1ZXOA

X-ray crystal structure of protein q8a1p1 from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr25.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
265
Chain Sequence
LIADSGSTKTDWCVVLNGAVIKRLGTKGINPFFQSEEEIQQKLTAVYFYGAGCTPEKAPVLRRAIADSLPVIGNIKANSDMLAAAHGLCGQKAGIACILGTGSNSCFYNGKEIVSNISPLGFILGDEGSGAVLGKLLVGDILKNQLPATLKEEFLKQFDLTPPEIIDRVYRQPFPNRFLASLSPFIAQHLEEPAIRQLVMNSFIAFFRRNVMQYDYKQYPVHFIGSIAYCYKEILQDAARQTGIQIGKILQSPMEGLIQYHSQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the hypothetical protein Q8A1P1 at the resolution 3.2A. Northeast Structural Genomics Consortium target BtR25.
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
molecule keywords conserved hypothetical protein Q8A1P1
total genus 43
structure length 265
sequence length 278
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zxoA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zxoA03
1K8KB 2IVNA 5AQYA 4EHUA 3O08A 1SAZA 5TKYA 5B8HA 3D2FB 3ZX0A 4JHDA 2FF6A 2HF3A 3WUHA 1GLJO 1R59O 4FL9A 3W3DA 2FF3B 3A5LC 1WOQA 4FWNA 3WXJA 4BRQA 3A5MC 1QQOA 5AQLA 1ZXOA 4MLEA 5BREA 1T44A 2H3GX 3DAWA 1IG8A 4FWLA 1QQNA 2YJFA 2YHYA 1GLEG 3TU5A 4BRCA 4MO4A 4LC9B 4BRHA 1BA0A 2FSJA 3H3OB 2ZF5O 3FE1A 5FPEA 2FLOA 2FSNA 4NB4A 2NZTA 5EVZA 2Q0UA 2P9PA 3H1VX 3A5OC 5KQDA 5AFUH 1G99A 1C0FA 1KXPA 2Q31A 4CZLA 4A61A 3OHRA 3U9DA 3VF2A 4DCHA 4H5NA 3H1QA 4FWMA 2A3ZA 1BA1A 3WEEA 4CZMA 3CJ7A 2AP1A 1X3NA 4J8FA 2D0OA 2P9UA 1HX1A 1NWKA 3U8XA 3LDNA 1NLVA 4FOIA 5E26A 2QM1A 4QS7A 2GWKA 3FZFA 4JD2A 4PKHA 1ESVA 3VGLA 4BR9A 2P9UB 1C0GA 1HUXA 2CGLA 3M1FA 4BRMA 3SJHA 4BVOA 4BQLA 3VF4A 4Y0WA 3KZBA 4FPBA 3FGUA 2V7YA 3U9ZA 3VESA 1QZ6A 3H6EA 5AQGA 2ZWHA 4BC4A 3VOVA 2P9PB 3VGMA 1GLAG 3BP8A 3LDOA 2ITMA 2D0PA 2VYPA 3UB5A 4WQ5C 1NGBA 5F2RA 1JCEA 5AQMA 1RFQA 3A0IX 5CE3A 3H46O 4F9OA 3WQUA 3WXIA 2YCHA 4K43A 4FWOA 4B1YB 4JD2B 1U2VB 3MDQA 3VGKA 2A41A 4CI6A 2ZGZA 3WQTA 1JCGA 4CZHA 2WUSA 2P9NB 4L3QA 1YVNA 2BUPA 4CBUA 2F9WA 4JAXA 1NGAA 2CH6A 1HPMA 1MWKA 4A2BA 4I6MA 1ATRA 2ASPA 1SQKA 4YDUC 5EY4A 1LCUA 1XC3A 3DXMA 3A8YA 4CZIA 4BR5A 2PBDA 4BRPA 1ATSA 3EKSA 3QFUA 3LM2A 2P9IB 4K42A 2A40A 4WQ5A 2A42A 1HKCA 2DPNA 2HOEA 4O8KA 4RCHA 1WUAA 3JS6A 4A62A 4BC3A 5AQVA 4XH4A 4B1XB 2VCPA 3O6WA 4JN4A 4PL8A 4JHDB 5AQXA 4FWSA 1BG3A 2HMPA 1DKGD 1V4SA 4PKIA 5AZIA 3WXLA 4BR4A 1YXQA 5KPRA 4CD3A 1K8KA 3KVGA 3BUZB 2Q0RA 3ZX2A 4NO7A 4MO5A 3FLCO 4GY2B 4K25A 1XQSC 5BRDA 3QB0A 4RWTA 1GLBG 2E2NA 3MN5A 4CZGA 5JLFA 4BC5A 2EWSA 1BU6O 2QWPA 3UKRB 1QQMA 3C7NB 4HWIA 2ASOA 2P9LA 4H5RA 3FZLA 4H0TB 3MCPA 3AY9A 3ULEB 2W40A 4FOEA 4WQ4C 1Y64A 2NRHA 1GLLO 3ENHA 5AZJA 3GOIA 2YHXA 5KPZA 3O1WA 4PKGA 3AAPA 5BN8A 3MN6A 1TUYA 2E2QA 3VEVA 4CZEA 4BRGA 3EN9A 2P9KA 2E88A 5FPNA 3QMLA 3VPZA 1CZAN 4M7XA 5F0XA 1U6ZA 1S22A 5ADXH 1TYQA 1H1VA 3EZWA 5BN9A 3VF6A 3QDKA 3ZEUA 3D7EO 1HLUA 2P9SA 1XUPO 2Q97A 4CBWA 3UE5A 4QS9A 3B8AX 3H3NO 2ASMA 2QWLA 3O80A 3EKUA 1DEJA 4BRAA 5AFUA 3CHWA 1LOTB 4H03B 2CGKA 5AQWA 3BF1A 1D4XA 3VEZA 2E1YA 2J4RA 3FZMA 5AQOA 4RTFD 4CZJA 1YUWA 3QBWA 2QWQA 4FPAA 2HF4A 2Q36A 3FFKB 3CI5A 3L6QA 4HTLA 3ZX3A 4IZ9A 3M6GA 3R6MA 3HI0A 3LM9A 3L0QA 2D1KA 3CIPA 3FZHA 2GEMA 3M3ZA 1MA9B 4EFHA 4EHTA 2PAVA 3JXUA 3ENOA 1EQYA 1P8ZA 4M7YA 3DXKA 3D2EB 2FXUA 3AARA 2P9KB 4PL7A 1KAXA 5AQRA 2GUPA 3CJ1A 3R8EA 4K41A 1NMDA 1Q18A 5AQPA 4BG9A 4BC2A 2OANA 5ELZA 3UKUA 1J6ZA 5AZJB 3O1BA 3IMXA 3LDLA 4BRLA 1T6DA 1X3MA 3SMPA 4Z94A 4BREA 3GDQA 3ULEA 4FSVA 3RSEA 4IXCA 5JMVA 3HBTA 3L4IA 1KAYA 5AQFA 1BDGA 1V4TA 2CGJA 4BRNA 1T6CA 3C7NA 4M63C 3ZETA 5AQUA 3UKRA 3S41A 4FWKA 4E1JA 4H0XB 3LDQA 1YAGA 3LDPA 4H0YB 5JICA 3QBXA 4BRFA 2Q1NA 4WYBA 4JNEA 3O5BA 4CJ7A 2VWBA 2QWOA 3DJCA 3IFRA 1BO5O 3VENA 4H0OA 4AM7A 3ATUA 4FWRA 4BG8A 5AQQA 1E4FT 1Z05A 2QWRA 5AZIB 3UKUB 1RDWX 5AQKA 1RGIA 5AQSA 2E1ZA 1BUPA 1X9JA 3BF3A 4BR2A 2BTFA 2QXLA 3VETA 4B1WB 3BEXA 3GG4A 2A6AA 4BRDA 1BOTO 4FO0A 5EXWA 2YHWA 4WQ4A 1NGFA 3QFPA 5AQTA 3FZKA 3QICA 4B9QA 1NGCA 2CH5A 2P9LB 4BRKA 2QWNA 2YJEA 4IO8A 4BRIA 2D4WA 4H5WA 2E2PA 4BR7A 5F1XA 5KPTA 2P9IA 1NGIA 1QZ5A 2GWJA 4KBOA 1GLDG 4MLHA 1GLCG 2E8AA 4DB3A 3HZ6A 4QS8A 1E4GT 5AQZA 3CJBA 1GLFO 5I9EB 3ZETB 3I33A 2F9TA 2Q2RA 3DXMB 3GL1A 2GTDA 1ZBSA 4IWVA 3RSEB 3VEXA 3SLCA 1NGEA 2YI1A 1NGHA 1OKJA 3HSCA 3CJ9A 3ID8A 4XH1A 1NGDA 3GE1A 4GNIA 4BR0A 3C0BA 5JLHA 1HJOA 3O8MA 2P9NA 1NGGA 4DHYA 1ATNA 3ATVA 3VEYA 5FPMA 1DGKN 3D2EA 3DXKB 1U2VA 2QW9A 4AM6A 5BPMA 1IJJA 4H0PA 4IJAA 3IDHA 2FSKA 5BRHA 1NM1A 1Z6RA 3CETA 3KHYA 1TYQB 2V52B 4ISEA 3AAQA 4H5VA 5AQNA 4DQ8A 4B1UB 3VEWA 3CJAA 5BPNA 2W41A 1MWMA 2V51B 3CERA 2QWMA 3DWLA 4BQZA 5BR9A 4C23A 5E84A 3P4IA 4I6MB 1SZ2A 5AR0A 5BPLA 5KQ8A 3G25A 4IJNA 5AQIA 4EIAA 3F9MA 2I7PA 3WT0A 3MK6A 3A5NC 1KAZA 3SK3A 3H45C 4O5FA 5EOYA 5ADXA 3MMVA 4BVPA 3LL3A 3U4LA 3WXKA 4XEIA 1QHAA 2I7NA 1JCFA 2E2OA 3IUCA 4FWQA 4B1VA 4CZFA 3J8AA 4ISFA 2P9SB 3SMSA 2UYTA 3ZEUB 2E20A 3CQYA 1MDUB 3HM8A 1HKBA 2V7ZA 3CQXA 4ISGA 3FR0A 1NGJA 1S3XA 4A2AA 5BRFA 1NBWA 5LJWA 4H5TA 4EAHD 4BGBA 5LY3A 4BROA 5EX5A 4B1ZA 2NLXA 3MN7A 2ZGYA 3VERA 3I8BA 2A5XA 4XH5A 3GBTA 3VEOA 1HKGA 2IVPA 3TPQA 2IVOA 2KHOA 1TUUA 4CZKA 2GELA 4CD1A 3O4WA 3EO3A 4FWPA 3W0LA 3MN9A 4YDUA 5AQHA 4H0VB 3CJCA 3D2FA 4BGAA 1ZC6A 5AQJA 2IIRA 5LJVA 3HTVA 3WEEB 5FPDA 2AA4A 4CBXA 3R9PA 3EL2A 1BWFO
chains in the Genus database with same CATH superfamily
4BDZA 4LF9K 2HSTA 3ZSVA 1HNVA 5B8HA 2D5RA 2WB1L 4KMAA 1S1WA 3WUHA 4AHUA 3OYMA 2V6SA 3Q3QA 5JS2A 4I2PA 2V6TA 1IBMK 2H3GX 3DAWA 1IG8A 1QQNA 1TGOA 2YJFA 1VSEA 3QETA 4BRHA 4LC9B 4OVLA 4KM9A 4YORA 4FLWA 2ZF5O 3DXJA 1VGXA 3HM9A 1JLAA 4OPAA 4NB4A 2P9PA 1C6VA 4ID1A 1V5VA 3QERA 3MXIA 3GTLK 2ZM6K 1O2BA 4DFMA 2Q31A 2NVXC 2FBVA 4OINA 4I2QA 2EX3A 3VF2A 3LAKA 1TV6A 3MX5A 4A3MK 4FWMA 1BA1A 3WEEA 2YX6A 3M3YC 5IP9C 4XCHA 4LF5K 4E89A 2Y3PA 3GTQC 3HOZC 1B4AA 4MQ3A 4CJ5A 4DSEA 2JA6A 4KTQA 3ZSXA 4PKHA 4FLUA 1ESVA 2XRIA 2P9UB 4RW9A 3OYNA 1ASUA 3S1RK 4BRMA 4BE0A 2PYJA 3SJHA 2R93K 3VF4A 4GT9A 4Y0WA 4Z4IA 4M42A 2W6KA 5FRNA 2V7YA 4JK8A 3S16C 3U9ZA 3THYB 3VESA 1QZ6A 5SWMA 2BANA 1BCMA 2YU9A 1S9EA 3TR8A 3JSTA 2D0PA 2GV9A 4Y7NC 3UB5A 4WQ5C 1NGBA 5KTQA 3RVCA 1RFQA 2QEXN 1IL2A 4F9OA 4G7HA 4U7BA 1RT4A 4FM1A 2E2IK 1XC9A 3MDQA 4OPJA 1UWBA 4U67L 3FOFA 4L8RB 3TARA 1WOOA 3WQTA 5IP9K 1TAQA 3AVJA 3VQ8A 4CJEA 1NKBA 1NK7A 2ETJA 3AGKA 4FJNA 4AHVA 2BUPA 4Q4ZA 3PX6A 3NE6A 2Y1JA 4J2BA 4Z0UA 1NGAA 3CCVN 1HPMA 3V9SA 3C6TA 4CIFA 3VQ4A 5DM6L 4LF6K 3VQPA 2ZE2A 1IE0A 3C6HA 3N4QA 3LPTA 2CFAA 4A3CC 4BR5A 4BRPA 1I3QA 1YTAA 3L2QA 1K8AO 3QFUA 1TWFK 3CFPA 2D6FC 3CC7N 2P9IB 1U04A 4K42A 1Y1VC 1D9FA 4XSXA 2NRWA 2NVQC 3O9QA 1BGXT 4M3RA 5IT9O 4M3YA 4DMNA 4HHTA 5CYMA 2O8FA 3THXA 5AQVA 2O8EA 1BIZA 3HSTB 3O6WA 4JN4A 4PL8A 4YNQA 4JHDB 2KTQA 3HT3A 4FWSA 3OYEA 5JFEA 1V4SA 3CCLN 1SL0A 3WXLA 2YKNA 4BR4A 4Z4CA 1TK8A 1O2AA 4GZYA 5KPRA 4A3DK 2CW0A 1K8KA 3T02A 3KVGA 4KM8A 3ZX2A 4YFNA 3F2KA 1YJNN 3M4OC 4BKWA 4GY2B 1VRTA 3K7AK 1I6HK 1QQCA 5BRDA 1ASWA 2UXBK 1USMA 4RWTA 4CZGA 1EETA 1XHZA 4BC5A 2XY8A 2EWSA 1BU6O 3TFHA 2W6LA 2ZFZA 2ASOA 2YU9K 3FZLA 1EP4A 3ALYA 3SV4A 1WOPA 3GTMK 2W40A 3CQZK 4E3SA 4GV3A 3RMBA 4OX9K 2NRHA 1GLLO 3ENHA 4FLYA 3EEQA 3AO5A 4E7KA 3GOIA 4OJRA 4JKCA 2GUIA 1RT7A 3AAPA 1GOBA 4C8MA 2E2QA 4DS4A 3AVCA 3TAPA 1HNZK 3AH5A 3QMLA 5F0XA 4B9TA 5FROA 1UA1A 1U6ZA 2JLEA 1S22A 2GSUA 3TAGA 5EGHA 3T3FA 5JVGL 3D7EO 1BL3A 4LF4K 3A8KA 4QS9A 1S5JA 5IOSA 5D3GA 4LF8K 2Y0SD 4FZBA 1KRPA 4BRAA 5GAEP 5AFUA 4NXNK 1LOTB 1J53A 1XPPA 4X6AC 4CEZA 1QVGM 1HRHA 5M1PA 4GTEA 3VA3A 1YX2A 4KASA 2E1YA 3FKIC 2X74A 5J2MA 4JI0K 2JGUA 4K0KK 2PY5A 3PO3C 1OH6A 1O2FB 3FFKB 4IO9L 4IZ9A 4FLVA 3M6GA 1XXCA 4QAGA 2FQTA 4JLHA 2UXCK 3CIPA 1FW6A 4IG0A 4JS5A 1RT5A 4PABA 4ELUA 2RH6A 1O27A 1IH7A 4FM0A 1YNNA 1WSVA 2PAVA 3ENOA 1NKCA 1K6YA 2O8DA 3GTKA 3GTPA 4PL7A 2HVIA 3R8EA 1TKZA 2NRZA 2I5JA 1NMDA 4OKEA 2HNYA 5C4XC 3V4GA 4AH9A 1WCMK 3IMXA 3OYJA 3LDLA 4BRLA 3RMCA 3SMPA 1TAUA 3AVIA 4JYAK 4FSVA 5GAGP 3NVKA 3LALA 1KFSA 3HBTA 2P5OA 3S9HA 4WILA 1HNXK 1JLGA 4BRNA 1T6CA 3GTMC 3GTGA 3UKRA 2KZZA 4KB2A 2AJQA 1ZBLA 3QIOA 4NOIA 4DFPA 3LDQA 3CQZA 3QIPA 5EGEA 4KAWX 4A5BA 2Q1NA 4WYBA 2B63A 1BQNA 3HPOA 4A3EK 4CJ7A 4OLBA 2QWOA 4BY1K 3OW2M 3QNOA 3CCUN 3ATUA 3HOYK 4FWRA 4NCAA 1JL2A 3A8IA 4BG8A 4BY7C 3UKUB 4FLZA 3AVKA 2NVTC 3I0SA 3CF5L 4W5TA 3KK3A 3BF3A 4ZHRA 4MEYA 4A3KC 1NJIO 2RKIA 1VHXA 3AA4A 4WFNL 4FO0A 5EXWA 1NGFA 3AVLA 5AQTA 5M1OA 2R7ZA 1CXQA 2KZMA 3SZZA 3AO2A 3GIRA 3ISNC 5CZ1A 2OPQA 4M3TA 4BRIA 2D4WA 4H5WA 4JKGB 4LSLA 1Q82O 3ZSWA 2GWJA 4MLHA 1G15A 1Q81O 2E8AA 1TWCK 3BZCA 4E7IA 2NVQK 5AQZA 3MWPA 3CJBA 3SYZA 4BBSC 1XXAA 3V1QA 2HHQA 4MEXA 1NK9A 4CF0A 3RSEB 3ZSZA 3S17C 4JKHA 1LWCA 4M3ZA 4OO1J 4KRFA 4F3OA 4GNIA 4Y1DA 1IV0A 3U3YA 4W5NA 4FJMA 3GTLA 1BDFA 1J9AA 3O9UA 3IAYA 4DHYA 4DR2K 2JWKA 3ATVA 4N41A 3OS2A 4DQSA 3AVGA 3A2FA 3VEYA 1RT1A 2YNFA 4WFAL 3CC4N 3DXKB 1VSLA 1LWEA 4H0PA 4JEPA 3VA0A 5LL6Z 3KD5E 1IS1A 2GBZA 1NM1A 3KHYA 4FK2A 1TYQB 1RT2A 2RHKA 3DRPA 5DMRA 3AQPA 1TL1A 1NJXA 1IKVA 1VQ8N 4DV0K 1WSJA 3O3HA 4CFDA 2W41A 3KLGA 4CEAA 2BE5A 1L0WA 3GTQK 3DWLA 4BQZA 4GTLA 5LMUK 1WQGA 1YJWN 2VUMC 4DTXA 4A93C 5AR0A 1T7PA 4A3FC 1SUQA 1NMNA 4DR7K 3WT0A 2P1JA 3O3FA 3MCAB 3SK3A 2B63K 1TKDA 4BVPA 3WXKA 3S1RC 3D45A 2E2OA 3IUCA 4CZFA 2GSOA 2P9SB 1DCHA 3HOUC 3BZKA 1BQMA 2VQEK 5BR8K 3LP0A 4DV1K 1RBUA 2Q3SA 1QS4A 3UIQA 4AHRA 2V7ZA 2EHGA 3SPYA 3AD8C 2Z1GA 3S1NK 3M3YK 5BRFA 4CHNA 5C4JK 4H5TA 4BGBA 1YTUA 2JH3A 1C0AA 4B1ZA 4DSJA 2FQOA 4JI4K 3M8SA 3I8BA 1HYVA 1TWCA 5FJ8K 2OPRA 1K9MO 1S1VA 3GBTA 5IYCK 4DTOA 5JS1A 4IOCL 4DQQA 3G4CA 4X66K 3PV8A 4LY7A 2GELA 5HRRA 4E1MA 4OIRA 1TWFA 3H3VL 3PO3K 1CLQA 4AHSA 4FWPA 3W0LA 1UOCA 4CGJA 4YDUA 4FLTA 4KH4A 4H0VB 4BGAA 2OZSA 4QJVB 1R9TA 3R9PA 5C44K 4JNEA 1BWFO 4NLBA 2Y1IA 3L4QA 1SAZA 5KGWA 2A6HA 3ZX0A 1Q7YO 1J6XA 4KI6A 1JLQA 1R59O 3W3DA 1WOQA 4FWNA 3CM5A 3I4MC 3MECA 3A5MC 4GMJB 3THXB 1B4BA 4KV8A 4MLEA 5BREA 5C0YA 1T44A 4FJ8A 1IG9A 4KMHA 4FWLA 3E9PA 1BCOA 3KKRA 4CGFA 1GLEG 4YG2A 4HVJA 1BA0A 3S3NA 3VQ9A 2FSJA 3FE1A 1UV7A 4Z4EA 4DQRA 2FLOA 3NGIA 1O29A 5EVZA 2Q0UA 3VQAA 4M3UA 4FJIA 3G4AA 5KQDA 5AFUH 4G0WA 5CHIA 1C0FA 2A1RA 5IYDK 1KXPA 4JI5K 3GEIA 4AH6A 2IAJA 2JA5C 4KTZA 3TSPA 4G1QA 4DCHA 4LQYA 5C44C 4CZMA 3KK2A 2AP1A 4YY3K 3H08A 2W42A 3LDNA 4A3GC 4JI7K 3HO1A 3HOVC 5E41A 4FOIA 1IQ0A 4JKFA 4FW2A 4QS7A 3V9WA 3B6OA 1LW0A 3V1OA 4FJKA 1ZVUA 1YNJA 4JI3K 4FJ5A 2UUAK 4PHTX 4KO0A 1C0GA 2RE2A 1F93A 1HUXA 4YOVA 4JK9A 4GTDA 5IYCC 3G71N 2KW4A 2OCEA 1NOYA 1KLNA 3SAHA 3ZYYX 4FPBA 2UXDK 1LV5A 2YHBA 1D5AA 2WBNA 2LSNA 3SQ1A 4FW1A 4CECA 5AQGA 2ZWHA 3S1MC 1NK0A 5IYBC 3GSIA 5IOTA 3OTOK 5CHPA 5HOOA 2VYPA 4QOZB 1Z25A 4LH4A 5F2RA 1O24A 4JRPA 3OYDA 2V6UA 4DLEA 3WXIA 3F73A 4G7ZA 4WE1A 2DFFA 3KKSA 1U2VB 3OA9A 4ILGB 4A3BC 4GFQA 2A41A 4A3DC 3ADAC 2ZGZA 4QIWD 1JCGA 2G8FA 3S15K 2P9NB 4L3QA 3SV3A 4X62K 3GDZA 2F9WA 1KTQA 4CESA 3VA7A 4CJQA 2CH6A 4DSFA 3DMJA 4A2BA 3SQ2A 1IBAA 3VQ7A 2IC3A 1SQKA 3OYKA 4IFVA 4YDUC 3NH0A 3CD6N 1LCUA 1XC3A 3DXMA 5J1EA 4CZIA 5FRMA 2A69A 3DOKA 1ATSA 3CC2N 3EKSA 4CJRA 4KH5A 1I3QK 3EY1A 4XSZA 3LM2A 1BI4B 1C1AA 1EXQA 3LWMA 3PO5A 4Y7NK 4DV2K 5C2DA 1HKCA 1XNRK 2HOEA 4O8KA 1JJ2M 1WUAA 1NJWA 1DCOA 1U49A 4BC3A 3HP9A 4XH4A 4CGGA 4B1XB 2OYQA 3S16K 4E7HA 4HUFA 3H0GK 2PYLA 3DYAA 1BG3A 4F4KA 5AZIA 3C6AA 1WBDA 2JA7A 1L3VA 4CD3A 4JKBA 3SQ0A 2Q0RA 1KLMA 2O8CA 1IBKK 5FDLA 1JLFA 4A59A 5GINA 3I56N 2ZUFA 5TKWA 4DTMA 1SL2A 3QEPA 2E2NA 3MN5A 1RBTA 4CJ4A 1Y97A 2G8UA 5JLFA 1R0AA 1NKEA 4C3HK 4IFEA 5I42A 3C7NB 3CCQN 4BDPA 4DV6K 4KAZA 4H5RA 3SAGA 3PX0A 4M3XA 1X1PA 1REVA 4DU1A 3GTOA 5CY4A 1L3SA 1Y64A 1EK8A 3QO9A 5AZJA 3LWLA 5KPZA 3O1WA 4B9LA 4DTNA 3CPWM 4QCLA 5H1SQ 1U45A 3PLAA 3K5LA 4CZEA 2R92K 4BRGA 3EN9A 5FPNA 3VPZA 4BBSK 2QA4N 1CZAN 4W5QA 1TYQA 3GTOC 3ZT3A 5IYBK 2P5GA 5BN9A 3N3YA 2FBYA 4NXMK 1HLUA 2P9SA 5M5YK 3DRSA 2Q97A 3TANA 1VQLN 1VLOA 4A3JK 3HVTA 3UE5A 2WFBA 1EI6A 4BLAA 4JI1K 3B8AX 3T1HK 2QWLA 1WAFA 2WAQD 5J2PA 4C3IC 3N0BA 4C45A 1DEJA 4N5SA 5DK5A 4A3BK 2XY6A 1YJ9N 3TI0A 4PUOA 3CM6A 1N32K 2J4RA 2VG6A 3FZMA 3QEIA 3G10A 2G8KA 4A3IK 3QBWA 2QWQA 4FPAA 3I8DA 2Q36A 4G0UA 3CI5A 3HOVK 1HYSA 4CIEA 1TKXA 3R6MA 4CFAA 4HCCA 1WSIA 3HI0A 2KFNA 2D1KA 1YCLA 2DFEA 4H8KA 3ZT4A 4C8NA 5J2QA 3CCMN 1Z26A 3JSMA 4JRQA 1MA9B 3PO4A 2XCOA 3AVAA 4KHSA 3L2RA 4FM2A 4EHTA 3H0GA 1N33K 1M1KO 3JXUA 1OH5A 4HUEA 1DTTA 4RW7A 1P8ZA 4M7YA 1IKWA 3D2EB 2FXUA 3DXKA 2OTJN 3GTKK 5AQRA 2GUPA 3GTPK 1PJ5A 4IDKA 2ZJPL 1Q18A 4B8CA 5AQPA 4BG9A 1IBLK 3OYAA 4B9VA 1ILYA 3J81O 2O8BB 3UKUA 1DD5A 3RRGA 4B9MA 3O1BA 3LPUA 4JKAA 1BISA 3LDSA 4A3GK 3BP3A 4BREA 2DFHA 3ULEA 1S9GA 3RSEA 4IXCA 3CG7A 4X6AK 3T1AA 3TAMA 4ICLA 3C7NA 3O4QA 4DQIA 3CQZC 1QSLA 3PX4A 3OJUA 4E1JA 4KHYA 2GSNA 1Q9XA 3V6DA 1TWAK 4H0YB 5JICA 4JKGA 4BRFA 4CVNE 4OKKA 2HBKA 3HOXC 3RRHA 1SKRA 4BWMA 2VWBA 3L4KA 1KC8O 1U4BA 1NNEA 2O8CB 4RW8A 1T03A 4PQUA 5IORA 2ZQBA 3QINA 1CZBA 1VQMN 1Z05A 4DWIA 2OA8A 2QWRA 5AQSA 2E1ZA 5I3UA 2RGRA 3T7ZA 3OYLA 4PWDA 1HMVA 1R9TK 2QXLA 4K8ZA 3BEXA 3GG4A 4BRDA 2YHWA 4CF2A 3Q7CA 3OYGA 4B9QA 3SUQA 1NGCA 1TK0A 2CH5A 3BDPA 4CEQA 2O8DB 4CERA 2NRVA 1VSDA 3KWIA 4IFYA 1NGIA 3CCSN 4KBOA 5J2NA 1GLCG 5C24A 3RMDA 1GOCA 3ZETB 3MWTA 4HUGA 1FXXA 4O5BA 2Q2RA 3HXAA 3DXMB 4JK7A 2KLAA 3RR7A 5M1NA 3FKIA 1VSJA 4RW6A 3SLCA 2YI1A 4MFBA 3E01A 4AHCA 4CCHA 1NGDA 4DS5A 3C0BA 4CHYA 2JA5A 5JLHA 1VQNN 3AVMA 3D6RA 4NYNA 4DKWA 1NGGA 4G9ZA 4CF8A 4YOTA 4YOWA 4IDHA 4DUYK 1RDDA 2NNWA 4FVMA 3OS1A 1D8YA 3LPXA 3VTHA 4F8RA 1U2VA 5HRSA 4C2MC 4AM6A 5C10A 3CMEN 2R7ZC 3IDHA 4EZ9A 1Z6RA 2V52B 3M8RA 3L2WA 3NF9A 3K5OA 4DTJA 3AAQA 4H5VA 4XIUA 2F8SA 4DQ8A 3VEWA 4K8XA 5BPNA 2ZUEA 3KLHA 3J7AP 4E0DA 3CERA 2G8VA 3GTQA 5T7BA 3V9XA 5E84A 2P5MA 3P4IA 5KQ8A 3K57A 3NGZA 4DG1A 3HYFA 5AQIA 3H0GC 4C3JK 2B63C 2I7PA 4KATA 1Y1WK 1PJ6A 1NK8A 4FYDA 5A2QO 1L3UA 3LL3A 4XEIA 4JI8K 1QHAA 2E2JC 2WONA 2R92C 4AF1A 1RTJA 4CGDA 1OVYA 4KN4A 3QEVA 4LFBK 4A3CK 1VAZA 2Z1IA 4E7LA 1CXUA 1NBWA 1KVAA 1TWCC 4A5AA 4ILJA 5LY3A 4BROA 1XI1A 5EX5A 4CFCA 4KPYA 4LFCK 2ZGYA 4JV5K 2O8EB 5M5WK 1KVCA 1TL3A 3AVBA 5HROA 3QNNA 1WN7A 2A1SA 3TWHA 2NRTA 3GEHA 1FJGK 1ASVA 2IDOA 3VEOA 2BGGA 4GKJK 3TTGA 4A3KK 2IVPA 3TPQA 2G8WA 5FLMK 1O25A 2KHOA 2RN2A 2NVTK 1RT6A 3S1QK 3TTDA 3O4WA 5C15A 3VQCA 1IKXA 3MN9A 1E3MA 5LJVA 3HTVA 3EYZA 3SUOA 1I50C 1TWHA 3WEEB 5AQKA 3EL2A 3ENBA 3CFOA 1NOZA 5IP7C 1K8KB 2F96A 3LP3A 3AVNA 3O4NA 3V9ZA 4EHUA 5TKYA 4QJVA 4JKDA 4DDQA 4OGCA 4JHDA 4CJ3A 2HF3A 4B3MK 1GLJO 2JA7K 2E2HC 3VQ5A 4YHHK 1YI2N 1QQOA 3T00A 3NHGA 1F21A 3HP6A 1ZXOA 4GTCA 5M1FA 3TSUA 2YHYA 1JOEA 4BRCA 4MO4A 4IEIA 1EX4A 3T69A 4BY1C 3VMFB 3HRGA 1JLCA 3V9UA 3SZ2A 3MEDA 4B9NA 4A3EC 3H1VX 3SJJA 3E1YA 4FJHA 4DQPA 1G99A 5CJ9A 3P1GA 4B08A 4PAAA 3GTLC 4W5RA 3U9DA 3R1XA 4H5NA 3V81A 1RBRA 2WC9A 3KWGA 5KRTA 3IRXA 3L3UA 5M5XK 3E9LA 4J8FA 4OKJA 1R9TC 3OYBA 3U8XA 3KIOA 3Q7BA 1X9MA 1B92A 4IG3A 5E26A 2F4VK 4OPKA 5KRSA 2R92A 4GTFA 1EO1A 2GWKA 4BLBA 3VGLA 1JLEA 4BR9A 1NJZA 1VQ4N 4LSNA 4M41A 1J5OA 4FJ7A 1F7UA 2R7YA 3HKZD 1J54A 2HBLA 3KZBA 3FGUA 4ILHA 3KK7A 1J6WA 4GTBA 3H6EA 3P38A 1WNSA 3L2UA 3HOWC 4E7JA 1GLAG 3BP8A 2ITMA 3CMAN 3VQQA 1WORA 1A5XA 2ITGA 5HL8A 4UY8O 1XMQK 3AO1A 1NK5A 1ZYQA 3WQUA 2YCHA 2HNZA 4CEOA 2VG5A 3CAGA 4X65K 3VGKA 1P90A 2D0CA 1TVRA 3K5MA 4R79A 2ZJQL 2YNHA 2WUSA 3NF8A 1JVIA 3DLGA 1TWAC 3T1YK 4M1XA 3AV9A 4CBUA 2G8IA 3NVMA 2F8TA 4CF1A 3K0SA 1MWKA 3U6FA 4A3LK 4CJKA 3LP2A 3SBTA 5C4JC 5CYQA 4CW7B 3K59A 1USOA 4OIPA 4JK1A 4WCEL 3AO4A 3TAFA 1RTIA 5D4DA 3F5TA 3MMLB 4WQ5A 2HBMA 2DPNA 3VTIA 3SUPA 4Q5SA 1XWLA 1KQ4A 1NK6A 3KTQA 4QIWL 3JS6A 1WB9A 2YU9C 1UA0A 2O5JA 1L3TA 1T05A 3S0XA 5AQXA 4X64K 4KHNA 2HMPA 1DKGD 4A3FK 1X31C 4LK0A 1YXQA 3S1NC 1VSFA 5M1KA 1SS6A 3P5JA 4KMUA 4V19S 1I6HC 4NO7A 4MO5A 4KKOA 2VGNA 2DTUA 3B6PA 2BDPA 3CFRA 1KD1O 3T01A 3M4OK 1LW2A 4K25A 4FK4A 4G7OA 3QB0A 5FLMC 4DV7K 3KLEA 4BXXK 2F7TA 4IBNA 1RT3A 1XNQK 3GEEA 3K2PA 1QQMA 3VQBA 4HWIA 1RU0A 5CR4A 4YOUA 3A8JA 2P9LA 4TSXA 3T19A 1VQPN 3MCPA 3ULEB 2YKMA 3MXMA 2GAHC 3MXJA 2OTLN 3MX2A 3SNNA 3RZOK 2YHXA 2PFUA 4PKGA 1RDAA 3M8QA 5BN8A 1VQ6N 4HTUA 3MN6A 3QEWA 4C8OA 3TFIA 3EE8A 4M7XA 1VJEA 1ZYRA 1C0TA 3K9JA 5ADXH 3FHZA 1H1VA 1XMOK 4E19A 4CHQA 1GOAA 3EZWA 3VF6A 3QDKA 2O4GA 4DV3K 4KMDA 1VSMA 4CBWA 4IOAL 3SAFA 1KQSM 3EKUA 3ZSOA 4C3HC 1YF5L 4FVUA 3CHWA 4DR5K 3OBWA 3OY9A 4DFJA 3AGRA 2XY7A 1M90O 2PA8D 5AQWA 1WSGA 3HPGA 4LLGA 4KI4A 4P5AA 3S17K 1PJ7A 3SPZA 3OBYA 3CXCM 3PUFA 4CHZA 1DLOA 4HTLA 2HF4A 3L6QA 3F9KA 3RMAA 3OREA 1TKTA 4MDBA 3LM9A 1VSKA 3R3LA 2E5LK 1FKPA 1O13A 3FFIA 3FZHA 3M3ZA 4KB1A 1W7AA 2VGMA 4EFHA 2HHHK 4BBRK 3HOSA 4RMFA 3NH1A 1EQYA 1WSRA 3AA5X 3SQ4A 4OLAA 1TWGC 1A5WA 2E6MA 4CGIA 3CQ8A 4BC2A 1VQKN 1VH2A 3S3OA 4M3WA 2VWKA 3MEGA 4JI6K 2OANA 4BY7K 5AZJB 1SFOK 5HLFA 2UUBK 4YFXA 1T6DA 1X3MA 5TMFA 3HOZK 4Z94A 4CEFA 4OGEA 2D0BA 4CJSA 2A6EA 3G6EN 1CZ9A 4FJJA 3AA3A 4AYBD 5JMVA 3L4IA 1KAYA 5AQFA 5C42A 1C0MA 4FM9A 4DU4A 4M63C 4BACA 5AQUA 1N36K 4LH5A 2JA8C 1VK0A 2RPIA 4FWKA 4H4OA 2NVXK 4H0XB 1YAGA 3LDPA 4Q5VA 1LAWA 5C3EK 3QBXA 3S2HC 2HHVA 3NBPA 3DLKA 5FLXO 1Q9YA 1JXEA 3TABA 3DJCA 3VENA 3O9RA 4J2EA 1NK4A 2G8HA 1QSSA 2HHWA 1BIUA 3VQ6A 3L4JA 5IWAK 1HQEA 5C2FA 4KC6A 5AQQA 3ASMA 5AZIB 1WCMC 1RGIA 4KFBA 1ZBHA 1HQUA 2E4LA 4BR2A 2BTFA 4UQGA 1TWHK 3S1MK 2A6AA 5M1QA 1BOTO 4CK3A 1NG9A 4P5BA 3QICA 4B3RK 1WAJA 3GTGK 3MEEA 2QWNA 1JL1A 1RBVA 4Y52K 4NLCA 4BR7A 5KPTA 1BI4A 4CGHA 4I9QA 1QZ5A 2HHSA 1WSFA 1LWFA 3K9KA 4O44A 4F2RA 1EH1A 2P8TA 3CYMA 3ZT0A 1Q8IA 4QS8A 3S14K 1E4GT 1T8EA 2JA6C 3I33A 2DY4A 4N76A 1RBSA 2GTDA 3M5RA 2OPPA 1NGEA 3FKIK 1OKJA 2Z1HA 4RG8A 3PSIA 3CJ9A 2IOCA 3ID8A 4XH1A 3GE1A 1B9FA 4BR0A 3AVHA 3O8MA 2P9NA 2JA5K 3AD7C 1ATNA 5FPMA 3GTJA 1DT9A 1WSHA 4IJAA 2FSKA 4BY9C 5BRHA 2WAQL 1RDCA 4Q0BA 2HHTA 4ISEA 3L3VA 3O3GA 2XHBA 4LK1A 4EP4A 4LF7K 1QE1A 1FK9A 2XY5A 3NFAA 3EE9A 4B1UB 3K7AC 2O4IA 1MWMA 4KB0A 2QWMA 3ZT2A 3I4MK 3GTPC 3ZLJA 4I6MB 1SZ2A 4YFKA 1FKOA 3G25A 4IJNA 1OH7A 2A68A 1HR0K 4C3IK 3TAQA 3MK6A 3P39A 4H4MA 3A5NC 5LMNK 4WJ4A 2VG7A 3O9TA 4O5FA 3CCEN 3RTVA 4A3JC 2HB5A 3MMVA 1O28A 4CHOA 4FWQA 4FK0A 2KFZA 4ISFA 4I9LA 1S6QA 3ZEUB 2E20A 1F7VA 3CQYA 1GE9A 3I55N 1HKBA 1S1XA 1RNHA 4DSKA 3DLBA 3KD1E 4ISGA 4DTRA 1S3XA 1NU0A 4A2AA 1N8RO 4IOXA 5TJ3A 4FZYA 5LJWA 4J2AA 3LAJA 1O26A 4Y1CA 3QLHA 3VERA 3E9OA 3P83D 1HI9A 4ELTA 3HVRA 4BBRC 1ISEA 2Z1JA 3RZDK 3CPEA 4CJTA 3HOTA 1HKGA 2VUMK 1WOSA 3K5NA 4FXDA 1QHTA 4C1NK 4CZKA 2BE2A 4CD1A 1WSEA 2VWJA 3EO3A 1BS2A 3DLEA 4FCYA 5GIOA 3OEPA 1JKHA 2HBJA 3CJCA 3DI6A 2VQFK 3EQLA 1TWGK 3OJSA 3QESA 1T3VA 2AA4A 4CBXA 4GTAA 3BGRA 2W7VA 2IVNA 4FJGA 3GTJK 2QTDA 3ZSRA 5AQYA 4FJLA 2KWAA 4B3SK 3O08A 1O1WA 3D2FB 1WBBA 3DRRA 2FF6A 4GVMA 4FL9A 2FF3B 4O0JA 3A5LC 4DUZK 1KSPA 1EWRA 4B3OA 4O55A 3WXJA 4BRQA 4MDAA 5AQLA 1Y1VK 4DV4K 2PA8L 4KN7A 1TWFC 3HPHA 4ID5A 3TU5A 1KVBA 3S1QC 2Y0SL 3H3OB 3QEXA 2X6NA 1B9DA 5FPEA 2FSNA 4BE2A 3VQDA 1W2BM 2NZTA 1YIJN 3A5OC 1JXBA 3KLIA 3OVNA 3PO2K 3RZDC 3NAEA 3THYA 4CZLA 1VQ7N 3TFJA 4KHQA 1SKSA 2NVYK 4KHWA 4A61A 3OHRA 4C3JC 2R93C 3H1QA 3G4SN 4DR4K 2A3ZA 3CJ7A 1X3NA 1A5VA 4NCGA 2D0OA 2P9UA 1HX1A 1NWKA 2KKZA 5E68A 1MU2A 1NLVA 1J5EK 1I3QC 1XZPB 3ULDA 1ZBFA 2QM1A 5KGXA 3FZFA 1XZPA 4JD2A 2KQ2A 5SZTA 2B4JA 2CGLA 2R93A 3M1FA 3J7YP 4BVOA 4BQLA 5CZ2A 1F9NA 3BP8C 5C12A 4C2MK 3WNFA 4LD0A 2FBXA 1Y1WC 1RTHA 1K83A 3GTJC 1HNWK 1DTQA 2WOMA 1I39A 2VUMA 3NMUA 3S15C 4KDDA 3BY5A 4BC4A 2E6LA 3VOVA 2P9PB 3VGMA 2WTUA 3LDOA 4EZ6A 4KHPK 1I94K 3LAPA 1U47A 2O5IA 1JCEA 3VQEA 5AQMA 1SL1A 2ATQA 3A0IX 3ZT1A 5CE3A 4J3NA 3H46O 2ZD1A 5EU7A 3OYIA 4K43A 4FWOA 4B1YB 3AQOA 4JD2B 4R5PA 1I3AA 3HL8A 4MQ9A 2HVHA 4LJZA 4LFAK 1K73O 4CI6A 1RDUA 3DM2A 4CZHA 2PZSA 4XLPA 3P31A 1YVNA 3PIPL 2QKBA 3V4IA 1L5UA 4JAXA 2UUCK 4KREA 2NUBA 2XO7A 3TTFA 3HJFA 4I6MA 1ATRA 2ASPA 1WLJA 4LR2A 5EY4A 1RTDA 5DM7L 3A8YA 4KTWA 1AB4A 2PBDA 2X78A 3IG1A 3SUNA 3S2DC 5C4XK 2P51A 1C1CA 3IPJA 4GV6A 1IO2A 2A40A 2QKKA 1QSYA 3LP1A 4DV5K 3ZCMA 2A42A 2YV0X 4RCHA 1SMYA 3CCRN 2NVYA 3JYTA 4A62A 2UU9K 2HW3A 1XZQA 3I4NC 5HBMA 2E2HA 2NVXA 4LOWA 3PIOL 4DF4A 2VCPA 4F2SA 4Y52C 3NUHA 4CIGA 3VN5A 4IKFA 4Z4GA 4PKIA 1JLBA 3AA2A 1ITGA 1TWHC 1I50A 3BUZB 3FOEA 3LANA 4PY5A 3FLCO 3THWA 3NF7A 1XQSC 1GLBG 2HMIA 3N4PA 3JAMO 4Z4FA 3S14C 1OH8A 4DR3K 4KH6A 4KARA 3HOXK 3UKRB 2QWPA 4CK1A 1K83K 1SKWA 5K14A 5C3EC 3S2HK 1HYZA 5HP1A 3DLLL 4OIQA 3GTGC 3GTMA 4FJXA 3I4NK 4WJ3M 5C25A 4H0TB 5HRNA 3AY9A 1S1TA 4FOEA 4WQ4C 1JQWA 2QXFA 4WFBL 2IS3A 4HCBA 4A3IC 4ZTJA 1X9WA 4OIOA 1TUYA 2QI2A 3VEVA 2P9KA 2E88A 1YHQN 4CJPA 4B9SA 3AO3A 3DLRA 1VQ5N 3GTKC 1N6QA 3ZEUA 5TMCA 1XUPO 1NJYA 5MLCQ 1IW7A 1YITN 1W9HA 3ERED 3H3NO 2ASMA 3O80A 3SBGA 2XCQA 4NCBA 3ID6A 3IS9A 4DR6K 4CJLA 4H03B 3GTOK 3LZIA 3N0CA 4WF9L 2CGKA 5L46A 3BF1A 1XXBA 1D4XA 3VEZA 3WODA 3HK2A 1VQON 3LAMA 5AQOA 1W97L 3J7ZO 3NCIA 4GKKK 1SFOC 4RTFD 4CZJA 1YUWA 3D0PA 3ZX3A 3HOUK 3S3MA 1BGWA 1RDBA 4C1NI 3THVA 2E2IA 3L0QA 3WNHA 2E2HK 4PA1A 3ZSYA 2GEMA 3OS0A 4AHTA 3HXMA 4KHUA 2YNGA 5M3MK 2NVYC 2JA8K 2NRXA 1Q86O 4YFUA 5IP7K 1YVUA 4AILC 3AARA 2P9KB 4B9UA 1WQFA 1KAXA 3DOLA 3KJVA 1I50K 3CJ1A 4A93K 3OPFA 4K41A 4YOXA 3EZ5A 3KK1A 1WCMA 2E2IC 3QX3A 5ELZA 4DF8A 1J6ZA 1XHXA 1SFOA 2BH1A 2IGIA 3GDQA 3BUEA 4ZH4A 3RZOC 4GV9A 4B8AB 3U3GA 1S1UA 5HL7L 1VQ9N 1BDGA 1V4TA 2CGJA 1DCPA 3O9SA 3TSQA 2EBBA 3ZETA 2B6AA 4DFKA 3L8BA 1SV5A 3S41A 3OYHA 4CE9A 4G0VA 1IKYA 4DTPA 3PO2C 4FLXA 5JVHL 4ILDA 2HNDA 3G0ZA 3NF6A 1ZQ1C 4W5OA 1N5YA 1ZBUA 3O5BA 4A57A 3PSFA 1EWQA 4N47A 3IFRA 4BXXC 1BO5O 1EQRA 4H0OA 4AM7A 3TAEA 2RF2A 1E4FT 1WIHA 3C6UA 2B5JA 4O8UA 1RDWX 4CJWA 2PMZD 1BUPA 3E66A 3V1RA 2HHUA 1X9JA 1J98A 2GX9A 4BDYA 1TWGA 2PHCB 3VETA 2E2JK 4B1WB 1EFWA 3SI6A 4FZXC 5M3FK 2O8FB 1XZQB 4WQ4A 2R7ZK 3I0RA 3QFPA 4GW6A 2QK9A 1G51A 4JI2K 3FZKA 1J6VA 2P9LB 1HQMA 4BRKA 4IO8A 2YJEA 2E2PA 2YHAA 5F1XA 2P9IA 4FZZA 1OVQA 1GLDG 1TWAA 1Y1VA 4DB3A 4DSIA 3HZ6A 1VSHA 4CFBA 4AQYK 1GLFO 2OPSA 5I9EB 2F9TA 4JKEA 2CFAB 3GL1A 4DTUA 4NYFA 4CHPA 1I6VA 4O4GA 1ZBSA 4IWVA 4GVEA 4CEBA 3THWB 3MAQA 3VEXA 4FJ9A 1C1BA 4I7FA 2OZMA 2PPBA 1C0UA 3HOYC 1NGHA 3WNGA 3SCXA 4P9SA 3HSCA 1RCHA 3OYCA 4IEEA 2O8BA 4A3MC 4A3LC 1QVFM 1KCFA 1HJOA 1S72N 4CEDA 1LAVA 1EKEA 5HRPA 4XLNA 3AVFA 1DGKN 4M45A 3CCJN 3D2EA 1WQHA 1HPZA 4N56A 3H3VD 2QW9A 1UAXA 3IKMA 4CJVA 1IJJA 5BPMA 3KLFA 4JS4A 3ITHA 3TTCA 1QTMA 5IOQA 3CETA 3OYFA 2GAGC 3DLHA 4C8KA 5JVOA 1HJRA 5AQNA 3HKZL 4B3TK 3CJAA 3RWUA 2V51B 3WXMB 1TK5A 1RILA 2JWLA 2YNIA 3C94A 2ZJRL 4ZTFA 5BR9A 4DSLA 4EP5A 4YOYA 4C23A 1U48A 2PMZL 3ZSQA 4CEEA 1BHLA 5BPLA 3L2VA 3HOWK 4CJFA 2HHXA 1VSIA 4EIAA 3F9MA 1KAZA 4BE1A 3H45C 1KFDA 3LZJA 5EOYA 5IYDC 4RW4A 3J80O 4DLGA 5ADXA 4KB4A 3U4LA 5GADP 1X9SA 2I7NA 1JCFA 3SZYA 4B1VA 3J8AA 4CJUA 4J2DA 3SMSA 2UYTA 3M8PA 1MDUB 1YT3A 1D9DA 3HM8A 2NRRA 5AJ3K 3CQXA 3C95A 2D0AA 4CK2A 3FR0A 1NGJA 5GAHP 2X6SA 4DTSA 1HNIA 3AD9C 2JA6K 4F3TA 2FBTA 1VRUA 4EAHD 3NH2A 1N34K 3C65A 4C8LA 2NLXA 3MN7A 4DU3A 2A5XA 1K83C 1Y1WA 1INNA 4XH5A 3WNEA 4ELVA 2XCRB 1S6PA 4OPHA 2IVOA 2WB1D 1TUUA 1W0HA 3S2DK 1VRQC 4E1NA 5KI6A 2FC0A 1BJTA 3K58A 3NDKA 4O2DA 4DR1K 4BWJA 4CF9A 5AQHA 4O0IA 3D2FA 3NGYA 1ZC6A 5AQJA 4AYBL 2IIRA 3PY8A 1ZBIA 5FPDA 5GIPA 3RR8A 4Z4HA 2JA7C
chains in the Genus database with same CATH topology
1K8KB 2IVNA 2QTDA 5AQYA 2KWAA 3L4QA 2HSTA 4EHUA 3O08A 1SAZA 5TKYA 5B8HA 4JKDA 4DDQA 4KMAA 3D2FB 3ZX0A 4JHDA 1Q7YO 2FF6A 2HF3A 3WUHA 1GLJO 1R59O 4FL9A 3W3DA 2FF3B 3Q3QA 3A5LC 1WOQA 4FWNA 3WXJA 4BRQA 3A5MC 4MDAA 1QQOA 5AQLA 1YI2N 1B4BA 1ZXOA 4MLEA 5BREA 5C0YA 1T44A 4GTCA 4KMHA 5M1FA 2H3GX 3DAWA 1IG8A 3E9PA 1QQNA 2YJFA 4FWLA 3TSUA 2YHYA 1GLEG 3TU5A 4BRCA 4MO4A 4LC9B 4BRHA 4KM9A 1BA0A 4YORA 2FSJA 3H3OB 2ZF5O 3FE1A 4IEIA 5FPEA 3T69A 4OPAA 2FLOA 2FSNA 1O29A 3VMFB 3HRGA 4NB4A 2NZTA 5EVZA 2Q0UA 1W2BM 2P9PA 1YIJN 3H1VX 3A5OC 3E1YA 3G4AA 5KQDA 5AFUH 4G0WA 1G99A 5CJ9A 5CHIA 1C0FA 1O2BA 1KXPA 2Q31A 4CZLA 1VQ7N 4A61A 3OHRA 4C3JC 3U9DA 3TSPA 3R1XA 3VF2A 4DCHA 4H5NA 3H1QA 3MX5A 3G4SN 4FWMA 2A3ZA 1BA1A 3WEEA 4CZMA 3CJ7A 2AP1A 2WC9A 3KWGA 2YX6A 1X3NA 3E9LA 4J8FA 2D0OA 2P9UA 1HX1A 1NWKA 2KKZA 3U8XA 2Y3PA 3LDNA 3Q7BA 1NLVA 4FOIA 1B4AA 5E26A 2R92A 4JKFA 2QM1A 4QS7A 4GTFA 2JA6A 1EO1A 2GWKA 1ZVUA 3FZFA 4JD2A 4BLBA 4PKHA 1ESVA 3VGLA 4BR9A 2P9UB 4PHTX 1VQ4N 1C0GA 2RE2A 1HUXA 2CGLA 3M1FA 4JK9A 4BRMA 4YOVA 4GTDA 2R93A 3SJHA 4BVOA 4BQLA 3G71N 1F9NA 3VF4A 5C12A 4GT9A 3SAHA 2HBLA 4Y0WA 3ZYYX 3KZBA 4FPBA 3FGUA 4ILHA 1K83A 3KK7A 2V7YA 4JK8A 3U9ZA 3VESA 1QZ6A 2WBNA 4GTBA 3H6EA 2VUMA 3P38A 3NMUA 4KDDA 5AQGA 2ZWHA 4BC4A 2YU9A 3VOVA 2P9PB 3VGMA 1GLAG 3BP8A 5IOTA 3LDOA 2ITMA 2D0PA 3CMAN 5CHPA 5HOOA 2VYPA 3UB5A 4WQ5C 3LAPA 1NGBA 5F2RA 1O24A 1JCEA 5AQMA 4UY8O 3RVCA 1RFQA 3A0IX 5CE3A 4J3NA 2QEXN 3H46O 4F9OA 3WQUA 3WXIA 4U7BA 2YCHA 4K43A 4FWOA 4B1YB 3AQOA 4JD2B 3CAGA 1U2VB 3MDQA 3VGKA 3OA9A 1P90A 4ILGB 4U67L 4GFQA 2A41A 4R79A 4CI6A 2ZGZA 1K73O 3FOFA 3WQTA 2ZJQL 1RDUA 1JCGA 4CZHA 2WUSA 2P9NB 3AGKA 3P31A 4L3QA 1YVNA 2BUPA 3PIPL 4M1XA 4CBUA 3NVMA 2F9WA 4JAXA 3VA7A 1NGAA 3TTFA 3CCVN 2CH6A 1HPMA 1MWKA 4A2BA 4I6MA 1ATRA 5DM6L 2ASPA 1SQKA 3SBTA 4YDUC 3C6HA 4LR2A 5EY4A 3N4QA 3CD6N 5DM7L 1LCUA 1XC3A 3DXMA 3A8YA 2CFAA 4CZIA 4BR5A 1AB4A 2PBDA 4BRPA 1ATSA 3CC2N 1I3QA 3EKSA 1K8AO 3QFUA 4WCEL 4KH5A 3LM2A 3CC7N 2P9IB 3F5TA 4K42A 3MMLB 2NRWA 4GV6A 2A40A 3O9QA 4WQ5A 5C2DA 2A42A 1HKCA 2HBMA 2DPNA 2HOEA 4O8KA 4RCHA 3VTIA 1JJ2M 1WUAA 3CCRN 1KQ4A 2NVYA 3JS6A 4A62A 4BC3A 2NVXA 2E2HA 5AQVA 4XH4A 4B1XB 3PIOL 2VCPA 3O6WA 3NUHA 4JN4A 3S0XA 4PL8A 4JHDB 5AQXA 4FWSA 1BG3A 2HMPA 5JFEA 1DKGD 1V4SA 4PKIA 5AZIA 3CCLN 3WXLA 3C6AA 4BR4A 1O2AA 2JA7A 1YXQA 5KPRA 4CD3A 4JKBA 1K8KA 1SS6A 5M1KA 1I50A 3KVGA 3BUZB 4KM8A 2Q0RA 3ZX2A 3FOEA 3F2KA 1YJNN 4NO7A 4MO5A 4BKWA 3FLCO 4A59A 2VGNA 4GY2B 1KD1O 5GINA 3I56N 4K25A 1XQSC 5TKWA 5BRDA 3QB0A 4RWTA 1GLBG 3N4PA 2E2NA 3MN5A 4KH6A 4CZGA 4KARA 5JLFA 2F7TA 4BC5A 2EWSA 1BU6O 2QWPA 3UKRB 4IFEA 1QQMA 3C7NB 3CCQN 4HWIA 5CR4A 4YOUA 2ASOA 2P9LA 3DLLL 2ZFZA 3GTMA 4H5RA 3SAGA 3FZLA 4H0TB 1VQPN 3MCPA 3AY9A 3ULEB 3GTOA 2W40A 4FOEA 4GV3A 4WQ4C 1Y64A 2NRHA 4WFBL 1GLLO 3ENHA 3MX2A 5AZJA 2OTLN 1EK8A 3GOIA 2YHXA 4JKCA 3O1WA 5KPZA 2PFUA 4PKGA 3AAPA 3CPWM 5BN8A 1VQ6N 5H1SQ 3MN6A 1TUYA 3PLAA 2E2QA 2QI2A 3VEVA 4CZEA 4BRGA 3EN9A 2P9KA 2E88A 5FPNA 3EE8A 3QMLA 1CZAN 4M7XA 3VPZA 5F0XA 2QA4N 3AH5A 1U6ZA 1YHQN 1S22A 5ADXH 3K9JA 1TYQA 2GSUA 3FHZA 1H1VA 5EGHA 3EZWA 5BN9A 5JVGL 3VF6A 1VQ5N 3QDKA 3ZEUA 3D7EO 1HLUA 3N3YA 4KMDA 2P9SA 1XUPO 2Q97A 4CBWA 1VQLN 5MLCQ 4IOAL 3UE5A 2WFBA 4QS9A 4BLAA 3SAFA 1YITN 3B8AX 5IOSA 3ERED 3H3NO 2ASMA 2QWLA 3O80A 1KQSM 3EKUA 3SBGA 4FZBA 4C3IC 4C3HC 3N0BA 1YF5L 1DEJA 4BRAA 5GAEP 3CHWA 5AFUA 3ID6A 4FVUA 2XCQA 1LOTB 4H03B 3OBWA 1QVGM 3AGRA 3N0CA 1YJ9N 1M90O 5M1PA 4WF9L 2CGKA 5AQWA 4GTEA 3BF1A 1XXBA 1D4XA 3VEZA 4KASA 2E1YA 2PHCB 1VQON 2J4RA 4P5AA 3FZMA 5AQOA 1W97L 3OBYA 3CXCM 3J7ZO 4RTFD 4CZJA 1YUWA 3QBWA 2QWQA 4FPAA 2HF4A 2Q36A 3FFKB 3CI5A 3L6QA 4HTLA 3ZX3A 4IZ9A 4IO9L 1BGWA 4C1NI 3M6GA 3R6MA 3OREA 1XXCA 4MDBA 2E2IA 3HI0A 3LM9A 3L0QA 3R3LA 2D1KA 1O13A 3CIPA 3FZHA 2GEMA 3M3ZA 3CCMN 2VGMA 1MA9B 2RH6A 4EFHA 1O27A 2XCOA 3HOSA 3H0GA 4EHTA 3GTPA 2PAVA 1M1KO 3JXUA 3ENOA 2NRXA 1EQYA 1Q86O 3GTKA 1P8ZA 4M7YA 3DXKA 3D2EB 2FXUA 3AARA 2OTJN 2P9KB 4PL7A 1WQFA 1KAXA 5AQRA 2GUPA 3CJ1A 3R8EA 3OPFA 2NRZA 4K41A 1NMDA 2ZJPL 1Q18A 4YOXA 5AQPA 4BG9A 4BC2A 1VQKN 1WCMA 1ILYA 2OANA 3QX3A 3V4GA 5ELZA 3UKUA 1DD5A 1J6ZA 5AZJB 3O1BA 3IMXA 4JKAA 3LDLA 4BRLA 1T6DA 1X3MA 2BH1A 1SFOA 3SMPA 4Z94A 4BREA 3GDQA 3ULEA 4FSVA 5GAGP 3G6EN 3NVKA 3BUEA 3RSEA 4IXCA 4GV9A 5JMVA 3HBTA 3L4IA 5HL7L 1KAYA 5AQFA 1BDGA 1V4TA 1VQ9N 2CGJA 4BRNA 3O9SA 4FM9A 1T6CA 3TSQA 3C7NA 3GTGA 4M63C 3ZETA 5AQUA 3UKRA 4KB2A 3S41A 4FWKA 4G0VA 4E1JA 4H0XB 3LDQA 3CQZA 2GSNA 1YAGA 3LDPA 5EGEA 4H0YB 5JICA 5JVHL 3QBXA 4ILDA 4KAWX 4A5BA 4JKGA 4BRFA 2Q1NA 2HBKA 4WYBA 4JNEA 2B63A 3O5BA 4LQYA 4CJ7A 4A57A 2VWBA 2QWOA 3L4KA 1KC8O 3DJCA 3IFRA 1BO5O 3OW2M 3VENA 3O9RA 5IORA 4H0OA 4AM7A 3CCUN 3ATUA 3L4JA 4FWRA 4BG8A 5C2FA 4KC6A 5AQQA 1VQMN 1E4FT 1Z05A 1WIHA 2QWRA 5AZIB 4O8UA 3UKUB 1RDWX 5AQKA 1RGIA 5AQSA 2E1ZA 1BUPA 3CF5L 3E66A 3T7ZA 2RGRA 1X9JA 2GX9A 3BF3A 2BTFA 2QXLA 3VETA 4BR2A 4B1WB 1TWGA 3BEXA 3GG4A 1NJIO 4WFNL 2A6AA 5M1QA 1BOTO 4FO0A 5EXWA 2YHWA 4WQ4A 4BRDA 4P5BA 1NGFA 3QFPA 5AQTA 3Q7CA 3FZKA 3QICA 5M1OA 4B9QA 1NGCA 2R7ZA 2CH5A 2P9LB 4BRKA 2QWNA 2YJEA 2NRVA 4IO8A 4BRIA 4NLCA 2D4WA 3KWIA 4H5WA 2E2PA 4JKGB 4BR7A 5F1XA 2P9IA 5KPTA 1Q82O 1NGIA 3CCSN 1QZ5A 2GWJA 4KBOA 1GLDG 4MLHA 1TWAA 1GLCG 1Y1VA 3K9KA 2E8AA 1Q81O 4DB3A 1EH1A 3HZ6A 4QS8A 1E4GT 3MWPA 5AQZA 3CJBA 1GLFO 5I9EB 3ZETB 3MWTA 3I33A 1XXAA 2F9TA 2Q2RA 3DXMB 4JKEA 2KLAA 4JK7A 2CFAB 3GL1A 5M1NA 2GTDA 3FKIA 1ZBSA 4IWVA 4GVEA 3M5RA 3RSEB 3VEXA 4G0UA 3SLCA 1NGEA 2YI1A 1NGHA 1OKJA 4JKHA 3HSCA 4OO1J 3CJ9A 3ID8A 4XH1A 1NGDA 3GE1A 4GNIA 4BR0A 3C0BA 4IEEA 2JA5A 5JLHA 1QVFM 1VQNN 3GTLA 3D6RA 4DKWA 1HJOA 3O8MA 2P9NA 3O9UA 1S72N 1NGGA 4G9ZA 4YOTA 4DHYA 4IDHA 4YOWA 1ATNA 2JWKA 2NNWA 3ATVA 3VEYA 4WFAL 5FPMA 3LPXA 3VTHA 1DGKN 1DT9A 3CC4N 3CCJN 1WQHA 3D2EA 3DXKB 3GTJA 1U2VA 4C2MC 2QW9A 4AM6A 3IKMA 5BPMA 1IJJA 4H0PA 4JEPA 5C10A 4IJAA 3CMEN 3IDHA 3TTCA 2FSKA 4BY9C 1IS1A 5BRHA 1NM1A 5IOQA 1Z6RA 3CETA 3KHYA 1TYQB 2V52B 4ISEA 2RHKA 3AQPA 5JVOA 3AAQA 4H5VA 1VQ8N 5AQNA 4DQ8A 3EE9A 4B1UB 3VEWA 3CJAA 5BPNA 2W41A 1MWMA 2V51B 3WXMB 3CERA 2QWMA 2JWLA 3DWLA 4BQZA 4GTLA 2ZJRL 1WQGA 5BR9A 1YJWN 3GTQA 4YOYA 4C23A 5E84A 2P5MA 3P4IA 4I6MB 1SZ2A 5AR0A 5BPLA 5KQ8A 3G25A 4IJNA 5AQIA 4EIAA 3F9MA 2I7PA 3WT0A 3MK6A 3P39A 4KATA 3A5NC 3MCAB 1KAZA 3SK3A 3H45C 3O9TA 4O5FA 5EOYA 3CCEN 5ADXA 3MMVA 4BVPA 3LL3A 3U4LA 3WXKA 5GADP 4XEIA 1O28A 4KB4A 1QHAA 2I7NA 1JCFA 2E2OA 3IUCA 4FWQA 4B1VA 4CZFA 3J8AA 2GSOA 4ISFA 2P9SB 3SMSA 2UYTA 3ZEUB 2E20A 4AF1A 3CQYA 1MDUB 1GE9A 3HM8A 3I55N 1OVYA 2NRRA 1HKBA 2V7ZA 3CQXA 4ISGA 3FR0A 1NGJA 5GAHP 1VAZA 1S3XA 4A2AA 1N8RO 4IOXA 5TJ3A 5BRFA 1NBWA 5LJWA 4H5TA 3LAJA 4A5AA 4EAHD 1O26A 4ILJA 4BGBA 3C65A 5LY3A 4BROA 5EX5A 2JH3A 4B1ZA 2NLXA 3MN7A 2ZGYA 3VERA 3E9OA 3I8BA 2A5XA 1TWCA 1ISEA 1Y1WA 4XH5A 3CPEA 1K9MO 3GBTA 3HOTA 2NRTA 2XCRB 3VEOA 1HKGA 4IOCL 4OPHA 3G4CA 2IVPA 3TPQA 2IVOA 1O25A 2KHOA 1TUUA 4C1NK 4CZKA 2GELA 4CD1A 3TTDA 3O4WA 5C15A 1TWFA 3EO3A 5GIOA 4FWPA 1BJTA 3W0LA 3MN9A 3OEPA 2HBJA 4YDUA 4KH4A 4H0VB 5AQHA 3CJCA 3D2FA 4BGAA 1ZC6A 5AQJA 2IIRA 5LJVA 3HTVA 1TWHA 1R9TA 3WEEB 4GTAA 1T3VA 2AA4A 4CBXA 5FPDA 3R9PA 5GIPA 3EL2A 3ENBA 1BWFO 4NLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8K B;  2IVN A;  5AQY A;  4EHU A;  3O08 A;  1SAZ A;  5TKY A;  5B8H A;  3D2F B;  3ZX0 A;  4JHD A;  2FF6 A;  2HF3 A;  3WUH A;  1GLJ O;  1R59 O;  4FL9 A;  3W3D A;  2FF3 B;  3A5L C;  1WOQ A;  4FWN A;  3WXJ A;  4BRQ A;  3A5M C;  1QQO A;  5AQL A;  1ZXO A;  4MLE A;  5BRE A;  1T44 A;  2H3G X;  3DAW A;  1IG8 A;  4FWL A;  1QQN A;  2YJF A;  2YHY A;  1GLE G;  3TU5 A;  4BRC A;  4MO4 A;  4LC9 B;  4BRH A;  1BA0 A;  2FSJ A;  3H3O B;  2ZF5 O;  3FE1 A;  5FPE A;  2FLO A;  2FSN A;  4NB4 A;  2NZT A;  5EVZ A;  2Q0U A;  2P9P A;  3H1V X;  3A5O C;  5KQD A;  5AFU H;  1G99 A;  1C0F A;  1KXP A;  2Q31 A;  4CZL A;  4A61 A;  3OHR A;  3U9D A;  3VF2 A;  4DCH A;  4H5N A;  3H1Q A;  4FWM A;  2A3Z A;  1BA1 A;  3WEE A;  4CZM A;  3CJ7 A;  2AP1 A;  1X3N A;  4J8F A;  2D0O A;  2P9U A;  1HX1 A;  1NWK A;  3U8X A;  3LDN A;  1NLV A;  4FOI A;  5E26 A;  2QM1 A;  4QS7 A;  2GWK A;  3FZF A;  4JD2 A;  4PKH A;  1ESV A;  3VGL A;  4BR9 A;  2P9U B;  1C0G A;  1HUX A;  2CGL A;  3M1F A;  4BRM A;  3SJH A;  4BVO A;  4BQL A;  3VF4 A;  4Y0W A;  3KZB A;  4FPB A;  3FGU A;  2V7Y A;  3U9Z A;  3VES A;  1QZ6 A;  3H6E A;  5AQG A;  2ZWH A;  4BC4 A;  3VOV A;  2P9P B;  3VGM A;  1GLA G;  3BP8 A;  3LDO A;  2ITM A;  2D0P A;  2VYP A;  3UB5 A;  4WQ5 C;  1NGB A;  5F2R A;  1JCE A;  5AQM A;  1RFQ A;  3A0I X;  5CE3 A;  3H46 O;  4F9O A;  3WQU A;  3WXI A;  2YCH A;  4K43 A;  4FWO A;  4B1Y B;  4JD2 B;  1U2V B;  3MDQ A;  3VGK A;  2A41 A;  4CI6 A;  2ZGZ A;  3WQT A;  1JCG A;  4CZH A;  2WUS A;  2P9N B;  4L3Q A;  1YVN A;  2BUP A;  4CBU A;  2F9W A;  4JAX A;  1NGA A;  2CH6 A;  1HPM A;  1MWK A;  4A2B A;  4I6M A;  1ATR A;  2ASP A;  1SQK A;  4YDU C;  5EY4 A;  1LCU A;  1XC3 A;  3DXM A;  3A8Y A;  4CZI A;  4BR5 A;  2PBD A;  4BRP A;  1ATS A;  3EKS A;  3QFU A;  3LM2 A;  2P9I B;  4K42 A;  2A40 A;  4WQ5 A;  2A42 A;  1HKC A;  2DPN A;  2HOE A;  4O8K A;  4RCH A;  1WUA A;  3JS6 A;  4A62 A;  4BC3 A;  5AQV A;  4XH4 A;  4B1X B;  2VCP A;  3O6W A;  4JN4 A;  4PL8 A;  4JHD B;  5AQX A;  4FWS A;  1BG3 A;  2HMP A;  1DKG D;  1V4S A;  4PKI A;  5AZI A;  3WXL A;  4BR4 A;  1YXQ A;  5KPR A;  4CD3 A;  1K8K A;  3KVG A;  3BUZ B;  2Q0R A;  3ZX2 A;  4NO7 A;  4MO5 A;  3FLC O;  4GY2 B;  4K25 A;  1XQS C;  5BRD A;  3QB0 A;  4RWT A;  1GLB G;  2E2N A;  3MN5 A;  4CZG A;  5JLF A;  4BC5 A;  2EWS A;  1BU6 O;  2QWP A;  3UKR B;  1QQM A;  3C7N B;  4HWI A;  2ASO A;  2P9L A;  4H5R A;  3FZL A;  4H0T B;  3MCP A;  3AY9 A;  3ULE B;  2W40 A;  4FOE A;  4WQ4 C;  1Y64 A;  2NRH A;  1GLL O;  3ENH A;  5AZJ A;  3GOI A;  2YHX A;  5KPZ A;  3O1W A;  4PKG A;  3AAP A;  5BN8 A;  3MN6 A;  1TUY A;  2E2Q A;  3VEV A;  4CZE A;  4BRG A;  3EN9 A;  2P9K A;  2E88 A;  5FPN A;  3QML A;  3VPZ A;  1CZA N;  4M7X A;  5F0X A;  1U6Z A;  1S22 A;  5ADX H;  1TYQ A;  1H1V A;  3EZW A;  5BN9 A;  3VF6 A;  3QDK A;  3ZEU A;  3D7E O;  1HLU A;  2P9S A;  1XUP O;  2Q97 A;  4CBW A;  3UE5 A;  4QS9 A;  3B8A X;  3H3N O;  2ASM A;  2QWL A;  3O80 A;  3EKU A;  1DEJ A;  4BRA A;  5AFU A;  3CHW A;  1LOT B;  4H03 B;  2CGK A;  5AQW A;  3BF1 A;  1D4X A;  3VEZ A;  2E1Y A;  2J4R A;  3FZM A;  5AQO A;  4RTF D;  4CZJ A;  1YUW A;  3QBW A;  2QWQ A;  4FPA A;  2HF4 A;  2Q36 A;  3FFK B;  3CI5 A;  3L6Q A;  4HTL A;  3ZX3 A;  4IZ9 A;  3M6G A;  3R6M A;  3HI0 A;  3LM9 A;  3L0Q A;  2D1K A;  3CIP A;  3FZH A;  2GEM A;  3M3Z A;  1MA9 B;  4EFH A;  4EHT A;  2PAV A;  3JXU A;  3ENO A;  1EQY A;  1P8Z A;  4M7Y A;  3DXK A;  3D2E B;  2FXU A;  3AAR A;  2P9K B;  4PL7 A;  1KAX A;  5AQR A;  2GUP A;  3CJ1 A;  3R8E A;  4K41 A;  1NMD A;  1Q18 A;  5AQP A;  4BG9 A;  4BC2 A;  2OAN A;  5ELZ A;  3UKU A;  1J6Z A;  5AZJ B;  3O1B A;  3IMX A;  3LDL A;  4BRL A;  1T6D A;  1X3M A;  3SMP A;  4Z94 A;  4BRE A;  3GDQ A;  3ULE A;  4FSV A;  3RSE A;  4IXC A;  5JMV A;  3HBT A;  3L4I A;  1KAY A;  5AQF A;  1BDG A;  1V4T A;  2CGJ A;  4BRN A;  1T6C A;  3C7N A;  4M63 C;  3ZET A;  5AQU A;  3UKR A;  3S41 A;  4FWK A;  4E1J A;  4H0X B;  3LDQ A;  1YAG A;  3LDP A;  4H0Y B;  5JIC A;  3QBX A;  4BRF A;  2Q1N A;  4WYB A;  4JNE A;  3O5B A;  4CJ7 A;  2VWB A;  2QWO A;  3DJC A;  3IFR A;  1BO5 O;  3VEN A;  4H0O A;  4AM7 A;  3ATU A;  4FWR A;  4BG8 A;  5AQQ A;  1E4F T;  1Z05 A;  2QWR A;  5AZI B;  3UKU B;  1RDW X;  5AQK A;  1RGI A;  5AQS A;  2E1Z A;  1BUP A;  1X9J A;  3BF3 A;  4BR2 A;  2BTF A;  2QXL A;  3VET A;  4B1W B;  3BEX A;  3GG4 A;  2A6A A;  4BRD A;  1BOT O;  4FO0 A;  5EXW A;  2YHW A;  4WQ4 A;  1NGF A;  3QFP A;  5AQT A;  3FZK A;  3QIC A;  4B9Q A;  1NGC A;  2CH5 A;  2P9L B;  4BRK A;  2QWN A;  2YJE A;  4IO8 A;  4BRI A;  2D4W A;  4H5W A;  2E2P A;  4BR7 A;  5F1X A;  5KPT A;  2P9I A;  1NGI A;  1QZ5 A;  2GWJ A;  4KBO A;  1GLD G;  4MLH A;  1GLC G;  2E8A A;  4DB3 A;  3HZ6 A;  4QS8 A;  1E4G T;  5AQZ A;  3CJB A;  1GLF O;  5I9E B;  3ZET B;  3I33 A;  2F9T A;  2Q2R A;  3DXM B;  3GL1 A;  2GTD A;  1ZBS A;  4IWV A;  3RSE B;  3VEX A;  3SLC A;  1NGE A;  2YI1 A;  1NGH A;  1OKJ A;  3HSC A;  3CJ9 A;  3ID8 A;  4XH1 A;  1NGD A;  3GE1 A;  4GNI A;  4BR0 A;  3C0B A;  5JLH A;  1HJO A;  3O8M A;  2P9N A;  1NGG A;  4DHY A;  1ATN A;  3ATV A;  3VEY A;  5FPM A;  1DGK N;  3D2E A;  3DXK B;  1U2V A;  2QW9 A;  4AM6 A;  5BPM A;  1IJJ A;  4H0P A;  4IJA A;  3IDH A;  2FSK A;  5BRH A;  1NM1 A;  1Z6R A;  3CET A;  3KHY A;  1TYQ B;  2V52 B;  4ISE A;  3AAQ A;  4H5V A;  5AQN A;  4DQ8 A;  4B1U B;  3VEW A;  3CJA A;  5BPN A;  2W41 A;  1MWM A;  2V51 B;  3CER A;  2QWM A;  3DWL A;  4BQZ A;  5BR9 A;  4C23 A;  5E84 A;  3P4I A;  4I6M B;  1SZ2 A;  5AR0 A;  5BPL A;  5KQ8 A;  3G25 A;  4IJN A;  5AQI A;  4EIA A;  3F9M A;  2I7P A;  3WT0 A;  3MK6 A;  3A5N C;  1KAZ A;  3SK3 A;  3H45 C;  4O5F A;  5EOY A;  5ADX A;  3MMV A;  4BVP A;  3LL3 A;  3U4L A;  3WXK A;  4XEI A;  1QHA A;  2I7N A;  1JCF A;  2E2O A;  3IUC A;  4FWQ A;  4B1V A;  4CZF A;  3J8A A;  4ISF A;  2P9S B;  3SMS A;  2UYT A;  3ZEU B;  2E20 A;  3CQY A;  1MDU B;  3HM8 A;  1HKB A;  2V7Z A;  3CQX A;  4ISG A;  3FR0 A;  1NGJ A;  1S3X A;  4A2A A;  5BRF A;  1NBW A;  5LJW A;  4H5T A;  4EAH D;  4BGB A;  5LY3 A;  4BRO A;  5EX5 A;  4B1Z A;  2NLX A;  3MN7 A;  2ZGY A;  3VER A;  3I8B A;  2A5X A;  4XH5 A;  3GBT A;  3VEO A;  1HKG A;  2IVP A;  3TPQ A;  2IVO A;  2KHO A;  1TUU A;  4CZK A;  2GEL A;  4CD1 A;  3O4W A;  3EO3 A;  4FWP A;  3W0L A;  3MN9 A;  4YDU A;  5AQH A;  4H0V B;  3CJC A;  3D2F A;  4BGA A;  1ZC6 A;  5AQJ A;  2IIR A;  5LJV A;  3HTV A;  3WEE B;  5FPD A;  2AA4 A;  4CBX A;  3R9P A;  3EL2 A;  1BWF O; 
#chains in the Genus database with same CATH topology
 4BDZ A;  4LF9 K;  2HST A;  3ZSV A;  1HNV A;  5B8H A;  2D5R A;  2WB1 L;  4KMA A;  1S1W A;  3WUH A;  4AHU A;  3OYM A;  2V6S A;  3Q3Q A;  5JS2 A;  4I2P A;  2V6T A;  1IBM K;  2H3G X;  3DAW A;  1IG8 A;  1QQN A;  1TGO A;  2YJF A;  1VSE A;  3QET A;  4BRH A;  4LC9 B;  4OVL A;  4KM9 A;  4YOR A;  4FLW A;  2ZF5 O;  3DXJ A;  1VGX A;  3HM9 A;  1JLA A;  4OPA A;  4NB4 A;  2P9P A;  1C6V A;  4ID1 A;  1V5V A;  3QER A;  3MXI A;  3GTL K;  2ZM6 K;  1O2B A;  4DFM A;  2Q31 A;  2NVX C;  2FBV A;  4OIN A;  4I2Q A;  2EX3 A;  3VF2 A;  3LAK A;  1TV6 A;  3MX5 A;  4A3M K;  4FWM A;  1BA1 A;  3WEE A;  2YX6 A;  3M3Y C;  5IP9 C;  4XCH A;  4LF5 K;  4E89 A;  2Y3P A;  3GTQ C;  3HOZ C;  1B4A A;  4MQ3 A;  4CJ5 A;  4DSE A;  2JA6 A;  4KTQ A;  3ZSX A;  4PKH A;  4FLU A;  1ESV A;  2XRI A;  2P9U B;  4RW9 A;  3OYN A;  1ASU A;  3S1R K;  4BRM A;  4BE0 A;  2PYJ A;  3SJH A;  2R93 K;  3VF4 A;  4GT9 A;  4Y0W A;  4Z4I A;  4M42 A;  2W6K A;  5FRN A;  2V7Y A;  4JK8 A;  3S16 C;  3U9Z A;  3THY B;  3VES A;  1QZ6 A;  5SWM A;  2BAN A;  1BCM A;  2YU9 A;  1S9E A;  3TR8 A;  3JST A;  2D0P A;  2GV9 A;  4Y7N C;  3UB5 A;  4WQ5 C;  1NGB A;  5KTQ A;  3RVC A;  1RFQ A;  2QEX N;  1IL2 A;  4F9O A;  4G7H A;  4U7B A;  1RT4 A;  4FM1 A;  2E2I K;  1XC9 A;  3MDQ A;  4OPJ A;  1UWB A;  4U67 L;  3FOF A;  4L8R B;  3TAR A;  1WOO A;  3WQT A;  5IP9 K;  1TAQ A;  3AVJ A;  3VQ8 A;  4CJE A;  1NKB A;  1NK7 A;  2ETJ A;  3AGK A;  4FJN A;  4AHV A;  2BUP A;  4Q4Z A;  3PX6 A;  3NE6 A;  2Y1J A;  4J2B A;  4Z0U A;  1NGA A;  3CCV N;  1HPM A;  3V9S A;  3C6T A;  4CIF A;  3VQ4 A;  5DM6 L;  4LF6 K;  3VQP A;  2ZE2 A;  1IE0 A;  3C6H A;  3N4Q A;  3LPT A;  2CFA A;  4A3C C;  4BR5 A;  4BRP A;  1I3Q A;  1YTA A;  3L2Q A;  1K8A O;  3QFU A;  1TWF K;  3CFP A;  2D6F C;  3CC7 N;  2P9I B;  1U04 A;  4K42 A;  1Y1V C;  1D9F A;  4XSX A;  2NRW A;  2NVQ C;  3O9Q A;  1BGX T;  4M3R A;  5IT9 O;  4M3Y A;  4DMN A;  4HHT A;  5CYM A;  2O8F A;  3THX A;  5AQV A;  2O8E A;  1BIZ A;  3HST B;  3O6W A;  4JN4 A;  4PL8 A;  4YNQ A;  4JHD B;  2KTQ A;  3HT3 A;  4FWS A;  3OYE A;  5JFE A;  1V4S A;  3CCL N;  1SL0 A;  3WXL A;  2YKN A;  4BR4 A;  4Z4C A;  1TK8 A;  1O2A A;  4GZY A;  5KPR A;  4A3D K;  2CW0 A;  1K8K A;  3T02 A;  3KVG A;  4KM8 A;  3ZX2 A;  4YFN A;  3F2K A;  1YJN N;  3M4O C;  4BKW A;  4GY2 B;  1VRT A;  3K7A K;  1I6H K;  1QQC A;  5BRD A;  1ASW A;  2UXB K;  1USM A;  4RWT A;  4CZG A;  1EET A;  1XHZ A;  4BC5 A;  2XY8 A;  2EWS A;  1BU6 O;  3TFH A;  2W6L A;  2ZFZ A;  2ASO A;  2YU9 K;  3FZL A;  1EP4 A;  3ALY A;  3SV4 A;  1WOP A;  3GTM K;  2W40 A;  3CQZ K;  4E3S A;  4GV3 A;  3RMB A;  4OX9 K;  2NRH A;  1GLL O;  3ENH A;  4FLY A;  3EEQ A;  3AO5 A;  4E7K A;  3GOI A;  4OJR A;  4JKC A;  2GUI A;  1RT7 A;  3AAP A;  1GOB A;  4C8M A;  2E2Q A;  4DS4 A;  3AVC A;  3TAP A;  1HNZ K;  3AH5 A;  3QML A;  5F0X A;  4B9T A;  5FRO A;  1UA1 A;  1U6Z A;  2JLE A;  1S22 A;  2GSU A;  3TAG A;  5EGH A;  3T3F A;  5JVG L;  3D7E O;  1BL3 A;  4LF4 K;  3A8K A;  4QS9 A;  1S5J A;  5IOS A;  5D3G A;  4LF8 K;  2Y0S D;  4FZB A;  1KRP A;  4BRA A;  5GAE P;  5AFU A;  4NXN K;  1LOT B;  1J53 A;  1XPP A;  4X6A C;  4CEZ A;  1QVG M;  1HRH A;  5M1P A;  4GTE A;  3VA3 A;  1YX2 A;  4KAS A;  2E1Y A;  3FKI C;  2X74 A;  5J2M A;  4JI0 K;  2JGU A;  4K0K K;  2PY5 A;  3PO3 C;  1OH6 A;  1O2F B;  3FFK B;  4IO9 L;  4IZ9 A;  4FLV A;  3M6G A;  1XXC A;  4QAG A;  2FQT A;  4JLH A;  2UXC K;  3CIP A;  1FW6 A;  4IG0 A;  4JS5 A;  1RT5 A;  4PAB A;  4ELU A;  2RH6 A;  1O27 A;  1IH7 A;  4FM0 A;  1YNN A;  1WSV A;  2PAV A;  3ENO A;  1NKC A;  1K6Y A;  2O8D A;  3GTK A;  3GTP A;  4PL7 A;  2HVI A;  3R8E A;  1TKZ A;  2NRZ A;  2I5J A;  1NMD A;  4OKE A;  2HNY A;  5C4X C;  3V4G A;  4AH9 A;  1WCM K;  3IMX A;  3OYJ A;  3LDL A;  4BRL A;  3RMC A;  3SMP A;  1TAU A;  3AVI A;  4JYA K;  4FSV A;  5GAG P;  3NVK A;  3LAL A;  1KFS A;  3HBT A;  2P5O A;  3S9H A;  4WIL A;  1HNX K;  1JLG A;  4BRN A;  1T6C A;  3GTM C;  3GTG A;  3UKR A;  2KZZ A;  4KB2 A;  2AJQ A;  1ZBL A;  3QIO A;  4NOI A;  4DFP A;  3LDQ A;  3CQZ A;  3QIP A;  5EGE A;  4KAW X;  4A5B A;  2Q1N A;  4WYB A;  2B63 A;  1BQN A;  3HPO A;  4A3E K;  4CJ7 A;  4OLB A;  2QWO A;  4BY1 K;  3OW2 M;  3QNO A;  3CCU N;  3ATU A;  3HOY K;  4FWR A;  4NCA A;  1JL2 A;  3A8I A;  4BG8 A;  4BY7 C;  3UKU B;  4FLZ A;  3AVK A;  2NVT C;  3I0S A;  3CF5 L;  4W5T A;  3KK3 A;  3BF3 A;  4ZHR A;  4MEY A;  4A3K C;  1NJI O;  2RKI A;  1VHX A;  3AA4 A;  4WFN L;  4FO0 A;  5EXW A;  1NGF A;  3AVL A;  5AQT A;  5M1O A;  2R7Z A;  1CXQ A;  2KZM A;  3SZZ A;  3AO2 A;  3GIR A;  3ISN C;  5CZ1 A;  2OPQ A;  4M3T A;  4BRI A;  2D4W A;  4H5W A;  4JKG B;  4LSL A;  1Q82 O;  3ZSW A;  2GWJ A;  4MLH A;  1G15 A;  1Q81 O;  2E8A A;  1TWC K;  3BZC A;  4E7I A;  2NVQ K;  5AQZ A;  3MWP A;  3CJB A;  3SYZ A;  4BBS C;  1XXA A;  3V1Q A;  2HHQ A;  4MEX A;  1NK9 A;  4CF0 A;  3RSE B;  3ZSZ A;  3S17 C;  4JKH A;  1LWC A;  4M3Z A;  4OO1 J;  4KRF A;  4F3O A;  4GNI A;  4Y1D A;  1IV0 A;  3U3Y A;  4W5N A;  4FJM A;  3GTL A;  1BDF A;  1J9A A;  3O9U A;  3IAY A;  4DHY A;  4DR2 K;  2JWK A;  3ATV A;  4N41 A;  3OS2 A;  4DQS A;  3AVG A;  3A2F A;  3VEY A;  1RT1 A;  2YNF A;  4WFA L;  3CC4 N;  3DXK B;  1VSL A;  1LWE A;  4H0P A;  4JEP A;  3VA0 A;  5LL6 Z;  3KD5 E;  1IS1 A;  2GBZ A;  1NM1 A;  3KHY A;  4FK2 A;  1TYQ B;  1RT2 A;  2RHK A;  3DRP A;  5DMR A;  3AQP A;  1TL1 A;  1NJX A;  1IKV A;  1VQ8 N;  4DV0 K;  1WSJ A;  3O3H A;  4CFD A;  2W41 A;  3KLG A;  4CEA A;  2BE5 A;  1L0W A;  3GTQ K;  3DWL A;  4BQZ A;  4GTL A;  5LMU K;  1WQG A;  1YJW N;  2VUM C;  4DTX A;  4A93 C;  5AR0 A;  1T7P A;  4A3F C;  1SUQ A;  1NMN A;  4DR7 K;  3WT0 A;  2P1J A;  3O3F A;  3MCA B;  3SK3 A;  2B63 K;  1TKD A;  4BVP A;  3WXK A;  3S1R C;  3D45 A;  2E2O A;  3IUC A;  4CZF A;  2GSO A;  2P9S B;  1DCH A;  3HOU C;  3BZK A;  1BQM A;  2VQE K;  5BR8 K;  3LP0 A;  4DV1 K;  1RBU A;  2Q3S A;  1QS4 A;  3UIQ A;  4AHR A;  2V7Z A;  2EHG A;  3SPY A;  3AD8 C;  2Z1G A;  3S1N K;  3M3Y K;  5BRF A;  4CHN A;  5C4J K;  4H5T A;  4BGB A;  1YTU A;  2JH3 A;  1C0A A;  4B1Z A;  4DSJ A;  2FQO A;  4JI4 K;  3M8S A;  3I8B A;  1HYV A;  1TWC A;  5FJ8 K;  2OPR A;  1K9M O;  1S1V A;  3GBT A;  5IYC K;  4DTO A;  5JS1 A;  4IOC L;  4DQQ A;  3G4C A;  4X66 K;  3PV8 A;  4LY7 A;  2GEL A;  5HRR A;  4E1M A;  4OIR A;  1TWF A;  3H3V L;  3PO3 K;  1CLQ A;  4AHS A;  4FWP A;  3W0L A;  1UOC A;  4CGJ A;  4YDU A;  4FLT A;  4KH4 A;  4H0V B;  4BGA A;  2OZS A;  4QJV B;  1R9T A;  3R9P A;  5C44 K;  4JNE A;  1BWF O;  4NLB A;  2Y1I A;  3L4Q A;  1SAZ A;  5KGW A;  2A6H A;  3ZX0 A;  1Q7Y O;  1J6X A;  4KI6 A;  1JLQ A;  1R59 O;  3W3D A;  1WOQ A;  4FWN A;  3CM5 A;  3I4M C;  3MEC A;  3A5M C;  4GMJ B;  3THX B;  1B4B A;  4KV8 A;  4MLE A;  5BRE A;  5C0Y A;  1T44 A;  4FJ8 A;  1IG9 A;  4KMH A;  4FWL A;  3E9P A;  1BCO A;  3KKR A;  4CGF A;  1GLE G;  4YG2 A;  4HVJ A;  1BA0 A;  3S3N A;  3VQ9 A;  2FSJ A;  3FE1 A;  1UV7 A;  4Z4E A;  4DQR A;  2FLO A;  3NGI A;  1O29 A;  5EVZ A;  2Q0U A;  3VQA A;  4M3U A;  4FJI A;  3G4A A;  5KQD A;  5AFU H;  4G0W A;  5CHI A;  1C0F A;  2A1R A;  5IYD K;  1KXP A;  4JI5 K;  3GEI A;  4AH6 A;  2IAJ A;  2JA5 C;  4KTZ A;  3TSP A;  4G1Q A;  4DCH A;  4LQY A;  5C44 C;  4CZM A;  3KK2 A;  2AP1 A;  4YY3 K;  3H08 A;  2W42 A;  3LDN A;  4A3G C;  4JI7 K;  3HO1 A;  3HOV C;  5E41 A;  4FOI A;  1IQ0 A;  4JKF A;  4FW2 A;  4QS7 A;  3V9W A;  3B6O A;  1LW0 A;  3V1O A;  4FJK A;  1ZVU A;  1YNJ A;  4JI3 K;  4FJ5 A;  2UUA K;  4PHT X;  4KO0 A;  1C0G A;  2RE2 A;  1F93 A;  1HUX A;  4YOV A;  4JK9 A;  4GTD A;  5IYC C;  3G71 N;  2KW4 A;  2OCE A;  1NOY A;  1KLN A;  3SAH A;  3ZYY X;  4FPB A;  2UXD K;  1LV5 A;  2YHB A;  1D5A A;  2WBN A;  2LSN A;  3SQ1 A;  4FW1 A;  4CEC A;  5AQG A;  2ZWH A;  3S1M C;  1NK0 A;  5IYB C;  3GSI A;  5IOT A;  3OTO K;  5CHP A;  5HOO A;  2VYP A;  4QOZ B;  1Z25 A;  4LH4 A;  5F2R A;  1O24 A;  4JRP A;  3OYD A;  2V6U A;  4DLE A;  3WXI A;  3F73 A;  4G7Z A;  4WE1 A;  2DFF A;  3KKS A;  1U2V B;  3OA9 A;  4ILG B;  4A3B C;  4GFQ A;  2A41 A;  4A3D C;  3ADA C;  2ZGZ A;  4QIW D;  1JCG A;  2G8F A;  3S15 K;  2P9N B;  4L3Q A;  3SV3 A;  4X62 K;  3GDZ A;  2F9W A;  1KTQ A;  4CES A;  3VA7 A;  4CJQ A;  2CH6 A;  4DSF A;  3DMJ A;  4A2B A;  3SQ2 A;  1IBA A;  3VQ7 A;  2IC3 A;  1SQK A;  3OYK A;  4IFV A;  4YDU C;  3NH0 A;  3CD6 N;  1LCU A;  1XC3 A;  3DXM A;  5J1E A;  4CZI A;  5FRM A;  2A69 A;  3DOK A;  1ATS A;  3CC2 N;  3EKS A;  4CJR A;  4KH5 A;  1I3Q K;  3EY1 A;  4XSZ A;  3LM2 A;  1BI4 B;  1C1A A;  1EXQ A;  3LWM A;  3PO5 A;  4Y7N K;  4DV2 K;  5C2D A;  1HKC A;  1XNR K;  2HOE A;  4O8K A;  1JJ2 M;  1WUA A;  1NJW A;  1DCO A;  1U49 A;  4BC3 A;  3HP9 A;  4XH4 A;  4CGG A;  4B1X B;  2OYQ A;  3S16 K;  4E7H A;  4HUF A;  3H0G K;  2PYL A;  3DYA A;  1BG3 A;  4F4K A;  5AZI A;  3C6A A;  1WBD A;  2JA7 A;  1L3V A;  4CD3 A;  4JKB A;  3SQ0 A;  2Q0R A;  1KLM A;  2O8C A;  1IBK K;  5FDL A;  1JLF A;  4A59 A;  5GIN A;  3I56 N;  2ZUF A;  5TKW A;  4DTM A;  1SL2 A;  3QEP A;  2E2N A;  3MN5 A;  1RBT A;  4CJ4 A;  1Y97 A;  2G8U A;  5JLF A;  1R0A A;  1NKE A;  4C3H K;  4IFE A;  5I42 A;  3C7N B;  3CCQ N;  4BDP A;  4DV6 K;  4KAZ A;  4H5R A;  3SAG A;  3PX0 A;  4M3X A;  1X1P A;  1REV A;  4DU1 A;  3GTO A;  5CY4 A;  1L3S A;  1Y64 A;  1EK8 A;  3QO9 A;  5AZJ A;  3LWL A;  5KPZ A;  3O1W A;  4B9L A;  4DTN A;  3CPW M;  4QCL A;  5H1S Q;  1U45 A;  3PLA A;  3K5L A;  4CZE A;  2R92 K;  4BRG A;  3EN9 A;  5FPN A;  3VPZ A;  4BBS K;  2QA4 N;  1CZA N;  4W5Q A;  1TYQ A;  3GTO C;  3ZT3 A;  5IYB K;  2P5G A;  5BN9 A;  3N3Y A;  2FBY A;  4NXM K;  1HLU A;  2P9S A;  5M5Y K;  3DRS A;  2Q97 A;  3TAN A;  1VQL N;  1VLO A;  4A3J K;  3HVT A;  3UE5 A;  2WFB A;  1EI6 A;  4BLA A;  4JI1 K;  3B8A X;  3T1H K;  2QWL A;  1WAF A;  2WAQ D;  5J2P A;  4C3I C;  3N0B A;  4C45 A;  1DEJ A;  4N5S A;  5DK5 A;  4A3B K;  2XY6 A;  1YJ9 N;  3TI0 A;  4PUO A;  3CM6 A;  1N32 K;  2J4R A;  2VG6 A;  3FZM A;  3QEI A;  3G10 A;  2G8K A;  4A3I K;  3QBW A;  2QWQ A;  4FPA A;  3I8D A;  2Q36 A;  4G0U A;  3CI5 A;  3HOV K;  1HYS A;  4CIE A;  1TKX A;  3R6M A;  4CFA A;  4HCC A;  1WSI A;  3HI0 A;  2KFN A;  2D1K A;  1YCL A;  2DFE A;  4H8K A;  3ZT4 A;  4C8N A;  5J2Q A;  3CCM N;  1Z26 A;  3JSM A;  4JRQ A;  1MA9 B;  3PO4 A;  2XCO A;  3AVA A;  4KHS A;  3L2R A;  4FM2 A;  4EHT A;  3H0G A;  1N33 K;  1M1K O;  3JXU A;  1OH5 A;  4HUE A;  1DTT A;  4RW7 A;  1P8Z A;  4M7Y A;  1IKW A;  3D2E B;  2FXU A;  3DXK A;  2OTJ N;  3GTK K;  5AQR A;  2GUP A;  3GTP K;  1PJ5 A;  4IDK A;  2ZJP L;  1Q18 A;  4B8C A;  5AQP A;  4BG9 A;  1IBL K;  3OYA A;  4B9V A;  1ILY A;  3J81 O;  2O8B B;  3UKU A;  1DD5 A;  3RRG A;  4B9M A;  3O1B A;  3LPU A;  4JKA A;  1BIS A;  3LDS A;  4A3G K;  3BP3 A;  4BRE A;  2DFH A;  3ULE A;  1S9G A;  3RSE A;  4IXC A;  3CG7 A;  4X6A K;  3T1A A;  3TAM A;  4ICL A;  3C7N A;  3O4Q A;  4DQI A;  3CQZ C;  1QSL A;  3PX4 A;  3OJU A;  4E1J A;  4KHY A;  2GSN A;  1Q9X A;  3V6D A;  1TWA K;  4H0Y B;  5JIC A;  4JKG A;  4BRF A;  4CVN E;  4OKK A;  2HBK A;  3HOX C;  3RRH A;  1SKR A;  4BWM A;  2VWB A;  3L4K A;  1KC8 O;  1U4B A;  1NNE A;  2O8C B;  4RW8 A;  1T03 A;  4PQU A;  5IOR A;  2ZQB A;  3QIN A;  1CZB A;  1VQM N;  1Z05 A;  4DWI A;  2OA8 A;  2QWR A;  5AQS A;  2E1Z A;  5I3U A;  2RGR A;  3T7Z A;  3OYL A;  4PWD A;  1HMV A;  1R9T K;  2QXL A;  4K8Z A;  3BEX A;  3GG4 A;  4BRD A;  2YHW A;  4CF2 A;  3Q7C A;  3OYG A;  4B9Q A;  3SUQ A;  1NGC A;  1TK0 A;  2CH5 A;  3BDP A;  4CEQ A;  2O8D B;  4CER A;  2NRV A;  1VSD A;  3KWI A;  4IFY A;  1NGI A;  3CCS N;  4KBO A;  5J2N A;  1GLC G;  5C24 A;  3RMD A;  1GOC A;  3ZET B;  3MWT A;  4HUG A;  1FXX A;  4O5B A;  2Q2R A;  3HXA A;  3DXM B;  4JK7 A;  2KLA A;  3RR7 A;  5M1N A;  3FKI A;  1VSJ A;  4RW6 A;  3SLC A;  2YI1 A;  4MFB A;  3E01 A;  4AHC A;  4CCH A;  1NGD A;  4DS5 A;  3C0B A;  4CHY A;  2JA5 A;  5JLH A;  1VQN N;  3AVM A;  3D6R A;  4NYN A;  4DKW A;  1NGG A;  4G9Z A;  4CF8 A;  4YOT A;  4YOW A;  4IDH A;  4DUY K;  1RDD A;  2NNW A;  4FVM A;  3OS1 A;  1D8Y A;  3LPX A;  3VTH A;  4F8R A;  1U2V A;  5HRS A;  4C2M C;  4AM6 A;  5C10 A;  3CME N;  2R7Z C;  3IDH A;  4EZ9 A;  1Z6R A;  2V52 B;  3M8R A;  3L2W A;  3NF9 A;  3K5O A;  4DTJ A;  3AAQ A;  4H5V A;  4XIU A;  2F8S A;  4DQ8 A;  3VEW A;  4K8X A;  5BPN A;  2ZUE A;  3KLH A;  3J7A P;  4E0D A;  3CER A;  2G8V A;  3GTQ A;  5T7B A;  3V9X A;  5E84 A;  2P5M A;  3P4I A;  5KQ8 A;  3K57 A;  3NGZ A;  4DG1 A;  3HYF A;  5AQI A;  3H0G C;  4C3J K;  2B63 C;  2I7P A;  4KAT A;  1Y1W K;  1PJ6 A;  1NK8 A;  4FYD A;  5A2Q O;  1L3U A;  3LL3 A;  4XEI A;  4JI8 K;  1QHA A;  2E2J C;  2WON A;  2R92 C;  4AF1 A;  1RTJ A;  4CGD A;  1OVY A;  4KN4 A;  3QEV A;  4LFB K;  4A3C K;  1VAZ A;  2Z1I A;  4E7L A;  1CXU A;  1NBW A;  1KVA A;  1TWC C;  4A5A A;  4ILJ A;  5LY3 A;  4BRO A;  1XI1 A;  5EX5 A;  4CFC A;  4KPY A;  4LFC K;  2ZGY A;  4JV5 K;  2O8E B;  5M5W K;  1KVC A;  1TL3 A;  3AVB A;  5HRO A;  3QNN A;  1WN7 A;  2A1S A;  3TWH A;  2NRT A;  3GEH A;  1FJG K;  1ASV A;  2IDO A;  3VEO A;  2BGG A;  4GKJ K;  3TTG A;  4A3K K;  2IVP A;  3TPQ A;  2G8W A;  5FLM K;  1O25 A;  2KHO A;  2RN2 A;  2NVT K;  1RT6 A;  3S1Q K;  3TTD A;  3O4W A;  5C15 A;  3VQC A;  1IKX A;  3MN9 A;  1E3M A;  5LJV A;  3HTV A;  3EYZ A;  3SUO A;  1I50 C;  1TWH A;  3WEE B;  5AQK A;  3EL2 A;  3ENB A;  3CFO A;  1NOZ A;  5IP7 C;  1K8K B;  2F96 A;  3LP3 A;  3AVN A;  3O4N A;  3V9Z A;  4EHU A;  5TKY A;  4QJV A;  4JKD A;  4DDQ A;  4OGC A;  4JHD A;  4CJ3 A;  2HF3 A;  4B3M K;  1GLJ O;  2JA7 K;  2E2H C;  3VQ5 A;  4YHH K;  1YI2 N;  1QQO A;  3T00 A;  3NHG A;  1F21 A;  3HP6 A;  1ZXO A;  4GTC A;  5M1F A;  3TSU A;  2YHY A;  1JOE A;  4BRC A;  4MO4 A;  4IEI A;  1EX4 A;  3T69 A;  4BY1 C;  3VMF B;  3HRG A;  1JLC A;  3V9U A;  3SZ2 A;  3MED A;  4B9N A;  4A3E C;  3H1V X;  3SJJ A;  3E1Y A;  4FJH A;  4DQP A;  1G99 A;  5CJ9 A;  3P1G A;  4B08 A;  4PAA A;  3GTL C;  4W5R A;  3U9D A;  3R1X A;  4H5N A;  3V81 A;  1RBR A;  2WC9 A;  3KWG A;  5KRT A;  3IRX A;  3L3U A;  5M5X K;  3E9L A;  4J8F A;  4OKJ A;  1R9T C;  3OYB A;  3U8X A;  3KIO A;  3Q7B A;  1X9M A;  1B92 A;  4IG3 A;  5E26 A;  2F4V K;  4OPK A;  5KRS A;  2R92 A;  4GTF A;  1EO1 A;  2GWK A;  4BLB A;  3VGL A;  1JLE A;  4BR9 A;  1NJZ A;  1VQ4 N;  4LSN A;  4M41 A;  1J5O A;  4FJ7 A;  1F7U A;  2R7Y A;  3HKZ D;  1J54 A;  2HBL A;  3KZB A;  3FGU A;  4ILH A;  3KK7 A;  1J6W A;  4GTB A;  3H6E A;  3P38 A;  1WNS A;  3L2U A;  3HOW C;  4E7J A;  1GLA G;  3BP8 A;  2ITM A;  3CMA N;  3VQQ A;  1WOR A;  1A5X A;  2ITG A;  5HL8 A;  4UY8 O;  1XMQ K;  3AO1 A;  1NK5 A;  1ZYQ A;  3WQU A;  2YCH A;  2HNZ A;  4CEO A;  2VG5 A;  3CAG A;  4X65 K;  3VGK A;  1P90 A;  2D0C A;  1TVR A;  3K5M A;  4R79 A;  2ZJQ L;  2YNH A;  2WUS A;  3NF8 A;  1JVI A;  3DLG A;  1TWA C;  3T1Y K;  4M1X A;  3AV9 A;  4CBU A;  2G8I A;  3NVM A;  2F8T A;  4CF1 A;  3K0S A;  1MWK A;  3U6F A;  4A3L K;  4CJK A;  3LP2 A;  3SBT A;  5C4J C;  5CYQ A;  4CW7 B;  3K59 A;  1USO A;  4OIP A;  4JK1 A;  4WCE L;  3AO4 A;  3TAF A;  1RTI A;  5D4D A;  3F5T A;  3MML B;  4WQ5 A;  2HBM A;  2DPN A;  3VTI A;  3SUP A;  4Q5S A;  1XWL A;  1KQ4 A;  1NK6 A;  3KTQ A;  4QIW L;  3JS6 A;  1WB9 A;  2YU9 C;  1UA0 A;  2O5J A;  1L3T A;  1T05 A;  3S0X A;  5AQX A;  4X64 K;  4KHN A;  2HMP A;  1DKG D;  4A3F K;  1X31 C;  4LK0 A;  1YXQ A;  3S1N C;  1VSF A;  5M1K A;  1SS6 A;  3P5J A;  4KMU A;  4V19 S;  1I6H C;  4NO7 A;  4MO5 A;  4KKO A;  2VGN A;  2DTU A;  3B6P A;  2BDP A;  3CFR A;  1KD1 O;  3T01 A;  3M4O K;  1LW2 A;  4K25 A;  4FK4 A;  4G7O A;  3QB0 A;  5FLM C;  4DV7 K;  3KLE A;  4BXX K;  2F7T A;  4IBN A;  1RT3 A;  1XNQ K;  3GEE A;  3K2P A;  1QQM A;  3VQB A;  4HWI A;  1RU0 A;  5CR4 A;  4YOU A;  3A8J A;  2P9L A;  4TSX A;  3T19 A;  1VQP N;  3MCP A;  3ULE B;  2YKM A;  3MXM A;  2GAH C;  3MXJ A;  2OTL N;  3MX2 A;  3SNN A;  3RZO K;  2YHX A;  2PFU A;  4PKG A;  1RDA A;  3M8Q A;  5BN8 A;  1VQ6 N;  4HTU A;  3MN6 A;  3QEW A;  4C8O A;  3TFI A;  3EE8 A;  4M7X A;  1VJE A;  1ZYR A;  1C0T A;  3K9J A;  5ADX H;  3FHZ A;  1H1V A;  1XMO K;  4E19 A;  4CHQ A;  1GOA A;  3EZW A;  3VF6 A;  3QDK A;  2O4G A;  4DV3 K;  4KMD A;  1VSM A;  4CBW A;  4IOA L;  3SAF A;  1KQS M;  3EKU A;  3ZSO A;  4C3H C;  1YF5 L;  4FVU A;  3CHW A;  4DR5 K;  3OBW A;  3OY9 A;  4DFJ A;  3AGR A;  2XY7 A;  1M90 O;  2PA8 D;  5AQW A;  1WSG A;  3HPG A;  4LLG A;  4KI4 A;  4P5A A;  3S17 K;  1PJ7 A;  3SPZ A;  3OBY A;  3CXC M;  3PUF A;  4CHZ A;  1DLO A;  4HTL A;  2HF4 A;  3L6Q A;  3F9K A;  3RMA A;  3ORE A;  1TKT A;  4MDB A;  3LM9 A;  1VSK A;  3R3L A;  2E5L K;  1FKP A;  1O13 A;  3FFI A;  3FZH A;  3M3Z A;  4KB1 A;  1W7A A;  2VGM A;  4EFH A;  2HHH K;  4BBR K;  3HOS A;  4RMF A;  3NH1 A;  1EQY A;  1WSR A;  3AA5 X;  3SQ4 A;  4OLA A;  1TWG C;  1A5W A;  2E6M A;  4CGI A;  3CQ8 A;  4BC2 A;  1VQK N;  1VH2 A;  3S3O A;  4M3W A;  2VWK A;  3MEG A;  4JI6 K;  2OAN A;  4BY7 K;  5AZJ B;  1SFO K;  5HLF A;  2UUB K;  4YFX A;  1T6D A;  1X3M A;  5TMF A;  3HOZ K;  4Z94 A;  4CEF A;  4OGE A;  2D0B A;  4CJS A;  2A6E A;  3G6E N;  1CZ9 A;  4FJJ A;  3AA3 A;  4AYB D;  5JMV A;  3L4I A;  1KAY A;  5AQF A;  5C42 A;  1C0M A;  4FM9 A;  4DU4 A;  4M63 C;  4BAC A;  5AQU A;  1N36 K;  4LH5 A;  2JA8 C;  1VK0 A;  2RPI A;  4FWK A;  4H4O A;  2NVX K;  4H0X B;  1YAG A;  3LDP A;  4Q5V A;  1LAW A;  5C3E K;  3QBX A;  3S2H C;  2HHV A;  3NBP A;  3DLK A;  5FLX O;  1Q9Y A;  1JXE A;  3TAB A;  3DJC A;  3VEN A;  3O9R A;  4J2E A;  1NK4 A;  2G8H A;  1QSS A;  2HHW A;  1BIU A;  3VQ6 A;  3L4J A;  5IWA K;  1HQE A;  5C2F A;  4KC6 A;  5AQQ A;  3ASM A;  5AZI B;  1WCM C;  1RGI A;  4KFB A;  1ZBH A;  1HQU A;  2E4L A;  4BR2 A;  2BTF A;  4UQG A;  1TWH K;  3S1M K;  2A6A A;  5M1Q A;  1BOT O;  4CK3 A;  1NG9 A;  4P5B A;  3QIC A;  4B3R K;  1WAJ A;  3GTG K;  3MEE A;  2QWN A;  1JL1 A;  1RBV A;  4Y52 K;  4NLC A;  4BR7 A;  5KPT A;  1BI4 A;  4CGH A;  4I9Q A;  1QZ5 A;  2HHS A;  1WSF A;  1LWF A;  3K9K A;  4O44 A;  4F2R A;  1EH1 A;  2P8T A;  3CYM A;  3ZT0 A;  1Q8I A;  4QS8 A;  3S14 K;  1E4G T;  1T8E A;  2JA6 C;  3I33 A;  2DY4 A;  4N76 A;  1RBS A;  2GTD A;  3M5R A;  2OPP A;  1NGE A;  3FKI K;  1OKJ A;  2Z1H A;  4RG8 A;  3PSI A;  3CJ9 A;  2IOC A;  3ID8 A;  4XH1 A;  3GE1 A;  1B9F A;  4BR0 A;  3AVH A;  3O8M A;  2P9N A;  2JA5 K;  3AD7 C;  1ATN A;  5FPM A;  3GTJ A;  1DT9 A;  1WSH A;  4IJA A;  2FSK A;  4BY9 C;  5BRH A;  2WAQ L;  1RDC A;  4Q0B A;  2HHT A;  4ISE A;  3L3V A;  3O3G A;  2XHB A;  4LK1 A;  4EP4 A;  4LF7 K;  1QE1 A;  1FK9 A;  2XY5 A;  3NFA A;  3EE9 A;  4B1U B;  3K7A C;  2O4I A;  1MWM A;  4KB0 A;  2QWM A;  3ZT2 A;  3I4M K;  3GTP C;  3ZLJ A;  4I6M B;  1SZ2 A;  4YFK A;  1FKO A;  3G25 A;  4IJN A;  1OH7 A;  2A68 A;  1HR0 K;  4C3I K;  3TAQ A;  3MK6 A;  3P39 A;  4H4M A;  3A5N C;  5LMN K;  4WJ4 A;  2VG7 A;  3O9T A;  4O5F A;  3CCE N;  3RTV A;  4A3J C;  2HB5 A;  3MMV A;  1O28 A;  4CHO A;  4FWQ A;  4FK0 A;  2KFZ A;  4ISF A;  4I9L A;  1S6Q A;  3ZEU B;  2E20 A;  1F7V A;  3CQY A;  1GE9 A;  3I55 N;  1HKB A;  1S1X A;  1RNH A;  4DSK A;  3DLB A;  3KD1 E;  4ISG A;  4DTR A;  1S3X A;  1NU0 A;  4A2A A;  1N8R O;  4IOX A;  5TJ3 A;  4FZY A;  5LJW A;  4J2A A;  3LAJ A;  1O26 A;  4Y1C A;  3QLH A;  3VER A;  3E9O A;  3P83 D;  1HI9 A;  4ELT A;  3HVR A;  4BBR C;  1ISE A;  2Z1J A;  3RZD K;  3CPE A;  4CJT A;  3HOT A;  1HKG A;  2VUM K;  1WOS A;  3K5N A;  4FXD A;  1QHT A;  4C1N K;  4CZK A;  2BE2 A;  4CD1 A;  1WSE A;  2VWJ A;  3EO3 A;  1BS2 A;  3DLE A;  4FCY A;  5GIO A;  3OEP A;  1JKH A;  2HBJ A;  3CJC A;  3DI6 A;  2VQF K;  3EQL A;  1TWG K;  3OJS A;  3QES A;  1T3V A;  2AA4 A;  4CBX A;  4GTA A;  3BGR A;  2W7V A;  2IVN A;  4FJG A;  3GTJ K;  2QTD A;  3ZSR A;  5AQY A;  4FJL A;  2KWA A;  4B3S K;  3O08 A;  1O1W A;  3D2F B;  1WBB A;  3DRR A;  2FF6 A;  4GVM A;  4FL9 A;  2FF3 B;  4O0J A;  3A5L C;  4DUZ K;  1KSP A;  1EWR A;  4B3O A;  4O55 A;  3WXJ A;  4BRQ A;  4MDA A;  5AQL A;  1Y1V K;  4DV4 K;  2PA8 L;  4KN7 A;  1TWF C;  3HPH A;  4ID5 A;  3TU5 A;  1KVB A;  3S1Q C;  2Y0S L;  3H3O B;  3QEX A;  2X6N A;  1B9D A;  5FPE A;  2FSN A;  4BE2 A;  3VQD A;  1W2B M;  2NZT A;  1YIJ N;  3A5O C;  1JXB A;  3KLI A;  3OVN A;  3PO2 K;  3RZD C;  3NAE A;  3THY A;  4CZL A;  1VQ7 N;  3TFJ A;  4KHQ A;  1SKS A;  2NVY K;  4KHW A;  4A61 A;  3OHR A;  4C3J C;  2R93 C;  3H1Q A;  3G4S N;  4DR4 K;  2A3Z A;  3CJ7 A;  1X3N A;  1A5V A;  4NCG A;  2D0O A;  2P9U A;  1HX1 A;  1NWK A;  2KKZ A;  5E68 A;  1MU2 A;  1NLV A;  1J5E K;  1I3Q C;  1XZP B;  3ULD A;  1ZBF A;  2QM1 A;  5KGX A;  3FZF A;  1XZP A;  4JD2 A;  2KQ2 A;  5SZT A;  2B4J A;  2CGL A;  2R93 A;  3M1F A;  3J7Y P;  4BVO A;  4BQL A;  5CZ2 A;  1F9N A;  3BP8 C;  5C12 A;  4C2M K;  3WNF A;  4LD0 A;  2FBX A;  1Y1W C;  1RTH A;  1K83 A;  3GTJ C;  1HNW K;  1DTQ A;  2WOM A;  1I39 A;  2VUM A;  3NMU A;  3S15 C;  4KDD A;  3BY5 A;  4BC4 A;  2E6L A;  3VOV A;  2P9P B;  3VGM A;  2WTU A;  3LDO A;  4EZ6 A;  4KHP K;  1I94 K;  3LAP A;  1U47 A;  2O5I A;  1JCE A;  3VQE A;  5AQM A;  1SL1 A;  2ATQ A;  3A0I X;  3ZT1 A;  5CE3 A;  4J3N A;  3H46 O;  2ZD1 A;  5EU7 A;  3OYI A;  4K43 A;  4FWO A;  4B1Y B;  3AQO A;  4JD2 B;  4R5P A;  1I3A A;  3HL8 A;  4MQ9 A;  2HVH A;  4LJZ A;  4LFA K;  1K73 O;  4CI6 A;  1RDU A;  3DM2 A;  4CZH A;  2PZS A;  4XLP A;  3P31 A;  1YVN A;  3PIP L;  2QKB A;  3V4I A;  1L5U A;  4JAX A;  2UUC K;  4KRE A;  2NUB A;  2XO7 A;  3TTF A;  3HJF A;  4I6M A;  1ATR A;  2ASP A;  1WLJ A;  4LR2 A;  5EY4 A;  1RTD A;  5DM7 L;  3A8Y A;  4KTW A;  1AB4 A;  2PBD A;  2X78 A;  3IG1 A;  3SUN A;  3S2D C;  5C4X K;  2P51 A;  1C1C A;  3IPJ A;  4GV6 A;  1IO2 A;  2A40 A;  2QKK A;  1QSY A;  3LP1 A;  4DV5 K;  3ZCM A;  2A42 A;  2YV0 X;  4RCH A;  1SMY A;  3CCR N;  2NVY A;  3JYT A;  4A62 A;  2UU9 K;  2HW3 A;  1XZQ A;  3I4N C;  5HBM A;  2E2H A;  2NVX A;  4LOW A;  3PIO L;  4DF4 A;  2VCP A;  4F2S A;  4Y52 C;  3NUH A;  4CIG A;  3VN5 A;  4IKF A;  4Z4G A;  4PKI A;  1JLB A;  3AA2 A;  1ITG A;  1TWH C;  1I50 A;  3BUZ B;  3FOE A;  3LAN A;  4PY5 A;  3FLC O;  3THW A;  3NF7 A;  1XQS C;  1GLB G;  2HMI A;  3N4P A;  3JAM O;  4Z4F A;  3S14 C;  1OH8 A;  4DR3 K;  4KH6 A;  4KAR A;  3HOX K;  3UKR B;  2QWP A;  4CK1 A;  1K83 K;  1SKW A;  5K14 A;  5C3E C;  3S2H K;  1HYZ A;  5HP1 A;  3DLL L;  4OIQ A;  3GTG C;  3GTM A;  4FJX A;  3I4N K;  4WJ3 M;  5C25 A;  4H0T B;  5HRN A;  3AY9 A;  1S1T A;  4FOE A;  4WQ4 C;  1JQW A;  2QXF A;  4WFB L;  2IS3 A;  4HCB A;  4A3I C;  4ZTJ A;  1X9W A;  4OIO A;  1TUY A;  2QI2 A;  3VEV A;  2P9K A;  2E88 A;  1YHQ N;  4CJP A;  4B9S A;  3AO3 A;  3DLR A;  1VQ5 N;  3GTK C;  1N6Q A;  3ZEU A;  5TMC A;  1XUP O;  1NJY A;  5MLC Q;  1IW7 A;  1YIT N;  1W9H A;  3ERE D;  3H3N O;  2ASM A;  3O80 A;  3SBG A;  2XCQ A;  4NCB A;  3ID6 A;  3IS9 A;  4DR6 K;  4CJL A;  4H03 B;  3GTO K;  3LZI A;  3N0C A;  4WF9 L;  2CGK A;  5L46 A;  3BF1 A;  1XXB A;  1D4X A;  3VEZ A;  3WOD A;  3HK2 A;  1VQO N;  3LAM A;  5AQO A;  1W97 L;  3J7Z O;  3NCI A;  4GKK K;  1SFO C;  4RTF D;  4CZJ A;  1YUW A;  3D0P A;  3ZX3 A;  3HOU K;  3S3M A;  1BGW A;  1RDB A;  4C1N I;  3THV A;  2E2I A;  3L0Q A;  3WNH A;  2E2H K;  4PA1 A;  3ZSY A;  2GEM A;  3OS0 A;  4AHT A;  3HXM A;  4KHU A;  2YNG A;  5M3M K;  2NVY C;  2JA8 K;  2NRX A;  1Q86 O;  4YFU A;  5IP7 K;  1YVU A;  4AIL C;  3AAR A;  2P9K B;  4B9U A;  1WQF A;  1KAX A;  3DOL A;  3KJV A;  1I50 K;  3CJ1 A;  4A93 K;  3OPF A;  4K41 A;  4YOX A;  3EZ5 A;  3KK1 A;  1WCM A;  2E2I C;  3QX3 A;  5ELZ A;  4DF8 A;  1J6Z A;  1XHX A;  1SFO A;  2BH1 A;  2IGI A;  3GDQ A;  3BUE A;  4ZH4 A;  3RZO C;  4GV9 A;  4B8A B;  3U3G A;  1S1U A;  5HL7 L;  1VQ9 N;  1BDG A;  1V4T A;  2CGJ A;  1DCP A;  3O9S A;  3TSQ A;  2EBB A;  3ZET A;  2B6A A;  4DFK A;  3L8B A;  1SV5 A;  3S41 A;  3OYH A;  4CE9 A;  4G0V A;  1IKY A;  4DTP A;  3PO2 C;  4FLX A;  5JVH L;  4ILD A;  2HND A;  3G0Z A;  3NF6 A;  1ZQ1 C;  4W5O A;  1N5Y A;  1ZBU A;  3O5B A;  4A57 A;  3PSF A;  1EWQ A;  4N47 A;  3IFR A;  4BXX C;  1BO5 O;  1EQR A;  4H0O A;  4AM7 A;  3TAE A;  2RF2 A;  1E4F T;  1WIH A;  3C6U A;  2B5J A;  4O8U A;  1RDW X;  4CJW A;  2PMZ D;  1BUP A;  3E66 A;  3V1R A;  2HHU A;  1X9J A;  1J98 A;  2GX9 A;  4BDY A;  1TWG A;  2PHC B;  3VET A;  2E2J K;  4B1W B;  1EFW A;  3SI6 A;  4FZX C;  5M3F K;  2O8F B;  1XZQ B;  4WQ4 A;  2R7Z K;  3I0R A;  3QFP A;  4GW6 A;  2QK9 A;  1G51 A;  4JI2 K;  3FZK A;  1J6V A;  2P9L B;  1HQM A;  4BRK A;  4IO8 A;  2YJE A;  2E2P A;  2YHA A;  5F1X A;  2P9I A;  4FZZ A;  1OVQ A;  1GLD G;  1TWA A;  1Y1V A;  4DB3 A;  4DSI A;  3HZ6 A;  1VSH A;  4CFB A;  4AQY K;  1GLF O;  2OPS A;  5I9E B;  2F9T A;  4JKE A;  2CFA B;  3GL1 A;  4DTU A;  4NYF A;  4CHP A;  1I6V A;  4O4G A;  1ZBS A;  4IWV A;  4GVE A;  4CEB A;  3THW B;  3MAQ A;  3VEX A;  4FJ9 A;  1C1B A;  4I7F A;  2OZM A;  2PPB A;  1C0U A;  3HOY C;  1NGH A;  3WNG A;  3SCX A;  4P9S A;  3HSC A;  1RCH A;  3OYC A;  4IEE A;  2O8B A;  4A3M C;  4A3L C;  1QVF M;  1KCF A;  1HJO A;  1S72 N;  4CED A;  1LAV A;  1EKE A;  5HRP A;  4XLN A;  3AVF A;  1DGK N;  4M45 A;  3CCJ N;  3D2E A;  1WQH A;  1HPZ A;  4N56 A;  3H3V D;  2QW9 A;  1UAX A;  3IKM A;  4CJV A;  1IJJ A;  5BPM A;  3KLF A;  4JS4 A;  3ITH A;  3TTC A;  1QTM A;  5IOQ A;  3CET A;  3OYF A;  2GAG C;  3DLH A;  4C8K A;  5JVO A;  1HJR A;  5AQN A;  3HKZ L;  4B3T K;  3CJA A;  3RWU A;  2V51 B;  3WXM B;  1TK5 A;  1RIL A;  2JWL A;  2YNI A;  3C94 A;  2ZJR L;  4ZTF A;  5BR9 A;  4DSL A;  4EP5 A;  4YOY A;  4C23 A;  1U48 A;  2PMZ L;  3ZSQ A;  4CEE A;  1BHL A;  5BPL A;  3L2V A;  3HOW K;  4CJF A;  2HHX A;  1VSI A;  4EIA A;  3F9M A;  1KAZ A;  4BE1 A;  3H45 C;  1KFD A;  3LZJ A;  5EOY A;  5IYD C;  4RW4 A;  3J80 O;  4DLG A;  5ADX A;  4KB4 A;  3U4L A;  5GAD P;  1X9S A;  2I7N A;  1JCF A;  3SZY A;  4B1V A;  3J8A A;  4CJU A;  4J2D A;  3SMS A;  2UYT A;  3M8P A;  1MDU B;  1YT3 A;  1D9D A;  3HM8 A;  2NRR A;  5AJ3 K;  3CQX A;  3C95 A;  2D0A A;  4CK2 A;  3FR0 A;  1NGJ A;  5GAH P;  2X6S A;  4DTS A;  1HNI A;  3AD9 C;  2JA6 K;  4F3T A;  2FBT A;  1VRU A;  4EAH D;  3NH2 A;  1N34 K;  3C65 A;  4C8L A;  2NLX A;  3MN7 A;  4DU3 A;  2A5X A;  1K83 C;  1Y1W A;  1INN A;  4XH5 A;  3WNE A;  4ELV A;  2XCR B;  1S6P A;  4OPH A;  2IVO A;  2WB1 D;  1TUU A;  1W0H A;  3S2D K;  1VRQ C;  4E1N A;  5KI6 A;  2FC0 A;  1BJT A;  3K58 A;  3NDK A;  4O2D A;  4DR1 K;  4BWJ A;  4CF9 A;  5AQH A;  4O0I A;  3D2F A;  3NGY A;  1ZC6 A;  5AQJ A;  4AYB L;  2IIR A;  3PY8 A;  1ZBI A;  5FPD A;  5GIP A;  3RR8 A;  4Z4H A;  2JA7 C; 
#chains in the Genus database with same CATH homology
 1K8K B;  2IVN A;  2QTD A;  5AQY A;  2KWA A;  3L4Q A;  2HST A;  4EHU A;  3O08 A;  1SAZ A;  5TKY A;  5B8H A;  4JKD A;  4DDQ A;  4KMA A;  3D2F B;  3ZX0 A;  4JHD A;  1Q7Y O;  2FF6 A;  2HF3 A;  3WUH A;  1GLJ O;  1R59 O;  4FL9 A;  3W3D A;  2FF3 B;  3Q3Q A;  3A5L C;  1WOQ A;  4FWN A;  3WXJ A;  4BRQ A;  3A5M C;  4MDA A;  1QQO A;  5AQL A;  1YI2 N;  1B4B A;  1ZXO A;  4MLE A;  5BRE A;  5C0Y A;  1T44 A;  4GTC A;  4KMH A;  5M1F A;  2H3G X;  3DAW A;  1IG8 A;  3E9P A;  1QQN A;  2YJF A;  4FWL A;  3TSU A;  2YHY A;  1GLE G;  3TU5 A;  4BRC A;  4MO4 A;  4LC9 B;  4BRH A;  4KM9 A;  1BA0 A;  4YOR A;  2FSJ A;  3H3O B;  2ZF5 O;  3FE1 A;  4IEI A;  5FPE A;  3T69 A;  4OPA A;  2FLO A;  2FSN A;  1O29 A;  3VMF B;  3HRG A;  4NB4 A;  2NZT A;  5EVZ A;  2Q0U A;  1W2B M;  2P9P A;  1YIJ N;  3H1V X;  3A5O C;  3E1Y A;  3G4A A;  5KQD A;  5AFU H;  4G0W A;  1G99 A;  5CJ9 A;  5CHI A;  1C0F A;  1O2B A;  1KXP A;  2Q31 A;  4CZL A;  1VQ7 N;  4A61 A;  3OHR A;  4C3J C;  3U9D A;  3TSP A;  3R1X A;  3VF2 A;  4DCH A;  4H5N A;  3H1Q A;  3MX5 A;  3G4S N;  4FWM A;  2A3Z A;  1BA1 A;  3WEE A;  4CZM A;  3CJ7 A;  2AP1 A;  2WC9 A;  3KWG A;  2YX6 A;  1X3N A;  3E9L A;  4J8F A;  2D0O A;  2P9U A;  1HX1 A;  1NWK A;  2KKZ A;  3U8X A;  2Y3P A;  3LDN A;  3Q7B A;  1NLV A;  4FOI A;  1B4A A;  5E26 A;  2R92 A;  4JKF A;  2QM1 A;  4QS7 A;  4GTF A;  2JA6 A;  1EO1 A;  2GWK A;  1ZVU A;  3FZF A;  4JD2 A;  4BLB A;  4PKH A;  1ESV A;  3VGL A;  4BR9 A;  2P9U B;  4PHT X;  1VQ4 N;  1C0G A;  2RE2 A;  1HUX A;  2CGL A;  3M1F A;  4JK9 A;  4BRM A;  4YOV A;  4GTD A;  2R93 A;  3SJH A;  4BVO A;  4BQL A;  3G71 N;  1F9N A;  3VF4 A;  5C12 A;  4GT9 A;  3SAH A;  2HBL A;  4Y0W A;  3ZYY X;  3KZB A;  4FPB A;  3FGU A;  4ILH A;  1K83 A;  3KK7 A;  2V7Y A;  4JK8 A;  3U9Z A;  3VES A;  1QZ6 A;  2WBN A;  4GTB A;  3H6E A;  2VUM A;  3P38 A;  3NMU A;  4KDD A;  5AQG A;  2ZWH A;  4BC4 A;  2YU9 A;  3VOV A;  2P9P B;  3VGM A;  1GLA G;  3BP8 A;  5IOT A;  3LDO A;  2ITM A;  2D0P A;  3CMA N;  5CHP A;  5HOO A;  2VYP A;  3UB5 A;  4WQ5 C;  3LAP A;  1NGB A;  5F2R A;  1O24 A;  1JCE A;  5AQM A;  4UY8 O;  3RVC A;  1RFQ A;  3A0I X;  5CE3 A;  4J3N A;  2QEX N;  3H46 O;  4F9O A;  3WQU A;  3WXI A;  4U7B A;  2YCH A;  4K43 A;  4FWO A;  4B1Y B;  3AQO A;  4JD2 B;  3CAG A;  1U2V B;  3MDQ A;  3VGK A;  3OA9 A;  1P90 A;  4ILG B;  4U67 L;  4GFQ A;  2A41 A;  4R79 A;  4CI6 A;  2ZGZ A;  1K73 O;  3FOF A;  3WQT A;  2ZJQ L;  1RDU A;  1JCG A;  4CZH A;  2WUS A;  2P9N B;  3AGK A;  3P31 A;  4L3Q A;  1YVN A;  2BUP A;  3PIP L;  4M1X A;  4CBU A;  3NVM A;  2F9W A;  4JAX A;  3VA7 A;  1NGA A;  3TTF A;  3CCV N;  2CH6 A;  1HPM A;  1MWK A;  4A2B A;  4I6M A;  1ATR A;  5DM6 L;  2ASP A;  1SQK A;  3SBT A;  4YDU C;  3C6H A;  4LR2 A;  5EY4 A;  3N4Q A;  3CD6 N;  5DM7 L;  1LCU A;  1XC3 A;  3DXM A;  3A8Y A;  2CFA A;  4CZI A;  4BR5 A;  1AB4 A;  2PBD A;  4BRP A;  1ATS A;  3CC2 N;  1I3Q A;  3EKS A;  1K8A O;  3QFU A;  4WCE L;  4KH5 A;  3LM2 A;  3CC7 N;  2P9I B;  3F5T A;  4K42 A;  3MML B;  2NRW A;  4GV6 A;  2A40 A;  3O9Q A;  4WQ5 A;  5C2D A;  2A42 A;  1HKC A;  2HBM A;  2DPN A;  2HOE A;  4O8K A;  4RCH A;  3VTI A;  1JJ2 M;  1WUA A;  3CCR N;  1KQ4 A;  2NVY A;  3JS6 A;  4A62 A;  4BC3 A;  2NVX A;  2E2H A;  5AQV A;  4XH4 A;  4B1X B;  3PIO L;  2VCP A;  3O6W A;  3NUH A;  4JN4 A;  3S0X A;  4PL8 A;  4JHD B;  5AQX A;  4FWS A;  1BG3 A;  2HMP A;  5JFE A;  1DKG D;  1V4S A;  4PKI A;  5AZI A;  3CCL N;  3WXL A;  3C6A A;  4BR4 A;  1O2A A;  2JA7 A;  1YXQ A;  5KPR A;  4CD3 A;  4JKB A;  1K8K A;  1SS6 A;  5M1K A;  1I50 A;  3KVG A;  3BUZ B;  4KM8 A;  2Q0R A;  3ZX2 A;  3FOE A;  3F2K A;  1YJN N;  4NO7 A;  4MO5 A;  4BKW A;  3FLC O;  4A59 A;  2VGN A;  4GY2 B;  1KD1 O;  5GIN A;  3I56 N;  4K25 A;  1XQS C;  5TKW A;  5BRD A;  3QB0 A;  4RWT A;  1GLB G;  3N4P A;  2E2N A;  3MN5 A;  4KH6 A;  4CZG A;  4KAR A;  5JLF A;  2F7T A;  4BC5 A;  2EWS A;  1BU6 O;  2QWP A;  3UKR B;  4IFE A;  1QQM A;  3C7N B;  3CCQ N;  4HWI A;  5CR4 A;  4YOU A;  2ASO A;  2P9L A;  3DLL L;  2ZFZ A;  3GTM A;  4H5R A;  3SAG A;  3FZL A;  4H0T B;  1VQP N;  3MCP A;  3AY9 A;  3ULE B;  3GTO A;  2W40 A;  4FOE A;  4GV3 A;  4WQ4 C;  1Y64 A;  2NRH A;  4WFB L;  1GLL O;  3ENH A;  3MX2 A;  5AZJ A;  2OTL N;  1EK8 A;  3GOI A;  2YHX A;  4JKC A;  3O1W A;  5KPZ A;  2PFU A;  4PKG A;  3AAP A;  3CPW M;  5BN8 A;  1VQ6 N;  5H1S Q;  3MN6 A;  1TUY A;  3PLA A;  2E2Q A;  2QI2 A;  3VEV A;  4CZE A;  4BRG A;  3EN9 A;  2P9K A;  2E88 A;  5FPN A;  3EE8 A;  3QML A;  1CZA N;  4M7X A;  3VPZ A;  5F0X A;  2QA4 N;  3AH5 A;  1U6Z A;  1YHQ N;  1S22 A;  5ADX H;  3K9J A;  1TYQ A;  2GSU A;  3FHZ A;  1H1V A;  5EGH A;  3EZW A;  5BN9 A;  5JVG L;  3VF6 A;  1VQ5 N;  3QDK A;  3ZEU A;  3D7E O;  1HLU A;  3N3Y A;  4KMD A;  2P9S A;  1XUP O;  2Q97 A;  4CBW A;  1VQL N;  5MLC Q;  4IOA L;  3UE5 A;  2WFB A;  4QS9 A;  4BLA A;  3SAF A;  1YIT N;  3B8A X;  5IOS A;  3ERE D;  3H3N O;  2ASM A;  2QWL A;  3O80 A;  1KQS M;  3EKU A;  3SBG A;  4FZB A;  4C3I C;  4C3H C;  3N0B A;  1YF5 L;  1DEJ A;  4BRA A;  5GAE P;  3CHW A;  5AFU A;  3ID6 A;  4FVU A;  2XCQ A;  1LOT B;  4H03 B;  3OBW A;  1QVG M;  3AGR A;  3N0C A;  1YJ9 N;  1M90 O;  5M1P A;  4WF9 L;  2CGK A;  5AQW A;  4GTE A;  3BF1 A;  1XXB A;  1D4X A;  3VEZ A;  4KAS A;  2E1Y A;  2PHC B;  1VQO N;  2J4R A;  4P5A A;  3FZM A;  5AQO A;  1W97 L;  3OBY A;  3CXC M;  3J7Z O;  4RTF D;  4CZJ A;  1YUW A;  3QBW A;  2QWQ A;  4FPA A;  2HF4 A;  2Q36 A;  3FFK B;  3CI5 A;  3L6Q A;  4HTL A;  3ZX3 A;  4IZ9 A;  4IO9 L;  1BGW A;  4C1N I;  3M6G A;  3R6M A;  3ORE A;  1XXC A;  4MDB A;  2E2I A;  3HI0 A;  3LM9 A;  3L0Q A;  3R3L A;  2D1K A;  1O13 A;  3CIP A;  3FZH A;  2GEM A;  3M3Z A;  3CCM N;  2VGM A;  1MA9 B;  2RH6 A;  4EFH A;  1O27 A;  2XCO A;  3HOS A;  3H0G A;  4EHT A;  3GTP A;  2PAV A;  1M1K O;  3JXU A;  3ENO A;  2NRX A;  1EQY A;  1Q86 O;  3GTK A;  1P8Z A;  4M7Y A;  3DXK A;  3D2E B;  2FXU A;  3AAR A;  2OTJ N;  2P9K B;  4PL7 A;  1WQF A;  1KAX A;  5AQR A;  2GUP A;  3CJ1 A;  3R8E A;  3OPF A;  2NRZ A;  4K41 A;  1NMD A;  2ZJP L;  1Q18 A;  4YOX A;  5AQP A;  4BG9 A;  4BC2 A;  1VQK N;  1WCM A;  1ILY A;  2OAN A;  3QX3 A;  3V4G A;  5ELZ A;  3UKU A;  1DD5 A;  1J6Z A;  5AZJ B;  3O1B A;  3IMX A;  4JKA A;  3LDL A;  4BRL A;  1T6D A;  1X3M A;  2BH1 A;  1SFO A;  3SMP A;  4Z94 A;  4BRE A;  3GDQ A;  3ULE A;  4FSV A;  5GAG P;  3G6E N;  3NVK A;  3BUE A;  3RSE A;  4IXC A;  4GV9 A;  5JMV A;  3HBT A;  3L4I A;  5HL7 L;  1KAY A;  5AQF A;  1BDG A;  1V4T A;  1VQ9 N;  2CGJ A;  4BRN A;  3O9S A;  4FM9 A;  1T6C A;  3TSQ A;  3C7N A;  3GTG A;  4M63 C;  3ZET A;  5AQU A;  3UKR A;  4KB2 A;  3S41 A;  4FWK A;  4G0V A;  4E1J A;  4H0X B;  3LDQ A;  3CQZ A;  2GSN A;  1YAG A;  3LDP A;  5EGE A;  4H0Y B;  5JIC A;  5JVH L;  3QBX A;  4ILD A;  4KAW X;  4A5B A;  4JKG A;  4BRF A;  2Q1N A;  2HBK A;  4WYB A;  4JNE A;  2B63 A;  3O5B A;  4LQY A;  4CJ7 A;  4A57 A;  2VWB A;  2QWO A;  3L4K A;  1KC8 O;  3DJC A;  3IFR A;  1BO5 O;  3OW2 M;  3VEN A;  3O9R A;  5IOR A;  4H0O A;  4AM7 A;  3CCU N;  3ATU A;  3L4J A;  4FWR A;  4BG8 A;  5C2F A;  4KC6 A;  5AQQ A;  1VQM N;  1E4F T;  1Z05 A;  1WIH A;  2QWR A;  5AZI B;  4O8U A;  3UKU B;  1RDW X;  5AQK A;  1RGI A;  5AQS A;  2E1Z A;  1BUP A;  3CF5 L;  3E66 A;  3T7Z A;  2RGR A;  1X9J A;  2GX9 A;  3BF3 A;  2BTF A;  2QXL A;  3VET A;  4BR2 A;  4B1W B;  1TWG A;  3BEX A;  3GG4 A;  1NJI O;  4WFN L;  2A6A A;  5M1Q A;  1BOT O;  4FO0 A;  5EXW A;  2YHW A;  4WQ4 A;  4BRD A;  4P5B A;  1NGF A;  3QFP A;  5AQT A;  3Q7C A;  3FZK A;  3QIC A;  5M1O A;  4B9Q A;  1NGC A;  2R7Z A;  2CH5 A;  2P9L B;  4BRK A;  2QWN A;  2YJE A;  2NRV A;  4IO8 A;  4BRI A;  4NLC A;  2D4W A;  3KWI A;  4H5W A;  2E2P A;  4JKG B;  4BR7 A;  5F1X A;  2P9I A;  5KPT A;  1Q82 O;  1NGI A;  3CCS N;  1QZ5 A;  2GWJ A;  4KBO A;  1GLD G;  4MLH A;  1TWA A;  1GLC G;  1Y1V A;  3K9K A;  2E8A A;  1Q81 O;  4DB3 A;  1EH1 A;  3HZ6 A;  4QS8 A;  1E4G T;  3MWP A;  5AQZ A;  3CJB A;  1GLF O;  5I9E B;  3ZET B;  3MWT A;  3I33 A;  1XXA A;  2F9T A;  2Q2R A;  3DXM B;  4JKE A;  2KLA A;  4JK7 A;  2CFA B;  3GL1 A;  5M1N A;  2GTD A;  3FKI A;  1ZBS A;  4IWV A;  4GVE A;  3M5R A;  3RSE B;  3VEX A;  4G0U A;  3SLC A;  1NGE A;  2YI1 A;  1NGH A;  1OKJ A;  4JKH A;  3HSC A;  4OO1 J;  3CJ9 A;  3ID8 A;  4XH1 A;  1NGD A;  3GE1 A;  4GNI A;  4BR0 A;  3C0B A;  4IEE A;  2JA5 A;  5JLH A;  1QVF M;  1VQN N;  3GTL A;  3D6R A;  4DKW A;  1HJO A;  3O8M A;  2P9N A;  3O9U A;  1S72 N;  1NGG A;  4G9Z A;  4YOT A;  4DHY A;  4IDH A;  4YOW A;  1ATN A;  2JWK A;  2NNW A;  3ATV A;  3VEY A;  4WFA L;  5FPM A;  3LPX A;  3VTH A;  1DGK N;  1DT9 A;  3CC4 N;  3CCJ N;  1WQH A;  3D2E A;  3DXK B;  3GTJ A;  1U2V A;  4C2M C;  2QW9 A;  4AM6 A;  3IKM A;  5BPM A;  1IJJ A;  4H0P A;  4JEP A;  5C10 A;  4IJA A;  3CME N;  3IDH A;  3TTC A;  2FSK A;  4BY9 C;  1IS1 A;  5BRH A;  1NM1 A;  5IOQ A;  1Z6R A;  3CET A;  3KHY A;  1TYQ B;  2V52 B;  4ISE A;  2RHK A;  3AQP A;  5JVO A;  3AAQ A;  4H5V A;  1VQ8 N;  5AQN A;  4DQ8 A;  3EE9 A;  4B1U B;  3VEW A;  3CJA A;  5BPN A;  2W41 A;  1MWM A;  2V51 B;  3WXM B;  3CER A;  2QWM A;  2JWL A;  3DWL A;  4BQZ A;  4GTL A;  2ZJR L;  1WQG A;  5BR9 A;  1YJW N;  3GTQ A;  4YOY A;  4C23 A;  5E84 A;  2P5M A;  3P4I A;  4I6M B;  1SZ2 A;  5AR0 A;  5BPL A;  5KQ8 A;  3G25 A;  4IJN A;  5AQI A;  4EIA A;  3F9M A;  2I7P A;  3WT0 A;  3MK6 A;  3P39 A;  4KAT A;  3A5N C;  3MCA B;  1KAZ A;  3SK3 A;  3H45 C;  3O9T A;  4O5F A;  5EOY A;  3CCE N;  5ADX A;  3MMV A;  4BVP A;  3LL3 A;  3U4L A;  3WXK A;  5GAD P;  4XEI A;  1O28 A;  4KB4 A;  1QHA A;  2I7N A;  1JCF A;  2E2O A;  3IUC A;  4FWQ A;  4B1V A;  4CZF A;  3J8A A;  2GSO A;  4ISF A;  2P9S B;  3SMS A;  2UYT A;  3ZEU B;  2E20 A;  4AF1 A;  3CQY A;  1MDU B;  1GE9 A;  3HM8 A;  3I55 N;  1OVY A;  2NRR A;  1HKB A;  2V7Z A;  3CQX A;  4ISG A;  3FR0 A;  1NGJ A;  5GAH P;  1VAZ A;  1S3X A;  4A2A A;  1N8R O;  4IOX A;  5TJ3 A;  5BRF A;  1NBW A;  5LJW A;  4H5T A;  3LAJ A;  4A5A A;  4EAH D;  1O26 A;  4ILJ A;  4BGB A;  3C65 A;  5LY3 A;  4BRO A;  5EX5 A;  2JH3 A;  4B1Z A;  2NLX A;  3MN7 A;  2ZGY A;  3VER A;  3E9O A;  3I8B A;  2A5X A;  1TWC A;  1ISE A;  1Y1W A;  4XH5 A;  3CPE A;  1K9M O;  3GBT A;  3HOT A;  2NRT A;  2XCR B;  3VEO A;  1HKG A;  4IOC L;  4OPH A;  3G4C A;  2IVP A;  3TPQ A;  2IVO A;  1O25 A;  2KHO A;  1TUU A;  4C1N K;  4CZK A;  2GEL A;  4CD1 A;  3TTD A;  3O4W A;  5C15 A;  1TWF A;  3EO3 A;  5GIO A;  4FWP A;  1BJT A;  3W0L A;  3MN9 A;  3OEP A;  2HBJ A;  4YDU A;  4KH4 A;  4H0V B;  5AQH A;  3CJC A;  3D2F A;  4BGA A;  1ZC6 A;  5AQJ A;  2IIR A;  5LJV A;  3HTV A;  1TWH A;  1R9T A;  3WEE B;  4GTA A;  1T3V A;  2AA4 A;  4CBX A;  5FPD A;  3R9P A;  5GIP A;  3EL2 A;  3ENB A;  1BWF O;  4NLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...