1ZXOA

X-ray crystal structure of protein q8a1p1 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr25.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
265
Chain Sequence
b'LIADSGSTKTDWCVVLNGAVIKRLGTKGINPFFQSEEEIQQKLTAVYFYGAGCTPEKAPVLRRAIADSLPVIGNIKANSDMLAAAHGLCGQKAGIACILGTGSNSCFYNGKEIVSNISPLGFILGDEGSGAVLGKLLVGDILKNQLPATLKEEFLKQFDLTPPEIIDRVYRQPFPNRFLASLSPFIAQHLEEPAIRQLVMNSFIAFFRRNVMQYDYKQYPVHFIGSIAYCYKEILQDAARQTGIQIGKILQSPMEGLIQYHSQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein Q8A1P1
publication title X-Ray structure of the hypothetical protein Q8A1P1 at the resolution 3.2A. Northeast Structural Genomics Consortium target BtR25.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 43
structure length 265
sequence length 278
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zxoA03
1U2VA 4MLEA 4CZGA 4O8KA 3D2EB 4FWPA 3LDOA 1D4XA 2A5XA 4B1VA 4JD2A 1BO5O 1ZBSA 2Q31A 4FWQA 2FLOA 1Y64A 4XEIA 4DHYA 5AQYA 3B8AX 3UE5A 3RSEB 2QWLA 2NRHA 1X3MA 1ATNA 3VEWA 2KHOA 2P9PA 1BUPA 2Q2RA 3WEEB 2GTDA 2VCPA 3MN5A 2P9SB 4MO4A 2I7PA 1RDWX 2Q0RA 1NWKA 3EN9A 1GLFO 3CHWA 2V52B 3ZEUA 5BN8A 1Z05A 4CZEA 1NGAA 4K41A 4MO5A 2D0OA 3GBTA 4PKIA 2E1ZA 2A3ZA 2E1YA 4CBXA 1DEJA 5LJWA 1HKGA 1NGEA 3A0IX 2CH6A 1QQMA 2A42A 3LL3A 2YJFA 4Y0WA 4BRPA 4B1WB 5JICA 3BP8A 4BRCA 3DXKA 1U6ZA 5LY3A 3I8BA 5JLFA 3ENOA 2P9PB 2GELA 4BRHA 1GLEG 3P4IA 5E84A 2F9WA 4K43A 3UKRA 1Q18A 1BA0A 3CERA 4JHDA 5AQZA 1T44A 3JS6A 4CZFA 3VF2A 5F1XA 4FWSA 5KPZA 5JLHA 3GOIA 3C0BA 2E2NA 3SK3A 4A61A 3IUCA 4BG9A 1BA1A 1S22A 5AQVA 5ADXH 3VENA 3L4IA 3SMPA 4CZHA 4O5FA 4BROA 4C23A 4H5VA 2I7NA 3UKUA 3W3DA 4M7YA 4BRQA 4FL9A 3ENHA 4DB3A 1HUXA 5F0XA 5AQUA 3O80A 3WQTA 5FPDA 4RTFD 1BDGA 2P9NB 2YHYA 3MN7A 2W41A 4DQ8A 3ZX0A 4WQ4A 4ISFA 3VGLA 4K25A 5EVZA 4MLHA 4BR0A 5AQIA 1YAGA 4DCHA 5KPTA 2HMPA 3CETA 3L0QA 2BTFA 3BEXA 4H5NA 3TPQA 3G25A 3L6QA 2QWOA 4BC3A 4H5TA 4YDUC 5BPLA 4BRGA 4GY2B 3ATUA 2NZTA 2YHWA 4BC2A 3EL2A 4BRIA 2GUPA 4BQLA 4CZLA 3LDNA 5FPMA 5BRDA 3FZFA 3O8MA 4ISGA 1BU6O 3UKUB 4EHUA 1WUAA 4BR9A 3H45C 1KAYA 1T6DA 1Z6RA 3U8XA 5AQLA 1GLLO 3R9PA 4WQ4C 3CJBA 4BRNA 4EFHA 4FPBA 4AM7A 3DJCA 3QICA 3QMLA 3VESA 3ZETB 4F9OA 1C0GA 1BWFO 2E8AA 1SQKA 4H5WA 1J6ZA 5KQ8A 1H1VA 3ID8A 4IXCA 3D7EO 3QB0A 1XC3A 4BVOA 3LDPA 4BVPA 3U9DA 5AZJB 2QWRA 2P9KB 5BR9A 3S41A 1NGJA 3D2FA 3FZMA 2QM1A 4H0XB 3JXUA 4GNIA 1CZAN 4NB4A 5EY4A 1NGGA 4PL8A 2AA4A 2CH5A 4CJ7A 3IFRA 3FGUA 5AZIB 3GE1A 4B1ZA 3DXMB 2Q1NA 4H5RA 1TYQA 2A6AA 3LDLA 3WXIA 1E4GT 4CZMA 3CIPA 2E2PA 1IJJA 1K8KB 5AQFA 3VEOA 2P9UB 3HSCA 2P9LB 1U2VB 3ATVA 3MN6A 1DGKN 5AQXA 5AFUH 1DKGD 4KBOA 3QFPA 4JD2B 4BC5A 4EIAA 4AM6A 1EQYA 1GLCG 4CBUA 1R59O 2QWNA 2ASMA 3DWLA 1YXQA 5AQGA 2HF4A 2ITMA 1IG8A 3FZLA 3VETA 1S3XA 2ZGYA 4XH4A 4CZJA 4FOEA 4NO7A 4PKHA 4BRFA 3QFUA 3LDQA 4H0TB 3MDQA 1NMDA 5EOYA 3R6MA 2WUSA 1C0FA 3KZBA 1JCGA 4EHTA 3WXKA 4CZKA 3O08A 3VEVA 5AQNA 2HF3A 1NM1A 1V4TA 4CD1A 1NGIA 2ZF5O 3ZEUB 5KQDA 1NLVA 3M1FA 1MWMA 2UYTA 4IJNA 3EKSA 5JMVA 4RWTA 3FR0A 5LJVA 3WUHA 4BC4A 4B1UB 5AFUA 2A40A 3C7NA 4E1JA 1RGIA 4JNEA 1TUYA 1ATSA 4LC9B 5BN9A 3U9ZA 3DXKB 1WOQA 3H1VX 4BQZA 4RCHA 1QQNA 2GWKA 3M3ZA 4H0YB 3ULEA 2QXLA 2FF3B 3M6GA 3UKRB 2E2OA 3FLCO 4WQ5A 4JHDB 2IVOA 4XH1A 4B1XB 1GLDG 4I6MA 5TKYA 2HOEA 2Q36A 3QBWA 3WT0A 5AQTA 3A5NC 3IDHA 3O1BA 3MK6A 5BRFA 3LM9A 2OANA 1JCEA 5FPNA 3O5BA 5AQPA 5AQOA 4M7XA 1SZ2A 4EAHD 3CJ9A 3CQXA 1NBWA 2DPNA 1QZ5A 5AQJA 2AP1A 2FF6A 5AQHA 2E88A 3O4WA 3U4LA 3SLCA 3I33A 4BR5A 2CGKA 3VF6A 1XQSC 3FZHA 3D2EA 1NGHA 4CD3A 1QZ6A 3H3NO 2W40A 4K42A 4WYBA 5AQQA 2CGLA 2V7YA 5AQSA 1LOTB 4CBWA 4Z94A 4I6MB 3CJCA 3DAWA 5BREA 3OHRA 1BG3A 3KVGA 3A5MC 5EX5A 5BPNA 3RSEA 2FSJA 4B1YB 2CGJA 2Q0UA 1NGBA 4J8FA 1X3NA 3H3OB 3GL1A 3WEEA 2P9SA 3MCPA 2D0PA 4FWMA 5ELZA 4BR7A 3HI0A 1HKBA 2P9IA 2Q97A 3CI5A 4QS8A 1LCUA 2GWJA 1KAZA 4QS7A 3AAQA 4BRLA 2IIRA 3VPZA 4BR4A 2E20A 5KPRA 1JCFA 3VEXA 4FWNA 3FE1A 5B8HA 5CE3A 1SAZA 3FFKB 1HX1A 1NGFA 2ASPA 3O6WA 4B9QA 4BGBA 4FSVA 2YCHA 2QW9A 3HBTA 2ZGZA 3CJ1A 3VF4A 4CI6A 3EO3A 2ZWHA 3VGKA 4JAXA 3MMVA 4BRMA 3BF3A 1YUWA 1ZXOA 3D2FB 3VERA 2PAVA 2FXUA 1T6CA 2F9TA 1GLBG 4PKGA 2A41A 3A5OC 2P9IB 4BRKA 3A8YA 3J8AA 3BUZB 4CZIA 3ZX2A 2BUPA 3HTVA 4BG8A 1TYQB 1QQOA 3WXLA 4FWLA 3LM2A 2QWQA 3H1QA 4FO0A 2H3GX 4FWOA 5E26A 4FWKA 4BGAA 3EZWA 3WXJA 3UB5A 1G99A 4M63C 1ZC6A 1V4SA 3W0LA 2QWPA 5AR0A 2IVPA 2P9NA 4H0OA 3H6EA 3EKUA 4QS9A 4A2BA 5AQKA 3R8EA 4ISEA 4IO8A 1QHAA 4A62A 3CQYA 2FSNA 3MN9A 5F2RA 1KXPA 4H0PA 3FZKA 4YDUA 2VWBA 1OKJA 2V7ZA 2YI1A 3ZX3A 2J4RA 4PL7A 3SMSA 4XH5A 5FPEA 4BREA 2FSKA 2D4WA 2IVNA 1KAXA 1ESVA 2E2QA 4BRDA 5I9EB 1HPMA 4H03B 5EXWA 3AY9A 2ASOA 2GEMA 4FWRA 5AQRA 2VYPA 2PBDA 4FPAA 4HTLA 4IJAA 3C7NB 1TUUA 4HWIA 2NLXA 1NGDA 3WQUA 5AQMA 1MA9B 1BOTO 5BPMA 1XUPO 1YVNA 3ZETA 3QBXA 3ULEB 1RFQA 2V51B 3BF1A 3GDQA 3HZ6A 3A5LC 3CJ7A 3TU5A 3CJAA 2YJEA 1X9JA 1HKCA 5AZJA 3H46O 3SJHA 2P9KA 2D1KA 1GLAG 3AAPA 4IWVA 3AARA 4WQ5C 3VOVA 5ADXA 1MDUB 4BR2A 3QDKA 3VGMA 1HJOA 1P8ZA 2QWMA 3HM8A 3KHYA 5BRHA 1GLJO 4A2AA 3VEZA 1HLUA 3F9MA 2EWSA 3O1WA 5AZIA 1ATRA 4FOIA 5AQWA 3DXMA 4JN4A 3IMXA 2YHXA 3VEYA 4BRAA 1E4FT 4H0VB 4IZ9A 4L3QA 1NGCA 1K8KA 3GG4A 2P9UA 2P9LA 1MWKA
chains in the Genus database with same CATH superfamily
4KMHA 5KTQA 4O8KA 1J98A 3D2EB 4HCCA 1TWAK 2OPQA 3CCQN 2VUMK 1D4XA 2A5XA 4B9LA 4BACA 1C0MA 4DSEA 4A3KC 3G4CA 1QSYA 1VQ6N 1LWFA 1YX2A 1HI9A 4YOXA 4FJXA 5SZTA 4XEIA 1VSJA 3NF7A 1VH2A 4DHYA 2KZZA 1RBRA 4B3OA 3B8AX 3AGKA 5M3MK 4C3HK 1QHTA 4CEOA 5C44K 1BUPA 2Q2RA 5C3EK 3WEEB 2BANA 4CE9A 2P9SB 4MO4A 4DTXA 1KQSM 4JI8K 4B9TA 3HOXC 2F8SA 2BH1A 3AVAA 2E6MA 3I0RA 4KTWA 1CZ9A 1GLFO 1KVBA 2V52B 1KVCA 3CHWA 3ZEUA 3SQ1A 3FOEA 3ADAC 4K41A 4MO5A 4A3KK 3OYKA 2O8BA 3RZDC 1DEJA 1QSSA 2IGIA 3LPUA 1NGEA 4B9SA 3TSPA 2NVYA 4KMDA 2CH6A 2GSNA 1NKBA 4C45A 4HUGA 3AVIA 5M5YK 2R93A 3DXKA 4G7OA 1Q86O 4OPHA 3R3LA 1WSFA 2WC9A 5JLFA 4F4KA 1JLCA 1B92A 4LF5K 4Y52C 2P9PB 3HOXK 1J9AA 2VGMA 4BRHA 1GLEG 1JLAA 3P4IA 5D4DA 2X74A 3KK1A 1TKXA 3NF8A 5AQZA 3RZDK 5HOOA 3VF2A 4CEAA 3GEHA 3GOIA 4RW9A 1JXEA 3SK3A 3A2FA 3MXMA 5C15A 1S22A 3HM9A 5ADXH 5KGXA 2F4VK 4A3CC 1P90A 1KLNA 3CPEA 4CHPA 4C23A 4CJTA 2Y3PA 4H5VA 4ILGB 3W3DA 4Y52K 3VQAA 4BRQA 1HUXA 5F0XA 4FM0A 2P9NB 2RKIA 3AVBA 4DTNA 4O0JA 5GAEP 1IO2A 4E1NA 3VGLA 4NLCA 4P9SA 3OYHA 4BR0A 4QAGA 4X62K 1TL3A 3TWHA 1OH6A 1S6PA 2HMPA 3G25A 3OYIA 3N3YA 1BI4A 3CQZA 4A3CK 1O24A 3ATUA 1VLOA 3K59A 5J1EA 4B3MK 4CHYA 5JS2A 3SQ0A 3O9QA 4KHUA 4RW7A 2R93K 2X78A 4KB2A 4JKCA 4JKGB 3O8MA 4ISGA 4IEIA 3UKUB 3FHZA 1N8RO 1QSLA 4BR9A 5M1QA 3ZSYA 1U49A 3I4NC 3PO5A 1T6DA 1Z6RA 4CGGA 1Q8IA 4XCHA 4GV3A 3AD7C 5AQLA 3A8KA 3R9PA 4CEDA 5LMUK 3VQ7A 4DSLA 3CJBA 4BRNA 4B9UA 1GOAA 3ZETB 4DLEA 1C0GA 1FK9A 2QXFA 3N4PA 3HVRA 4GV9A 1BWFO 2E8AA 2XY8A 3ID8A 1N34K 3CQZC 3AVMA 3D7EO 3QB0A 4JI5K 1Q7YO 3SBGA 1XC3A 1KCFA 2V6TA 3CC2N 3CAGA 4CGHA 2QWRA 2P9KB 3ZLJA 4M45A 1WCMA 2IC3A 3D2FA 2P5OA 5C4JK 3JXUA 4O44A 4GTBA 3CQ8A 3DOKA 1YITN 3CD6N 1B4AA 1OVQA 4CJ7A 3GTOA 3E01A 2WFBA 3AO3A 1D8YA 1HQMA 3DXMB 4C8NA 3MXIA 2A6AA 3LDLA 1E4GT 4CZMA 3CIPA 4XSZA 3NVMA 3CQZK 1S1UA 1C0AA 1K8KB 5AQFA 3VEOA 4HHTA 3OYJA 4DV2K 1U2VB 4KH5A 4J2EA 1IBAA 5AQXA 4CW7B 4KAZA 1S1TA 2QTDA 4KBOA 3QFPA 3VA0A 1VQNN 1C0UA 3CCEN 3CMAN 4BE2A 3V4GA 5FLXO 4CIGA 5H1SQ 1SL2A 5M1NA 4F2RA 2HF4A 4JKEA 3QO9A 3G10A 4OKKA 4XH4A 4YHHK 3E1YA 4FOEA 4NO7A 4MEXA 4M3XA 4H8KA 3HSTB 3QFUA 4H0TB 3MDQA 1X31C 3TTDA 5EOYA 4EP4A 3LP2A 3KZBA 1L3UA 2OZMA 3TANA 2UXBK 5KRSA 4CZKA 2G8VA 1RDCA 2IOCA 3VEVA 3ASMA 5GAHP 1RBVA 1TK0A 4PQUA 4CD1A 1NGIA 1NLVA 5GIPA 5JMVA 3FR0A 1VSLA 3P83D 1WCMK 4BBSC 4B9MA 3C7NA 2BE5A 4AYBL 1RGIA 3MCAB 2E6LA 4NXNK 4RW6A 3GTOK 2O8FB 3WODA 3L2WA 1QQNA 3ERED 2FF3B 3VMFB 4JKDA 2QKKA 4AHRA 1W0HA 4PHTX 3UKRB 4CJ3A 4BKWA 4NCBA 3L4KA 3FLCO 4WQ5A 4IOCL 2IVOA 1TWHA 2P8TA 1GLDG 4NXMK 3OBWA 3C6AA 3WT0A 2HOEA 1YJNN 1D9FA 4FJLA 1WOSA 1SS6A 4BBSK 1KD1O 3O1BA 3MK6A 5IYDC 3LM9A 2OANA 2V6UA 5AQPA 2P51A 2JA8K 4BWJA 1SZ2A 5CYMA 3QEIA 3CJ9A 3CQXA 2VG6A 1QZ5A 5AQJA 4DF8A 4E0DA 4C1NI 3O4WA 2JGUA 3BDPA 2O4GA 2CGKA 1RBUA 1XQSC 4CECA 2R7YA 5IP7C 1ZBHA 4FK4A 4JI3K 4KFBA 3GTKA 5HL8A 5DM6L 2A68A 3O4NA 4WYBA 4CCHA 4LQYA 4ILHA 1C1BA 2V7YA 1TWHC 3CJCA 4DR3K 5C24A 3RWUA 5BPNA 1N36K 4KB4A 3ISNC 4B1YB 2CGJA 1NGBA 4A3LC 3K0SA 4DTOA 3SAHA 1JJ2M 1RDBA 3KKRA 3KLGA 2KLAA 2D0PA 1B4BA 1EH1A 1X9SA 4NYNA 4BR7A 3S1RK 3E66A 4ELUA 5IP7K 3ZSOA 2Q97A 1OH8A 1S9GA 2E2JC 2LSNA 1SMYA 3S1NC 2WOMA 2QKBA 1TAQA 2XCOA 3T19A 4BRLA 1WB9A 5C42A 2VGNA 5KPRA 1TWHK 3GTKC 5B8HA 5CE3A 1SAZA 3MMLB 3M3YC 2ZJQL 3J7ZO 4BGBA 2ATQA 3TSUA 1BS2A 1SV5A 2YCHA 4G9ZA 4A3LK 3HBTA 3AVHA 2JA7A 3CJ1A 2GAGC 5HRRA 1VGXA 4CI6A 1IG9A 3LPTA 4BRMA 3THXB 1GE9A 3VERA 3K5LA 2E2JK 3S1NK 1GLBG 2A41A 3AVCA 3A5OC 2P9IB 1WQFA 5HLFA 3GTKK 1X9MA 1EQRA 1JLGA 3M3YK 4KHPK 1VQLN 4GTEA 4GTDA 4MQ3A 2QWQA 4FO0A 1DLOA 4PA1A 4FWKA 1OH7A 1T03A 4B9NA 3LAJA 3WXJA 4YOYA 2QWPA 2GAHC 4JI7K 3L2RA 3OS0A 4WFNL 3V81A 1L3TA 1TKTA 1VSHA 3LALA 4C1NK 4JK1A 1NJZA 1ZQ1C 3AA5X 4DS4A 4DSJA 4A62A 3CQYA 3EEQA 3MN9A 4FLXA 2OYQA 2JWKA 2V7ZA 1J5OA 3ENBA 1RT2A 3K7AC 3K58A 2J4RA 5FPEA 2FBYA 3V1QA 4BE0A 4BREA 4G0UA 1KAXA 1TWGC 3TSQA 4JKAA 4BRDA 4FYDA 2JA7K 4JKBA 3DOLA 3QEXA 4ZTJA 1N33K 1IBKK 2VYPA 1SKSA 3M8QA 2XY5A 3SYZA 4HTLA 1WQGA 4KAWX 3NCIA 1DCHA 1J6XA 2NLXA 2IDOA 3CCLN 3S17C 5AQMA 4F2SA 3V9ZA 3THWB 1MA9B 4CF8A 3QESA 4KB1A 1DD5A 4Z4GA 3K7AK 3C95A 1U45A 5K14A 3A5LC 4I2QA 1NJYA 3TAFA 4FJ7A 3H46O 1GOBA 5M1PA 5IWAK 3NAEA 2D1KA 5M3FK 3AARA 5ADXA 1MDUB 4BR2A 3QDKA 4MDAA 2UUAK 1P8ZA 3CC4N 3HM8A 5BRHA 1HMVA 4CFDA 3LAMA 3SV4A 1QVGM 3S17K 5AZIA 3AH5A 2ZUFA 3AVLA 3CM6A 3ITHA 4JN4A 2YHXA 3NFAA 1ZBLA 1VSIA 2F8TA 1S1WA 4OO1J 4LK0A 2JA5A 4BRKA 2QEXN 1O27A 3BUEA 4CZGA 4DR5K 5CZ2A 4GVMA 4DV1K 3TABA 2CFAB 2W7VA 4Y7NC 3CCRN 4CJ5A 3KTQA 2Q31A 2HHHK 1HYVA 2VQEK 4NOIA 3K5MA 2E4LA 3HPHA 4KHSA 3TFHA 3QX3A 1VSMA 3CCSN 3THYA 5AQYA 3V1RA 2QWLA 4ZH4A 1RTHA 3BZKA 4OINA 2HNYA 1HNZK 4KM9A 2VCPA 3QIPA 3LAKA 3MWPA 3UIQA 2KZMA 3OPFA 3ZSWA 1T7PA 1WSVA 3SPZA 2JA5C 4Y7NK 1XI1A 2DFEA 1XHZA 2D0OA 3GBTA 4PKIA 1DCOA 4E3SA 5FDLA 5DM7L 2Y1JA 4BBRC 1LAWA 2NVQC 3PSFA 1CZBA 4B1WB 5JICA 5E68A 4BRCA 5LY3A 3NGYA 3I8BA 3VQPA 3ENOA 1NJXA 2YKMA 4LF7K 2KFZA 5L46A 5E84A 1YJ9N 2JA5K 4K43A 3GTLA 1BA0A 4KKOA 3J81O 1BGWA 4CZFA 5GIOA 5KPZA 1NKCA 4CJSA 4FVUA 3TI0A 4DV5K 4BBRK 3C0BA 3KLFA 1UWBA 4DWIA 5J2NA 2NVQK 3F73A 5AQVA 1QQCA 3VENA 4DU4A 2JH3A 3U3GA 4P5BA 1Q82O 3EYZA 5IYCC 2HSTA 2WB1D 3VQDA 4I2PA 4FL9A 4AHVA 1Y1WA 4DSFA 5IORA 1WAJA 3WQTA 4IG3A 3B6OA 4RTFD 1XZQA 3L8BA 4DQ8A 2EHGA 4WQ4A 3J7YP 4WF9L 4DS5A 4DF4A 3HOZC 4K25A 4CF9A 1EO1A 1C1CA 4C8LA 1J5EK 3GTLC 2IAJA 2BTFA 1KSPA 2FBXA 2GV9A 1PJ7A 1IBMK 3HVTA 4YDUC 3SCXA 2HVHA 2YHBA 1YVUA 4CJVA 4GY2B 2YHWA 4YY3K 1VQ7N 3QERA 3EL2A 4BRIA 2HVIA 2GUPA 2B63A 4BQLA 2PZSA 4CZLA 3LDNA 4YFXA 4IOXA 2KKZA 5BRDA 2ETJA 1K73O 4DFPA 2XCQA 1YI2N 1W7AA 3H45C 4ELVA 4OPKA 3HOZK 2A69A 3GTLK 1F7VA 4WQ4C 3TR8A 5C44C 4CFBA 1QVFM 3M8PA 4WFBL 1LV5A 3VESA 3LDSA 3DXJA 1NOYA 3V4IA 1J6ZA 4XLPA 4FW2A 4OPJA 2KQ2A 4DTSA 2YHAA 1HJRA 2GBZA 1HNXK 4FM2A 5BR9A 1NU0A 3G6EN 4B3RK 3T1AA 1WSRA 2XCRB 2B63C 4NB4A 1BIZA 2G8IA 1RTIA 1G15A 4CJEA 3QNOA 4JI0K 3HK2A 3BY5A 3Q7CA 3C94A 1ZYQA 2Q1NA 4M3ZA 3Q7BA 4JI6K 4H5RA 1TYQA 3WXIA 2E2PA 5I3UA 3AVKA 1UV7A 2YNIA 1WN7A 4Q5VA 3AD9C 5IP9C 3HSCA 2P9LB 1YTAA 4ILDA 2UUCK 1DGKN 2DFFA 2ITGA 2O8EA 4FLTA 5AFUH 3HOUC 2Z1GA 3J7AP 2O8DB 1O13A 2B63K 4JD2B 3TTFA 2PHCB 3NVKA 2HB5A 3NH0A 1YXQA 2E5LK 4FXDA 2ITMA 1IG8A 3FZLA 3PUFA 3VETA 3GTQA 1S3XA 3KLEA 2FBVA 4WILA 1TWFA 4CZJA 2FBTA 4BRFA 1REVA 4V19S 4BXXC 3PO2K 2D0BA 3R6MA 1JVIA 5HRNA 4C3JC 3Q3QA 1JCGA 5IP9K 1MU2A 3WXKA 1Z26A 5FROA 3OREA 4M1XA 5CHPA 3SI6A 3K9KA 4NLBA 3PO4A 4CJFA 4CVNE 2HF3A 1V4TA 4DQPA 3HOUK 2VQFK 3SUQA 5KQDA 3M1FA 1MWMA 2UYTA 3K57A 3EKSA 4FJIA 3BZCA 3OA9A 2AJQA 4BC4A 3S2DC 2UUBK 2A6EA 4IOAL 1IKWA 4DR6K 5M5WK 3WNFA 3DLLL 1WSGA 3O4QA 4E1JA 2NVYC 4OGCA 1VQ8N 1TUYA 1ATSA 2GSOA 5IT9O 4BXXK 3ZCMA 4LC9B 3U9ZA 2R93C 4F8RA 3GTQC 3OVNA 1M1KO 3GTPA 4X64K 4RCHA 1TWFC 4C3JK 4BWMA 1BCOA 3CCUN 2OCEA 4KN7A 3M6GA 1WSHA 3JYTA 2VG7A 5HRPA 2QA4N 2E2OA 1I50A 3ZSVA 4JHDB 4B1XB 2PMZL 3S2DK 1RT6A 4HVJA 3CXCM 2NRXA 2NVYK 1JCEA 5T7BA 1BGXT 2UXDK 5SWMA 4OKEA 4BDYA 2NRRA 4JS5A 3PIOL 4FLYA 3GTQK 4A5AA 3ULDA 5HL7L 1TWFK 2DPNA 2HBKA 4G0VA 3T1YK 1X1PA 3SLCA 5C4JC 3GTPC 3SZYA 3OYEA 3SNNA 2PA8L 2RGRA 2B5JA 2D0AA 4IFVA 3VQCA 3D2EA 4DV0K 4CD3A 3JAMO 1QZ6A 2W6KA 3SV3A 3E9PA 2RN2A 4GW6A 4FCYA 4EP5A 4M3RA 1N6QA 4CBWA 1SKRA 1NK4A 1VQ4N 5BREA 3SUPA 3OHRA 1BG3A 4LR2A 3KVGA 4QOZB 4X65K 4P5AA 2FSJA 2NUBA 1B9FA 3CCJN 1T3VA 4AQYK 4FK2A 3WEEA 1RDUA 4Q4ZA 2P9SA 3GTPK 3MCPA 3NF6A 1HPZA 4HTUA 3T00A 3H3VL 1JXBA 1T8EA 3RZOC 4CJ4A 3GSIA 1ZBFA 2YKNA 2FC0A 2NVTC 3OW2M 1NK0A 3VQ5A 1RTJA 2E2HA 2HHQA 4QS8A 2GWJA 5EGHA 4QS7A 2IIRA 4CESA 2NNWA 1I50K 1PJ5A 1RT1A 3O9SA 4IG0A 3VN5A 4OIOA 1KVAA 3VEXA 3FE1A 1ZVUA 3G71N 4FZBA 3FFKB 4CHOA 2WAQL 5CR4A 3O6WA 4O55A 1VJEA 1ILYA 4AH6A 4IFYA 2JA6A 5A2QO 4JRPA 1L3SA 3VF4A 5C12A 3TAPA 1SFOA 5LMNK 3EO3A 2ZWHA 4E89A 4JAXA 1KC8O 1J6VA 4OIRA 3LP1A 3RZOK 1YUWA 1WCMC 2NVTK 1Y1VA 2FXUA 1T6CA 2F9TA 3S0XA 4PKGA 3KLHA 2XHBA 2Z1HA 3CG7A 3GTOC 3BUZB 4DSKA 5DMRA 2E2HC 3ZX2A 3P39A 4DR7K 2R92A 3HTVA 3HP9A 3V1OA 1QQOA 4Q0BA 4FWLA 2W6LA 3ZT2A 3H1QA 3C6TA 2HBJA 2Y1IA 4JS4A 3W0LA 3HPOA 2JA6C 5AR0A 2P9NA 4QJVB 4YNQA 2X6SA 3MXJA 1SFOC 3I4MC 1NOZA 2JA8C 1HR0K 1VSKA 1WBBA 4NCGA 2E2HK 4RW8A 1TL1A 1HQEA 1KXPA 4H0PA 4FJ5A 2VWBA 4FJ9A 4DR1K 4PABA 4N47A 3ZX3A 4WCEL 3OYGA 4CGIA 4PL7A 4LF4K 2O8CA 3MECA 2R92C 3SMSA 4LFCK 4WE1A 2DTUA 4DFJA 4DKWA 1JOEA 4DTPA 3D6RA 4JK9A 2JA6K 4JKGA 2PFUA 5EXWA 2GEMA 1SFOK 3I4MK 1TWCA 3KD1E 1TUUA 2G8WA 1Y1VK 2D5RA 4ICLA 4YOTA 3TFIA 1BOTO 3QEWA 3ZETA 4LSLA 2R92K 3J80O 3ULEB 3S1RC 2V51B 1BQMA 3DLRA 3VQ9A 1S1VA 3CJAA 2YJEA 3A8JA 1X9JA 3CFPA 2P9KA 3S14C 4F3TA 3ALYA 4WQ5C 4KH4A 3HO1A 4I7FA 3SAFA 3VGMA 1HJOA 4KM8A 1HLUA 3KWIA 4DTJA 3DLEA 3OYNA 2EWSA 4KC6A 2P1JA 1HNVA 2KW4A 1ATRA 4FOIA 3PY8A 2EBBA 3DXMA 4RW4A 3M8RA 1OH5A 3AQOA 5KI6A 2XY6A 4Y1CA 4L3QA 1WSIA 3TAQA 4M3YA 1K8KA 1JKHA 4PWDA 1XZPB 1MWKA 2NVXA 4B08A 1U2VA 4MLEA 4RG8A 3KK3A 3S14K 4GV6A 1JLEA 4FWPA 1RDDA 4B1VA 2ZJPL 3GTJA 1ZBSA 3ZSXA 2DFHA 4FWQA 2FLOA 4JKFA 1RT5A 2RPIA 3L2VA 4DV7K 1HQUA 1EXQA 2HNDA 3I56N 1ASUA 4FLVA 2OA8A 4FZZA 3RSEB 1X3MA 4LFAK 3VEWA 4HUFA 3DRRA 3DLBA 2O4IA 1VSDA 4KV8A 4I9LA 3MN5A 4FLZA 4DLGA 4KREA 4K8ZA 4K8XA 2I7PA 4BY7C 3EN9A 1NWKA 4KTQA 1SL0A 4YFNA 4DU1A 1DTTA 1Z05A 4CZEA 2PYJA 2X6NA 4DFKA 4A3BK 4CJWA 1IE0A 4CBXA 3QIOA 3TAMA 3NMUA 4E19A 5D3GA 3ZSZA 3GTJC 3LL3A 2A42A 3RVCA 1FJGK 3HP6A 2YJFA 4WJ3M 4Z0UA 2O8FA 1U6ZA 3THYB 1WIHA 4GKJK 3DM2A 1RBTA 2JA7C 1O28A 3H08A 5CJ9A 3KLIA 2YV0X 3CM5A 4DQIA 3GEIA 4BY7K 3VA3A 1W2BM 1YIJN 1INNA 3VQ4A 3UKRA 1Q18A 2NVXK 3CERA 3O3FA 1Z25A 1J53A 2B6AA 4YFUA 5F1XA 4FJNA 5JLHA 1CXQA 3GTJK 3RTVA 4AYBD 2E2NA 4A61A 4CJUA 1BA1A 2PY5A 4AILC 3L4IA 3SMPA 2YX6A 3CFOA 4CJRA 4A93C 3VQEA 3TAEA 4BROA 4N76A 2WTUA 2HHSA 2I7NA 2HHXA 1FXXA 4FK0A 1CXUA 1ASWA 1I39A 3O80A 1TK8A 4GVEA 2YHYA 4U67L 1U4BA 4C3IK 3QLHA 3ZX0A 3OY9A 2NRZA 4LD0A 4FJKA 4MLHA 4KATA 3IRXA 4BY9C 2DY4A 1YAGA 4DCHA 5KPTA 1YJWN 3CETA 3L0QA 4BDPA 3TPQA 3BEXA 5KRTA 4ZTFA 3AVJA 3L6QA 5LL6Z 3U6FA 1XMOK 4ILJA 4ELTA 2QWOA 4BC3A 1IKYA 5FRMA 5BPLA 5TMCA 1WAFA 4BRGA 4A93K 4O0IA 3AO2A 5FPMA 1ITGA 2R7ZA 3FZFA 4NYFA 1UA0A 3AA2A 2ZQBA 4LLGA 1KAYA 1I3QA 4E7HA 3U8XA 1GLLO 2IS3A 4HCBA 3V9SA 3JSMA 3O9UA 5GADP 4FZYA 1JL2A 4EFHA 3GTGA 3QICA 3QMLA 4XIUA 1UOCA 2UXCK 5FLMC 1KFDA 4LF6K 4H5WA 3KIOA 3L3UA 3QINA 4IXCA 2GX9A 4A5BA 1NJWA 4OVLA 3ZT1A 3LDPA 4E7KA 3U9DA 5AZJB 3S41A 4B9VA 1NGJA 3FZMA 2QM1A 4H0XB 4N5SA 4UY8O 3N0CA 5IYBC 5EY4A 1CZAN 1NGGA 4M3UA 2AA4A 1W97L 2CH5A 3RMBA 1YNJA 2PPBA 1WOPA 4OGEA 3F2KA 3S1MC 3LP3A 4AF1A 3O3GA 4LY7A 5FLMK 1IJJA 3AVNA 3S15C 3GTGC 2P9UB 3IG1A 3MN6A 4A3IC 4JI4K 4TSXA 2GSUA 2HBMA 4C2MC 1DKGD 2KFNA 1EQYA 5IYBK 4CJQA 1R59O 2QWNA 2ASMA 3DWLA 5MLCQ 2R7ZK 3KD5E 3L2UA 1NNEA 1EWQA 1I3QK 4A3JC 2ZGYA 3S1MK 1S9EA 4KI4A 4PKHA 4X66K 1RT3A 3S15K 1HYSA 4ID5A 3GTGK 1I94K 4OIQA 3G4AA 1HYZA 4A3IK 1TK5A 3O08A 3KWGA 4FW1A 1NM1A 1XHXA 4C2MK 3ZEUB 1XXCA 4C8MA 4IJNA 4OLBA 2ZFZA 1RNHA 5LJVA 3SZZA 3OYMA 1C0TA 2O8BB 3WUHA 3SAGA 4B1UB 3M5RA 2A40A 4R5PA 4A3JK 1BCMA 4M3WA 2A1SA 1KLMA 3THWA 1TKZA 5BN9A 1IV0A 3DXKB 5AJ3K 1WOQA 4YOWA 3V9UA 1K6YA 4CHQA 3EE8A 3EQLA 2GWKA 3M3ZA 1BL3A 2QXLA 4OKJA 3SBTA 3O3HA 3S3MA 2Z1JA 5JVHL 4XH1A 3SZ2A 4I6MA 5TKYA 2Q36A 3QBWA 3A5NC 2E2IA 5BRFA 5CHIA 1J54A 5FPNA 3O5BA 3IS9A 2ZD1A 3NGIA 4DG1A 4KHYA 2V6SA 5EU7A 2HHTA 4AHUA 1NBWA 3AVFA 1TAUA 1JLBA 1AB4A 2FF6A 2WONA 4A3GC 5AQHA 2E88A 1Y1WC 4OJRA 3VF6A 1NK9A 2GUIA 2D0CA 2CFAA 3P38A 3H3NO 1VQ5N 2W40A 5CY4A 3MEGA 3VTIA 3TTGA 3K5NA 1BI4B 3DMJA 3ZT0A 1LOTB 4Z94A 4CGFA 4XSXA 5EX5A 2NRVA 1E3MA 2E2IC 1XPPA 2BE2A 1NK8A 4FVMA 1RT4A 3GTMA 2Q0UA 4A3GK 1X3NA 1ASVA 1NK7A 2A6HA 1Y1WK 3OYCA 1DCPA 2XRIA 4IFEA 4CJLA 5HBMA 1UA1A 4R79A 4U7BA 5FRNA 4GFQA 3HPGA 1R9TA 2RHKA 3P1GA 3QETA 2ZUEA 3LPXA 4N41A 1KAZA 1I6HC 4DR2K 2QI2A 1O25A 4ID1A 1DT9A 4CGDA 3PO2C 3NH1A 3OJUA 1FKOA 3VQBA 4A57A 2Z1IA 1ISEA 1LWCA 3TFJA 3U3YA 2JLEA 3OYAA 1NGFA 2ASPA 2E2IK 4M42A 1HRHA 1I3AA 1VAZA 4KRFA 2QW9A 4PAAA 3RMCA 3MWTA 2ZGZA 1IKVA 1EP4A 4F3OA 1KRPA 1NG9A 3CYMA 3VGKA 1O2AA 3MMVA 3GTMC 3BF3A 3QNNA 1ZXOA 3D2FB 1RDAA 1KTQA 2D6FC 4FM1A 2PAVA 4NCAA 4DV4K 4DDQA 4DMNA 1ZBUA 1I6HK 4KASA 2NRTA 3A8YA 4CK2A 1R9TC 1DTQA 3M8SA 3K2PA 4BG8A 4A3DC 1EFWA 3PSIA 4BLBA 1USOA 4FWOA 3PIPL 3CCVN 4BE1A 5E26A 1Y97A 3E9OA 4BGAA 1VHXA 1X9WA 3OTOK 1G99A 4JRQA 1ZC6A 3GTMK 3GIRA 3JSTA 2QK9A 1YT3A 3EKUA 3H6EA 4JI2K 5J2MA 2FQTA 4KHQA 1U04A 2F96A 4K0KK 3AQPA 1I6VA 4A2BA 1XWLA 3HRGA 3L4QA 3LANA 4B3TK 2O5IA 1XMQK 1R9TK 1S5JA 1B9DA 4MDBA 2FSNA 3LWLA 3EE9A 3SUOA 4A3DK 4W5QA 4HUEA 1KQ4A 4W5OA 3VA7A 3HL8A 3GEEA 2WBNA 1K8AO 2IVNA 3S3NA 1O2BA 2OPRA 2E2QA 3DI6A 3AD8C 3L4JA 4CEFA 5GAGP 2BGGA 3RR7A 3K9JA 1HPMA 3N0BA 5C4XC 4H03B 2ASOA 4FWRA 3EZ5A 4GZYA 1XC9A 1WSJA 3F9KA 4CEBA 4JYAK 3RR8A 4FPAA 4W5NA 3C7NB 5EGEA 1EWRA 3L3VA 4O4GA 3ZT3A 4JV5K 3PO3C 4B8AB 5IOSA 4DUYK 1YVNA 2KTQA 3DLHA 4OX9K 3SQ4A 4AH9A 3QBXA 1C1AA 1RFQA 3BF1A 3GDQA 5E41A 4DV3K 4DTUA 3FKIA 3TU5A 4Z4FA 1A5WA 1HKCA 2O8CB 5C4XK 4IWVA 4GT9A 4KO0A 1I50C 2OTJN 4E7IA 5TKWA 2QWMA 3KHYA 3L2QA 2XO7A 4A2AA 3VEZA 4DFMA 4A3MC 3F9MA 4JI1K 3MEEA 3PO3K 4CIFA 3IMXA 1U47A 3VEYA 4W5RA 3NH2A 3KK2A 4IZ9A 1J6WA 3QEVA 4Z4IA 3GG4A 1JQWA 2P9LA 4JEPA 3HOSA 4KTZA 1R0AA 4IBNA 3FKIC 5BR8K 2O8DA 3LDOA 2ZM6K 4JD2A 1BO5O 4BLAA 1QTMA 4BDZA 5IOTA 1S1XA 4A3MK 5CYQA 2KWAA 1WOOA 4CHNA 3I4NK 2PYLA 1Y64A 1YNNA 3MX2A 3G4SN 3UE5A 4CEEA 2NRHA 3VTHA 5JS1A 3WNEA 4E7LA 1ATNA 2KHOA 4G7ZA 2P9PA 5M1KA 1TVRA 1XNQK 4MFBA 3CC7N 2GTDA 4KH6A 5M1OA 2G8UA 1VK0A 3T01A 1M90O 1RDWX 2Q0RA 5JVOA 3FKIK 2W42A 1IL2A 5BN8A 1WQHA 1NGAA 2YNGA 4Z4CA 2E1ZA 2A3ZA 2E1YA 1VRTA 5LJWA 3V6DA 1HKGA 1S6QA 3CPWM 3A0IX 1QQMA 4CF1A 1T05A 4GTAA 3S16C 4Y0WA 4BRPA 3NDKA 3BP8A 4FJGA 5FJ8K 4KB0A 3OJSA 3FOFA 3H0GA 4CK3A 3HOTA 2GELA 4AHCA 3NF9A 3WNHA 2F9WA 3LZIA 3PX4A 3OS1A 1Y1VC 4DV6K 4Z4EA 4C8OA 5I42A 3HOYC 4JHDA 1KFSA 4RMFA 1USMA 2HW3A 3OYFA 3S1QC 1T44A 1NMNA 3JS6A 1F9NA 4CJPA 4FWSA 4DTRA 4GKKK 3DYAA 2I5JA 3AO4A 3IUCA 4BG9A 3M4OC 5JFEA 3S16K 4B8CA 4I9QA 2G8FA 1NJIO 4CZHA 4JLHA 4O5FA 3UKUA 2YNFA 4M7YA 4YOVA 4LOWA 3ENHA 1NK5A 4DB3A 5AQUA 3BP8C 5FPDA 1BDFA 1BDGA 3MN7A 3H0GC 5TMFA 2W41A 4A3EC 3DLGA 3AO1A 4ISFA 1A5XA 3HOYK 2P5MA 2PMZD 2OZSA 3MEDA 3S1QK 5EVZA 3T3FA 2Y0SL 1CLQA 3AVGA 4M3TA 5AQIA 5HP1A 1S72N 3HOVC 4H5NA 3M4OK 3SPYA 4JK7A 4A59A 1NKEA 4H5TA 1TKDA 5C10A 3MX5A 3B6PA 3OS2A 2NZTA 4BC2A 1F7UA 1K9MO 2HNZA 4M41A 1EETA 1O1WA 4QIWL 3CFRA 2PA8D 4CJKA 4FLUA 4BY1C 1BU6O 3H0GK 4EHUA 3O9TA 3LAPA 1WUAA 4A3EK 3PX6A 3KJVA 4CHZA 1Q81O 4IDKA 1TWCC 3NUHA 2RF2A 1EKEA 4CGJA 3HOVK 2B4JA 4MEYA 4CF2A 2HBLA 3E9LA 2FQOA 4FPBA 4AM7A 3DJCA 4F9OA 3HOWC 1ZYRA 1U48A 4WFAL 3ZYYX 5IYDK 5KQ8A 1SQKA 4IEEA 1H1VA 3AV9A 4W5TA 3C6UA 4DUZK 4DR4K 3KKSA 3OYBA 4DQSA 2CW0A 4BVOA 4BVPA 4A3BC 3H3VD 3D0PA 4BY1K 3C6HA 1VRQC 3IKMA 5M1FA 1C6VA 4DQRA 4IDHA 4QCLA 3OBYA 3WXMB 4GNIA 4O5BA 2ZE2A 4PL8A 4EZ9A 1TWCK 3IFRA 3FGUA 3N4QA 3VQ8A 1TV6A 3TARA 5AZIB 1PJ6A 3GE1A 4B1ZA 4CFAA 1O29A 3IAYA 3LZJA 2WAQD 1WBDA 3HOWK 1HNWK 1IKXA 4LSNA 3F5TA 5C25A 3ATVA 4CF0A 2NVXC 4YG2A 5CZ1A 1VQPN 4O2DA 3DLKA 4N56A 4JKHA 4BC5A 4Z4HA 1RILA 4EIAA 4LJZA 4AM6A 1GLCG 4QJVA 4OIPA 4Y1DA 4CBUA 3NE6A 5C2DA 1VQON 5AQGA 4KN4A 4CERA 3OYDA 3T69A 4XLNA 4JK8A 2HMIA 4KI6A 1FKPA 3P5JA 4B3SK 1LWEA 3LDQA 4PUOA 1NMDA 1IBLK 2WUSA 1C0FA 3AA4A 1Q9YA 4C3IC 3CF5L 4EHTA 1RU0A 3WNGA 1IW7A 5KGWA 1TWGA 5AQNA 3MAQA 2ZF5O 5HROA 1WNSA 3AA3A 2VWKA 4RWTA 2G8HA 3D45A 3FFIA 1F93A 5HRSA 4J2DA 5GINA 3PLAA 5AFUA 3AO5A 1SKWA 4JNEA 1ZBIA 1BIUA 3THVA 3H1VX 4BQZA 3P31A 4WJ4A 2A1RA 3ID6A 4H0YB 4OLAA 2WB1L 3ULEA 3T02A 1YCLA 4A3FC 3EY1A 3VQQA 4LH4A 1L5UA 1TGOA 5M5XK 1V5VA 3HKZL 4LH5A 3HXAA 4DU3A 5AQTA 3IDHA 1QS4A 1A5VA 4CEZA 3QEPA 1JL1A 1SUQA 1VQ9N 4UQGA 1D5AA 5AQOA 2Y0SD 4KMUA 4M7XA 4E1MA 2YNHA 4EAHD 1VQKN 1EK8A 3AGRA 2AP1A 3IPJA 3U4LA 4X6AC 2HHUA 1XZPA 4A3FK 4BR5A 3I33A 2RH6A 4KDDA 1XZQB 1VQMN 3FZHA 4J2AA 1XXAA 4H4MA 1NGHA 1Q9XA 3RRGA 4QIWD 1TWGK 1JLFA 4GTFA 4K42A 1WSEA 4EZ6A 4DQQA 1N32K 5C0YA 1O26A 1VSEA 5AQQA 2CGLA 1EI6A 5AQSA 3G0ZA 4I6MB 2BDPA 3DAWA 3A5MC 3SQ2A 4PY5A 4LK1A 4GTCA 3RSEA 4YFKA 1WORA 1XXBA 4J8FA 3THXA 1YTUA 1JLQA 2XY7A 3H3OB 3I8DA 4X6AK 3GL1A 1LW0A 1LAVA 4AHTA 2R7ZC 4FWMA 5ELZA 1IS1A 3HI0A 1HKBA 2P9IA 2YU9A 3CI5A 2RE2A 4CEQA 1XNRK 1I3QC 2HHWA 4KHNA 4KHWA 1LCUA 3AAQA 4KARA 3NHGA 3VPZA 4OPAA 3ZSQA 1QE1A 4BR4A 2E20A 4FM9A 1JCFA 4LFBK 2JWLA 4FWNA 1HX1A 4B9QA 3NGZA 4FJHA 4FSVA 2Q3SA 3HT3A 3V9WA 4G1QA 2NRWA 1OVYA 4ZHRA 1RCHA 3GDZA 5C2FA 4FJMA 3O9RA 3I0SA 3PV8A 3S3OA 4IO9L 2UU9K 1EX4A 3J8AA 2YU9C 4CZIA 2G8KA 2BUPA 3CCMN 3KK7A 1TYQB 3WXLA 1L0WA 2VG5A 2EX3A 3LM2A 4LF9K 2H3GX 1VSFA 1K83A 3LP0A 1N5YA 2O8EB 3EZWA 3UB5A 4C8KA 4M63C 4CIEA 3T1HK 1BHLA 3T7ZA 1V4SA 4FJJA 4MQ9A 4J3NA 2IVPA 4H0OA 4QS9A 3I55N 2HHVA 1YF5L 4H4OA 1L3VA 2F7TA 3OYLA 5AQKA 1VRUA 3R8EA 3LWMA 4ISEA 3HXMA 1RTDA 1SL1A 4KPYA 2YU9K 1F21A 1RBSA 4O8UA 4IO8A 4GTLA 1QHAA 3S2HC 4GMJB 5F2RA 3ZSRA 3S9HA 3FZKA 3DRPA 4YDUA 4CFCA 5J2QA 1NK6A 1OKJA 1BJTA 4DSIA 2YI1A 1IH7A 4XH5A 2P5GA 1TWAA 3HYFA 2ZJRL 2VUMA 2FSKA 2OPPA 2D4WA 3K5OA 3SUNA 1ESVA 1O2FB 4LF8K 1BQNA 4E7JA 5I9EB 4IKFA 3BP3A 4G0WA 1WLJA 3AY9A 4CK1A 4G7HA 1K83C 5AQRA 1BISA 2PBDA 1LW2A 1D9DA 2OTLN 1RT7A 4IJAA 3BGRA 4HWIA 3HKZD 1NGDA 3WQUA 1FW6A 3S2HK 2O5JA 5BPMA 3SJJA 3RRHA 4FLWA 3NBPA 1XUPO 3CMEN 5IOQA 4KMAA 1HNIA 4FJ8A 4YOUA 1G51A 3HZ6A 4YORA 3CJ7A 3TTCA 4AHSA 5DK5A 4DTMA 3HJFA 3A8IA 5AZJA 4J2BA 3SJHA 5IYCK 1W9HA 1GLAG 3AAPA 1TWAC 3OEPA 1IQ0A 3VOVA 1K83K 2VUMC 5JVGL 5J2PA 3DRSA 1GLJO 1GOCA 2VWJA 3ZT4A 3R1XA 3VQ6A 4Q5SA 3RMAA 2OPSA 3O1WA 3V9XA 1YHQN 4L8RB 3PX0A 5AQWA 4C3HC 4BRAA 1E4FT 4H0VB 3RMDA 4FZXC 3TAGA 3C65A 1UAXA 1NGCA 5C3EC 5TJ3A 2P9UA
chains in the Genus database with same CATH topology
4JEPA 1U2VA 3BUEA 3HOSA 4MLEA 4CZGA 4KMHA 4O8KA 3D2EB 2CFAB 4GV6A 3CCQN 4FWPA 3LDOA 1D4XA 2A5XA 4B1VA 4JD2A 2ZJPL 1BO5O 3CCRN 1ZBSA 3GTJA 4BLAA 2Q31A 5IOTA 3G4CA 1VQ6N 4FWQA 4YOXA 2FLOA 2KWAA 3QX3A 4JKFA 1Y64A 4XEIA 3CCSN 3MX2A 4DHYA 5AQYA 3G4SN 3I56N 3B8AX 3UE5A 3AGKA 3RSEB 2QWLA 2NRHA 1X3MA 3VTHA 1ATNA 3VEWA 2KHOA 2P9PA 5M1KA 1BUPA 2Q2RA 4KM9A 3CC7N 3WEEB 2GTDA 2VCPA 4KH6A 3MN5A 2P9SB 3MWPA 4MO4A 5M1OA 1KQSM 3OPFA 1M90O 2BH1A 2I7PA 1RDWX 2Q0RA 1NWKA 3EN9A 5JVOA 1GLFO 3CHWA 2V52B 3ZEUA 5BN8A 3FOEA 1Z05A 4CZEA 1NGAA 1WQHA 4K41A 4MO5A 2D0OA 3GBTA 4PKIA 2E1ZA 2A3ZA 2E1YA 4CBXA 1DEJA 3NMUA 5LJWA 5DM7L 1HKGA 1NGEA 3CPWM 3TSPA 3A0IX 2NVYA 2CH6A 1QQMA 2A42A 3LL3A 3RVCA 2GSNA 4KMDA 4GTAA 2YJFA 4Y0WA 4BRPA 4B1WB 5JICA 2R93A 3BP8A 4BRCA 3DXKA 1Q86O 1U6ZA 3R3LA 4OPHA 5LY3A 1WIHA 3FOFA 3I8BA 2WC9A 5JLFA 3H0GA 3ENOA 1O28A 3HOTA 2P9PB 5CJ9A 2GELA 2VGMA 4BRHA 1GLEG 3P4IA 1W2BM 5E84A 1YIJN 1YJ9N 2F9WA 4K43A 3GTLA 3UKRA 1Q18A 1BA0A 3CERA 4JHDA 5AQZA 1BGWA 1T44A 5HOOA 3JS6A 4CZFA 3VF2A 5F1XA 4FWSA 5KPZA 5JLHA 3GOIA 5GIOA 4FVUA 3C0BA 2E2NA 3SK3A 4A61A 3IUCA 4BG9A 5C15A 1BA1A 1S22A 5AQVA 5JFEA 5ADXH 3VENA 3L4IA 2JH3A 3SMPA 1P90A 1NJIO 4P5BA 2YX6A 4CZHA 4O5FA 3CPEA 4BROA 4C23A 1Q82O 2HSTA 2Y3PA 4H5VA 2I7NA 4ILGB 3UKUA 3W3DA 4M7YA 4BRQA 4YOVA 4FL9A 3ENHA 1Y1WA 4DB3A 1HUXA 5F0XA 5AQUA 5IORA 3O80A 3WQTA 5FPDA 4RTFD 1BDGA 2P9NB 2YHYA 4GVEA 3MN7A 4U67L 2W41A 4DQ8A 5GAEP 3ZX0A 4WQ4A 4ISFA 3VGLA 2NRZA 2P5MA 4WF9L 4NLCA 4K25A 5EVZA 1EO1A 4MLHA 4KATA 4BR0A 5AQIA 4BY9C 1S72N 1YAGA 4DCHA 5KPTA 1YJWN 2HMPA 3CETA 3L0QA 2BTFA 3BEXA 4H5NA 3TPQA 3G25A 3N3YA 3L6QA 4JK7A 4ILJA 3CQZA 4A59A 2QWOA 4BC3A 4H5TA 4YDUC 5BPLA 1O24A 4BRGA 5C10A 3MX5A 4GY2B 3ATUA 2NZTA 2YHWA 1VQ7N 4BC2A 3EL2A 4BRIA 1K9MO 3O9QA 2GUPA 2B63A 4BQLA 4CZLA 3LDNA 4IOXA 5FPMA 2KKZA 4KB2A 4JKCA 5BRDA 4JKGB 3FZFA 3O8MA 4IEIA 1BU6O 4ISGA 3UKUB 1K73O 3FHZA 2R7ZA 1N8RO 4EHUA 2XCQA 3O9TA 1YI2N 1WUAA 4BR9A 3LAPA 3H45C 5M1QA 1KAYA 1I3QA 1Q81O 1T6DA 1Z6RA 4GV3A 3NUHA 3U8XA 5AQLA 1GLLO 3R9PA 4WQ4C 1QVFM 3O9UA 4WFBL 2HBLA 3CJBA 4BRNA 4EFHA 3E9LA 5GADP 4FPBA 4AM7A 3DJCA 3QICA 3QMLA 3VESA 3ZETB 4F9OA 3GTGA 1C0GA 3N4PA 4WFAL 4GV9A 3ZYYX 1BWFO 2E8AA 1SQKA 4H5WA 1J6ZA 4IEEA 5KQ8A 1H1VA 3ID8A 4IXCA 2GX9A 4A5BA 3D7EO 3QB0A 1Q7YO 3SBGA 1XC3A 4BVOA 3CC2N 3LDPA 4BVPA 3CAGA 3U9DA 5AZJB 2QWRA 2P9KB 5BR9A 3G6EN 3C6HA 3S41A 1NGJA 1WCMA 3IKMA 5M1FA 2XCRB 3D2FA 3FZMA 2QM1A 4H0XB 4IDHA 3OBYA 4UY8O 3JXUA 3WXMB 4GNIA 1CZAN 4NB4A 5EY4A 4GTBA 1NGGA 4PL8A 1YITN 1B4AA 3CD6N 2AA4A 1W97L 2CH5A 4CJ7A 3IFRA 3GTOA 3FGUA 2WFBA 3N4QA 5AZIB 3GE1A 3Q7CA 3F2KA 4B1ZA 1O29A 3DXMB 4AF1A 2Q1NA 3Q7BA 4H5RA 1TYQA 2A6AA 3LDLA 3WXIA 1E4GT 4CZMA 3CIPA 2E2PA 3NVMA 1IJJA 3F5TA 1K8KB 5AQFA 3VEOA 2P9UB 3HSCA 2P9LB 4ILDA 1U2VB 3ATVA 3MN6A 1DGKN 4KH5A 5AQXA 2GSUA 5AFUH 2HBMA 1VQPN 4C2MC 1DKGD 2QTDA 1O13A 4KBOA 3QFPA 4JD2B 4JKHA 3TTFA 4BC5A 4EIAA 1VQNN 4AM6A 1EQYA 1GLCG 3CCEN 3CMAN 4CBUA 3NVKA 2PHCB 5C2DA 3V4GA 1R59O 2QWNA 2ASMA 3DWLA 1YXQA 5MLCQ 5H1SQ 1VQON 5AQGA 5M1NA 2HF4A 2ITMA 1IG8A 3FZLA 3VETA 3GTQA 1S3XA 4JKEA 3T69A 2ZGYA 4JK8A 4XH4A 4CZJA 3E1YA 4FOEA 4NO7A 1TWFA 4PKHA 4BRFA 3QFUA 3LDQA 4H0TB 3MDQA 1NMDA 3TTDA 5EOYA 3R6MA 2WUSA 1C0FA 4C3IC 4C3JC 3Q3QA 3KZBA 1JCGA 3CF5L 4EHTA 3WXKA 3OREA 4M1XA 3G4AA 5CHPA 4CZKA 3K9KA 4NLBA 1TWGA 3O08A 3KWGA 5AQNA 3VEVA 2HF3A 1NM1A 1V4TA 5GAHP 4CD1A 1NGIA 2ZF5O 3ZEUB 1XXCA 5KQDA 1NLVA 3M1FA 1MWMA 2UYTA 4IJNA 5GIPA 3EKSA 5JMVA 4RWTA 3FR0A 3OA9A 5LJVA 2ZFZA 3WUHA 4BC4A 4B1UB 3SAGA 3M5RA 5GINA 3PLAA 4IOAL 5AFUA 2A40A 3DLLL 3C7NA 4E1JA 1RGIA 3MCAB 1VQ8N 4JNEA 1TUYA 1ATSA 2GSOA 4LC9B 5BN9A 3U9ZA 3DXKB 1WOQA 4YOWA 3GTPA 1M1KO 3H1VX 4BQZA 3P31A 4RCHA 1QQNA 3EE8A 2GWKA 3M3ZA 3ID6A 4H0YB 3ULEA 2QXLA 3ERED 2FF3B 3VMFB 4JKDA 3CCUN 3SBTA 3M6GA 4PHTX 3UKRB 2QA4N 4BKWA 2E2OA 3L4KA 3FLCO 4WQ5A 4IOCL 1I50A 4JHDB 2IVOA 4XH1A 5JVHL 1TWHA 4B1XB 1GLDG 3OBWA 3C6AA 4I6MA 2HOEA 2Q36A 3QBWA 5TKYA 3WT0A 1SS6A 1YJNN 5AQTA 3A5NC 2E2IA 3IDHA 3CXCM 1KD1O 3O1BA 3MK6A 5BRFA 3LM9A 2NRXA 2OANA 5CHIA 1JCEA 1VQ9N 5FPNA 3O5BA 5AQPA 5AQOA 2NRRA 4M7XA 3PIOL 1SZ2A 4A5AA 4EAHD 1VQKN 3CJ9A 3CQXA 1NBWA 5HL7L 1EK8A 2DPNA 3AGRA 1QZ5A 5AQJA 2HBKA 2AP1A 2FF6A 1AB4A 4G0VA 5AQHA 4C1NI 2E88A 3O4WA 3U4LA 3SLCA 3I33A 4BR5A 2RH6A 4KDDA 1VQMN 2CGKA 3VF6A 2RGRA 1XQSC 3FZHA 1XXAA 3D2EA 2CFAA 1NGHA 4CD3A 3P38A 1QZ6A 3GTKA 3H3NO 1VQ5N 3E9PA 4GTFA 2W40A 4K42A 5DM6L 3VTIA 1O26A 5C0YA 4WYBA 5AQQA 4LQYA 2CGLA 4ILHA 2V7YA 5AQSA 1LOTB 4CBWA 4Z94A 4I6MB 3CJCA 1VQ4N 3DAWA 5BREA 3OHRA 1BG3A 4LR2A 3KVGA 3A5MC 5EX5A 2NRVA 5BPNA 4GTCA 4KB4A 3RSEA 4P5AA 2FSJA 1XXBA 4B1YB 2CGJA 3GTMA 2Q0UA 1NGBA 1T3VA 4J8FA 3CCJN 1X3NA 3SAHA 1JJ2M 3H3OB 3GL1A 1RDUA 3WEEA 2P9SA 2KLAA 3MCPA 2D0PA 1B4BA 1EH1A 4FWMA 4IFEA 5ELZA 4BR7A 1IS1A 3E66A 3HI0A 4R79A 4U7BA 1HKBA 2P9IA 2Q97A 3OW2M 1R9TA 4GFQA 2YU9A 3CI5A 2RE2A 2RHKA 2E2HA 3LPXA 4QS8A 1LCUA 2GWJA 1KAZA 2XCOA 5EGHA 4QS7A 3AAQA 2QI2A 4BRLA 1O25A 2IIRA 4KARA 1DT9A 2VGNA 2NNWA 4OPAA 3VPZA 2E20A 4BR4A 3O9SA 5KPRA 4FM9A 1JCFA 3VEXA 2JWLA 4FWNA 3FE1A 4A57A 5B8HA 5CE3A 3G71N 1ISEA 1SAZA 3FFKB 1ZVUA 3MMLB 4FZBA 2ZJQL 1HX1A 5CR4A 1NGFA 2ASPA 3O6WA 4B9QA 4BGBA 3J7ZO 3TSUA 4FSVA 1VAZA 2YCHA 2QW9A 1ILYA 2JA6A 4G9ZA 3HBTA 3MWTA 2ZGZA 2JA7A 3CJ1A 3VF4A 5C12A 2NRWA 1OVYA 1SFOA 4CI6A 3EO3A 2ZWHA 3VGKA 4JAXA 5C2FA 1KC8O 1O2AA 3MMVA 4BRMA 3BF3A 1GE9A 1YUWA 1ZXOA 3D2FB 3VERA 1Y1VA 2PAVA 2FXUA 1T6CA 3O9RA 2F9TA 4DDQA 1GLBG 3S0XA 4PKGA 2A41A 4KASA 3A5OC 2P9IB 4IO9L 4BRKA 1WQFA 2NRTA 3A8YA 3J8AA 3BUZB 4CZIA 3ZX2A 1F9NA 2BUPA 3P39A 2R92A 3HTVA 4BG8A 3CCMN 3KK7A 1VQLN 4GTEA 1TYQB 1QQOA 3WXLA 4GTDA 4FWLA 4BLBA 3LM2A 2QWQA 3H1QA 4FO0A 2H3GX 4FWOA 3PIPL 3CCVN 5E26A 4FWKA 3E9OA 4BGAA 1K83A 2HBJA 3LAJA 3EZWA 3WXJA 3UB5A 1G99A 4M63C 4YOYA 3T7ZA 1ZC6A 1V4SA 3W0LA 2QWPA 4J3NA 5AR0A 2IVPA 2P9NA 4H0OA 3H6EA 3EKUA 4QS9A 3I55N 3N0CA 4WFNL 1YF5L 3AQPA 2F7TA 4A2BA 4C1NK 5AQKA 3L4QA 3HRGA 3R8EA 4ISEA 4MDBA 4O8UA 4IO8A 4GTLA 1QHAA 4A62A 3CQYA 2FSNA 3MN9A 5F2RA 1KXPA 3EE9A 4H0PA 3FZKA 4YDUA 2VWBA 1OKJA 1BJTA 1KQ4A 2JWKA 2V7ZA 2YI1A 3ENBA 3VA7A 3ZX3A 4WCEL 2J4RA 4PL7A 3SMSA 4XH5A 5FPEA 1TWAA 2ZJRL 2VUMA 2WBNA 4BREA 2FSKA 1K8AO 4G0UA 2D4WA 2IVNA 4DKWA 1KAXA 1ESVA 2E2QA 1O2BA 3L4JA 3TSQA 3D6RA 4JK9A 5GAGP 4JKAA 4BRDA 3K9JA 1HPMA 4JKGA 5I9EB 2PFUA 4H03B 3AY9A 2ASOA 4JKBA 2GEMA 5EXWA 3N0BA 4G0WA 4FWRA 5AQRA 2VYPA 2PBDA 1TWCA 4FPAA 2OTLN 4HTLA 1WQGA 4IJAA 3C7NB 1TUUA 4HWIA 4KAWX 5EGEA 2NLXA 1NGDA 3WQUA 4YOTA 5AQMA 3CCLN 1MA9B 1BOTO 5BPMA 5IOQA 5IOSA 1XUPO 3CMEN 1YVNA 4KMAA 3ZETA 1DD5A 4YOUA 3QBXA 3ULEB 1RFQA 2V51B 3BF1A 3GDQA 3HZ6A 3FKIA 3A5LC 3CJ7A 4YORA 3TU5A 3CJAA 3TTCA 2YJEA 1X9JA 1HKCA 5AZJA 3H46O 5M1PA 2P9KA 3SJHA 2D1KA 1GLAG 3AAPA 4IWVA 3OEPA 3AARA 4WQ5C 4KH4A 3VOVA 5ADXA 4GT9A 2OTJN 1MDUB 4BR2A 3QDKA 3SAFA 5JVGL 4MDAA 1HJOA 1P8ZA 5TKWA 3VGMA 3CC4N 2QWMA 3HM8A 3KHYA 5BRHA 4KM8A 1GLJO 4A2AA 3VEZA 1HLUA 3KWIA 3R1XA 3F9MA 2EWSA 1QVGM 3O1WA 4KC6A 5AZIA 3AH5A 1YHQN 1ATRA 4FOIA 5AQWA 3DXMA 4C3HC 4JN4A 3IMXA 2YHXA 3AQOA 3VEYA 4BRAA 1E4FT 4H0VB 4IZ9A 3C65A 4L3QA 1NGCA 4OO1J 5TJ3A 2JA5A 1K8KA 3GG4A 2QEXN 2P9UA 1O27A 2P9LA 1MWKA 2NVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2V A;  4MLE A;  4CZG A;  4O8K A;  3D2E B;  4FWP A;  3LDO A;  1D4X A;  2A5X A;  4B1V A;  4JD2 A;  1BO5 O;  1ZBS A;  2Q31 A;  4FWQ A;  2FLO A;  1Y64 A;  4XEI A;  4DHY A;  5AQY A;  3B8A X;  3UE5 A;  3RSE B;  2QWL A;  2NRH A;  1X3M A;  1ATN A;  3VEW A;  2KHO A;  2P9P A;  1BUP A;  2Q2R A;  3WEE B;  2GTD A;  2VCP A;  3MN5 A;  2P9S B;  4MO4 A;  2I7P A;  1RDW X;  2Q0R A;  1NWK A;  3EN9 A;  1GLF O;  3CHW A;  2V52 B;  3ZEU A;  5BN8 A;  1Z05 A;  4CZE A;  1NGA A;  4K41 A;  4MO5 A;  2D0O A;  3GBT A;  4PKI A;  2E1Z A;  2A3Z A;  2E1Y A;  4CBX A;  1DEJ A;  5LJW A;  1HKG A;  1NGE A;  3A0I X;  2CH6 A;  1QQM A;  2A42 A;  3LL3 A;  2YJF A;  4Y0W A;  4BRP A;  4B1W B;  5JIC A;  3BP8 A;  4BRC A;  3DXK A;  1U6Z A;  5LY3 A;  3I8B A;  5JLF A;  3ENO A;  2P9P B;  2GEL A;  4BRH A;  1GLE G;  3P4I A;  5E84 A;  2F9W A;  4K43 A;  3UKR A;  1Q18 A;  1BA0 A;  3CER A;  4JHD A;  5AQZ A;  1T44 A;  3JS6 A;  4CZF A;  3VF2 A;  5F1X A;  4FWS A;  5KPZ A;  5JLH A;  3GOI A;  3C0B A;  2E2N A;  3SK3 A;  4A61 A;  3IUC A;  4BG9 A;  1BA1 A;  1S22 A;  5AQV A;  5ADX H;  3VEN A;  3L4I A;  3SMP A;  4CZH A;  4O5F A;  4BRO A;  4C23 A;  4H5V A;  2I7N A;  3UKU A;  3W3D A;  4M7Y A;  4BRQ A;  4FL9 A;  3ENH A;  4DB3 A;  1HUX A;  5F0X A;  5AQU A;  3O80 A;  3WQT A;  5FPD A;  4RTF D;  1BDG A;  2P9N B;  2YHY A;  3MN7 A;  2W41 A;  4DQ8 A;  3ZX0 A;  4WQ4 A;  4ISF A;  3VGL A;  4K25 A;  5EVZ A;  4MLH A;  4BR0 A;  5AQI A;  1YAG A;  4DCH A;  5KPT A;  2HMP A;  3CET A;  3L0Q A;  2BTF A;  3BEX A;  4H5N A;  3TPQ A;  3G25 A;  3L6Q A;  2QWO A;  4BC3 A;  4H5T A;  4YDU C;  5BPL A;  4BRG A;  4GY2 B;  3ATU A;  2NZT A;  2YHW A;  4BC2 A;  3EL2 A;  4BRI A;  2GUP A;  4BQL A;  4CZL A;  3LDN A;  5FPM A;  5BRD A;  3FZF A;  3O8M A;  4ISG A;  1BU6 O;  3UKU B;  4EHU A;  1WUA A;  4BR9 A;  3H45 C;  1KAY A;  1T6D A;  1Z6R A;  3U8X A;  5AQL A;  1GLL O;  3R9P A;  4WQ4 C;  3CJB A;  4BRN A;  4EFH A;  4FPB A;  4AM7 A;  3DJC A;  3QIC A;  3QML A;  3VES A;  3ZET B;  4F9O A;  1C0G A;  1BWF O;  2E8A A;  1SQK A;  4H5W A;  1J6Z A;  5KQ8 A;  1H1V A;  3ID8 A;  4IXC A;  3D7E O;  3QB0 A;  1XC3 A;  4BVO A;  3LDP A;  4BVP A;  3U9D A;  5AZJ B;  2QWR A;  2P9K B;  5BR9 A;  3S41 A;  1NGJ A;  3D2F A;  3FZM A;  2QM1 A;  4H0X B;  3JXU A;  4GNI A;  1CZA N;  4NB4 A;  5EY4 A;  1NGG A;  4PL8 A;  2AA4 A;  2CH5 A;  4CJ7 A;  3IFR A;  3FGU A;  5AZI B;  3GE1 A;  4B1Z A;  3DXM B;  2Q1N A;  4H5R A;  1TYQ A;  2A6A A;  3LDL A;  3WXI A;  1E4G T;  4CZM A;  3CIP A;  2E2P A;  1IJJ A;  1K8K B;  5AQF A;  3VEO A;  2P9U B;  3HSC A;  2P9L B;  1U2V B;  3ATV A;  3MN6 A;  1DGK N;  5AQX A;  5AFU H;  1DKG D;  4KBO A;  3QFP A;  4JD2 B;  4BC5 A;  4EIA A;  4AM6 A;  1EQY A;  1GLC G;  4CBU A;  1R59 O;  2QWN A;  2ASM A;  3DWL A;  1YXQ A;  5AQG A;  2HF4 A;  2ITM A;  1IG8 A;  3FZL A;  3VET A;  1S3X A;  2ZGY A;  4XH4 A;  4CZJ A;  4FOE A;  4NO7 A;  4PKH A;  4BRF A;  3QFU A;  3LDQ A;  4H0T B;  3MDQ A;  1NMD A;  5EOY A;  3R6M A;  2WUS A;  1C0F A;  3KZB A;  1JCG A;  4EHT A;  3WXK A;  4CZK A;  3O08 A;  3VEV A;  5AQN A;  2HF3 A;  1NM1 A;  1V4T A;  4CD1 A;  1NGI A;  2ZF5 O;  3ZEU B;  5KQD A;  1NLV A;  3M1F A;  1MWM A;  2UYT A;  4IJN A;  3EKS A;  5JMV A;  4RWT A;  3FR0 A;  5LJV A;  3WUH A;  4BC4 A;  4B1U B;  5AFU A;  2A40 A;  3C7N A;  4E1J A;  1RGI A;  4JNE A;  1TUY A;  1ATS A;  4LC9 B;  5BN9 A;  3U9Z A;  3DXK B;  1WOQ A;  3H1V X;  4BQZ A;  4RCH A;  1QQN A;  2GWK A;  3M3Z A;  4H0Y B;  3ULE A;  2QXL A;  2FF3 B;  3M6G A;  3UKR B;  2E2O A;  3FLC O;  4WQ5 A;  4JHD B;  2IVO A;  4XH1 A;  4B1X B;  1GLD G;  4I6M A;  5TKY A;  2HOE A;  2Q36 A;  3QBW A;  3WT0 A;  5AQT A;  3A5N C;  3IDH A;  3O1B A;  3MK6 A;  5BRF A;  3LM9 A;  2OAN A;  1JCE A;  5FPN A;  3O5B A;  5AQP A;  5AQO A;  4M7X A;  1SZ2 A;  4EAH D;  3CJ9 A;  3CQX A;  1NBW A;  2DPN A;  1QZ5 A;  5AQJ A;  2AP1 A;  2FF6 A;  5AQH A;  2E88 A;  3O4W A;  3U4L A;  3SLC A;  3I33 A;  4BR5 A;  2CGK A;  3VF6 A;  1XQS C;  3FZH A;  3D2E A;  1NGH A;  4CD3 A;  1QZ6 A;  3H3N O;  2W40 A;  4K42 A;  4WYB A;  5AQQ A;  2CGL A;  2V7Y A;  5AQS A;  1LOT B;  4CBW A;  4Z94 A;  4I6M B;  3CJC A;  3DAW A;  5BRE A;  3OHR A;  1BG3 A;  3KVG A;  3A5M C;  5EX5 A;  5BPN A;  3RSE A;  2FSJ A;  4B1Y B;  2CGJ A;  2Q0U A;  1NGB A;  4J8F A;  1X3N A;  3H3O B;  3GL1 A;  3WEE A;  2P9S A;  3MCP A;  2D0P A;  4FWM A;  5ELZ A;  4BR7 A;  3HI0 A;  1HKB A;  2P9I A;  2Q97 A;  3CI5 A;  4QS8 A;  1LCU A;  2GWJ A;  1KAZ A;  4QS7 A;  3AAQ A;  4BRL A;  2IIR A;  3VPZ A;  4BR4 A;  2E20 A;  5KPR A;  1JCF A;  3VEX A;  4FWN A;  3FE1 A;  5B8H A;  5CE3 A;  1SAZ A;  3FFK B;  1HX1 A;  1NGF A;  2ASP A;  3O6W A;  4B9Q A;  4BGB A;  4FSV A;  2YCH A;  2QW9 A;  3HBT A;  2ZGZ A;  3CJ1 A;  3VF4 A;  4CI6 A;  3EO3 A;  2ZWH A;  3VGK A;  4JAX A;  3MMV A;  4BRM A;  3BF3 A;  1YUW A;  1ZXO A;  3D2F B;  3VER A;  2PAV A;  2FXU A;  1T6C A;  2F9T A;  1GLB G;  4PKG A;  2A41 A;  3A5O C;  2P9I B;  4BRK A;  3A8Y A;  3J8A A;  3BUZ B;  4CZI A;  3ZX2 A;  2BUP A;  3HTV A;  4BG8 A;  1TYQ B;  1QQO A;  3WXL A;  4FWL A;  3LM2 A;  2QWQ A;  3H1Q A;  4FO0 A;  2H3G X;  4FWO A;  5E26 A;  4FWK A;  4BGA A;  3EZW A;  3WXJ A;  3UB5 A;  1G99 A;  4M63 C;  1ZC6 A;  1V4S A;  3W0L A;  2QWP A;  5AR0 A;  2IVP A;  2P9N A;  4H0O A;  3H6E A;  3EKU A;  4QS9 A;  4A2B A;  5AQK A;  3R8E A;  4ISE A;  4IO8 A;  1QHA A;  4A62 A;  3CQY A;  2FSN A;  3MN9 A;  5F2R A;  1KXP A;  4H0P A;  3FZK A;  4YDU A;  2VWB A;  1OKJ A;  2V7Z A;  2YI1 A;  3ZX3 A;  2J4R A;  4PL7 A;  3SMS A;  4XH5 A;  5FPE A;  4BRE A;  2FSK A;  2D4W A;  2IVN A;  1KAX A;  1ESV A;  2E2Q A;  4BRD A;  5I9E B;  1HPM A;  4H03 B;  5EXW A;  3AY9 A;  2ASO A;  2GEM A;  4FWR A;  5AQR A;  2VYP A;  2PBD A;  4FPA A;  4HTL A;  4IJA A;  3C7N B;  1TUU A;  4HWI A;  2NLX A;  1NGD A;  3WQU A;  5AQM A;  1MA9 B;  1BOT O;  5BPM A;  1XUP O;  1YVN A;  3ZET A;  3QBX A;  3ULE B;  1RFQ A;  2V51 B;  3BF1 A;  3GDQ A;  3HZ6 A;  3A5L C;  3CJ7 A;  3TU5 A;  3CJA A;  2YJE A;  1X9J A;  1HKC A;  5AZJ A;  3H46 O;  3SJH A;  2P9K A;  2D1K A;  1GLA G;  3AAP A;  4IWV A;  3AAR A;  4WQ5 C;  3VOV A;  5ADX A;  1MDU B;  4BR2 A;  3QDK A;  3VGM A;  1HJO A;  1P8Z A;  2QWM A;  3HM8 A;  3KHY A;  5BRH A;  1GLJ O;  4A2A A;  3VEZ A;  1HLU A;  3F9M A;  2EWS A;  3O1W A;  5AZI A;  1ATR A;  4FOI A;  5AQW A;  3DXM A;  4JN4 A;  3IMX A;  2YHX A;  3VEY A;  4BRA A;  1E4F T;  4H0V B;  4IZ9 A;  4L3Q A;  1NGC A;  1K8K A;  3GG4 A;  2P9U A;  2P9L A;  1MWK A; 
#chains in the Genus database with same CATH topology
 4KMH A;  5KTQ A;  4O8K A;  1J98 A;  3D2E B;  4HCC A;  1TWA K;  2OPQ A;  3CCQ N;  2VUM K;  1D4X A;  2A5X A;  4B9L A;  4BAC A;  1C0M A;  4DSE A;  4A3K C;  3G4C A;  1QSY A;  1VQ6 N;  1LWF A;  1YX2 A;  1HI9 A;  4YOX A;  4FJX A;  5SZT A;  4XEI A;  1VSJ A;  3NF7 A;  1VH2 A;  4DHY A;  2KZZ A;  1RBR A;  4B3O A;  3B8A X;  3AGK A;  5M3M K;  4C3H K;  1QHT A;  4CEO A;  5C44 K;  1BUP A;  2Q2R A;  5C3E K;  3WEE B;  2BAN A;  4CE9 A;  2P9S B;  4MO4 A;  4DTX A;  1KQS M;  4JI8 K;  4B9T A;  3HOX C;  2F8S A;  2BH1 A;  3AVA A;  2E6M A;  3I0R A;  4KTW A;  1CZ9 A;  1GLF O;  1KVB A;  2V52 B;  1KVC A;  3CHW A;  3ZEU A;  3SQ1 A;  3FOE A;  3ADA C;  4K41 A;  4MO5 A;  4A3K K;  3OYK A;  2O8B A;  3RZD C;  1DEJ A;  1QSS A;  2IGI A;  3LPU A;  1NGE A;  4B9S A;  3TSP A;  2NVY A;  4KMD A;  2CH6 A;  2GSN A;  1NKB A;  4C45 A;  4HUG A;  3AVI A;  5M5Y K;  2R93 A;  3DXK A;  4G7O A;  1Q86 O;  4OPH A;  3R3L A;  1WSF A;  2WC9 A;  5JLF A;  4F4K A;  1JLC A;  1B92 A;  4LF5 K;  4Y52 C;  2P9P B;  3HOX K;  1J9A A;  2VGM A;  4BRH A;  1GLE G;  1JLA A;  3P4I A;  5D4D A;  2X74 A;  3KK1 A;  1TKX A;  3NF8 A;  5AQZ A;  3RZD K;  5HOO A;  3VF2 A;  4CEA A;  3GEH A;  3GOI A;  4RW9 A;  1JXE A;  3SK3 A;  3A2F A;  3MXM A;  5C15 A;  1S22 A;  3HM9 A;  5ADX H;  5KGX A;  2F4V K;  4A3C C;  1P90 A;  1KLN A;  3CPE A;  4CHP A;  4C23 A;  4CJT A;  2Y3P A;  4H5V A;  4ILG B;  3W3D A;  4Y52 K;  3VQA A;  4BRQ A;  1HUX A;  5F0X A;  4FM0 A;  2P9N B;  2RKI A;  3AVB A;  4DTN A;  4O0J A;  5GAE P;  1IO2 A;  4E1N A;  3VGL A;  4NLC A;  4P9S A;  3OYH A;  4BR0 A;  4QAG A;  4X62 K;  1TL3 A;  3TWH A;  1OH6 A;  1S6P A;  2HMP A;  3G25 A;  3OYI A;  3N3Y A;  1BI4 A;  3CQZ A;  4A3C K;  1O24 A;  3ATU A;  1VLO A;  3K59 A;  5J1E A;  4B3M K;  4CHY A;  5JS2 A;  3SQ0 A;  3O9Q A;  4KHU A;  4RW7 A;  2R93 K;  2X78 A;  4KB2 A;  4JKC A;  4JKG B;  3O8M A;  4ISG A;  4IEI A;  3UKU B;  3FHZ A;  1N8R O;  1QSL A;  4BR9 A;  5M1Q A;  3ZSY A;  1U49 A;  3I4N C;  3PO5 A;  1T6D A;  1Z6R A;  4CGG A;  1Q8I A;  4XCH A;  4GV3 A;  3AD7 C;  5AQL A;  3A8K A;  3R9P A;  4CED A;  5LMU K;  3VQ7 A;  4DSL A;  3CJB A;  4BRN A;  4B9U A;  1GOA A;  3ZET B;  4DLE A;  1C0G A;  1FK9 A;  2QXF A;  3N4P A;  3HVR A;  4GV9 A;  1BWF O;  2E8A A;  2XY8 A;  3ID8 A;  1N34 K;  3CQZ C;  3AVM A;  3D7E O;  3QB0 A;  4JI5 K;  1Q7Y O;  3SBG A;  1XC3 A;  1KCF A;  2V6T A;  3CC2 N;  3CAG A;  4CGH A;  2QWR A;  2P9K B;  3ZLJ A;  4M45 A;  1WCM A;  2IC3 A;  3D2F A;  2P5O A;  5C4J K;  3JXU A;  4O44 A;  4GTB A;  3CQ8 A;  3DOK A;  1YIT N;  3CD6 N;  1B4A A;  1OVQ A;  4CJ7 A;  3GTO A;  3E01 A;  2WFB A;  3AO3 A;  1D8Y A;  1HQM A;  3DXM B;  4C8N A;  3MXI A;  2A6A A;  3LDL A;  1E4G T;  4CZM A;  3CIP A;  4XSZ A;  3NVM A;  3CQZ K;  1S1U A;  1C0A A;  1K8K B;  5AQF A;  3VEO A;  4HHT A;  3OYJ A;  4DV2 K;  1U2V B;  4KH5 A;  4J2E A;  1IBA A;  5AQX A;  4CW7 B;  4KAZ A;  1S1T A;  2QTD A;  4KBO A;  3QFP A;  3VA0 A;  1VQN N;  1C0U A;  3CCE N;  3CMA N;  4BE2 A;  3V4G A;  5FLX O;  4CIG A;  5H1S Q;  1SL2 A;  5M1N A;  4F2R A;  2HF4 A;  4JKE A;  3QO9 A;  3G10 A;  4OKK A;  4XH4 A;  4YHH K;  3E1Y A;  4FOE A;  4NO7 A;  4MEX A;  4M3X A;  4H8K A;  3HST B;  3QFU A;  4H0T B;  3MDQ A;  1X31 C;  3TTD A;  5EOY A;  4EP4 A;  3LP2 A;  3KZB A;  1L3U A;  2OZM A;  3TAN A;  2UXB K;  5KRS A;  4CZK A;  2G8V A;  1RDC A;  2IOC A;  3VEV A;  3ASM A;  5GAH P;  1RBV A;  1TK0 A;  4PQU A;  4CD1 A;  1NGI A;  1NLV A;  5GIP A;  5JMV A;  3FR0 A;  1VSL A;  3P83 D;  1WCM K;  4BBS C;  4B9M A;  3C7N A;  2BE5 A;  4AYB L;  1RGI A;  3MCA B;  2E6L A;  4NXN K;  4RW6 A;  3GTO K;  2O8F B;  3WOD A;  3L2W A;  1QQN A;  3ERE D;  2FF3 B;  3VMF B;  4JKD A;  2QKK A;  4AHR A;  1W0H A;  4PHT X;  3UKR B;  4CJ3 A;  4BKW A;  4NCB A;  3L4K A;  3FLC O;  4WQ5 A;  4IOC L;  2IVO A;  1TWH A;  2P8T A;  1GLD G;  4NXM K;  3OBW A;  3C6A A;  3WT0 A;  2HOE A;  1YJN N;  1D9F A;  4FJL A;  1WOS A;  1SS6 A;  4BBS K;  1KD1 O;  3O1B A;  3MK6 A;  5IYD C;  3LM9 A;  2OAN A;  2V6U A;  5AQP A;  2P51 A;  2JA8 K;  4BWJ A;  1SZ2 A;  5CYM A;  3QEI A;  3CJ9 A;  3CQX A;  2VG6 A;  1QZ5 A;  5AQJ A;  4DF8 A;  4E0D A;  4C1N I;  3O4W A;  2JGU A;  3BDP A;  2O4G A;  2CGK A;  1RBU A;  1XQS C;  4CEC A;  2R7Y A;  5IP7 C;  1ZBH A;  4FK4 A;  4JI3 K;  4KFB A;  3GTK A;  5HL8 A;  5DM6 L;  2A68 A;  3O4N A;  4WYB A;  4CCH A;  4LQY A;  4ILH A;  1C1B A;  2V7Y A;  1TWH C;  3CJC A;  4DR3 K;  5C24 A;  3RWU A;  5BPN A;  1N36 K;  4KB4 A;  3ISN C;  4B1Y B;  2CGJ A;  1NGB A;  4A3L C;  3K0S A;  4DTO A;  3SAH A;  1JJ2 M;  1RDB A;  3KKR A;  3KLG A;  2KLA A;  2D0P A;  1B4B A;  1EH1 A;  1X9S A;  4NYN A;  4BR7 A;  3S1R K;  3E66 A;  4ELU A;  5IP7 K;  3ZSO A;  2Q97 A;  1OH8 A;  1S9G A;  2E2J C;  2LSN A;  1SMY A;  3S1N C;  2WOM A;  2QKB A;  1TAQ A;  2XCO A;  3T19 A;  4BRL A;  1WB9 A;  5C42 A;  2VGN A;  5KPR A;  1TWH K;  3GTK C;  5B8H A;  5CE3 A;  1SAZ A;  3MML B;  3M3Y C;  2ZJQ L;  3J7Z O;  4BGB A;  2ATQ A;  3TSU A;  1BS2 A;  1SV5 A;  2YCH A;  4G9Z A;  4A3L K;  3HBT A;  3AVH A;  2JA7 A;  3CJ1 A;  2GAG C;  5HRR A;  1VGX A;  4CI6 A;  1IG9 A;  3LPT A;  4BRM A;  3THX B;  1GE9 A;  3VER A;  3K5L A;  2E2J K;  3S1N K;  1GLB G;  2A41 A;  3AVC A;  3A5O C;  2P9I B;  1WQF A;  5HLF A;  3GTK K;  1X9M A;  1EQR A;  1JLG A;  3M3Y K;  4KHP K;  1VQL N;  4GTE A;  4GTD A;  4MQ3 A;  2QWQ A;  4FO0 A;  1DLO A;  4PA1 A;  4FWK A;  1OH7 A;  1T03 A;  4B9N A;  3LAJ A;  3WXJ A;  4YOY A;  2QWP A;  2GAH C;  4JI7 K;  3L2R A;  3OS0 A;  4WFN L;  3V81 A;  1L3T A;  1TKT A;  1VSH A;  3LAL A;  4C1N K;  4JK1 A;  1NJZ A;  1ZQ1 C;  3AA5 X;  4DS4 A;  4DSJ A;  4A62 A;  3CQY A;  3EEQ A;  3MN9 A;  4FLX A;  2OYQ A;  2JWK A;  2V7Z A;  1J5O A;  3ENB A;  1RT2 A;  3K7A C;  3K58 A;  2J4R A;  5FPE A;  2FBY A;  3V1Q A;  4BE0 A;  4BRE A;  4G0U A;  1KAX A;  1TWG C;  3TSQ A;  4JKA A;  4BRD A;  4FYD A;  2JA7 K;  4JKB A;  3DOL A;  3QEX A;  4ZTJ A;  1N33 K;  1IBK K;  2VYP A;  1SKS A;  3M8Q A;  2XY5 A;  3SYZ A;  4HTL A;  1WQG A;  4KAW X;  3NCI A;  1DCH A;  1J6X A;  2NLX A;  2IDO A;  3CCL N;  3S17 C;  5AQM A;  4F2S A;  3V9Z A;  3THW B;  1MA9 B;  4CF8 A;  3QES A;  4KB1 A;  1DD5 A;  4Z4G A;  3K7A K;  3C95 A;  1U45 A;  5K14 A;  3A5L C;  4I2Q A;  1NJY A;  3TAF A;  4FJ7 A;  3H46 O;  1GOB A;  5M1P A;  5IWA K;  3NAE A;  2D1K A;  5M3F K;  3AAR A;  5ADX A;  1MDU B;  4BR2 A;  3QDK A;  4MDA A;  2UUA K;  1P8Z A;  3CC4 N;  3HM8 A;  5BRH A;  1HMV A;  4CFD A;  3LAM A;  3SV4 A;  1QVG M;  3S17 K;  5AZI A;  3AH5 A;  2ZUF A;  3AVL A;  3CM6 A;  3ITH A;  4JN4 A;  2YHX A;  3NFA A;  1ZBL A;  1VSI A;  2F8T A;  1S1W A;  4OO1 J;  4LK0 A;  2JA5 A;  4BRK A;  2QEX N;  1O27 A;  3BUE A;  4CZG A;  4DR5 K;  5CZ2 A;  4GVM A;  4DV1 K;  3TAB A;  2CFA B;  2W7V A;  4Y7N C;  3CCR N;  4CJ5 A;  3KTQ A;  2Q31 A;  2HHH K;  1HYV A;  2VQE K;  4NOI A;  3K5M A;  2E4L A;  3HPH A;  4KHS A;  3TFH A;  3QX3 A;  1VSM A;  3CCS N;  3THY A;  5AQY A;  3V1R A;  2QWL A;  4ZH4 A;  1RTH A;  3BZK A;  4OIN A;  2HNY A;  1HNZ K;  4KM9 A;  2VCP A;  3QIP A;  3LAK A;  3MWP A;  3UIQ A;  2KZM A;  3OPF A;  3ZSW A;  1T7P A;  1WSV A;  3SPZ A;  2JA5 C;  4Y7N K;  1XI1 A;  2DFE A;  1XHZ A;  2D0O A;  3GBT A;  4PKI A;  1DCO A;  4E3S A;  5FDL A;  5DM7 L;  2Y1J A;  4BBR C;  1LAW A;  2NVQ C;  3PSF A;  1CZB A;  4B1W B;  5JIC A;  5E68 A;  4BRC A;  5LY3 A;  3NGY A;  3I8B A;  3VQP A;  3ENO A;  1NJX A;  2YKM A;  4LF7 K;  2KFZ A;  5L46 A;  5E84 A;  1YJ9 N;  2JA5 K;  4K43 A;  3GTL A;  1BA0 A;  4KKO A;  3J81 O;  1BGW A;  4CZF A;  5GIO A;  5KPZ A;  1NKC A;  4CJS A;  4FVU A;  3TI0 A;  4DV5 K;  4BBR K;  3C0B A;  3KLF A;  1UWB A;  4DWI A;  5J2N A;  2NVQ K;  3F73 A;  5AQV A;  1QQC A;  3VEN A;  4DU4 A;  2JH3 A;  3U3G A;  4P5B A;  1Q82 O;  3EYZ A;  5IYC C;  2HST A;  2WB1 D;  3VQD A;  4I2P A;  4FL9 A;  4AHV A;  1Y1W A;  4DSF A;  5IOR A;  1WAJ A;  3WQT A;  4IG3 A;  3B6O A;  4RTF D;  1XZQ A;  3L8B A;  4DQ8 A;  2EHG A;  4WQ4 A;  3J7Y P;  4WF9 L;  4DS5 A;  4DF4 A;  3HOZ C;  4K25 A;  4CF9 A;  1EO1 A;  1C1C A;  4C8L A;  1J5E K;  3GTL C;  2IAJ A;  2BTF A;  1KSP A;  2FBX A;  2GV9 A;  1PJ7 A;  1IBM K;  3HVT A;  4YDU C;  3SCX A;  2HVH A;  2YHB A;  1YVU A;  4CJV A;  4GY2 B;  2YHW A;  4YY3 K;  1VQ7 N;  3QER A;  3EL2 A;  4BRI A;  2HVI A;  2GUP A;  2B63 A;  4BQL A;  2PZS A;  4CZL A;  3LDN A;  4YFX A;  4IOX A;  2KKZ A;  5BRD A;  2ETJ A;  1K73 O;  4DFP A;  2XCQ A;  1YI2 N;  1W7A A;  3H45 C;  4ELV A;  4OPK A;  3HOZ K;  2A69 A;  3GTL K;  1F7V A;  4WQ4 C;  3TR8 A;  5C44 C;  4CFB A;  1QVF M;  3M8P A;  4WFB L;  1LV5 A;  3VES A;  3LDS A;  3DXJ A;  1NOY A;  3V4I A;  1J6Z A;  4XLP A;  4FW2 A;  4OPJ A;  2KQ2 A;  4DTS A;  2YHA A;  1HJR A;  2GBZ A;  1HNX K;  4FM2 A;  5BR9 A;  1NU0 A;  3G6E N;  4B3R K;  3T1A A;  1WSR A;  2XCR B;  2B63 C;  4NB4 A;  1BIZ A;  2G8I A;  1RTI A;  1G15 A;  4CJE A;  3QNO A;  4JI0 K;  3HK2 A;  3BY5 A;  3Q7C A;  3C94 A;  1ZYQ A;  2Q1N A;  4M3Z A;  3Q7B A;  4JI6 K;  4H5R A;  1TYQ A;  3WXI A;  2E2P A;  5I3U A;  3AVK A;  1UV7 A;  2YNI A;  1WN7 A;  4Q5V A;  3AD9 C;  5IP9 C;  3HSC A;  2P9L B;  1YTA A;  4ILD A;  2UUC K;  1DGK N;  2DFF A;  2ITG A;  2O8E A;  4FLT A;  5AFU H;  3HOU C;  2Z1G A;  3J7A P;  2O8D B;  1O13 A;  2B63 K;  4JD2 B;  3TTF A;  2PHC B;  3NVK A;  2HB5 A;  3NH0 A;  1YXQ A;  2E5L K;  4FXD A;  2ITM A;  1IG8 A;  3FZL A;  3PUF A;  3VET A;  3GTQ A;  1S3X A;  3KLE A;  2FBV A;  4WIL A;  1TWF A;  4CZJ A;  2FBT A;  4BRF A;  1REV A;  4V19 S;  4BXX C;  3PO2 K;  2D0B A;  3R6M A;  1JVI A;  5HRN A;  4C3J C;  3Q3Q A;  1JCG A;  5IP9 K;  1MU2 A;  3WXK A;  1Z26 A;  5FRO A;  3ORE A;  4M1X A;  5CHP A;  3SI6 A;  3K9K A;  4NLB A;  3PO4 A;  4CJF A;  4CVN E;  2HF3 A;  1V4T A;  4DQP A;  3HOU K;  2VQF K;  3SUQ A;  5KQD A;  3M1F A;  1MWM A;  2UYT A;  3K57 A;  3EKS A;  4FJI A;  3BZC A;  3OA9 A;  2AJQ A;  4BC4 A;  3S2D C;  2UUB K;  2A6E A;  4IOA L;  1IKW A;  4DR6 K;  5M5W K;  3WNF A;  3DLL L;  1WSG A;  3O4Q A;  4E1J A;  2NVY C;  4OGC A;  1VQ8 N;  1TUY A;  1ATS A;  2GSO A;  5IT9 O;  4BXX K;  3ZCM A;  4LC9 B;  3U9Z A;  2R93 C;  4F8R A;  3GTQ C;  3OVN A;  1M1K O;  3GTP A;  4X64 K;  4RCH A;  1TWF C;  4C3J K;  4BWM A;  1BCO A;  3CCU N;  2OCE A;  4KN7 A;  3M6G A;  1WSH A;  3JYT A;  2VG7 A;  5HRP A;  2QA4 N;  2E2O A;  1I50 A;  3ZSV A;  4JHD B;  4B1X B;  2PMZ L;  3S2D K;  1RT6 A;  4HVJ A;  3CXC M;  2NRX A;  2NVY K;  1JCE A;  5T7B A;  1BGX T;  2UXD K;  5SWM A;  4OKE A;  4BDY A;  2NRR A;  4JS5 A;  3PIO L;  4FLY A;  3GTQ K;  4A5A A;  3ULD A;  5HL7 L;  1TWF K;  2DPN A;  2HBK A;  4G0V A;  3T1Y K;  1X1P A;  3SLC A;  5C4J C;  3GTP C;  3SZY A;  3OYE A;  3SNN A;  2PA8 L;  2RGR A;  2B5J A;  2D0A A;  4IFV A;  3VQC A;  3D2E A;  4DV0 K;  4CD3 A;  3JAM O;  1QZ6 A;  2W6K A;  3SV3 A;  3E9P A;  2RN2 A;  4GW6 A;  4FCY A;  4EP5 A;  4M3R A;  1N6Q A;  4CBW A;  1SKR A;  1NK4 A;  1VQ4 N;  5BRE A;  3SUP A;  3OHR A;  1BG3 A;  4LR2 A;  3KVG A;  4QOZ B;  4X65 K;  4P5A A;  2FSJ A;  2NUB A;  1B9F A;  3CCJ N;  1T3V A;  4AQY K;  4FK2 A;  3WEE A;  1RDU A;  4Q4Z A;  2P9S A;  3GTP K;  3MCP A;  3NF6 A;  1HPZ A;  4HTU A;  3T00 A;  3H3V L;  1JXB A;  1T8E A;  3RZO C;  4CJ4 A;  3GSI A;  1ZBF A;  2YKN A;  2FC0 A;  2NVT C;  3OW2 M;  1NK0 A;  3VQ5 A;  1RTJ A;  2E2H A;  2HHQ A;  4QS8 A;  2GWJ A;  5EGH A;  4QS7 A;  2IIR A;  4CES A;  2NNW A;  1I50 K;  1PJ5 A;  1RT1 A;  3O9S A;  4IG0 A;  3VN5 A;  4OIO A;  1KVA A;  3VEX A;  3FE1 A;  1ZVU A;  3G71 N;  4FZB A;  3FFK B;  4CHO A;  2WAQ L;  5CR4 A;  3O6W A;  4O55 A;  1VJE A;  1ILY A;  4AH6 A;  4IFY A;  2JA6 A;  5A2Q O;  4JRP A;  1L3S A;  3VF4 A;  5C12 A;  3TAP A;  1SFO A;  5LMN K;  3EO3 A;  2ZWH A;  4E89 A;  4JAX A;  1KC8 O;  1J6V A;  4OIR A;  3LP1 A;  3RZO K;  1YUW A;  1WCM C;  2NVT K;  1Y1V A;  2FXU A;  1T6C A;  2F9T A;  3S0X A;  4PKG A;  3KLH A;  2XHB A;  2Z1H A;  3CG7 A;  3GTO C;  3BUZ B;  4DSK A;  5DMR A;  2E2H C;  3ZX2 A;  3P39 A;  4DR7 K;  2R92 A;  3HTV A;  3HP9 A;  3V1O A;  1QQO A;  4Q0B A;  4FWL A;  2W6L A;  3ZT2 A;  3H1Q A;  3C6T A;  2HBJ A;  2Y1I A;  4JS4 A;  3W0L A;  3HPO A;  2JA6 C;  5AR0 A;  2P9N A;  4QJV B;  4YNQ A;  2X6S A;  3MXJ A;  1SFO C;  3I4M C;  1NOZ A;  2JA8 C;  1HR0 K;  1VSK A;  1WBB A;  4NCG A;  2E2H K;  4RW8 A;  1TL1 A;  1HQE A;  1KXP A;  4H0P A;  4FJ5 A;  2VWB A;  4FJ9 A;  4DR1 K;  4PAB A;  4N47 A;  3ZX3 A;  4WCE L;  3OYG A;  4CGI A;  4PL7 A;  4LF4 K;  2O8C A;  3MEC A;  2R92 C;  3SMS A;  4LFC K;  4WE1 A;  2DTU A;  4DFJ A;  4DKW A;  1JOE A;  4DTP A;  3D6R A;  4JK9 A;  2JA6 K;  4JKG A;  2PFU A;  5EXW A;  2GEM A;  1SFO K;  3I4M K;  1TWC A;  3KD1 E;  1TUU A;  2G8W A;  1Y1V K;  2D5R A;  4ICL A;  4YOT A;  3TFI A;  1BOT O;  3QEW A;  3ZET A;  4LSL A;  2R92 K;  3J80 O;  3ULE B;  3S1R C;  2V51 B;  1BQM A;  3DLR A;  3VQ9 A;  1S1V A;  3CJA A;  2YJE A;  3A8J A;  1X9J A;  3CFP A;  2P9K A;  3S14 C;  4F3T A;  3ALY A;  4WQ5 C;  4KH4 A;  3HO1 A;  4I7F A;  3SAF A;  3VGM A;  1HJO A;  4KM8 A;  1HLU A;  3KWI A;  4DTJ A;  3DLE A;  3OYN A;  2EWS A;  4KC6 A;  2P1J A;  1HNV A;  2KW4 A;  1ATR A;  4FOI A;  3PY8 A;  2EBB A;  3DXM A;  4RW4 A;  3M8R A;  1OH5 A;  3AQO A;  5KI6 A;  2XY6 A;  4Y1C A;  4L3Q A;  1WSI A;  3TAQ A;  4M3Y A;  1K8K A;  1JKH A;  4PWD A;  1XZP B;  1MWK A;  2NVX A;  4B08 A;  1U2V A;  4MLE A;  4RG8 A;  3KK3 A;  3S14 K;  4GV6 A;  1JLE A;  4FWP A;  1RDD A;  4B1V A;  2ZJP L;  3GTJ A;  1ZBS A;  3ZSX A;  2DFH A;  4FWQ A;  2FLO A;  4JKF A;  1RT5 A;  2RPI A;  3L2V A;  4DV7 K;  1HQU A;  1EXQ A;  2HND A;  3I56 N;  1ASU A;  4FLV A;  2OA8 A;  4FZZ A;  3RSE B;  1X3M A;  4LFA K;  3VEW A;  4HUF A;  3DRR A;  3DLB A;  2O4I A;  1VSD A;  4KV8 A;  4I9L A;  3MN5 A;  4FLZ A;  4DLG A;  4KRE A;  4K8Z A;  4K8X A;  2I7P A;  4BY7 C;  3EN9 A;  1NWK A;  4KTQ A;  1SL0 A;  4YFN A;  4DU1 A;  1DTT A;  1Z05 A;  4CZE A;  2PYJ A;  2X6N A;  4DFK A;  4A3B K;  4CJW A;  1IE0 A;  4CBX A;  3QIO A;  3TAM A;  3NMU A;  4E19 A;  5D3G A;  3ZSZ A;  3GTJ C;  3LL3 A;  2A42 A;  3RVC A;  1FJG K;  3HP6 A;  2YJF A;  4WJ3 M;  4Z0U A;  2O8F A;  1U6Z A;  3THY B;  1WIH A;  4GKJ K;  3DM2 A;  1RBT A;  2JA7 C;  1O28 A;  3H08 A;  5CJ9 A;  3KLI A;  2YV0 X;  3CM5 A;  4DQI A;  3GEI A;  4BY7 K;  3VA3 A;  1W2B M;  1YIJ N;  1INN A;  3VQ4 A;  3UKR A;  1Q18 A;  2NVX K;  3CER A;  3O3F A;  1Z25 A;  1J53 A;  2B6A A;  4YFU A;  5F1X A;  4FJN A;  5JLH A;  1CXQ A;  3GTJ K;  3RTV A;  4AYB D;  2E2N A;  4A61 A;  4CJU A;  1BA1 A;  2PY5 A;  4AIL C;  3L4I A;  3SMP A;  2YX6 A;  3CFO A;  4CJR A;  4A93 C;  3VQE A;  3TAE A;  4BRO A;  4N76 A;  2WTU A;  2HHS A;  2I7N A;  2HHX A;  1FXX A;  4FK0 A;  1CXU A;  1ASW A;  1I39 A;  3O80 A;  1TK8 A;  4GVE A;  2YHY A;  4U67 L;  1U4B A;  4C3I K;  3QLH A;  3ZX0 A;  3OY9 A;  2NRZ A;  4LD0 A;  4FJK A;  4MLH A;  4KAT A;  3IRX A;  4BY9 C;  2DY4 A;  1YAG A;  4DCH A;  5KPT A;  1YJW N;  3CET A;  3L0Q A;  4BDP A;  3TPQ A;  3BEX A;  5KRT A;  4ZTF A;  3AVJ A;  3L6Q A;  5LL6 Z;  3U6F A;  1XMO K;  4ILJ A;  4ELT A;  2QWO A;  4BC3 A;  1IKY A;  5FRM A;  5BPL A;  5TMC A;  1WAF A;  4BRG A;  4A93 K;  4O0I A;  3AO2 A;  5FPM A;  1ITG A;  2R7Z A;  3FZF A;  4NYF A;  1UA0 A;  3AA2 A;  2ZQB A;  4LLG A;  1KAY A;  1I3Q A;  4E7H A;  3U8X A;  1GLL O;  2IS3 A;  4HCB A;  3V9S A;  3JSM A;  3O9U A;  5GAD P;  4FZY A;  1JL2 A;  4EFH A;  3GTG A;  3QIC A;  3QML A;  4XIU A;  1UOC A;  2UXC K;  5FLM C;  1KFD A;  4LF6 K;  4H5W A;  3KIO A;  3L3U A;  3QIN A;  4IXC A;  2GX9 A;  4A5B A;  1NJW A;  4OVL A;  3ZT1 A;  3LDP A;  4E7K A;  3U9D A;  5AZJ B;  3S41 A;  4B9V A;  1NGJ A;  3FZM A;  2QM1 A;  4H0X B;  4N5S A;  4UY8 O;  3N0C A;  5IYB C;  5EY4 A;  1CZA N;  1NGG A;  4M3U A;  2AA4 A;  1W97 L;  2CH5 A;  3RMB A;  1YNJ A;  2PPB A;  1WOP A;  4OGE A;  3F2K A;  3S1M C;  3LP3 A;  4AF1 A;  3O3G A;  4LY7 A;  5FLM K;  1IJJ A;  3AVN A;  3S15 C;  3GTG C;  2P9U B;  3IG1 A;  3MN6 A;  4A3I C;  4JI4 K;  4TSX A;  2GSU A;  2HBM A;  4C2M C;  1DKG D;  2KFN A;  1EQY A;  5IYB K;  4CJQ A;  1R59 O;  2QWN A;  2ASM A;  3DWL A;  5MLC Q;  2R7Z K;  3KD5 E;  3L2U A;  1NNE A;  1EWQ A;  1I3Q K;  4A3J C;  2ZGY A;  3S1M K;  1S9E A;  4KI4 A;  4PKH A;  4X66 K;  1RT3 A;  3S15 K;  1HYS A;  4ID5 A;  3GTG K;  1I94 K;  4OIQ A;  3G4A A;  1HYZ A;  4A3I K;  1TK5 A;  3O08 A;  3KWG A;  4FW1 A;  1NM1 A;  1XHX A;  4C2M K;  3ZEU B;  1XXC A;  4C8M A;  4IJN A;  4OLB A;  2ZFZ A;  1RNH A;  5LJV A;  3SZZ A;  3OYM A;  1C0T A;  2O8B B;  3WUH A;  3SAG A;  4B1U B;  3M5R A;  2A40 A;  4R5P A;  4A3J K;  1BCM A;  4M3W A;  2A1S A;  1KLM A;  3THW A;  1TKZ A;  5BN9 A;  1IV0 A;  3DXK B;  5AJ3 K;  1WOQ A;  4YOW A;  3V9U A;  1K6Y A;  4CHQ A;  3EE8 A;  3EQL A;  2GWK A;  3M3Z A;  1BL3 A;  2QXL A;  4OKJ A;  3SBT A;  3O3H A;  3S3M A;  2Z1J A;  5JVH L;  4XH1 A;  3SZ2 A;  4I6M A;  5TKY A;  2Q36 A;  3QBW A;  3A5N C;  2E2I A;  5BRF A;  5CHI A;  1J54 A;  5FPN A;  3O5B A;  3IS9 A;  2ZD1 A;  3NGI A;  4DG1 A;  4KHY A;  2V6S A;  5EU7 A;  2HHT A;  4AHU A;  1NBW A;  3AVF A;  1TAU A;  1JLB A;  1AB4 A;  2FF6 A;  2WON A;  4A3G C;  5AQH A;  2E88 A;  1Y1W C;  4OJR A;  3VF6 A;  1NK9 A;  2GUI A;  2D0C A;  2CFA A;  3P38 A;  3H3N O;  1VQ5 N;  2W40 A;  5CY4 A;  3MEG A;  3VTI A;  3TTG A;  3K5N A;  1BI4 B;  3DMJ A;  3ZT0 A;  1LOT B;  4Z94 A;  4CGF A;  4XSX A;  5EX5 A;  2NRV A;  1E3M A;  2E2I C;  1XPP A;  2BE2 A;  1NK8 A;  4FVM A;  1RT4 A;  3GTM A;  2Q0U A;  4A3G K;  1X3N A;  1ASV A;  1NK7 A;  2A6H A;  1Y1W K;  3OYC A;  1DCP A;  2XRI A;  4IFE A;  4CJL A;  5HBM A;  1UA1 A;  4R79 A;  4U7B A;  5FRN A;  4GFQ A;  3HPG A;  1R9T A;  2RHK A;  3P1G A;  3QET A;  2ZUE A;  3LPX A;  4N41 A;  1KAZ A;  1I6H C;  4DR2 K;  2QI2 A;  1O25 A;  4ID1 A;  1DT9 A;  4CGD A;  3PO2 C;  3NH1 A;  3OJU A;  1FKO A;  3VQB A;  4A57 A;  2Z1I A;  1ISE A;  1LWC A;  3TFJ A;  3U3Y A;  2JLE A;  3OYA A;  1NGF A;  2ASP A;  2E2I K;  4M42 A;  1HRH A;  1I3A A;  1VAZ A;  4KRF A;  2QW9 A;  4PAA A;  3RMC A;  3MWT A;  2ZGZ A;  1IKV A;  1EP4 A;  4F3O A;  1KRP A;  1NG9 A;  3CYM A;  3VGK A;  1O2A A;  3MMV A;  3GTM C;  3BF3 A;  3QNN A;  1ZXO A;  3D2F B;  1RDA A;  1KTQ A;  2D6F C;  4FM1 A;  2PAV A;  4NCA A;  4DV4 K;  4DDQ A;  4DMN A;  1ZBU A;  1I6H K;  4KAS A;  2NRT A;  3A8Y A;  4CK2 A;  1R9T C;  1DTQ A;  3M8S A;  3K2P A;  4BG8 A;  4A3D C;  1EFW A;  3PSI A;  4BLB A;  1USO A;  4FWO A;  3PIP L;  3CCV N;  4BE1 A;  5E26 A;  1Y97 A;  3E9O A;  4BGA A;  1VHX A;  1X9W A;  3OTO K;  1G99 A;  4JRQ A;  1ZC6 A;  3GTM K;  3GIR A;  3JST A;  2QK9 A;  1YT3 A;  3EKU A;  3H6E A;  4JI2 K;  5J2M A;  2FQT A;  4KHQ A;  1U04 A;  2F96 A;  4K0K K;  3AQP A;  1I6V A;  4A2B A;  1XWL A;  3HRG A;  3L4Q A;  3LAN A;  4B3T K;  2O5I A;  1XMQ K;  1R9T K;  1S5J A;  1B9D A;  4MDB A;  2FSN A;  3LWL A;  3EE9 A;  3SUO A;  4A3D K;  4W5Q A;  4HUE A;  1KQ4 A;  4W5O A;  3VA7 A;  3HL8 A;  3GEE A;  2WBN A;  1K8A O;  2IVN A;  3S3N A;  1O2B A;  2OPR A;  2E2Q A;  3DI6 A;  3AD8 C;  3L4J A;  4CEF A;  5GAG P;  2BGG A;  3RR7 A;  3K9J A;  1HPM A;  3N0B A;  5C4X C;  4H03 B;  2ASO A;  4FWR A;  3EZ5 A;  4GZY A;  1XC9 A;  1WSJ A;  3F9K A;  4CEB A;  4JYA K;  3RR8 A;  4FPA A;  4W5N A;  3C7N B;  5EGE A;  1EWR A;  3L3V A;  4O4G A;  3ZT3 A;  4JV5 K;  3PO3 C;  4B8A B;  5IOS A;  4DUY K;  1YVN A;  2KTQ A;  3DLH A;  4OX9 K;  3SQ4 A;  4AH9 A;  3QBX A;  1C1A A;  1RFQ A;  3BF1 A;  3GDQ A;  5E41 A;  4DV3 K;  4DTU A;  3FKI A;  3TU5 A;  4Z4F A;  1A5W A;  1HKC A;  2O8C B;  5C4X K;  4IWV A;  4GT9 A;  4KO0 A;  1I50 C;  2OTJ N;  4E7I A;  5TKW A;  2QWM A;  3KHY A;  3L2Q A;  2XO7 A;  4A2A A;  3VEZ A;  4DFM A;  4A3M C;  3F9M A;  4JI1 K;  3MEE A;  3PO3 K;  4CIF A;  3IMX A;  1U47 A;  3VEY A;  4W5R A;  3NH2 A;  3KK2 A;  4IZ9 A;  1J6W A;  3QEV A;  4Z4I A;  3GG4 A;  1JQW A;  2P9L A;  4JEP A;  3HOS A;  4KTZ A;  1R0A A;  4IBN A;  3FKI C;  5BR8 K;  2O8D A;  3LDO A;  2ZM6 K;  4JD2 A;  1BO5 O;  4BLA A;  1QTM A;  4BDZ A;  5IOT A;  1S1X A;  4A3M K;  5CYQ A;  2KWA A;  1WOO A;  4CHN A;  3I4N K;  2PYL A;  1Y64 A;  1YNN A;  3MX2 A;  3G4S N;  3UE5 A;  4CEE A;  2NRH A;  3VTH A;  5JS1 A;  3WNE A;  4E7L A;  1ATN A;  2KHO A;  4G7Z A;  2P9P A;  5M1K A;  1TVR A;  1XNQ K;  4MFB A;  3CC7 N;  2GTD A;  4KH6 A;  5M1O A;  2G8U A;  1VK0 A;  3T01 A;  1M90 O;  1RDW X;  2Q0R A;  5JVO A;  3FKI K;  2W42 A;  1IL2 A;  5BN8 A;  1WQH A;  1NGA A;  2YNG A;  4Z4C A;  2E1Z A;  2A3Z A;  2E1Y A;  1VRT A;  5LJW A;  3V6D A;  1HKG A;  1S6Q A;  3CPW M;  3A0I X;  1QQM A;  4CF1 A;  1T05 A;  4GTA A;  3S16 C;  4Y0W A;  4BRP A;  3NDK A;  3BP8 A;  4FJG A;  5FJ8 K;  4KB0 A;  3OJS A;  3FOF A;  3H0G A;  4CK3 A;  3HOT A;  2GEL A;  4AHC A;  3NF9 A;  3WNH A;  2F9W A;  3LZI A;  3PX4 A;  3OS1 A;  1Y1V C;  4DV6 K;  4Z4E A;  4C8O A;  5I42 A;  3HOY C;  4JHD A;  1KFS A;  4RMF A;  1USM A;  2HW3 A;  3OYF A;  3S1Q C;  1T44 A;  1NMN A;  3JS6 A;  1F9N A;  4CJP A;  4FWS A;  4DTR A;  4GKK K;  3DYA A;  2I5J A;  3AO4 A;  3IUC A;  4BG9 A;  3M4O C;  5JFE A;  3S16 K;  4B8C A;  4I9Q A;  2G8F A;  1NJI O;  4CZH A;  4JLH A;  4O5F A;  3UKU A;  2YNF A;  4M7Y A;  4YOV A;  4LOW A;  3ENH A;  1NK5 A;  4DB3 A;  5AQU A;  3BP8 C;  5FPD A;  1BDF A;  1BDG A;  3MN7 A;  3H0G C;  5TMF A;  2W41 A;  4A3E C;  3DLG A;  3AO1 A;  4ISF A;  1A5X A;  3HOY K;  2P5M A;  2PMZ D;  2OZS A;  3MED A;  3S1Q K;  5EVZ A;  3T3F A;  2Y0S L;  1CLQ A;  3AVG A;  4M3T A;  5AQI A;  5HP1 A;  1S72 N;  3HOV C;  4H5N A;  3M4O K;  3SPY A;  4JK7 A;  4A59 A;  1NKE A;  4H5T A;  1TKD A;  5C10 A;  3MX5 A;  3B6P A;  3OS2 A;  2NZT A;  4BC2 A;  1F7U A;  1K9M O;  2HNZ A;  4M41 A;  1EET A;  1O1W A;  4QIW L;  3CFR A;  2PA8 D;  4CJK A;  4FLU A;  4BY1 C;  1BU6 O;  3H0G K;  4EHU A;  3O9T A;  3LAP A;  1WUA A;  4A3E K;  3PX6 A;  3KJV A;  4CHZ A;  1Q81 O;  4IDK A;  1TWC C;  3NUH A;  2RF2 A;  1EKE A;  4CGJ A;  3HOV K;  2B4J A;  4MEY A;  4CF2 A;  2HBL A;  3E9L A;  2FQO A;  4FPB A;  4AM7 A;  3DJC A;  4F9O A;  3HOW C;  1ZYR A;  1U48 A;  4WFA L;  3ZYY X;  5IYD K;  5KQ8 A;  1SQK A;  4IEE A;  1H1V A;  3AV9 A;  4W5T A;  3C6U A;  4DUZ K;  4DR4 K;  3KKS A;  3OYB A;  4DQS A;  2CW0 A;  4BVO A;  4BVP A;  4A3B C;  3H3V D;  3D0P A;  4BY1 K;  3C6H A;  1VRQ C;  3IKM A;  5M1F A;  1C6V A;  4DQR A;  4IDH A;  4QCL A;  3OBY A;  3WXM B;  4GNI A;  4O5B A;  2ZE2 A;  4PL8 A;  4EZ9 A;  1TWC K;  3IFR A;  3FGU A;  3N4Q A;  3VQ8 A;  1TV6 A;  3TAR A;  5AZI B;  1PJ6 A;  3GE1 A;  4B1Z A;  4CFA A;  1O29 A;  3IAY A;  3LZJ A;  2WAQ D;  1WBD A;  3HOW K;  1HNW K;  1IKX A;  4LSN A;  3F5T A;  5C25 A;  3ATV A;  4CF0 A;  2NVX C;  4YG2 A;  5CZ1 A;  1VQP N;  4O2D A;  3DLK A;  4N56 A;  4JKH A;  4BC5 A;  4Z4H A;  1RIL A;  4EIA A;  4LJZ A;  4AM6 A;  1GLC G;  4QJV A;  4OIP A;  4Y1D A;  4CBU A;  3NE6 A;  5C2D A;  1VQO N;  5AQG A;  4KN4 A;  4CER A;  3OYD A;  3T69 A;  4XLN A;  4JK8 A;  2HMI A;  4KI6 A;  1FKP A;  3P5J A;  4B3S K;  1LWE A;  3LDQ A;  4PUO A;  1NMD A;  1IBL K;  2WUS A;  1C0F A;  3AA4 A;  1Q9Y A;  4C3I C;  3CF5 L;  4EHT A;  1RU0 A;  3WNG A;  1IW7 A;  5KGW A;  1TWG A;  5AQN A;  3MAQ A;  2ZF5 O;  5HRO A;  1WNS A;  3AA3 A;  2VWK A;  4RWT A;  2G8H A;  3D45 A;  3FFI A;  1F93 A;  5HRS A;  4J2D A;  5GIN A;  3PLA A;  5AFU A;  3AO5 A;  1SKW A;  4JNE A;  1ZBI A;  1BIU A;  3THV A;  3H1V X;  4BQZ A;  3P31 A;  4WJ4 A;  2A1R A;  3ID6 A;  4H0Y B;  4OLA A;  2WB1 L;  3ULE A;  3T02 A;  1YCL A;  4A3F C;  3EY1 A;  3VQQ A;  4LH4 A;  1L5U A;  1TGO A;  5M5X K;  1V5V A;  3HKZ L;  4LH5 A;  3HXA A;  4DU3 A;  5AQT A;  3IDH A;  1QS4 A;  1A5V A;  4CEZ A;  3QEP A;  1JL1 A;  1SUQ A;  1VQ9 N;  4UQG A;  1D5A A;  5AQO A;  2Y0S D;  4KMU A;  4M7X A;  4E1M A;  2YNH A;  4EAH D;  1VQK N;  1EK8 A;  3AGR A;  2AP1 A;  3IPJ A;  3U4L A;  4X6A C;  2HHU A;  1XZP A;  4A3F K;  4BR5 A;  3I33 A;  2RH6 A;  4KDD A;  1XZQ B;  1VQM N;  3FZH A;  4J2A A;  1XXA A;  4H4M A;  1NGH A;  1Q9X A;  3RRG A;  4QIW D;  1TWG K;  1JLF A;  4GTF A;  4K42 A;  1WSE A;  4EZ6 A;  4DQQ A;  1N32 K;  5C0Y A;  1O26 A;  1VSE A;  5AQQ A;  2CGL A;  1EI6 A;  5AQS A;  3G0Z A;  4I6M B;  2BDP A;  3DAW A;  3A5M C;  3SQ2 A;  4PY5 A;  4LK1 A;  4GTC A;  3RSE A;  4YFK A;  1WOR A;  1XXB A;  4J8F A;  3THX A;  1YTU A;  1JLQ A;  2XY7 A;  3H3O B;  3I8D A;  4X6A K;  3GL1 A;  1LW0 A;  1LAV A;  4AHT A;  2R7Z C;  4FWM A;  5ELZ A;  1IS1 A;  3HI0 A;  1HKB A;  2P9I A;  2YU9 A;  3CI5 A;  2RE2 A;  4CEQ A;  1XNR K;  1I3Q C;  2HHW A;  4KHN A;  4KHW A;  1LCU A;  3AAQ A;  4KAR A;  3NHG A;  3VPZ A;  4OPA A;  3ZSQ A;  1QE1 A;  4BR4 A;  2E20 A;  4FM9 A;  1JCF A;  4LFB K;  2JWL A;  4FWN A;  1HX1 A;  4B9Q A;  3NGZ A;  4FJH A;  4FSV A;  2Q3S A;  3HT3 A;  3V9W A;  4G1Q A;  2NRW A;  1OVY A;  4ZHR A;  1RCH A;  3GDZ A;  5C2F A;  4FJM A;  3O9R A;  3I0S A;  3PV8 A;  3S3O A;  4IO9 L;  2UU9 K;  1EX4 A;  3J8A A;  2YU9 C;  4CZI A;  2G8K A;  2BUP A;  3CCM N;  3KK7 A;  1TYQ B;  3WXL A;  1L0W A;  2VG5 A;  2EX3 A;  3LM2 A;  4LF9 K;  2H3G X;  1VSF A;  1K83 A;  3LP0 A;  1N5Y A;  2O8E B;  3EZW A;  3UB5 A;  4C8K A;  4M63 C;  4CIE A;  3T1H K;  1BHL A;  3T7Z A;  1V4S A;  4FJJ A;  4MQ9 A;  4J3N A;  2IVP A;  4H0O A;  4QS9 A;  3I55 N;  2HHV A;  1YF5 L;  4H4O A;  1L3V A;  2F7T A;  3OYL A;  5AQK A;  1VRU A;  3R8E A;  3LWM A;  4ISE A;  3HXM A;  1RTD A;  1SL1 A;  4KPY A;  2YU9 K;  1F21 A;  1RBS A;  4O8U A;  4IO8 A;  4GTL A;  1QHA A;  3S2H C;  4GMJ B;  5F2R A;  3ZSR A;  3S9H A;  3FZK A;  3DRP A;  4YDU A;  4CFC A;  5J2Q A;  1NK6 A;  1OKJ A;  1BJT A;  4DSI A;  2YI1 A;  1IH7 A;  4XH5 A;  2P5G A;  1TWA A;  3HYF A;  2ZJR L;  2VUM A;  2FSK A;  2OPP A;  2D4W A;  3K5O A;  3SUN A;  1ESV A;  1O2F B;  4LF8 K;  1BQN A;  4E7J A;  5I9E B;  4IKF A;  3BP3 A;  4G0W A;  1WLJ A;  3AY9 A;  4CK1 A;  4G7H A;  1K83 C;  5AQR A;  1BIS A;  2PBD A;  1LW2 A;  1D9D A;  2OTL N;  1RT7 A;  4IJA A;  3BGR A;  4HWI A;  3HKZ D;  1NGD A;  3WQU A;  1FW6 A;  3S2H K;  2O5J A;  5BPM A;  3SJJ A;  3RRH A;  4FLW A;  3NBP A;  1XUP O;  3CME N;  5IOQ A;  4KMA A;  1HNI A;  4FJ8 A;  4YOU A;  1G51 A;  3HZ6 A;  4YOR A;  3CJ7 A;  3TTC A;  4AHS A;  5DK5 A;  4DTM A;  3HJF A;  3A8I A;  5AZJ A;  4J2B A;  3SJH A;  5IYC K;  1W9H A;  1GLA G;  3AAP A;  1TWA C;  3OEP A;  1IQ0 A;  3VOV A;  1K83 K;  2VUM C;  5JVG L;  5J2P A;  3DRS A;  1GLJ O;  1GOC A;  2VWJ A;  3ZT4 A;  3R1X A;  3VQ6 A;  4Q5S A;  3RMA A;  2OPS A;  3O1W A;  3V9X A;  1YHQ N;  4L8R B;  3PX0 A;  5AQW A;  4C3H C;  4BRA A;  1E4F T;  4H0V B;  3RMD A;  4FZX C;  3TAG A;  3C65 A;  1UAX A;  1NGC A;  5C3E C;  5TJ3 A;  2P9U A; 
#chains in the Genus database with same CATH homology
 4JEP A;  1U2V A;  3BUE A;  3HOS A;  4MLE A;  4CZG A;  4KMH A;  4O8K A;  3D2E B;  2CFA B;  4GV6 A;  3CCQ N;  4FWP A;  3LDO A;  1D4X A;  2A5X A;  4B1V A;  4JD2 A;  2ZJP L;  1BO5 O;  3CCR N;  1ZBS A;  3GTJ A;  4BLA A;  2Q31 A;  5IOT A;  3G4C A;  1VQ6 N;  4FWQ A;  4YOX A;  2FLO A;  2KWA A;  3QX3 A;  4JKF A;  1Y64 A;  4XEI A;  3CCS N;  3MX2 A;  4DHY A;  5AQY A;  3G4S N;  3I56 N;  3B8A X;  3UE5 A;  3AGK A;  3RSE B;  2QWL A;  2NRH A;  1X3M A;  3VTH A;  1ATN A;  3VEW A;  2KHO A;  2P9P A;  5M1K A;  1BUP A;  2Q2R A;  4KM9 A;  3CC7 N;  3WEE B;  2GTD A;  2VCP A;  4KH6 A;  3MN5 A;  2P9S B;  3MWP A;  4MO4 A;  5M1O A;  1KQS M;  3OPF A;  1M90 O;  2BH1 A;  2I7P A;  1RDW X;  2Q0R A;  1NWK A;  3EN9 A;  5JVO A;  1GLF O;  3CHW A;  2V52 B;  3ZEU A;  5BN8 A;  3FOE A;  1Z05 A;  4CZE A;  1NGA A;  1WQH A;  4K41 A;  4MO5 A;  2D0O A;  3GBT A;  4PKI A;  2E1Z A;  2A3Z A;  2E1Y A;  4CBX A;  1DEJ A;  3NMU A;  5LJW A;  5DM7 L;  1HKG A;  1NGE A;  3CPW M;  3TSP A;  3A0I X;  2NVY A;  2CH6 A;  1QQM A;  2A42 A;  3LL3 A;  3RVC A;  2GSN A;  4KMD A;  4GTA A;  2YJF A;  4Y0W A;  4BRP A;  4B1W B;  5JIC A;  2R93 A;  3BP8 A;  4BRC A;  3DXK A;  1Q86 O;  1U6Z A;  3R3L A;  4OPH A;  5LY3 A;  1WIH A;  3FOF A;  3I8B A;  2WC9 A;  5JLF A;  3H0G A;  3ENO A;  1O28 A;  3HOT A;  2P9P B;  5CJ9 A;  2GEL A;  2VGM A;  4BRH A;  1GLE G;  3P4I A;  1W2B M;  5E84 A;  1YIJ N;  1YJ9 N;  2F9W A;  4K43 A;  3GTL A;  3UKR A;  1Q18 A;  1BA0 A;  3CER A;  4JHD A;  5AQZ A;  1BGW A;  1T44 A;  5HOO A;  3JS6 A;  4CZF A;  3VF2 A;  5F1X A;  4FWS A;  5KPZ A;  5JLH A;  3GOI A;  5GIO A;  4FVU A;  3C0B A;  2E2N A;  3SK3 A;  4A61 A;  3IUC A;  4BG9 A;  5C15 A;  1BA1 A;  1S22 A;  5AQV A;  5JFE A;  5ADX H;  3VEN A;  3L4I A;  2JH3 A;  3SMP A;  1P90 A;  1NJI O;  4P5B A;  2YX6 A;  4CZH A;  4O5F A;  3CPE A;  4BRO A;  4C23 A;  1Q82 O;  2HST A;  2Y3P A;  4H5V A;  2I7N A;  4ILG B;  3UKU A;  3W3D A;  4M7Y A;  4BRQ A;  4YOV A;  4FL9 A;  3ENH A;  1Y1W A;  4DB3 A;  1HUX A;  5F0X A;  5AQU A;  5IOR A;  3O80 A;  3WQT A;  5FPD A;  4RTF D;  1BDG A;  2P9N B;  2YHY A;  4GVE A;  3MN7 A;  4U67 L;  2W41 A;  4DQ8 A;  5GAE P;  3ZX0 A;  4WQ4 A;  4ISF A;  3VGL A;  2NRZ A;  2P5M A;  4WF9 L;  4NLC A;  4K25 A;  5EVZ A;  1EO1 A;  4MLH A;  4KAT A;  4BR0 A;  5AQI A;  4BY9 C;  1S72 N;  1YAG A;  4DCH A;  5KPT A;  1YJW N;  2HMP A;  3CET A;  3L0Q A;  2BTF A;  3BEX A;  4H5N A;  3TPQ A;  3G25 A;  3N3Y A;  3L6Q A;  4JK7 A;  4ILJ A;  3CQZ A;  4A59 A;  2QWO A;  4BC3 A;  4H5T A;  4YDU C;  5BPL A;  1O24 A;  4BRG A;  5C10 A;  3MX5 A;  4GY2 B;  3ATU A;  2NZT A;  2YHW A;  1VQ7 N;  4BC2 A;  3EL2 A;  4BRI A;  1K9M O;  3O9Q A;  2GUP A;  2B63 A;  4BQL A;  4CZL A;  3LDN A;  4IOX A;  5FPM A;  2KKZ A;  4KB2 A;  4JKC A;  5BRD A;  4JKG B;  3FZF A;  3O8M A;  4IEI A;  1BU6 O;  4ISG A;  3UKU B;  1K73 O;  3FHZ A;  2R7Z A;  1N8R O;  4EHU A;  2XCQ A;  3O9T A;  1YI2 N;  1WUA A;  4BR9 A;  3LAP A;  3H45 C;  5M1Q A;  1KAY A;  1I3Q A;  1Q81 O;  1T6D A;  1Z6R A;  4GV3 A;  3NUH A;  3U8X A;  5AQL A;  1GLL O;  3R9P A;  4WQ4 C;  1QVF M;  3O9U A;  4WFB L;  2HBL A;  3CJB A;  4BRN A;  4EFH A;  3E9L A;  5GAD P;  4FPB A;  4AM7 A;  3DJC A;  3QIC A;  3QML A;  3VES A;  3ZET B;  4F9O A;  3GTG A;  1C0G A;  3N4P A;  4WFA L;  4GV9 A;  3ZYY X;  1BWF O;  2E8A A;  1SQK A;  4H5W A;  1J6Z A;  4IEE A;  5KQ8 A;  1H1V A;  3ID8 A;  4IXC A;  2GX9 A;  4A5B A;  3D7E O;  3QB0 A;  1Q7Y O;  3SBG A;  1XC3 A;  4BVO A;  3CC2 N;  3LDP A;  4BVP A;  3CAG A;  3U9D A;  5AZJ B;  2QWR A;  2P9K B;  5BR9 A;  3G6E N;  3C6H A;  3S41 A;  1NGJ A;  1WCM A;  3IKM A;  5M1F A;  2XCR B;  3D2F A;  3FZM A;  2QM1 A;  4H0X B;  4IDH A;  3OBY A;  4UY8 O;  3JXU A;  3WXM B;  4GNI A;  1CZA N;  4NB4 A;  5EY4 A;  4GTB A;  1NGG A;  4PL8 A;  1YIT N;  1B4A A;  3CD6 N;  2AA4 A;  1W97 L;  2CH5 A;  4CJ7 A;  3IFR A;  3GTO A;  3FGU A;  2WFB A;  3N4Q A;  5AZI B;  3GE1 A;  3Q7C A;  3F2K A;  4B1Z A;  1O29 A;  3DXM B;  4AF1 A;  2Q1N A;  3Q7B A;  4H5R A;  1TYQ A;  2A6A A;  3LDL A;  3WXI A;  1E4G T;  4CZM A;  3CIP A;  2E2P A;  3NVM A;  1IJJ A;  3F5T A;  1K8K B;  5AQF A;  3VEO A;  2P9U B;  3HSC A;  2P9L B;  4ILD A;  1U2V B;  3ATV A;  3MN6 A;  1DGK N;  4KH5 A;  5AQX A;  2GSU A;  5AFU H;  2HBM A;  1VQP N;  4C2M C;  1DKG D;  2QTD A;  1O13 A;  4KBO A;  3QFP A;  4JD2 B;  4JKH A;  3TTF A;  4BC5 A;  4EIA A;  1VQN N;  4AM6 A;  1EQY A;  1GLC G;  3CCE N;  3CMA N;  4CBU A;  3NVK A;  2PHC B;  5C2D A;  3V4G A;  1R59 O;  2QWN A;  2ASM A;  3DWL A;  1YXQ A;  5MLC Q;  5H1S Q;  1VQO N;  5AQG A;  5M1N A;  2HF4 A;  2ITM A;  1IG8 A;  3FZL A;  3VET A;  3GTQ A;  1S3X A;  4JKE A;  3T69 A;  2ZGY A;  4JK8 A;  4XH4 A;  4CZJ A;  3E1Y A;  4FOE A;  4NO7 A;  1TWF A;  4PKH A;  4BRF A;  3QFU A;  3LDQ A;  4H0T B;  3MDQ A;  1NMD A;  3TTD A;  5EOY A;  3R6M A;  2WUS A;  1C0F A;  4C3I C;  4C3J C;  3Q3Q A;  3KZB A;  1JCG A;  3CF5 L;  4EHT A;  3WXK A;  3ORE A;  4M1X A;  3G4A A;  5CHP A;  4CZK A;  3K9K A;  4NLB A;  1TWG A;  3O08 A;  3KWG A;  5AQN A;  3VEV A;  2HF3 A;  1NM1 A;  1V4T A;  5GAH P;  4CD1 A;  1NGI A;  2ZF5 O;  3ZEU B;  1XXC A;  5KQD A;  1NLV A;  3M1F A;  1MWM A;  2UYT A;  4IJN A;  5GIP A;  3EKS A;  5JMV A;  4RWT A;  3FR0 A;  3OA9 A;  5LJV A;  2ZFZ A;  3WUH A;  4BC4 A;  4B1U B;  3SAG A;  3M5R A;  5GIN A;  3PLA A;  4IOA L;  5AFU A;  2A40 A;  3DLL L;  3C7N A;  4E1J A;  1RGI A;  3MCA B;  1VQ8 N;  4JNE A;  1TUY A;  1ATS A;  2GSO A;  4LC9 B;  5BN9 A;  3U9Z A;  3DXK B;  1WOQ A;  4YOW A;  3GTP A;  1M1K O;  3H1V X;  4BQZ A;  3P31 A;  4RCH A;  1QQN A;  3EE8 A;  2GWK A;  3M3Z A;  3ID6 A;  4H0Y B;  3ULE A;  2QXL A;  3ERE D;  2FF3 B;  3VMF B;  4JKD A;  3CCU N;  3SBT A;  3M6G A;  4PHT X;  3UKR B;  2QA4 N;  4BKW A;  2E2O A;  3L4K A;  3FLC O;  4WQ5 A;  4IOC L;  1I50 A;  4JHD B;  2IVO A;  4XH1 A;  5JVH L;  1TWH A;  4B1X B;  1GLD G;  3OBW A;  3C6A A;  4I6M A;  2HOE A;  2Q36 A;  3QBW A;  5TKY A;  3WT0 A;  1SS6 A;  1YJN N;  5AQT A;  3A5N C;  2E2I A;  3IDH A;  3CXC M;  1KD1 O;  3O1B A;  3MK6 A;  5BRF A;  3LM9 A;  2NRX A;  2OAN A;  5CHI A;  1JCE A;  1VQ9 N;  5FPN A;  3O5B A;  5AQP A;  5AQO A;  2NRR A;  4M7X A;  3PIO L;  1SZ2 A;  4A5A A;  4EAH D;  1VQK N;  3CJ9 A;  3CQX A;  1NBW A;  5HL7 L;  1EK8 A;  2DPN A;  3AGR A;  1QZ5 A;  5AQJ A;  2HBK A;  2AP1 A;  2FF6 A;  1AB4 A;  4G0V A;  5AQH A;  4C1N I;  2E88 A;  3O4W A;  3U4L A;  3SLC A;  3I33 A;  4BR5 A;  2RH6 A;  4KDD A;  1VQM N;  2CGK A;  3VF6 A;  2RGR A;  1XQS C;  3FZH A;  1XXA A;  3D2E A;  2CFA A;  1NGH A;  4CD3 A;  3P38 A;  1QZ6 A;  3GTK A;  3H3N O;  1VQ5 N;  3E9P A;  4GTF A;  2W40 A;  4K42 A;  5DM6 L;  3VTI A;  1O26 A;  5C0Y A;  4WYB A;  5AQQ A;  4LQY A;  2CGL A;  4ILH A;  2V7Y A;  5AQS A;  1LOT B;  4CBW A;  4Z94 A;  4I6M B;  3CJC A;  1VQ4 N;  3DAW A;  5BRE A;  3OHR A;  1BG3 A;  4LR2 A;  3KVG A;  3A5M C;  5EX5 A;  2NRV A;  5BPN A;  4GTC A;  4KB4 A;  3RSE A;  4P5A A;  2FSJ A;  1XXB A;  4B1Y B;  2CGJ A;  3GTM A;  2Q0U A;  1NGB A;  1T3V A;  4J8F A;  3CCJ N;  1X3N A;  3SAH A;  1JJ2 M;  3H3O B;  3GL1 A;  1RDU A;  3WEE A;  2P9S A;  2KLA A;  3MCP A;  2D0P A;  1B4B A;  1EH1 A;  4FWM A;  4IFE A;  5ELZ A;  4BR7 A;  1IS1 A;  3E66 A;  3HI0 A;  4R79 A;  4U7B A;  1HKB A;  2P9I A;  2Q97 A;  3OW2 M;  1R9T A;  4GFQ A;  2YU9 A;  3CI5 A;  2RE2 A;  2RHK A;  2E2H A;  3LPX A;  4QS8 A;  1LCU A;  2GWJ A;  1KAZ A;  2XCO A;  5EGH A;  4QS7 A;  3AAQ A;  2QI2 A;  4BRL A;  1O25 A;  2IIR A;  4KAR A;  1DT9 A;  2VGN A;  2NNW A;  4OPA A;  3VPZ A;  2E20 A;  4BR4 A;  3O9S A;  5KPR A;  4FM9 A;  1JCF A;  3VEX A;  2JWL A;  4FWN A;  3FE1 A;  4A57 A;  5B8H A;  5CE3 A;  3G71 N;  1ISE A;  1SAZ A;  3FFK B;  1ZVU A;  3MML B;  4FZB A;  2ZJQ L;  1HX1 A;  5CR4 A;  1NGF A;  2ASP A;  3O6W A;  4B9Q A;  4BGB A;  3J7Z O;  3TSU A;  4FSV A;  1VAZ A;  2YCH A;  2QW9 A;  1ILY A;  2JA6 A;  4G9Z A;  3HBT A;  3MWT A;  2ZGZ A;  2JA7 A;  3CJ1 A;  3VF4 A;  5C12 A;  2NRW A;  1OVY A;  1SFO A;  4CI6 A;  3EO3 A;  2ZWH A;  3VGK A;  4JAX A;  5C2F A;  1KC8 O;  1O2A A;  3MMV A;  4BRM A;  3BF3 A;  1GE9 A;  1YUW A;  1ZXO A;  3D2F B;  3VER A;  1Y1V A;  2PAV A;  2FXU A;  1T6C A;  3O9R A;  2F9T A;  4DDQ A;  1GLB G;  3S0X A;  4PKG A;  2A41 A;  4KAS A;  3A5O C;  2P9I B;  4IO9 L;  4BRK A;  1WQF A;  2NRT A;  3A8Y A;  3J8A A;  3BUZ B;  4CZI A;  3ZX2 A;  1F9N A;  2BUP A;  3P39 A;  2R92 A;  3HTV A;  4BG8 A;  3CCM N;  3KK7 A;  1VQL N;  4GTE A;  1TYQ B;  1QQO A;  3WXL A;  4GTD A;  4FWL A;  4BLB A;  3LM2 A;  2QWQ A;  3H1Q A;  4FO0 A;  2H3G X;  4FWO A;  3PIP L;  3CCV N;  5E26 A;  4FWK A;  3E9O A;  4BGA A;  1K83 A;  2HBJ A;  3LAJ A;  3EZW A;  3WXJ A;  3UB5 A;  1G99 A;  4M63 C;  4YOY A;  3T7Z A;  1ZC6 A;  1V4S A;  3W0L A;  2QWP A;  4J3N A;  5AR0 A;  2IVP A;  2P9N A;  4H0O A;  3H6E A;  3EKU A;  4QS9 A;  3I55 N;  3N0C A;  4WFN L;  1YF5 L;  3AQP A;  2F7T A;  4A2B A;  4C1N K;  5AQK A;  3L4Q A;  3HRG A;  3R8E A;  4ISE A;  4MDB A;  4O8U A;  4IO8 A;  4GTL A;  1QHA A;  4A62 A;  3CQY A;  2FSN A;  3MN9 A;  5F2R A;  1KXP A;  3EE9 A;  4H0P A;  3FZK A;  4YDU A;  2VWB A;  1OKJ A;  1BJT A;  1KQ4 A;  2JWK A;  2V7Z A;  2YI1 A;  3ENB A;  3VA7 A;  3ZX3 A;  4WCE L;  2J4R A;  4PL7 A;  3SMS A;  4XH5 A;  5FPE A;  1TWA A;  2ZJR L;  2VUM A;  2WBN A;  4BRE A;  2FSK A;  1K8A O;  4G0U A;  2D4W A;  2IVN A;  4DKW A;  1KAX A;  1ESV A;  2E2Q A;  1O2B A;  3L4J A;  3TSQ A;  3D6R A;  4JK9 A;  5GAG P;  4JKA A;  4BRD A;  3K9J A;  1HPM A;  4JKG A;  5I9E B;  2PFU A;  4H03 B;  3AY9 A;  2ASO A;  4JKB A;  2GEM A;  5EXW A;  3N0B A;  4G0W A;  4FWR A;  5AQR A;  2VYP A;  2PBD A;  1TWC A;  4FPA A;  2OTL N;  4HTL A;  1WQG A;  4IJA A;  3C7N B;  1TUU A;  4HWI A;  4KAW X;  5EGE A;  2NLX A;  1NGD A;  3WQU A;  4YOT A;  5AQM A;  3CCL N;  1MA9 B;  1BOT O;  5BPM A;  5IOQ A;  5IOS A;  1XUP O;  3CME N;  1YVN A;  4KMA A;  3ZET A;  1DD5 A;  4YOU A;  3QBX A;  3ULE B;  1RFQ A;  2V51 B;  3BF1 A;  3GDQ A;  3HZ6 A;  3FKI A;  3A5L C;  3CJ7 A;  4YOR A;  3TU5 A;  3CJA A;  3TTC A;  2YJE A;  1X9J A;  1HKC A;  5AZJ A;  3H46 O;  5M1P A;  2P9K A;  3SJH A;  2D1K A;  1GLA G;  3AAP A;  4IWV A;  3OEP A;  3AAR A;  4WQ5 C;  4KH4 A;  3VOV A;  5ADX A;  4GT9 A;  2OTJ N;  1MDU B;  4BR2 A;  3QDK A;  3SAF A;  5JVG L;  4MDA A;  1HJO A;  1P8Z A;  5TKW A;  3VGM A;  3CC4 N;  2QWM A;  3HM8 A;  3KHY A;  5BRH A;  4KM8 A;  1GLJ O;  4A2A A;  3VEZ A;  1HLU A;  3KWI A;  3R1X A;  3F9M A;  2EWS A;  1QVG M;  3O1W A;  4KC6 A;  5AZI A;  3AH5 A;  1YHQ N;  1ATR A;  4FOI A;  5AQW A;  3DXM A;  4C3H C;  4JN4 A;  3IMX A;  2YHX A;  3AQO A;  3VEY A;  4BRA A;  1E4F T;  4H0V B;  4IZ9 A;  3C65 A;  4L3Q A;  1NGC A;  4OO1 J;  5TJ3 A;  2JA5 A;  1K8K A;  3GG4 A;  2QEX N;  2P9U A;  1O27 A;  2P9L A;  1MWK A;  2NVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...