2B63K

Complete rna polymerase ii-rna inhibitor complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2b63K00
4A3FK 1I3QC 5C3EK 1TWHK 5IYCC 4X6AC 4A3DC 2B63C 3CQZK 3EQLA 3HOYC 5IP9K 2A6EA 4A93C 4LK0A 4C3HK 2JA5K 2O5IA 3HOYK 1I3QK 2WAQL 1TWFC 5IYCK 2PMZL 5IYBC 4X6AK 5C4XK 4G7ZA 3S1QC 3HOXK 4XLNA 2NVYC 1WCMC 1I6HC 1TWGK 1Y1VC 4A3KC 2WB1D 2BE5A 4G7HA 1HQMA 4KN4A 3I4NC 1TWFK 5M5XK 3GTQC 5IYBK 2NVQC 5M3FK 4YFKA 5TMCA 1Y1WC 4ZH4A 2VUMC 1TWCC 2A68A 3S1QK 4BBRC 4A3GK 2NVXC 3RZOK 4BBSC 2NVYK 1WCMK 1Y1VK 5IYDK 4A3KK 4XSXA 3H0GC 2WAQD 2PMZD 2NVQK 1YNJA 3GTGC 5C4JK 4OIQA 4OIRA 3K7AC 1TWCK 4BBRK 2NVTC 4MEXA 4XLPA 4BBSK 4Q5SA 4QIWL 2E2JC 4LLGA 2JA8C 4C2MK 3PO2C 5TMFA 1K83C 2PPBA 5M5WK 3S2DK 2A69A 3H0GK 5M3MK 4A3DK 1TWAC 1BDFA 3GTGK 4A3LC 2B63K 1SFOC 4BY1C 3K7AK 2CW0A 2R7ZC 4YFXA 3HKZL 2NVTK 2E2JK 4A93K 5C44C 2E2IC 1ZYRA 3GTJC 3PO2K 3S2DC 1K83K 1R9TC 3PO3C 3S14C 3S2HC 3GTPC 4A3CC 1TWAK 5IP7C 4JK1A 3GTKC 1SFOK 3H3VL 3FKIC 2JA7C 2R7ZK 1I6HK 4BXXC 5FJ8K 4QIWD 3DXJA 4OINA 2E2IK 1I6VA 4Q4ZA 3GTJK 3HOZC 4A3EC 1R9TK 3I4NK 3HOWC 3GTQK 3S14K 3S2HK 4KN7A 3PO3K 2R93C 5IP7K 3RZDC 1Y1WK 2YU9C 2VUMK 3GTLC 3GTKK 2PA8L 4XSZA 2NVXK 3I4MC 3HKZD 4KMUA 3S15C 4A3BC 1I50C 3HOVC 1YNNA 3HOUC 3HOZK 4A3MC 4C3IK 4A3EK 2E2HC 2R92C 3HOWK 5C3EC 5M5YK 4G7OA 2YU9K 1XPPA 5D4DA 3M4OC 4MEYA 3H3VD 3I4MK 3M3YC 2A6HA 3CQZC 1IW7A 2JA8K 1I50K 4OIOA 3WODA 4AYBL 2O5JA 2Y0SL 3HOUK 3S17C 2E2HK 2R92K 4A3IC 3GTMC 4A3LK 4NOIA 4BY1K 3M4OK 5C4XC 3M3YK 2PA8D 3S1RC 4A3JC 3S16C 3HOXC 2JA6C 4LK1A 5C44K 4Y7NC 1TWGC 4C3JK 4YFNA 4BY7C 3S17K 4OIPA 3GTPK 5FLMC 4A3IK 3GTMK 4A3CK 4MQ9A 3FKIK 4LJZA 2JA7K 1SMYA 3GTOC 4GZYA 4Y52C 3S1RK 4A3JK 4BXXK 3S16K 2JA6K 4A3GC 3RZOC 4Y7NK 5IYDC 4AYBD 4BY7K 2Y0SD 4A3FC 3S1MC 5FLMK 3S1NC 1TWHC 2R93K 3RZDK 3GTLK 3S1NK 4QJVA 5C4JC 4QJVB 3GTOK 4Y52K 5IP9C 3S15K 4A3BK 4YG2A 3HOVK 2WB1L 4A3MK 2JA5C 3S1MK
chains in the Genus database with same CATH superfamily
1I3QC 4AH6A 5C3EK 1O29A 3T00A 1I50A 1TWAA 5IP9K 2FQTA 2A6EA 4LK0A 1JOEA 2JA5K 3HOYK 2PMZL 4X6AK 3S1QC 4XLNA 1WCMC 3QX3A 1I6HC 3FKIA 2BE5A 4G7HA 2JA6A 1TWFK 1WIHA 1PJ7A 5IYBK 5M3FK 1Y1WC 1F9NA 1ZBSA 2VUMC 2A68A 2NVXC 2V6UA 3ERED 4BBSC 4C2MC 4XSXA 1VLOA 4KMAA 2GSUA 3VA7A 1XZPB 2PMZD 1YCLA 5C4JK 3OREA 4OIQA 3K7AC 4KDDA 4KB2A 5IORA 4Q5SA 2ZUEA 1INNA 4ILDA 1K83C 5M5WK 3H0GK 2GAGC 4A3DK 1TWAC 3GTGK 3GTMA 2JA5A 5JFEA 1PJ5A 1IL2A 1EQRA 4A3CC 3FKIC 4BXXC 2CFAA 1HI9A 4OINA 1I6VA 5EGEA 4Q4ZA 3TFJA 1XZPA 1BGWA 3S14K 4FZBA 3A8JA 3GTKK 3I4MC 1DD5A 3AQPA 3S15C 3HOZK 5IOSA 2R92C 1DCPA 3HOWK 5C3EC 1WQHA 2YU9K 1O26A 3M3YC 1IQ0A 2A6HA 3H0GA 4KASA 1IW7A 1JVIA 2JA8K 3GTGA 4OIOA 2P5MA 2O5JA 3HOUK 3S17C 4A3IC 3GTMC 4BY1K 3M4OK 3IPJA 3S16C 1ZXOA 4C3JK 2PHCB 2Y3PA 3GTPK 3GEHA 1YX2A 5IOQA 1O24A 2JA7K 4LJZA 4KB4A 4A3JK 2ZUFA 4BY7K 4A3FC 1IBAA 4XCHA 2XCRB 2ZFZA 5C4JC 4QJVB 3V4GA 4Y52K 1WORA 5TJ3A 2YU9A 4GTEA 1EFWA 1TWHK 5IYCC 1J6XA 4A3DC 4BKWA 3CQZK 1F7UA 1X31C 2R7ZA 2RH6A 3N0CA 1V5VA 4G7ZA 3GTPA 3HOXK 4A3KC 2JA7A 1ZVUA 4BLAA 1KQ4A 3OPFA 4YFKA 1J98A 1TWCC 1ZQ1C 2NVYK 1Y1VK 2NVQK 1XXCA 4OIRA 4WJ4A 4BBRK 4XLPA 1O25A 3FOEA 2E2JC 4LLGA 1B4BA 2JA8C 3CQZA 3PO2C 2A69A 2B63K 4BY1C 2CW0A 2R7ZC 3HKZL 3A8KA 1WSRA 2NVTK 3G4AA 3GTJC 3LAPA 4C3JC 3PO3C 3GTPC 5IP7C 1SFOK 4KARA 2JA7C 3ADAC 1O28A 2CFAB 2E2IK 3S2DK 3I4NK 3T01A 1R9TK 3S2HK 3GTQK 1XXBA 3HKZD 1XZQA 4PAAA 1I50C 1YNNA 3NUHA 4C3IK 4A3EK 3TFHA 4RMFA 4G7OA 2P8TA 1O2FB 5D4DA 3CAGA 4G0VA 3CQZC 1DCHA 4GFQA 2B63A 2Y0SL 2E2HK 1WQFA 1TWFA 4BLBA 3S1RC 4P5BA 5L46A 3HOXC 3L4KA 2JA6C 4LK1A 1VRQC 3GIRA 1SFOA 1O2BA 5FLMC 4MQ9A 4LR2A 3FHZA 1SMYA 3AQOA 1R9TA 4GZYA 1J6WA 3GTQA 4Y7NK 3TTGA 2V6SA 2Y0SD 2R93K 3GTLK 3BUEA 4J3NA 2FQOA 3GTOK 1VGXA 5IP9C 2W7VA 2WB1L 5CHPA 2JA5C 3HOYC 3S1MK 2D6FC 3S1NK 3GEIA 4X6AC 2B63C 2E2HA 3EQLA 4GT9A 4C3HK 4KMDA 2O5IA 1I3QK 3AD9C 2WAQL 1TWFC 4GTFA 5IYBC 2EBBA 5C4XK 3LPXA 4G0WA 1F7VA 3GTKA 1TWGK 2WB1D 1HQMA 4KN4A 1ISEA 3I4NC 3GTQC 5TMCA 3Q3QA 4ZH4A 2R93A 3S1QK 5E68A 3RZOK 2GAHC 3GTLA 1EI6A 1WCMK 3FOFA 4O2DA 3H0GC 4C3IC 2WAQD 3OEPA 1O2AA 3GTGC 1WOSA 4BBSK 3AD8C 4C2MK 4WJ3M 1GE9A 3GEEA 1BDFA 3K7AK 4KM9A 3GDZA 4A93K 1K83K 3S14C 1EH1A 1TWAK 1TWGA 4KM8A 4GTLA 4JK1A 4WILA 3GTKC 3H3VL 5FJ8K 3HOZC 1DCOA 3HOWC 1USOA 2R93C 4KN7A 1EK8A 1WCMA 2YU9C 3GTLC 3BP8C 1TWHA 4FM9A 1XZQB 5EGHA 3HOUC 4P5AA 1AB4A 3LAJA 3BP3A 3M4OC 4MEYA 3HXAA 4C45A 3H3VD 3I4MK 3N3YA 5JVOA 4AYBL 1WOPA 3AH5A 2R92K 2RGRA 2GSNA 4A3LK 4NOIA 3MMLB 5C4XC 1K83A 3M3YK 4A3JC 1G51A 5C44K 1TWGC 4YFNA 4BY7C 3S17K 4OIPA 2NVYA 4A3IK 3GTMK 1Y1VA 4Y52C 1IE0A 3A8IA 3S16K 3RZOC 1IS1A 1RU0A 4KMHA 4AYBD 3L4JA 3TFIA 1TWHC 3RZDK 2KWAA 3S0XA 4A3BK 1C0AA 3HOVK 1VJEA 4A3MK 4KC6A 2GSOA 4A3FK 1WOOA 2JH3A 4KAWX 2R92A 5IOTA 3GSIA 4A93C 5IYCK 2E2IA 3AD7C 1WSVA 2NVYC 1BS2A 1Y1VC 3SZZA 5M5XK 4GTDA 2NVQC 3N0BA 4GTAA 4BBRC 4A3GK 1UV7A 5IYDK 4A3KK 3T02A 5HL8A 1YNJA 4M1XA 1PJ6A 2XCQA 1TWCK 2NVTC 4MEXA 4QIWL 4GTBA 5TMFA 2PPBA 4LOWA 5M3MK 1WQGA 4A3LC 1SFOC 4YFXA 2E2JK 1J6VA 5C44C 2E2IC 1ZYRA 3S2DC 3PO2K 3S2HC 1BJTA 1R9TC 5CJ9A 2R7ZK 1JQWA 1I6HK 1VH2A 1XXAA 3DXJA 4QIWD 4G0UA 3GTOA 3GTJK 2V6TA 4A3EC 3PO3K 5IP7K 3RZDC 3G4CA 1Y1WK 2VUMK 2PA8L 4XSZA 2NVXK 4P9SA 4KMUA 4A3BC 3HOVC 1TWCA 4A3MC 2E2HC 5M5YK 1XPPA 1I3QA 1I50K 3WODA 1F93A 4GTCA 2PA8D 1O27A 2XCOA 4Y7NC 4A3CK 4DDQA 1L0WA 3FKIK 3GTJA 3GTOC 3S1RK 4BXXK 4LQYA 4KATA 2JA6K 4A3GC 1Y1WA 2VUMA 1B4AA 5IYDC 2NVXA 3S1MC 4PABA 3S1NC 5FLMK 3SZYA 4QJVA 3S15K 4YG2A 4C3HC 3JSTA 1USMA
chains in the Genus database with same CATH topology
4A3FK 1I3QC 5C3EK 1TWHK 5IYCC 4X6AC 4A3DC 2B63C 3CQZK 3EQLA 3HOYC 5IP9K 2A6EA 4A93C 4LK0A 4C3HK 2JA5K 2O5IA 3HOYK 1I3QK 2WAQL 1TWFC 5IYCK 2PMZL 5IYBC 4X6AK 5C4XK 4G7ZA 3S1QC 3HOXK 4XLNA 2NVYC 1WCMC 1I6HC 1TWGK 1Y1VC 4A3KC 2WB1D 2BE5A 4G7HA 1HQMA 4KN4A 3I4NC 1TWFK 5M5XK 3GTQC 5IYBK 2NVQC 5M3FK 4YFKA 5TMCA 1Y1WC 4ZH4A 2VUMC 1TWCC 2A68A 3S1QK 4BBRC 4A3GK 2NVXC 3RZOK 4BBSC 2NVYK 1WCMK 1Y1VK 5IYDK 4A3KK 4XSXA 3H0GC 2WAQD 2PMZD 2NVQK 1YNJA 3GTGC 5C4JK 4OIQA 4OIRA 3K7AC 1TWCK 4BBRK 2NVTC 4MEXA 4XLPA 4BBSK 4Q5SA 4QIWL 2E2JC 4LLGA 2JA8C 4C2MK 3PO2C 5TMFA 1K83C 2PPBA 5M5WK 3S2DK 2A69A 3H0GK 5M3MK 4A3DK 1TWAC 1BDFA 3GTGK 4A3LC 2B63K 1SFOC 4BY1C 3K7AK 2CW0A 2R7ZC 4YFXA 3HKZL 2NVTK 2E2JK 4A93K 5C44C 2E2IC 1ZYRA 3GTJC 3PO2K 3S2DC 1K83K 1R9TC 3PO3C 3S14C 3S2HC 3GTPC 4A3CC 1TWAK 5IP7C 4JK1A 3GTKC 1SFOK 3H3VL 3FKIC 2JA7C 2R7ZK 1I6HK 4BXXC 5FJ8K 4QIWD 3DXJA 4OINA 2E2IK 1I6VA 4Q4ZA 3GTJK 3HOZC 4A3EC 1R9TK 3I4NK 3HOWC 3GTQK 3S14K 3S2HK 4KN7A 3PO3K 2R93C 5IP7K 3RZDC 1Y1WK 2YU9C 2VUMK 3GTLC 3GTKK 2PA8L 4XSZA 2NVXK 3I4MC 3HKZD 4KMUA 3S15C 4A3BC 1I50C 3HOVC 1YNNA 3HOUC 3HOZK 4A3MC 4C3IK 4A3EK 2E2HC 2R92C 3HOWK 5C3EC 5M5YK 4G7OA 2YU9K 1XPPA 5D4DA 3M4OC 4MEYA 3H3VD 3I4MK 3M3YC 2A6HA 3CQZC 1IW7A 2JA8K 1I50K 4OIOA 3WODA 4AYBL 2O5JA 2Y0SL 3HOUK 3S17C 2E2HK 2R92K 4A3IC 3GTMC 4A3LK 4NOIA 4BY1K 3M4OK 5C4XC 3M3YK 2PA8D 3S1RC 4A3JC 3S16C 3HOXC 2JA6C 4LK1A 5C44K 4Y7NC 1TWGC 4C3JK 4YFNA 4BY7C 3S17K 4OIPA 3GTPK 5FLMC 4A3IK 3GTMK 4A3CK 4MQ9A 3FKIK 4LJZA 2JA7K 1SMYA 3GTOC 4GZYA 4Y52C 3S1RK 4A3JK 4BXXK 3S16K 2JA6K 4A3GC 3RZOC 4Y7NK 5IYDC 4AYBD 4BY7K 2Y0SD 4A3FC 3S1MC 5FLMK 3S1NC 1TWHC 2R93K 3RZDK 3GTLK 3S1NK 4QJVA 5C4JC 4QJVB 3GTOK 4Y52K 5IP9C 3S15K 4A3BK 4YG2A 3HOVK 2WB1L 4A3MK 2JA5C 3S1MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F K;  1I3Q C;  5C3E K;  1TWH K;  5IYC C;  4X6A C;  4A3D C;  2B63 C;  3CQZ K;  3EQL A;  3HOY C;  5IP9 K;  2A6E A;  4A93 C;  4LK0 A;  4C3H K;  2JA5 K;  2O5I A;  3HOY K;  1I3Q K;  2WAQ L;  1TWF C;  5IYC K;  2PMZ L;  5IYB C;  4X6A K;  5C4X K;  4G7Z A;  3S1Q C;  3HOX K;  4XLN A;  2NVY C;  1WCM C;  1I6H C;  1TWG K;  1Y1V C;  4A3K C;  2WB1 D;  2BE5 A;  4G7H A;  1HQM A;  4KN4 A;  3I4N C;  1TWF K;  5M5X K;  3GTQ C;  5IYB K;  2NVQ C;  5M3F K;  4YFK A;  5TMC A;  1Y1W C;  4ZH4 A;  2VUM C;  1TWC C;  2A68 A;  3S1Q K;  4BBR C;  4A3G K;  2NVX C;  3RZO K;  4BBS C;  2NVY K;  1WCM K;  1Y1V K;  5IYD K;  4A3K K;  4XSX A;  3H0G C;  2WAQ D;  2PMZ D;  2NVQ K;  1YNJ A;  3GTG C;  5C4J K;  4OIQ A;  4OIR A;  3K7A C;  1TWC K;  4BBR K;  2NVT C;  4MEX A;  4XLP A;  4BBS K;  4Q5S A;  4QIW L;  2E2J C;  4LLG A;  2JA8 C;  4C2M K;  3PO2 C;  5TMF A;  1K83 C;  2PPB A;  5M5W K;  3S2D K;  2A69 A;  3H0G K;  5M3M K;  4A3D K;  1TWA C;  1BDF A;  3GTG K;  4A3L C;  2B63 K;  1SFO C;  4BY1 C;  3K7A K;  2CW0 A;  2R7Z C;  4YFX A;  3HKZ L;  2NVT K;  2E2J K;  4A93 K;  5C44 C;  2E2I C;  1ZYR A;  3GTJ C;  3PO2 K;  3S2D C;  1K83 K;  1R9T C;  3PO3 C;  3S14 C;  3S2H C;  3GTP C;  4A3C C;  1TWA K;  5IP7 C;  4JK1 A;  3GTK C;  1SFO K;  3H3V L;  3FKI C;  2JA7 C;  2R7Z K;  1I6H K;  4BXX C;  5FJ8 K;  4QIW D;  3DXJ A;  4OIN A;  2E2I K;  1I6V A;  4Q4Z A;  3GTJ K;  3HOZ C;  4A3E C;  1R9T K;  3I4N K;  3HOW C;  3GTQ K;  3S14 K;  3S2H K;  4KN7 A;  3PO3 K;  2R93 C;  5IP7 K;  3RZD C;  1Y1W K;  2YU9 C;  2VUM K;  3GTL C;  3GTK K;  2PA8 L;  4XSZ A;  2NVX K;  3I4M C;  3HKZ D;  4KMU A;  3S15 C;  4A3B C;  1I50 C;  3HOV C;  1YNN A;  3HOU C;  3HOZ K;  4A3M C;  4C3I K;  4A3E K;  2E2H C;  2R92 C;  3HOW K;  5C3E C;  5M5Y K;  4G7O A;  2YU9 K;  1XPP A;  5D4D A;  3M4O C;  4MEY A;  3H3V D;  3I4M K;  3M3Y C;  2A6H A;  3CQZ C;  1IW7 A;  2JA8 K;  1I50 K;  4OIO A;  3WOD A;  4AYB L;  2O5J A;  2Y0S L;  3HOU K;  3S17 C;  2E2H K;  2R92 K;  4A3I C;  3GTM C;  4A3L K;  4NOI A;  4BY1 K;  3M4O K;  5C4X C;  3M3Y K;  2PA8 D;  3S1R C;  4A3J C;  3S16 C;  3HOX C;  2JA6 C;  4LK1 A;  5C44 K;  4Y7N C;  1TWG C;  4C3J K;  4YFN A;  4BY7 C;  3S17 K;  4OIP A;  3GTP K;  5FLM C;  4A3I K;  3GTM K;  4A3C K;  4MQ9 A;  3FKI K;  4LJZ A;  2JA7 K;  1SMY A;  3GTO C;  4GZY A;  4Y52 C;  3S1R K;  4A3J K;  4BXX K;  3S16 K;  2JA6 K;  4A3G C;  3RZO C;  4Y7N K;  5IYD C;  4AYB D;  4BY7 K;  2Y0S D;  4A3F C;  3S1M C;  5FLM K;  3S1N C;  1TWH C;  2R93 K;  3RZD K;  3GTL K;  3S1N K;  4QJV A;  5C4J C;  4QJV B;  3GTO K;  4Y52 K;  5IP9 C;  3S15 K;  4A3B K;  4YG2 A;  3HOV K;  2WB1 L;  4A3M K;  2JA5 C;  3S1M K; 
#chains in the Genus database with same CATH topology
 1I3Q C;  4AH6 A;  5C3E K;  1O29 A;  3T00 A;  1I50 A;  1TWA A;  5IP9 K;  2FQT A;  2A6E A;  4LK0 A;  1JOE A;  2JA5 K;  3HOY K;  2PMZ L;  4X6A K;  3S1Q C;  4XLN A;  1WCM C;  3QX3 A;  1I6H C;  3FKI A;  2BE5 A;  4G7H A;  2JA6 A;  1TWF K;  1WIH A;  1PJ7 A;  5IYB K;  5M3F K;  1Y1W C;  1F9N A;  1ZBS A;  2VUM C;  2A68 A;  2NVX C;  2V6U A;  3ERE D;  4BBS C;  4C2M C;  4XSX A;  1VLO A;  4KMA A;  2GSU A;  3VA7 A;  1XZP B;  2PMZ D;  1YCL A;  5C4J K;  3ORE A;  4OIQ A;  3K7A C;  4KDD A;  4KB2 A;  5IOR A;  4Q5S A;  2ZUE A;  1INN A;  4ILD A;  1K83 C;  5M5W K;  3H0G K;  2GAG C;  4A3D K;  1TWA C;  3GTG K;  3GTM A;  2JA5 A;  5JFE A;  1PJ5 A;  1IL2 A;  1EQR A;  4A3C C;  3FKI C;  4BXX C;  2CFA A;  1HI9 A;  4OIN A;  1I6V A;  5EGE A;  4Q4Z A;  3TFJ A;  1XZP A;  1BGW A;  3S14 K;  4FZB A;  3A8J A;  3GTK K;  3I4M C;  1DD5 A;  3AQP A;  3S15 C;  3HOZ K;  5IOS A;  2R92 C;  1DCP A;  3HOW K;  5C3E C;  1WQH A;  2YU9 K;  1O26 A;  3M3Y C;  1IQ0 A;  2A6H A;  3H0G A;  4KAS A;  1IW7 A;  1JVI A;  2JA8 K;  3GTG A;  4OIO A;  2P5M A;  2O5J A;  3HOU K;  3S17 C;  4A3I C;  3GTM C;  4BY1 K;  3M4O K;  3IPJ A;  3S16 C;  1ZXO A;  4C3J K;  2PHC B;  2Y3P A;  3GTP K;  3GEH A;  1YX2 A;  5IOQ A;  1O24 A;  2JA7 K;  4LJZ A;  4KB4 A;  4A3J K;  2ZUF A;  4BY7 K;  4A3F C;  1IBA A;  4XCH A;  2XCR B;  2ZFZ A;  5C4J C;  4QJV B;  3V4G A;  4Y52 K;  1WOR A;  5TJ3 A;  2YU9 A;  4GTE A;  1EFW A;  1TWH K;  5IYC C;  1J6X A;  4A3D C;  4BKW A;  3CQZ K;  1F7U A;  1X31 C;  2R7Z A;  2RH6 A;  3N0C A;  1V5V A;  4G7Z A;  3GTP A;  3HOX K;  4A3K C;  2JA7 A;  1ZVU A;  4BLA A;  1KQ4 A;  3OPF A;  4YFK A;  1J98 A;  1TWC C;  1ZQ1 C;  2NVY K;  1Y1V K;  2NVQ K;  1XXC A;  4OIR A;  4WJ4 A;  4BBR K;  4XLP A;  1O25 A;  3FOE A;  2E2J C;  4LLG A;  1B4B A;  2JA8 C;  3CQZ A;  3PO2 C;  2A69 A;  2B63 K;  4BY1 C;  2CW0 A;  2R7Z C;  3HKZ L;  3A8K A;  1WSR A;  2NVT K;  3G4A A;  3GTJ C;  3LAP A;  4C3J C;  3PO3 C;  3GTP C;  5IP7 C;  1SFO K;  4KAR A;  2JA7 C;  3ADA C;  1O28 A;  2CFA B;  2E2I K;  3S2D K;  3I4N K;  3T01 A;  1R9T K;  3S2H K;  3GTQ K;  1XXB A;  3HKZ D;  1XZQ A;  4PAA A;  1I50 C;  1YNN A;  3NUH A;  4C3I K;  4A3E K;  3TFH A;  4RMF A;  4G7O A;  2P8T A;  1O2F B;  5D4D A;  3CAG A;  4G0V A;  3CQZ C;  1DCH A;  4GFQ A;  2B63 A;  2Y0S L;  2E2H K;  1WQF A;  1TWF A;  4BLB A;  3S1R C;  4P5B A;  5L46 A;  3HOX C;  3L4K A;  2JA6 C;  4LK1 A;  1VRQ C;  3GIR A;  1SFO A;  1O2B A;  5FLM C;  4MQ9 A;  4LR2 A;  3FHZ A;  1SMY A;  3AQO A;  1R9T A;  4GZY A;  1J6W A;  3GTQ A;  4Y7N K;  3TTG A;  2V6S A;  2Y0S D;  2R93 K;  3GTL K;  3BUE A;  4J3N A;  2FQO A;  3GTO K;  1VGX A;  5IP9 C;  2W7V A;  2WB1 L;  5CHP A;  2JA5 C;  3HOY C;  3S1M K;  2D6F C;  3S1N K;  3GEI A;  4X6A C;  2B63 C;  2E2H A;  3EQL A;  4GT9 A;  4C3H K;  4KMD A;  2O5I A;  1I3Q K;  3AD9 C;  2WAQ L;  1TWF C;  4GTF A;  5IYB C;  2EBB A;  5C4X K;  3LPX A;  4G0W A;  1F7V A;  3GTK A;  1TWG K;  2WB1 D;  1HQM A;  4KN4 A;  1ISE A;  3I4N C;  3GTQ C;  5TMC A;  3Q3Q A;  4ZH4 A;  2R93 A;  3S1Q K;  5E68 A;  3RZO K;  2GAH C;  3GTL A;  1EI6 A;  1WCM K;  3FOF A;  4O2D A;  3H0G C;  4C3I C;  2WAQ D;  3OEP A;  1O2A A;  3GTG C;  1WOS A;  4BBS K;  3AD8 C;  4C2M K;  4WJ3 M;  1GE9 A;  3GEE A;  1BDF A;  3K7A K;  4KM9 A;  3GDZ A;  4A93 K;  1K83 K;  3S14 C;  1EH1 A;  1TWA K;  1TWG A;  4KM8 A;  4GTL A;  4JK1 A;  4WIL A;  3GTK C;  3H3V L;  5FJ8 K;  3HOZ C;  1DCO A;  3HOW C;  1USO A;  2R93 C;  4KN7 A;  1EK8 A;  1WCM A;  2YU9 C;  3GTL C;  3BP8 C;  1TWH A;  4FM9 A;  1XZQ B;  5EGH A;  3HOU C;  4P5A A;  1AB4 A;  3LAJ A;  3BP3 A;  3M4O C;  4MEY A;  3HXA A;  4C45 A;  3H3V D;  3I4M K;  3N3Y A;  5JVO A;  4AYB L;  1WOP A;  3AH5 A;  2R92 K;  2RGR A;  2GSN A;  4A3L K;  4NOI A;  3MML B;  5C4X C;  1K83 A;  3M3Y K;  4A3J C;  1G51 A;  5C44 K;  1TWG C;  4YFN A;  4BY7 C;  3S17 K;  4OIP A;  2NVY A;  4A3I K;  3GTM K;  1Y1V A;  4Y52 C;  1IE0 A;  3A8I A;  3S16 K;  3RZO C;  1IS1 A;  1RU0 A;  4KMH A;  4AYB D;  3L4J A;  3TFI A;  1TWH C;  3RZD K;  2KWA A;  3S0X A;  4A3B K;  1C0A A;  3HOV K;  1VJE A;  4A3M K;  4KC6 A;  2GSO A;  4A3F K;  1WOO A;  2JH3 A;  4KAW X;  2R92 A;  5IOT A;  3GSI A;  4A93 C;  5IYC K;  2E2I A;  3AD7 C;  1WSV A;  2NVY C;  1BS2 A;  1Y1V C;  3SZZ A;  5M5X K;  4GTD A;  2NVQ C;  3N0B A;  4GTA A;  4BBR C;  4A3G K;  1UV7 A;  5IYD K;  4A3K K;  3T02 A;  5HL8 A;  1YNJ A;  4M1X A;  1PJ6 A;  2XCQ A;  1TWC K;  2NVT C;  4MEX A;  4QIW L;  4GTB A;  5TMF A;  2PPB A;  4LOW A;  5M3M K;  1WQG A;  4A3L C;  1SFO C;  4YFX A;  2E2J K;  1J6V A;  5C44 C;  2E2I C;  1ZYR A;  3S2D C;  3PO2 K;  3S2H C;  1BJT A;  1R9T C;  5CJ9 A;  2R7Z K;  1JQW A;  1I6H K;  1VH2 A;  1XXA A;  3DXJ A;  4QIW D;  4G0U A;  3GTO A;  3GTJ K;  2V6T A;  4A3E C;  3PO3 K;  5IP7 K;  3RZD C;  3G4C A;  1Y1W K;  2VUM K;  2PA8 L;  4XSZ A;  2NVX K;  4P9S A;  4KMU A;  4A3B C;  3HOV C;  1TWC A;  4A3M C;  2E2H C;  5M5Y K;  1XPP A;  1I3Q A;  1I50 K;  3WOD A;  1F93 A;  4GTC A;  2PA8 D;  1O27 A;  2XCO A;  4Y7N C;  4A3C K;  4DDQ A;  1L0W A;  3FKI K;  3GTJ A;  3GTO C;  3S1R K;  4BXX K;  4LQY A;  4KAT A;  2JA6 K;  4A3G C;  1Y1W A;  2VUM A;  1B4A A;  5IYD C;  2NVX A;  3S1M C;  4PAB A;  3S1N C;  5FLM K;  3SZY A;  4QJV A;  3S15 K;  4YG2 A;  4C3H C;  3JST A;  1USM A; 
#chains in the Genus database with same CATH homology
 4A3F K;  1I3Q C;  5C3E K;  1TWH K;  5IYC C;  4X6A C;  4A3D C;  2B63 C;  3CQZ K;  3EQL A;  3HOY C;  5IP9 K;  2A6E A;  4A93 C;  4LK0 A;  4C3H K;  2JA5 K;  2O5I A;  3HOY K;  1I3Q K;  2WAQ L;  1TWF C;  5IYC K;  2PMZ L;  5IYB C;  4X6A K;  5C4X K;  4G7Z A;  3S1Q C;  3HOX K;  4XLN A;  2NVY C;  1WCM C;  1I6H C;  1TWG K;  1Y1V C;  4A3K C;  2WB1 D;  2BE5 A;  4G7H A;  1HQM A;  4KN4 A;  3I4N C;  1TWF K;  5M5X K;  3GTQ C;  5IYB K;  2NVQ C;  5M3F K;  4YFK A;  5TMC A;  1Y1W C;  4ZH4 A;  2VUM C;  1TWC C;  2A68 A;  3S1Q K;  4BBR C;  4A3G K;  2NVX C;  3RZO K;  4BBS C;  2NVY K;  1WCM K;  1Y1V K;  5IYD K;  4A3K K;  4XSX A;  3H0G C;  2WAQ D;  2PMZ D;  2NVQ K;  1YNJ A;  3GTG C;  5C4J K;  4OIQ A;  4OIR A;  3K7A C;  1TWC K;  4BBR K;  2NVT C;  4MEX A;  4XLP A;  4BBS K;  4Q5S A;  4QIW L;  2E2J C;  4LLG A;  2JA8 C;  4C2M K;  3PO2 C;  5TMF A;  1K83 C;  2PPB A;  5M5W K;  3S2D K;  2A69 A;  3H0G K;  5M3M K;  4A3D K;  1TWA C;  1BDF A;  3GTG K;  4A3L C;  2B63 K;  1SFO C;  4BY1 C;  3K7A K;  2CW0 A;  2R7Z C;  4YFX A;  3HKZ L;  2NVT K;  2E2J K;  4A93 K;  5C44 C;  2E2I C;  1ZYR A;  3GTJ C;  3PO2 K;  3S2D C;  1K83 K;  1R9T C;  3PO3 C;  3S14 C;  3S2H C;  3GTP C;  4A3C C;  1TWA K;  5IP7 C;  4JK1 A;  3GTK C;  1SFO K;  3H3V L;  3FKI C;  2JA7 C;  2R7Z K;  1I6H K;  4BXX C;  5FJ8 K;  4QIW D;  3DXJ A;  4OIN A;  2E2I K;  1I6V A;  4Q4Z A;  3GTJ K;  3HOZ C;  4A3E C;  1R9T K;  3I4N K;  3HOW C;  3GTQ K;  3S14 K;  3S2H K;  4KN7 A;  3PO3 K;  2R93 C;  5IP7 K;  3RZD C;  1Y1W K;  2YU9 C;  2VUM K;  3GTL C;  3GTK K;  2PA8 L;  4XSZ A;  2NVX K;  3I4M C;  3HKZ D;  4KMU A;  3S15 C;  4A3B C;  1I50 C;  3HOV C;  1YNN A;  3HOU C;  3HOZ K;  4A3M C;  4C3I K;  4A3E K;  2E2H C;  2R92 C;  3HOW K;  5C3E C;  5M5Y K;  4G7O A;  2YU9 K;  1XPP A;  5D4D A;  3M4O C;  4MEY A;  3H3V D;  3I4M K;  3M3Y C;  2A6H A;  3CQZ C;  1IW7 A;  2JA8 K;  1I50 K;  4OIO A;  3WOD A;  4AYB L;  2O5J A;  2Y0S L;  3HOU K;  3S17 C;  2E2H K;  2R92 K;  4A3I C;  3GTM C;  4A3L K;  4NOI A;  4BY1 K;  3M4O K;  5C4X C;  3M3Y K;  2PA8 D;  3S1R C;  4A3J C;  3S16 C;  3HOX C;  2JA6 C;  4LK1 A;  5C44 K;  4Y7N C;  1TWG C;  4C3J K;  4YFN A;  4BY7 C;  3S17 K;  4OIP A;  3GTP K;  5FLM C;  4A3I K;  3GTM K;  4A3C K;  4MQ9 A;  3FKI K;  4LJZ A;  2JA7 K;  1SMY A;  3GTO C;  4GZY A;  4Y52 C;  3S1R K;  4A3J K;  4BXX K;  3S16 K;  2JA6 K;  4A3G C;  3RZO C;  4Y7N K;  5IYD C;  4AYB D;  4BY7 K;  2Y0S D;  4A3F C;  3S1M C;  5FLM K;  3S1N C;  1TWH C;  2R93 K;  3RZD K;  3GTL K;  3S1N K;  4QJV A;  5C4J C;  4QJV B;  3GTO K;  4Y52 K;  5IP9 C;  3S15 K;  4A3B K;  4YG2 A;  3HOV K;  2WB1 L;  4A3M K;  2JA5 C;  3S1M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...