4NXM K;  4CFC A;  4CZL A;  2HST A;  5F2R A;  5BRE A;  2KLA A;  3GTL C;  1W97 L;  4CF0 A;  1FXX A;  1B4A A;  1KC8 O;  3F5T A;  4BKW A;  3ORE A;  2D0A A;  3D7E O;  3MK6 A;  4ELU A;  3IRX A;  3HOX C;  3TWH A;  4CFD A;  4FK2 A;  4C3J C;  5HL7 L;  1RT6 A;  4DU1 A;  1WBD A;  3ULD A;  2XY8 A;  3O9S A;  4HUF A;  3ALY A;  1WQF A;  1SFO C;  5AQJ A;  1I50 C;  2H3G X;  5C3E C;  3FHZ A;  5CY4 A;  3LAK A;  2PYJ A;  1U45 A;  4PL8 A;  4F2S A;  2NVY K;  1XNQ K;  4A3I K;  4JKG B;  5DM7 L;  5FRN A;  4J3N A;  4BBR C;  4HUG A;  5GAE P;  1I3Q K;  1EI6 A;  2RGR A;  1YAG A;  3FKI K;  4BR5 A;  3M3Y C;  4K8X A;  3SJJ A;  4FW1 A;  1XQS C;  5JS2 A;  4PQU A;  3WNF A;  1SFO K;  4FWQ A;  5K14 A;  4WYB A;  4DS5 A;  4QJV B;  4NYF A;  5CR4 A;  4CHZ A;  4FL9 A;  4I7F A;  4CHP A;  2OPP A;  2VG7 A;  4JHD A;  4LF5 K;  3B8A X;  4JK7 A;  4GV9 A;  2CW0 A;  4DUY K;  3D6R A;  4E7L A;  2XY6 A;  5J2M A;  1O26 A;  4DV2 K;  1NGD A;  3K9J A;  4C8L A;  3DJC A;  3NBP A;  4GTD A;  4BE0 A;  3TAP A;  4FJ8 A;  4PKI A;  3L2R A;  2PZS A;  3S1M K;  4FLZ A;  4DLE A;  2WAQ D;  1MA9 B;  4BRA A;  3AGK A;  4E0D A;  3S9H A;  3LAL A;  1ZYR A;  1ASW A;  4IG0 A;  4I2P A;  4BRQ A;  4L3Q A;  3SQ4 A;  3VN5 A;  1GLF O;  3MXM A;  3ZET A;  2E6M A;  5FPD A;  4RW7 A;  4X64 K;  1TWA C;  2NNW A;  1FKP A;  3CC7 N;  3O6W A;  3WEE B;  2OAN A;  3TAF A;  2NRZ A;  4H0Y B;  2R7Z A;  3I56 N;  1BO5 O;  5C42 A;  2A5X A;  3A8K A;  1NM1 A;  1VSD A;  1SMY A;  1SFO A;  3G4C A;  2OCE A;  3ZSQ A;  3GTG A;  4YOY A;  3TFJ A;  3C7N B;  3IAY A;  3ID8 A;  5J2Q A;  2B6A A;  4XLP A;  1W9H A;  3O4Q A;  4MFB A;  3GTM C;  3SK3 A;  4DSF A;  5JFE A;  4K8Z A;  5SWM A;  5M1K A;  3BZK A;  1LV5 A;  4LOW A;  1Z6R A;  4B9U A;  1TWG A;  1W0H A;  1F9N A;  3ERE D;  3QET A;  1TKT A;  4KH6 A;  4OIR A;  4K41 A;  3VQA A;  1T05 A;  3CCV N;  1FJG K;  4G1Q A;  1EH1 A;  1Q18 A;  2JA6 C;  1B4B A;  1RNH A;  3HM9 A;  4DFM A;  2XY5 A;  1VSJ A;  4Z4C A;  4JV5 K;  2WOM A;  1VRT A;  4Z94 A;  1Y1V K;  3RMA A;  5HRS A;  4A3I C;  2KZM A;  1WOR A;  1VQ7 N;  4EIA A;  5KQ8 A;  3TAE A;  3F2K A;  3L4K A;  2WFB A;  5AQF A;  5C44 C;  3HVT A;  4DTJ A;  4DSL A;  4EFH A;  3SPY A;  2IOC A;  3L4I A;  5BN9 A;  4DR4 K;  4AIL C;  3L0Q A;  3T01 A;  4O8K A;  1O24 A;  2VUM A;  4A3C C;  2R93 K;  2JA6 A;  1MWK A;  3QBW A;  4ID1 A;  3EY1 A;  3OVN A;  3H0G K;  3J80 O;  4P5A A;  1WOQ A;  1HUX A;  5ELZ A;  1QQN A;  1WLJ A;  4WIL A;  5TKY A;  1RBT A;  3I4M C;  4OGC A;  1WB9 A;  4GT9 A;  4F9O A;  3S17 C;  3OTO K;  1RIL A;  1G15 A;  5MLC Q;  1S1V A;  3DMJ A;  3QB0 A;  2CGJ A;  3L2Q A;  4B9Q A;  3S0X A;  1RTI A;  4CHQ A;  2DFE A;  1NGC A;  2XHB A;  3M8S A;  2UXC K;  2YHX A;  1BGW A;  4AM6 A;  4A3G K;  4ILH A;  4KAZ A;  3UB5 A;  3ULE B;  3HZ6 A;  3CJ9 A;  3GEI A;  4KHU A;  4BC5 A;  4WJ3 M;  4E1M A;  3VF2 A;  3THV A;  1TL3 A;  1A5V A;  3FZK A;  4WCE L;  1D4X A;  3CQX A;  1XI1 A;  1WSF A;  1MWM A;  4OIN A;  4J8F A;  4MDA A;  5AQY A;  4W5T A;  1ZBI A;  5AQO A;  3KD5 E;  3S17 K;  3ATV A;  4RW8 A;  1WAJ A;  1S3X A;  5KQD A;  4AH6 A;  2XO7 A;  2O4G A;  4E7I A;  4FJH A;  4BY1 K;  3KLG A;  4DDQ A;  4RW9 A;  1I50 A;  4JEP A;  4CHY A;  1VQ5 N;  4B9T A;  4DV0 K;  5BPN A;  4A5B A;  2IDO A;  3ULE A;  5E41 A;  2VG6 A;  2X74 A;  2G8I A;  1TGO A;  4IO8 A;  1IKW A;  2BAN A;  3AVJ A;  3V9X A;  1Y1W C;  1DD5 A;  2QWL A;  4NCB A;  1X9S A;  4MDB A;  3ZT4 A;  5CE3 A;  4N76 A;  1JCG A;  1CLQ A;  2F8T A;  3NDK A;  4HUE A;  1IBA A;  2ASO A;  1NGA A;  3SAH A;  4JN4 A;  2P9U B;  2HHS A;  3QNO A;  3RRG A;  3QNN A;  4FLU A;  4OLA A;  4FOE A;  3CG7 A;  2QWR A;  5AZJ B;  3PLA A;  2O8E A;  1U48 A;  3MEE A;  3NH2 A;  1XUP O;  5KPT A;  3HO1 A;  4LK1 A;  3SAG A;  4O4G A;  1CXQ A;  1USM A;  4XH5 A;  3KWI A;  4ID5 A;  3VMF B;  4BQZ A;  1Y1W K;  1L3T A;  4FPA A;  3QDK A;  3ZSW A;  3CD6 N;  2UYT A;  3UKU B;  1ZVU A;  3GTK A;  5C0Y A;  4L8R B;  1N6Q A;  3GTJ K;  4X6A C;  4CVN E;  1C1C A;  3E9L A;  4F2R A;  4RW4 A;  4CER A;  2OPS A;  1QHA A;  5LY3 A;  5IYD K;  5JVH L;  4LC9 B;  1VSK A;  1YNN A;  1SV5 A;  3LPX A;  3GTJ C;  3NGI A;  2GX9 A;  4DF4 A;  2Q0U A;  2JA8 K;  2E88 A;  2D0C A;  4CGG A;  2IVP A;  4P9S A;  3V4I A;  5LJV A;  3P1G A;  3A8I A;  4GW6 A;  3P38 A;  2FSN A;  4BE2 A;  3BUE A;  1KRP A;  4BR2 A;  3CCQ N;  5C24 A;  3E01 A;  3D2E A;  4DF8 A;  2E1Z A;  2FQO A;  3GTK K;  2WON A;  4OIP A;  1V4T A;  4NLB A;  5AQL A;  5BRD A;  3OYF A;  4BC4 A;  1NU0 A;  4DV5 K;  3GDZ A;  3SBT A;  3OY9 A;  1RT7 A;  4JKB A;  4BBS K;  4OPH A;  4FJ5 A;  1T3V A;  1J53 A;  3T1Y K;  4JKF A;  3QEP A;  5C4J C;  3H1Q A;  4BLA A;  3I33 A;  5M1O A;  4LK0 A;  4BR7 A;  3TFH A;  2DY4 A;  4CJW A;  1I94 K;  3LDO A;  1GLB G;  1RCH A;  3C7N A;  4JS4 A;  1TAQ A;  1KSP A;  1BCO A;  3QFP A;  1GLL O;  2PPB A;  4NB4 A;  2DFH A;  4A3M C;  3QEV A;  1YVN A;  1QSY A;  5KGW A;  4JI6 K;  1BIS A;  3ZSO A;  2Z1J A;  3QIN A;  1TK0 A;  3ATU A;  4YY3 K;  1SUQ A;  1WSJ A;  2VWK A;  4Z4H A;  3CC4 N;  2VQF K;  2V7Y A;  1XXB A;  3U3Y A;  1CZ9 A;  1KFD A;  1RT4 A;  4CJP A;  1XC3 A;  1S9E A;  3TAB A;  2UUC K;  2JGU A;  2P9N B;  4CK1 A;  1HNW K;  2NVY A;  1V5V A;  1LAW A;  1TWG C;  3LAJ A;  3AVL A;  3O3H A;  4F4K A;  4IDK A;  2RPI A;  4CK3 A;  3OYL A;  1LW0 A;  4BVP A;  1IS1 A;  2JLE A;  4CIF A;  3HTV A;  1DTQ A;  4DSJ A;  2A40 A;  3M3Z A;  1ZBL A;  4H0T B;  3C95 A;  4IXC A;  4JD2 B;  5J2P A;  2QA4 N;  3S1R C;  2GV9 A;  4QAG A;  1ZYQ A;  1WNS A;  2Q2R A;  3PV8 A;  4FVM A;  3OA9 A;  2O5J A;  1M90 O;  1ISE A;  4KDD A;  4KHS A;  3S2D C;  1JLQ A;  4I6M B;  4CBX A;  4LQY A;  4MEX A;  5CZ2 A;  1K9M O;  2B4J A;  2ETJ A;  4KAR A;  4QCL A;  5IT9 O;  2VUM C;  3VOV A;  3JSM A;  1IE0 A;  3T1A A;  4BDY A;  4TSX A;  2P9L A;  1BG3 A;  3AH5 A;  4B1U B;  1VSF A;  3NF8 A;  4CZE A;  4A2B A;  4FM0 A;  4KHP K;  1R9T C;  1OH6 A;  1ILY A;  3CQZ C;  4QS8 A;  1K6Y A;  3DAW A;  4MQ9 A;  2PBD A;  3N4Q A;  5GIO A;  3QIC A;  4LF6 K;  4HWI A;  2OTJ N;  3LDL A;  4JI2 K;  3M8Q A;  2NVX A;  4YOX A;  4WQ5 A;  4XEI A;  3DM2 A;  5DMR A;  1TUY A;  3KZB A;  5JS1 A;  1NJI O;  1RBR A;  5GAG P;  4FYD A;  4CJQ A;  3AVN A;  5EXW A;  4DG1 A;  1VRQ C;  1NWK A;  2P8T A;  4LF7 K;  3SPZ A;  3J7Z O;  3VEV A;  5HBM A;  3Q7B A;  1YIJ N;  2KZZ A;  3LAN A;  1M1K O;  1R9T K;  3SMP A;  3T69 A;  3S1R K;  3I4N C;  3AY9 A;  4FJ7 A;  1YJN N;  3RTV A;  3LPU A;  2HHX A;  3VA0 A;  3NGZ A;  5E84 A;  3RSE B;  3WQT A;  4IFV A;  3NVM A;  4Y52 C;  2I7N A;  2I7P A;  2HHW A;  2ATQ A;  1EO1 A;  1VQN N;  2W7V A;  1KVA A;  2VQE K;  4CJ5 A;  1JXB A;  2G8F A;  4QS7 A;  4CW7 B;  1RDC A;  4A3D C;  1XHX A;  4YOV A;  3GG4 A;  1S5J A;  3AV9 A;  3BF3 A;  5C2D A;  4A62 A;  3AQP A;  4CED A;  4AQY K;  2Y0S L;  1TWH A;  4A57 A;  4JKD A;  3CAG A;  4CHO A;  2P9I A;  1MU2 A;  3RMD A;  3LAP A;  4BR4 A;  1JLF A;  1ASU A;  4CEA A;  3JXU A;  1S1X A;  3NE6 A;  2ZGZ A;  1GLD G;  3KK2 A;  3HST B;  3OYC A;  2OPR A;  3N4P A;  3CCR N;  4CJS A;  5J2N A;  4FZY A;  3PO2 C;  4OKE A;  4B1Y B;  1YX2 A;  4M7X A;  3D2E B;  4ILG B;  1RBV A;  4YDU A;  3MN6 A;  3HKZ L;  3TPQ A;  4DQ8 A;  4YOU A;  1ATS A;  3JYT A;  1BS2 A;  5IYB K;  4H4M A;  4OLB A;  4C2M C;  2NVQ K;  3CCS N;  1KLM A;  3A8Y A;  1TWH C;  4M3U A;  2YI1 A;  3SZZ A;  3FZF A;  1T03 A;  1JKH A;  1TWA K;  1VSM A;  4YG2 A;  4NCA A;  4ZH4 A;  3MEG A;  3EQL A;  1DGK N;  4CJ4 A;  4LR2 A;  3BUZ B;  3FFK B;  2HMI A;  4A3D K;  3P4I A;  3MN7 A;  4Q0B A;  4DTO A;  1INN A;  3GTO K;  1RU0 A;  1ATN A;  5HOO A;  2A68 A;  5FPE A;  4DLG A;  4CZI A;  3PX4 A;  1TWF K;  3HI0 A;  4BGB A;  4DR7 K;  3RSE A;  4FLW A;  5GAH P;  3GTM K;  1JVI A;  4A3K K;  4M42 A;  1TWC C;  4FLT A;  2ZJQ L;  1KFS A;  1XPP A;  5SZT A;  1EP4 A;  2QKB A;  3J7A P;  5C3E K;  4Q4Z A;  3TTG A;  4DR1 K;  2CH6 A;  3G4A A;  2D0O A;  3HP6 A;  3DWL A;  4B9S A;  4K43 A;  2O8C A;  2A6A A;  2E1Y A;  4DQP A;  2IS3 A;  3GTL K;  1KD1 O;  3FOF A;  5AQX A;  1H1V A;  1J6V A;  4C23 A;  4KRE A;  4NO7 A;  3BDP A;  3L2W A;  4BG8 A;  4BG9 A;  5M5W K;  1DCH A;  2QI2 A;  1L3V A;  1XMQ K;  4KTQ A;  4YFN A;  4FOI A;  4LY7 A;  3H45 C;  4KFB A;  2FSK A;  3MXI A;  1S6Q A;  2F96 A;  3C6T A;  3HOW K;  1XWL A;  4ISE A;  5EVZ A;  3M4O C;  2GSU A;  4JI8 K;  1YF5 L;  3C6A A;  1X31 C;  3PY8 A;  3MX2 A;  2IC3 A;  1HNI A;  2E2J C;  1HQM A;  3NFA A;  5M5Y K;  4R79 A;  4CFA A;  2IIR A;  4DQI A;  3DXM B;  4RMF A;  1VAZ A;  4CBW A;  4CF9 A;  4JKA A;  3S16 C;  4AHC A;  1OVQ A;  2HNY A;  3HVR A;  4ZHR A;  4FCY A;  4X62 K;  4X6A K;  3AVF A;  3V6D A;  1A5X A;  4LF4 K;  2JWK A;  3CIP A;  3TSU A;  3FZL A;  4C3J K;  3FLC O;  4N47 A;  3VGK A;  4CEZ A;  4ICL A;  1YTU A;  3PO5 A;  3ZT1 A;  1B92 A;  3KHY A;  4OKK A;  1E3M A;  5IYB C;  2VG5 A;  4CJF A;  4BXX C;  2W42 A;  1N5Y A;  4CF8 A;  1USO A;  5D3G A;  2Q31 A;  1BGX T;  4PUO A;  2E2H A;  1WCM K;  3G10 A;  2UUA K;  1J6W A;  4DTR A;  4W5O A;  2W6K A;  4RTF D;  3FOE A;  4E7H A;  5C12 A;  4IO9 L;  3AVB A;  1BHL A;  5JMV A;  4EZ6 A;  3R9P A;  3ZT2 A;  3DXK A;  3U9D A;  3KVG A;  3M4O K;  3VES A;  2P9P B;  1BCM A;  1IBL K;  4DMN A;  4BY7 K;  5AQR A;  1HYS A;  4YFX A;  1RTD A;  3PO3 C;  3CYM A;  4DUZ K;  4FM2 A;  1HRH A;  4DU4 A;  4FVU A;  4B9N A;  4LF8 K;  4A3F K;  1ZXO A;  2P9K A;  4JI3 K;  1EWQ A;  3E66 A;  3P5J A;  2RN2 A;  3LWM A;  1WCM C;  3T00 A;  1WQG A;  3PUF A;  1SQK A;  3LZJ A;  3G0Z A;  3GTM A;  3M8P A;  1L0W A;  1Z25 A;  3F9K A;  5FPM A;  5JVO A;  3I8D A;  2ZUE A;  3R1X A;  1W2B M;  3HOV K;  1VHX A;  1TYQ B;  1YCL A;  4M7Y A;  3H3O B;  3AVM A;  1E4G T;  5M1Q A;  1JL2 A;  4WQ4 A;  4CD3 A;  1S1T A;  1K8A O;  2F4V K;  1D5A A;  4EHT A;  3HXA A;  4A3B K;  3MCA B;  3HOU C;  4GKJ K;  2J4R A;  2CGL A;  4DB3 A;  1HPM A;  2RH6 A;  1TKX A;  4AYB D;  1KTQ A;  5HRP A;  4XIU A;  1UAX A;  4IG3 A;  5BRF A;  2FBT A;  3UKR A;  4GZY A;  3PIO L;  3ZX3 A;  5F1X A;  2WTU A;  3MEC A;  2D0B A;  2AP1 A;  2KWA A;  3M1F A;  4M45 A;  2O8B A;  2E8A A;  2ZFZ A;  4KB0 A;  2QW9 A;  3SUQ A;  3O4W A;  4ILD A;  1YI2 N;  4CEQ A;  4IFE A;  3VGM A;  5KTQ A;  1PJ6 A;  3L4J A;  3CQY A;  4E7J A;  4W5R A;  5CJ9 A;  3J7Y P;  3WXM B;  3FGU A;  2F7T A;  4CZG A;  4OVL A;  3HJF A;  2B5J A;  5CHI A;  3HP9 A;  3AGR A;  1VSE A;  3D45 A;  1NK5 A;  4B1V A;  3P39 A;  4MQ3 A;  3DOL A;  2HVH A;  3CJC A;  4GV3 A;  1KVB A;  5C10 A;  1YIT N;  1BI4 B;  3UIQ A;  2QXF A;  2NRR A;  1NLV A;  4LSN A;  3O08 A;  3K7A C;  3ZSZ A;  3NAE A;  1LCU A;  4BRE A;  4LFA K;  4XSZ A;  5AR0 A;  1GLE G;  4KO0 A;  4KB4 A;  2O4I A;  4AM7 A;  1K73 O;  2R92 K;  2A41 A;  3L8B A;  4JI4 K;  1C0F A;  1JCF A;  4ELV A;  3CC2 N;  2BE5 A;  4BRL A;  2VUM K;  1HPZ A;  5EY4 A;  5FJ8 K;  1EWR A;  2YHB A;  5IOS A;  1EXQ A;  1AB4 A;  1BIU A;  5TMF A;  3KLE A;  4H0V B;  2NVQ C;  3TAN A;  3VET A;  4HHT A;  2W41 A;  3R6M A;  5IOT A;  4PKG A;  1N34 K;  4A93 C;  2E2H K;  4GNI A;  3KLI A;  3V4G A;  4DQQ A;  1Y1W A;  2NUB A;  3V1R A;  5C4X K;  2YHA A;  4ELT A;  2R92 A;  3TTC A;  2KQ2 A;  2D1K A;  4UY8 O;  3KTQ A;  4BRG A;  3OYG A;  4YOR A;  3BP8 A;  1TK8 A;  3CFR A;  2ZM6 K;  2P5M A;  4A3E K;  1IKX A;  3TAM A;  3MDQ A;  4CJT A;  1Q7Y O;  3NH0 A;  2NRX A;  1GOB A;  4BRC A;  4H0P A;  2P9N A;  2ZQB A;  1FKO A;  3IS9 A;  2CFA B;  1U6Z A;  4JKH A;  3RVC A;  4AF1 A;  2EBB A;  1VQ8 N;  2NLX A;  1HYZ A;  3ZEU B;  1J5O A;  2FC0 A;  3AVA A;  3KKR A;  4IKF A;  4BY7 C;  4Z4G A;  1X3M A;  1SL2 A;  1CZB A;  1BA0 A;  2RE2 A;  3BGR A;  3THY B;  2EX3 A;  5AZI A;  1K8K B;  5AQN A;  3S3M A;  4OPJ A;  3ZSX A;  1PJ5 A;  4CJL A;  1WOS A;  3O9Q A;  2G8U A;  4JI1 K;  1BIZ A;  1XHZ A;  5TJ3 A;  1TWC K;  3RR8 A;  2GAG C;  2JA6 K;  4ZTF A;  1QQC A;  1VSH A;  3HKZ D;  2O8E B;  2KTQ A;  3JS6 A;  4DSK A;  4MO4 A;  4E89 A;  2BDP A;  4AHU A;  3D0P A;  4BGA A;  1TWF C;  4Y7N K;  4B9M A;  4H4O A;  1YHQ N;  1P90 A;  1NJZ A;  1S1U A;  2E2Q A;  3HOZ C;  4Y0W A;  4HCB A;  1WN7 A;  3OJU A;  3A0I X;  4JI0 K;  4W5N A;  3THY A;  2ITM A;  3H3V D;  3RZO C;  2D4W A;  1SS6 A;  4BRN A;  4F3T A;  3KLF A;  2NVT K;  1TWH K;  4CIE A;  1Q81 O;  3KK7 A;  3R8E A;  2Y0S D;  5M3F K;  4CK2 A;  5BPM A;  4JAX A;  1J9A A;  2GUP A;  2F8S A;  1B9D A;  2CFA A;  5TKW A;  3ZLJ A;  3I4M K;  3CM5 A;  1GLC G;  3EKS A;  1NMD A;  4A5A A;  2FSJ A;  2W40 A;  2YJE A;  4I2Q A;  4B3M K;  3GEE A;  3ZSR A;  2JA7 K;  3DXJ A;  2YU9 K;  3L2V A;  3PX0 A;  4JYA K;  4A93 K;  2ZE2 A;  4DTU A;  4B9L A;  4BVO A;  2ZJP L;  4QIW L;  1XXA A;  3O1W A;  2GAH C;  3SBG A;  2P9U A;  4KHW A;  2NRV A;  1QQM A;  5IP7 K;  1E4F T;  4FLV A;  2Q1N A;  4Y1C A;  1EK8 A;  4GY2 B;  4O5F A;  1QVG M;  1XZQ B;  1A5W A;  3KD1 E;  1WBB A;  5C4J K;  4AHT A;  3IDH A;  5F0X A;  1ASV A;  1YVU A;  1NK4 A;  4FJK A;  1TWA A;  1C0U A;  2A1R A;  3H08 A;  3VF4 A;  4IZ9 A;  3CCU N;  4A3F C;  3HOZ K;  5HL8 A;  5DK5 A;  3GTK C;  3WT0 A;  1NJY A;  5AQV A;  4FSV A;  2D0P A;  3FR0 A;  1WSV A;  1JL1 A;  2HOE A;  2ZGY A;  1L3U A;  1ITG A;  3VQ6 A;  1WUA A;  3ZSY A;  1HYV A;  4QS9 A;  4RWT A;  3O3F A;  3OS0 A;  3THX B;  2KKZ A;  2E6L A;  5BR8 K;  4IJN A;  3C65 A;  3OYK A;  1RDB A;  5AQH A;  3S1N K;  1NK6 A;  1NJX A;  2YNI A;  1UA0 A;  1RTH A;  5CYQ A;  5M1P A;  5ADX A;  3AD7 C;  3DRS A;  5JLH A;  3VQ4 A;  3V9S A;  3CJ7 A;  2DTU A;  4MLE A;  4FM1 A;  3QEI A;  3GTG K;  3LM2 A;  3S41 A;  3UE5 A;  4I6M A;  1LWC A;  3A8J A;  3O9T A;  1K83 K;  3S14 C;  4GMJ B;  4R5P A;  2QWQ A;  3WXJ A;  1J6Z A;  3GTG C;  2PMZ D;  4KTW A;  3SNN A;  4B3O A;  4J2B A;  3N0B A;  1RT1 A;  3AAP A;  3S2D K;  3ZCM A;  3FFI A;  4DKW A;  4CJE A;  5H1S Q;  4E1J A;  1F7V A;  1HJO A;  4QOZ B;  1C1A A;  2HF3 A;  1I6H C;  4KMU A;  4NXN K;  3AO1 A;  5KPR A;  3S1M C;  3AD9 C;  5AQI A;  3WUH A;  3OEP A;  3U3G A;  2P5O A;  2HHT A;  4G7O A;  1DCO A;  3MED A;  1S9G A;  4FWN A;  4B3R K;  4BRH A;  5LMN K;  4G0V A;  2Q97 A;  4LF9 K;  2O5I A;  3GOI A;  3K5M A;  1HNZ K;  3LPT A;  5D4D A;  2NRT A;  3CMA N;  4BRF A;  2Y3P A;  4C45 A;  1RDD A;  3T1H K;  1C0M A;  3VEO A;  3CQ8 A;  2R92 C;  1D9D A;  3WXK A;  1NGF A;  1NGJ A;  1WSE A;  4XCH A;  1IV0 A;  1DEJ A;  5AQG A;  3S3N A;  1YXQ A;  2OTL N;  4Y7N C;  4M41 A;  4CJ7 A;  4KI6 A;  2DPN A;  4CEB A;  4BAC A;  2HW3 A;  4M3R A;  3QX3 A;  4FM9 A;  2O8D B;  4Z4F A;  1P8Z A;  1WOO A;  4YFK A;  5JVG L;  3OHR A;  3AA2 A;  4Q5S A;  4DR2 K;  3NMU A;  5CZ1 A;  3O8M A;  1GOC A;  1NGI A;  2YU9 C;  4FK0 A;  2QTD A;  2P51 A;  1RDA A;  4DV3 K;  1IH7 A;  2UXD K;  5I3U A;  3ENB A;  4PKH A;  3SV4 A;  1XZP A;  4FWL A;  2RKI A;  4ZTJ A;  2HBK A;  3PX6 A;  3SQ1 A;  1ATR A;  4BDZ A;  4K0K K;  3DXK B;  4FWK A;  1NK9 A;  4CGJ A;  1VRU A;  1RBS A;  3HOW C;  3TAQ A;  3QER A;  3Q7C A;  3UKR B;  1T6D A;  5J1E A;  3L2U A;  2PA8 L;  1VK0 A;  1D8Y A;  4B1Z A;  3K5N A;  1IG8 A;  3U6F A;  4KMH A;  4E1N A;  3T3F A;  2WUS A;  1IO2 A;  2YKN A;  3SQ2 A;  2XY7 A;  1LAV A;  4FPB A;  2PAV A;  3WEE A;  4IDH A;  4PAB A;  3ZET B;  2YHY A;  3FKI A;  1O25 A;  4LJZ A;  2Z1I A;  2ZJR L;  3M3Y K;  1HQE A;  3CQZ A;  2P5G A;  1HR0 K;  3QFU A;  2A1S A;  2NVX K;  3B6P A;  1ZBU A;  5AQT A;  4AH9 A;  1DT9 A;  2ZF5 O;  5AQU A;  3MAQ A;  4U7B A;  4A59 A;  4CIG A;  3F73 A;  3OYM A;  4JHD B;  3KK1 A;  3VQ7 A;  1S6P A;  4CI6 A;  3DLK A;  1L3S A;  1RGI A;  2VWJ A;  2V6U A;  1HNX K;  4DV4 K;  3TI0 A;  4H5V A;  4JK9 A;  1N33 K;  3AA3 A;  1IBK K;  2VGN A;  5AFU A;  2ZWH A;  3V9U A;  4FZB A;  3H6E A;  1QSS A;  1O2A A;  3CM6 A;  3J8A A;  4GTF A;  3VEY A;  4I9L A;  2Q0R A;  2YHW A;  5HRN A;  3WXL A;  1VJE A;  2V6S A;  2KW4 A;  3VEW A;  3MX5 A;  3S2H C;  1YUW A;  3NF9 A;  3CCJ N;  4C1N K;  3K58 A;  1L5U A;  2YU9 A;  4G7Z A;  3DLB A;  3EL2 A;  1YT3 A;  3KK3 A;  4M3X A;  2AJQ A;  5AQP A;  2YJF A;  1IL2 A;  2E20 A;  3VEZ A;  4OIQ A;  4JNE A;  4NYN A;  5C15 A;  4Q5V A;  5HLF A;  5B8H A;  4Z4E A;  3S15 C;  4B8C A;  4CJ3 A;  1I39 A;  3SUN A;  2DFF A;  1VLO A;  2V7Z A;  2HND A;  3MXJ A;  4FWS A;  1ZC6 A;  4OJR A;  1KQS M;  4CCH A;  2AA4 A;  4HTL A;  4BC3 A;  3TSQ A;  4AHS A;  4DU3 A;  1NKC A;  2GSO A;  4H5W A;  2EHG A;  4KB2 A;  3IMX A;  1G99 A;  1NGE A;  4FK4 A;  1J6X A;  4RW6 A;  1JCE A;  2VWB A;  2HF4 A;  1T44 A;  2CH5 A;  4FJ9 A;  3G71 N;  3OPF A;  3OYI A;  5E68 A;  1TL1 A;  2W6L A;  5IP9 C;  4B1W B;  1WSH A;  2FLO A;  5C2F A;  3CJB A;  3OYD A;  3QEW A;  4BBR K;  2XCO A;  2UXB K;  4CGD A;  3WNG A;  4CEO A;  2A42 A;  3G4S N;  3VQB A;  4GTC A;  2ASM A;  3K9K A;  3LP2 A;  1OH5 A;  1RTJ A;  4DR6 K;  1KAZ A;  3BP8 C;  3SUO A;  3K57 A;  3ASM A;  4W5Q A;  1OH7 A;  1F7U A;  2HBJ A;  5IWA K;  1IQ0 A;  3ITH A;  3CXC M;  4KAW X;  3SAF A;  4B3T K;  4WFB L;  4FJX A;  4KI4 A;  3GIR A;  5AJ3 K;  4GKK K;  3K0S A;  4GFQ A;  1X9M A;  2R7Z C;  3IKM A;  3M5R A;  3U4L A;  3CF5 L;  3I0R A;  5M5X K;  1QVF M;  1TKD A;  3P31 A;  3SUP A;  4G0W A;  3A5N C;  3MWT A;  4A3L K;  5ADX H;  4DV6 K;  4OX9 K;  2FF6 A;  3A5L C;  1I3A A;  4OPA A;  1QZ5 A;  1HQU A;  4KAS A;  1HKG A;  3PSI A;  2X6N A;  4G7H A;  3LP0 A;  4KPY A;  3QBX A;  5HP1 A;  4EP4 A;  2BE2 A;  2HVI A;  5FLM C;  1DTT A;  1RT3 A;  4YOT A;  3AVG A;  1X1P A;  1VQ9 N;  1JLG A;  1TAU A;  2WAQ L;  4AYB L;  1XXC A;  4LH5 A;  4B8A B;  3HOT A;  3VEN A;  4F3O A;  3EZ5 A;  3EKU A;  3HOY K;  5AQZ A;  4RCH A;  3VPZ A;  3LL3 A;  5IYD C;  2YNG A;  3QIO A;  4A3K C;  3I55 N;  1NGH A;  4C8N A;  4LSL A;  3UKU A;  4CZM A;  1Q86 O;  1N36 K;  2HHV A;  1IW7 A;  2FBV A;  3HPH A;  3TR8 A;  4BC2 A;  3E9P A;  4KV8 A;  4NCG A;  5FDL A;  2QWO A;  4DR3 K;  1NBW A;  3LWL A;  3CCE N;  1NOZ A;  1JLA A;  1Y97 A;  3IPJ A;  3DLG A;  5AZJ A;  5HRR A;  3VQE A;  3OJS A;  1X9W A;  1FW6 A;  1S72 N;  1Z26 A;  1QS4 A;  3NCI A;  2E2O A;  1CXU A;  3B6O A;  1NGG A;  3PO3 K;  1KCF A;  2UUB K;  3VTH A;  1TV6 A;  3V1Q A;  5AQW A;  1NK7 A;  2FF3 B;  2P9I B;  3C6U A;  3CME N;  5FRM A;  2E2I A;  4EAH D;  4KMA A;  3CFP A;  1MDU B;  2ZD1 A;  3SLC A;  3CPW M;  1SL1 A;  3RMB A;  2P9P A;  1HI9 A;  3PO4 A;  1HKC A;  4CJR A;  4XSX A;  2QM1 A;  4FLY A;  5HRO A;  3CCM N;  3FE1 A;  2E2H C;  3VGL A;  5LL6 Z;  4PHT X;  3OYJ A;  4M3W A;  3VTI A;  3ZT0 A;  1XZP B;  4LH4 A;  1EQY A;  1SKW A;  3M6G A;  3DRP A;  4BR9 A;  2LSN A;  1QE1 A;  1UV7 A;  4OPK A;  3V9Z A;  4JLH A;  2PA8 D;  2YNH A;  4LD0 A;  1VGX A;  2PFU A;  4KN7 A;  5FLX O;  5M1N A;  1XC9 A;  3N0C A;  3O4N A;  4H8K A;  3VQP A;  1F21 A;  4B3S K;  3O9U A;  3NUH A;  1T7P A;  1QHT A;  1BQN A;  4DSE A;  4DTM A;  1GOA A;  1PJ7 A;  1VH2 A;  2JA7 C;  2QWP A;  1UWB A;  4KRF A;  3K5O A;  1Q9X A;  2Q3S A;  2R7Z K;  4CD1 A;  4FJG A;  4G9Z A;  3G25 A;  5EGH A;  2CGK A;  5EU7 A;  3EO3 A;  2P9S A;  2XCQ A;  3O9R A;  3TTD A;  4BRD A;  3CI5 A;  1G51 A;  1EKE A;  3LAM A;  4N41 A;  1JJ2 M;  3GL1 A;  5T7B A;  3Q3Q A;  4DTX A;  2HHQ A;  3HBT A;  3OW2 M;  1QQO A;  3C6H A;  4IJA A;  4A3J C;  5CYM A;  4LLG A;  4FJN A;  1BI4 A;  1HX1 A;  1UOC A;  2IGI A;  2B63 A;  3HT3 A;  3PSF A;  2O8F A;  3GSI A;  5BN8 A;  2GWK A;  4FW2 A;  2NZT A;  1Q8I A;  3EZW A;  3TAR A;  4CE9 A;  2YCH A;  5AFU H;  1XZQ A;  3AAR A;  4A3B C;  2HB5 A;  2FQT A;  3BY5 A;  3HL8 A;  1J98 A;  3H3V L;  2EWS A;  4O0J A;  3ZYY X;  4DFP A;  3HOS A;  1TWF A;  1VSL A;  2G8V A;  5E26 A;  3H0G A;  4OGE A;  2VCP A;  1NMN A;  2JA8 C;  3EE8 A;  3HOV C;  1I6H K;  3VQQ A;  2XCR B;  3OYN A;  1VQ4 N;  1QSL A;  4BWM A;  3SYZ A;  3GTL A;  4KKO A;  1Q9Y A;  3QES A;  4UQG A;  3RR7 A;  5AQQ A;  2JWL A;  4GTB A;  2FBY A;  3LDP A; 
#chains in the Genus database with same CATH homology
 4IJN A;  3FZH A;  3C65 A;  3AAQ A;  4A57 A;  4JKD A;  1NGB A;  5EGE A;  5AQH A;  3DLL L;  3CAG A;  2P9I A;  4M1X A;  1GE9 A;  1Q82 O;  3LAP A;  3MWP A;  3GE1 A;  4BR4 A;  5GIP A;  4OO1 J;  5M1P A;  5ADX A;  4BRK A;  4BRP A;  1BUP A;  4P5B A;  3D2F A;  4DHY A;  5JLH A;  3JXU A;  3CJ7 A;  4GV6 A;  4MLE A;  2ZGZ A;  3MML B;  1GLD G;  3O1B A;  2BUP A;  1V4S A;  2VGM A;  3L4Q A;  4CZL A;  3LM2 A;  3S41 A;  3UE5 A;  4I6M A;  2HST A;  5F2R A;  5BRE A;  2KLA A;  1O27 A;  1W97 L;  3N4P A;  3O9T A;  3CCR N;  1KC8 O;  1B4A A;  3F5T A;  4BKW A;  3ORE A;  2QWQ A;  3MK6 A;  3D7E O;  4B1Y B;  3WXJ A;  1J6Z A;  4M7X A;  4C3J C;  1VQK N;  5HL7 L;  3D2E B;  4ILG B;  3SMS A;  3O9S A;  2FXU A;  3T7Z A;  4YDU A;  3MN6 A;  1WQF A;  2BH1 A;  5AQJ A;  3TPQ A;  4DQ8 A;  3AAP A;  4YOU A;  3N0B A;  1ATS A;  4DKW A;  2H3G X;  4C2M C;  5H1S Q;  3CCS N;  3FHZ A;  2GSN A;  4E1J A;  1VQM N;  1LOT B;  3A8Y A;  2HBL A;  1HJO A;  4PL8 A;  3LM9 A;  2HF3 A;  2YI1 A;  3FZF A;  1CZA N;  5AZI B;  5KPR A;  4FWR A;  4XH4 A;  5AQI A;  3WUH A;  4C1N I;  4JKG B;  3OEP A;  5DM7 L;  1X3N A;  4J3N A;  5GAE P;  1DGK N;  5EX5 A;  4LR2 A;  3BUZ B;  3FFK B;  2RGR A;  1K83 A;  1YAG A;  3A5M C;  3P4I A;  3MN7 A;  4FWN A;  4KH5 A;  4BRH A;  5I9E B;  4G0V A;  2Q97 A;  4BR5 A;  5GAD P;  3GOI A;  3E9O A;  1ATN A;  5HOO A;  1O28 A;  2NRT A;  1XQS C;  2QWM A;  5FPE A;  3CMA N;  4CZI A;  4BRF A;  2Y3P A;  3HI0 A;  4BGB A;  3GTO A;  5AQS A;  3RSE A;  2P9L B;  2WC9 A;  4FWQ A;  4WYB A;  3VEO A;  5GAH P;  1R9T A;  2P9S B;  5CR4 A;  3WXK A;  1NGF A;  1NGJ A;  4C3H C;  1DEJ A;  3OBY A;  1KXP A;  4FL9 A;  5AQG A;  2GTD A;  4JHD A;  4EHU A;  3B8A X;  1YXQ A;  3LDN A;  4JK7 A;  2OTL N;  4BY9 C;  2ZJQ L;  4GV9 A;  3ENH A;  4CJ7 A;  3D6R A;  2DPN A;  1O26 A;  3QX3 A;  1BA1 A;  4FM9 A;  1NGD A;  3K9J A;  5BRH A;  1YJW N;  3DJC A;  2CH6 A;  1P8Z A;  3HRG A;  3G4A A;  3I8B A;  4CZH A;  5JVG L;  4GTD A;  2D0O A;  5IOR A;  3DWL A;  3OHR A;  4K43 A;  3NMU A;  4PKI A;  4U67 L;  2A6A A;  2E1Y A;  3O8M A;  1NGI A;  1MA9 B;  4BRA A;  3AGK A;  2QTD A;  3O80 A;  1KD1 O;  4IOA L;  5AQX A;  3FOF A;  1Y64 A;  4CZJ A;  1H1V A;  4WQ5 C;  3VEX A;  2QXL A;  3ENB A;  4PKH A;  4C23 A;  4K25 A;  4NO7 A;  4FWL A;  4JKC A;  4BRQ A;  1K8K A;  2HBK A;  1WIH A;  4L3Q A;  4GTA A;  3AQO A;  3MN5 A;  1GLF O;  4BG8 A;  1ATR A;  4BG9 A;  3DXM A;  3DXK B;  3ZET A;  3GBT A;  4FWK A;  3BF1 A;  2QI2 A;  5FPD A;  2NNW A;  3CC7 N;  3O6W A;  3WEE B;  2OAN A;  4FOI A;  3H45 C;  3Q7C A;  4H03 B;  2NRZ A;  3UKR B;  4H0Y B;  4KMD A;  2R7Z A;  2FSK A;  3I56 N;  1T6D A;  1BO5 O;  1Y1V A;  2A5X A;  1NM1 A;  4BR0 A;  4B1Z A;  1SFO A;  4ISE A;  3CER A;  1IG8 A;  4JK8 A;  5EVZ A;  1WQH A;  1YF5 L;  2GSU A;  3C6A A;  3G4C A;  4GTL A;  4KMH A;  2WUS A;  3MX2 A;  3GTG A;  4YOY A;  3GTQ A;  3C7N B;  4FPB A;  3WEE A;  2PAV A;  4IDH A;  3G6E N;  3ID8 A;  4R79 A;  2IIR A;  4H0O A;  3DXM B;  2YHY A;  3ZET B;  3FKI A;  1O25 A;  1VAZ A;  1X9J A;  4CBW A;  2ZJR L;  4BRO A;  4JKA A;  3CQZ A;  4C3I C;  1I3Q A;  3QFU A;  3H1V X;  3SK3 A;  5JFE A;  5M1K A;  5AQT A;  1DT9 A;  1Z6R A;  2ZF5 O;  5AQU A;  1TWG A;  1VQ6 N;  2JWK A;  3CIP A;  3TSU A;  1F9N A;  3ERE D;  3MMV A;  2HMP A;  4KH6 A;  2JA5 A;  3FZL A;  3TTF A;  4K41 A;  4KH4 A;  5EOY A;  4A59 A;  4U7B A;  3FLC O;  3VGK A;  3CCV N;  1EH1 A;  4JHD B;  1Q18 A;  1B4B A;  3WXI A;  3KHY A;  4CI6 A;  3E1Y A;  1RGI A;  3D2F B;  4IEE A;  3GDQ A;  3CPE A;  4H5V A;  4JK9 A;  4DCH A;  2E2P A;  2Q31 A;  4Z94 A;  5BR9 A;  2E2H A;  2VGN A;  5AFU A;  2ZWH A;  1VQL N;  2JH3 A;  5IOQ A;  4FZB A;  3H6E A;  1O2A A;  1VQ7 N;  4RTF D;  4EIA A;  3J8A A;  1KQ4 A;  5KQ8 A;  3L6Q A;  3F2K A;  4GTF A;  2WFB A;  3VEY A;  3FOE A;  3L4K A;  4M63 C;  5AQF A;  1U2V B;  5C12 A;  4IO9 L;  4BRM A;  2Q0R A;  2YHW A;  5JMV A;  3WXL A;  4EFH A;  3R9P A;  3L4I A;  3VEW A;  4CBU A;  3IUC A;  3MX5 A;  5BN9 A;  1YUW A;  2V52 B;  3HSC A;  3DXK A;  3U9D A;  3L0Q A;  3CCJ N;  2ASP A;  4C1N K;  2YU9 A;  1O13 A;  3KVG A;  4O8K A;  4WFA L;  4CZF A;  1O24 A;  2VUM A;  3VES A;  1MWK A;  2P9P B;  2JA6 A;  3EL2 A;  3QBW A;  3U8X A;  5AQP A;  2YJF A;  5AQR A;  2E20 A;  3VEZ A;  2QEX N;  4JNE A;  5C15 A;  3O5B A;  1YJ9 N;  4P5A A;  4G0U A;  1WOQ A;  1HUX A;  3MCP A;  5ELZ A;  1QQN A;  5B8H A;  4FVU A;  1HLU A;  5TKY A;  5GIN A;  1ZXO A;  2P9K A;  4GT9 A;  4F9O A;  3E66 A;  1WQG A;  2V7Z A;  1IJJ A;  1SQK A;  5MLC Q;  4FWS A;  4GVE A;  3VA7 A;  3GTM A;  3QB0 A;  3ENO A;  2CGJ A;  1ZC6 A;  3VF6 A;  5FPM A;  4B9Q A;  5JVO A;  3S0X A;  3QML A;  1TYQ A;  3R1X A;  1W2B M;  1KQS M;  2AA4 A;  4HTL A;  1TYQ B;  4BC3 A;  1NGC A;  3H3N O;  2P9K B;  3TSQ A;  4M7Y A;  2GSO A;  4H5W A;  4KB2 A;  2YHX A;  3IMX A;  3H3O B;  1BGW A;  4AM6 A;  1E4G T;  4ILH A;  1G99 A;  5M1Q A;  3UB5 A;  2E2N A;  1NGE A;  4WQ4 A;  3ULE B;  4CD3 A;  2VYP A;  1SZ2 A;  3CJ9 A;  3HZ6 A;  4EHT A;  4BC5 A;  1JCE A;  2VWB A;  5JLF A;  3VF2 A;  2HF4 A;  3MCA B;  1T44 A;  2CH5 A;  3N3Y A;  4IOC L;  1RDW X;  3FZK A;  4WCE L;  3G71 N;  3OPF A;  1D4X A;  2J4R A;  2CGL A;  3CQX A;  3KWG A;  1HPM A;  4DB3 A;  2RH6 A;  1MWM A;  4B1W B;  1GLJ O;  4J8F A;  2FLO A;  5C2F A;  3CJB A;  4MDA A;  5AQY A;  4A61 A;  3U9Z A;  5BRF A;  5AQO A;  3UKR A;  1VQO N;  3ATV A;  2XCO A;  4KAT A;  3ZEU A;  1S3X A;  3ZX3 A;  5KQD A;  5F1X A;  3PIO L;  2NRH A;  3G4S N;  2A42 A;  2KWA A;  2AP1 A;  4GTC A;  2ASM A;  3M1F A;  2E8A A;  3K9K A;  2ZFZ A;  2JA7 A;  4DDQ A;  1S22 A;  1I50 A;  2QW9 A;  4JEP A;  3TU5 A;  1KAZ A;  1VQ5 N;  3FZM A;  3O4W A;  4ILD A;  1YI2 N;  5BPN A;  4IFE A;  3VGM A;  4A5B A;  1U2V A;  3ULE A;  3CQY A;  3L4J A;  2HBJ A;  4KBO A;  1DKG D;  5FPN A;  5CJ9 A;  3CXC M;  4KAW X;  1TUU A;  4IO8 A;  3SAF A;  4WFB L;  4FO0 A;  3WXM B;  1DD5 A;  3FGU A;  2F7T A;  2QWL A;  4CZG A;  4GFQ A;  3IKM A;  3M5R A;  3U4L A;  3CF5 L;  1SAZ A;  5CHI A;  3EN9 A;  1QVF M;  3NVK A;  3AGR A;  2QWN A;  4MDB A;  3P31 A;  4FWP A;  4IEI A;  5CE3 A;  4B1V A;  1JCG A;  4G0W A;  3A5N C;  5BPL A;  3MWT A;  3P39 A;  5ADX H;  2ASO A;  1NGA A;  5LJW A;  4JN4 A;  2P9U B;  3LDQ A;  4BQL A;  3SAH A;  2FF6 A;  3CJC A;  3A5L C;  1KAY A;  4FOE A;  5C10 A;  4GV3 A;  4JD2 A;  1YIT N;  3GTJ A;  4OPA A;  1QZ5 A;  3R3L A;  2NRR A;  2QWR A;  5AZJ B;  1NLV A;  3CCL N;  3PLA A;  4BRI A;  4KAS A;  3O08 A;  1HKG A;  3F9M A;  1XUP O;  4XH1 A;  5KPT A;  5KPZ A;  1LCU A;  4BRE A;  3W3D A;  3QBX A;  3SAG A;  3OBW A;  5AR0 A;  1GLE G;  4XH5 A;  4KB4 A;  3KWI A;  4MLH A;  4YOT A;  4AM7 A;  1K73 O;  3VMF B;  2A41 A;  4BQZ A;  2Q36 A;  1VQ9 N;  4FPA A;  3CHW A;  1C0F A;  3QDK A;  2UYT A;  3UKU B;  1JCF A;  1K8A O;  3CD6 N;  3CC2 N;  5C0Y A;  4BRL A;  1XXC A;  1ZVU A;  5EY4 A;  3HOT A;  3E9L A;  3VEN A;  3EKU A;  5IOS A;  5AQZ A;  4RCH A;  1QHA A;  3VPZ A;  5LY3 A;  5JVH L;  4LC9 B;  3LL3 A;  1AB4 A;  4H0V B;  3I55 N;  3SJH A;  3IFR A;  3LPX A;  1NGH A;  2GX9 A;  2Q0U A;  2E88 A;  3HM8 A;  3UKU A;  3VET A;  4CZM A;  1Q86 O;  2IVP A;  2W41 A;  5LJV A;  4JKG A;  3BEX A;  3R6M A;  5IOT A;  3P38 A;  1ZBS A;  2FSN A;  3CJA A;  3E9P A;  4PKG A;  4BC2 A;  3BUE A;  1RFQ A;  4BR2 A;  3CCQ N;  4GNI A;  3D2E A;  2QWO A;  3V4G A;  1NBW A;  3CCE N;  2E1Z A;  4CZK A;  1V4T A;  4NLB A;  5AQL A;  5BRD A;  4KM9 A;  4BC4 A;  5AZJ A;  1Y1W A;  2R92 A;  4ILJ A;  2GEL A;  3TTC A;  3SBT A;  3MN9 A;  4JKB A;  2D1K A;  4OPH A;  4UY8 O;  1T3V A;  4BRG A;  1VQP N;  1S72 N;  4YOR A;  3BP8 A;  4B1X B;  2HBM A;  2NRW A;  4NLC A;  4JKF A;  2R93 A;  2E2O A;  3H1Q A;  4BLA A;  3I33 A;  1NGG A;  5M1O A;  3ZX2 A;  2P5M A;  4KC6 A;  4BR7 A;  3GTK A;  3MDQ A;  3VTH A;  1Q7Y O;  3LDO A;  1GLB G;  3PIP L;  2NRX A;  1OVY A;  5AQW A;  3C7N A;  2FF3 B;  2GWJ A;  2P9N A;  2P9I B;  4H0P A;  4BRC A;  3CME N;  1OKJ A;  3QFP A;  1GLL O;  3A5O C;  4NB4 A;  2E2I A;  4EAH D;  1U6Z A;  2CFA B;  5JIC A;  4KMA A;  4JKH A;  3RVC A;  1YVN A;  1MDU B;  4AF1 A;  1VQ8 N;  3SLC A;  2NLX A;  3CPW M;  1WCM A;  3ZEU B;  4O8U A;  2P9P A;  3ATU A;  1HKC A;  3CJ1 A;  2QM1 A;  1R59 O;  3CCM N;  3CC4 N;  1RDU A;  1X3M A;  3FE1 A;  2V7Y A;  1XXB A;  1BA0 A;  2IVN A;  2RE2 A;  3VGL A;  4PHT X;  1XC3 A;  5AZI A;  3VTI A;  4WQ4 C;  1K8K B;  5AQN A;  3GTP A;  4MO5 A;  2P9N B;  3H46 O;  1EQY A;  4PL7 A;  2NVY A;  3LAJ A;  3M6G A;  3O9Q A;  3W0L A;  1BWF O;  4BR9 A;  2YX6 A;  5TJ3 A;  4BVP A;  1IS1 A;  2PFU A;  3HTV A;  4K42 A;  4IOX A;  5CHP A;  1BU6 O;  2A40 A;  3JS6 A;  5M1N A;  1TWC A;  4MO4 A;  3M3Z A;  4H0T B;  4JD2 B;  4IXC A;  1C0G A;  2QA4 N;  3N0C A;  4BGA A;  2Q2R A;  2IVO A;  3O9U A;  3OA9 A;  4ISG A;  3NUH A;  1YHQ N;  2KHO A;  1M90 O;  1P90 A;  4WF9 L;  1ISE A;  4KDD A;  2QWP A;  3WQU A;  4I6M B;  4CBX A;  4LQY A;  4BLB A;  1K9M O;  4A2A A;  2E2Q A;  4Y0W A;  4KAR A;  3VOV A;  3VER A;  4CD1 A;  5DM6 L;  2V51 B;  1Z05 A;  3G25 A;  4G9Z A;  3A0I X;  2CGK A;  5EGH A;  4H5T A;  3EO3 A;  2P9S A;  2ITM A;  2XCQ A;  2D4W A;  3O9R A;  2RHK A;  3TTD A;  3CI5 A;  4BRD A;  1SS6 A;  2P9L A;  4BRN A;  1BDG A;  1BG3 A;  3AH5 A;  4H5N A;  4WFN L;  4B1U B;  3EE9 A;  5AQM A;  4CZE A;  1KAX A;  2BTF A;  4A2B A;  4H0X B;  1Q81 O;  4H5R A;  3KK7 A;  3R8E A;  1ILY A;  1JJ2 M;  4QS8 A;  3DAW A;  3GL1 A;  2PBD A;  3N4Q A;  5BPM A;  3QIC A;  5GIO A;  3Q3Q A;  4JAX A;  2GUP A;  4HWI A;  1BOT O;  2OTJ N;  3LDL A;  5TKW A;  2CFA A;  2WBN A;  2NVX A;  1GLC G;  4YOX A;  3EKS A;  1NMD A;  4WQ5 A;  4A5A A;  3HBT A;  2FSJ A;  2W40 A;  2YJE A;  3CET A;  1QQO A;  3C6H A;  4XEI A;  3OW2 M;  1N8R O;  3TSP A;  1TUY A;  3KZB A;  4IJA A;  1QZ6 A;  1NJI O;  2F9W A;  5GAG P;  1HX1 A;  2GEM A;  2B63 A;  4BVO A;  5EXW A;  4FWM A;  2ZJP L;  1XXA A;  3O1W A;  1HKB A;  1NWK A;  4IWV A;  5AQK A;  3SBG A;  2P9U A;  5BN8 A;  3J7Z O;  4JKE A;  2GWK A;  3VEV A;  2NRV A;  3C0B A;  4GTE A;  1QQM A;  2NZT A;  3EZW A;  1E4F T;  3Q7B A;  1YIJ N;  3ZX0 A;  2YCH A;  5AFU H;  1GLA G;  1M1K O;  4ISF A;  2Q1N A;  3SMP A;  1EK8 A;  3AAR A;  3T69 A;  2PHC B;  4GY2 B;  4O5F A;  1QVG M;  4YOW A;  3AY9 A;  3IDH A;  5F0X A;  1YJN N;  2EWS A;  3ZYY X;  1O2B A;  2A3Z A;  3HOS A;  1TWA A;  1TWF A;  3ID6 A;  3VF4 A;  1ESV A;  5E26 A;  2F9T A;  4IZ9 A;  5E84 A;  3RSE B;  3WQT A;  3CCU N;  2VCP A;  3H0G A;  5M1F A;  3EE8 A;  3NVM A;  2I7N A;  2I7P A;  2XCR B;  3WT0 A;  1EO1 A;  1VQN N;  4FWO A;  1VQ4 N;  5AQV A;  4FSV A;  2D0P A;  3FR0 A;  3GTL A;  4QS7 A;  1O29 A;  2HOE A;  4KM8 A;  2ZGY A;  1T6C A;  1WUA A;  4YOV A;  3GG4 A;  4QS9 A;  4RWT A;  3BF3 A;  5C2D A;  4A62 A;  5AQQ A;  1BJT A;  3AQP A;  2JWL A;  4GTB A;  2KKZ A;  3LDP A;  4YDU C;  1TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...