2B63K

Complete rna polymerase ii-rna inhibitor complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2b63K00
1HQMA 4JK1A 4BY7K 3HOYK 2JA8K 4A3MK 3S16C 4Q4ZA 4A3KC 3GTOC 3GTGC 4Y7NC 2R92C 4A3DC 1TWHC 5TMFA 1I6VA 4XLNA 1R9TC 3EQLA 5C3EK 3PO3C 5C4JC 4OINA 4NOIA 3PO2C 1TWFC 3HOVK 2R93C 4A3LK 3I4NC 4LK1A 4C3JK 4A3BC 3H0GK 2E2HK 4G7HA 3S14C 2B63K 3S1NK 1Y1VK 3GTLC 4A93C 4Y52K 1BDFA 4LLGA 3I4MC 5IP7C 4BXXK 5IYCC 3FKIC 1XPPA 3S1MK 2PPBA 4A3EC 3K7AK 3S17C 1Y1WC 2NVQK 2JA5K 5C44C 4A3FK 2YU9K 3M4OK 1WCMC 3HOXC 4BBSC 3S2DC 1I6HK 3HKZL 3S1QC 4C3HK 4QJVA 4BBRC 4QIWL 4ZH4A 3GTPC 3GTOK 3M3YC 1I50K 3RZOK 2A6HA 2R92K 4A3DK 1TWHK 3S2HK 3GTJC 4A3GK 4A3JC 4OIRA 5M3MK 5C4JK 5IYBC 3CQZK 3GTKC 3GTMC 3HOWK 3PO2K 1SMYA 3HOZK 4QJVB 2R7ZC 2JA6K 3S14K 5C4XC 1TWGK 3S15C 2NVTC 3I4MK 2NVXC 2E2JK 2E2IK 1I3QC 3H3VL 4KN7A 3RZDC 2NVYC 4A3EK 5IP9C 4A3IK 5FLMC 4BY1K 1SFOK 1TWCK 1ZYRA 4A3CC 3S1QK 2CW0A 3DXJA 2VUMK 3HOUC 4KMUA 3HOYC 3HKZD 2O5IA 3WODA 1IW7A 3S16K 4AYBL 4A3KK 3GTGK 2WB1L 4QIWD 4Y7NK 2PMZL 5M5XK 1R9TK 3PO3K 5FJ8K 4C2MK 2Y0SL 3HOVC 4Q5SA 4A3GC 1TWFK 2R93K 3I4NK 5M5YK 1TWAC 2WAQL 2R7ZK 2E2HC 1YNNA 4A3BK 2PA8L 2B63C 4Y52C 1Y1VC 4XSXA 5IYDC 3S1NC 5D4DA 4G7ZA 4A93K 2A6EA 3GTLK 4BXXC 1I3QK 5M3FK 5IP7K 3S1MC 2JA7C 5IYCK 3FKIK 4X6AC 4MQ9A 4KN4A 5IP9K 5FLMK 2A69A 3S1RC 4OIQA 2NVQC 2JA5C 4MEXA 3GTQC 4A3FC 3H3VD 3S17K 1Y1WK 2YU9C 3M4OC 1I6HC 1K83C 5C44K 4LK0A 1WCMK 3HOXK 4BBSK 3S2DK 2O5JA 4YFXA 4YG2A 4C3IK 4BY7C 4BBRK 1I50C 4LJZA 2A68A 4A3MC 2JA8C 3GTPK 3M3YK 3RZOC 3S2HC 4GZYA 4OIPA 3GTJK 4AYBD 2WB1D 3CQZC 5C3EC 2PMZD 4A3JK 3HOWC 4YFNA 5IYBK 3HOZC 3GTMK 3GTKK 4A3LC 1TWAK 4XSZA 2JA6C 2Y0SD 1TWGC 3H0GC 5C4XK 4YFKA 5IYDK 3S15K 2WAQD 4OIOA 2E2JC 2BE5A 2E2IC 2PA8D 2NVXK 2NVTK 5TMCA 4X6AK 2JA7K 3S1RK 5M5WK 4BY1C 4A3IC 4XLPA 3RZDK 3GTQK 2NVYK 1SFOC 3K7AC 1TWCC 1K83K 1YNJA 4MEYA 2VUMC 4G7OA 4A3CK 3HOUK
chains in the Genus database with same CATH superfamily
3L4KA 3GTGC 1WOSA 4Y7NC 4C45A 4A3DC 1TWHC 1Y1VA 3N0BA 5TMFA 1I6VA 1VRQC 4XLNA 5C3EK 3OPFA 3FOEA 4NOIA 1TWFC 1IQ0A 2GAGC 4C3JK 3AD7C 2E2HK 1IE0A 2V6TA 1Y1VK 4LLGA 3I4MC 1EK8A 5IP7C 4GTAA 1F93A 4G0VA 1ZVUA 3K7AK 3S17C 5C44C 1WCMC 5IOQA 3S2DC 3G4AA 1XZPA 4GTLA 4G0UA 2GSOA 4QIWL 3TFJA 4ZH4A 3RZOK 2A6HA 2R92K 1PJ5A 2B63A 2XCQA 4A3JC 4KAWX 5IYBC 3PO2K 1J6WA 4LR2A 3T01A 3NUHA 3S15C 1J98A 1J6VA 2VUMA 2E2JK 1I3QC 3RZDC 1EQRA 1XXAA 4A3EK 5IP9C 3GTOA 5FLMC 1WORA 1TWCK 3JSTA 5EGHA 3S1QK 2VUMK 5JVOA 4KMUA 1YX2A 3L4JA 1WOPA 3S16K 2JA6A 4AYBL 2FQTA 2CFAA 3PO3K 5FJ8K 4C2MK 2Y0SL 4FZBA 4GTFA 2R93K 4C3JC 2E2HC 3AD9C 1EFWA 2PA8L 1Y1VC 1EI6A 2KWAA 2RGRA 3GEHA 5IYCK 1X31C 3S1RC 4MEXA 3GTGA 3AH5A 1JVIA 1ZBSA 3HOXK 4BBSK 3TTGA 4WILA 3RZOC 4A3MC 2R7ZA 3ADAC 3GTPK 1WIHA 4A3GK 1TWAK 4XSZA 1AB4A 4WJ3M 5C4XK 5IYDK 3GEEA 4OIOA 2E2JC 2BE5A 4X6AK 4P9SA 2JA7K 5M5WK 2NVYK 1TWCC 1K83K 2VUMC 4G7OA 4A3CK 4GTBA 1BS2A 3HOUK 1HQMA 4JK1A 4BY7K 3HOYK 5IOTA 2W7VA 3S16C 4Q4ZA 3GTOC 1O26A 4O2DA 3PO3C 4C2MC 4OINA 3HOVK 2R93C 2JA5A 3H0GK 3S14C 4G7HA 1B4AA 5CJ9A 5IYCC 3ERED 1GE9A 2JA5K 4KC6A 4KATA 1I6HK 3HOXC 4BBSC 1KQ4A 2GSUA 3CQZA 3N3YA 2GSNA 4KMAA 4QJVA 3FHZA 3GTPC 2E2HA 1V5VA 1ZQ1C 2V6SA 5C4JK 3CQZK 3HOWK 1SMYA 2R7ZC 5C4XC 4KM9A 4BKWA 1IBAA 3GIRA 4KN7A 3TFIA 2NVYC 1PJ7A 2R92A 1SFOK 1VLOA 1F7VA 4A3CC 1R9TA 5EGEA 2CW0A 3DXJA 3V4GA 3HOUC 1JOEA 4WJ4A 3HOYC 1WQFA 2O5IA 4A3KK 3GSIA 3GTLA 5M5XK 1R9TK 3S0XA 3HOVC 3I4NK 1DCPA 4XSXA 1TWCA 4G7ZA 4A93K 1F9NA 3GTLK 4P5AA 4MQ9A 1IL2A 4OIQA 2A69A 2JA5C 3H3VD 1I6HC 1O24A 5CHPA 2O5JA 3A8KA 3VA7A 4YG2A 1XZQB 2R93A 4LJZA 3M3YK 4FM9A 4GZYA 4OIPA 3G4CA 5HL8A 4LOWA 1G51A 1O2AA 3CQZC 2PMZD 5C3EC 3HOWC 3GTKK 3N0CA 3SZZA 2WAQD 1L0WA 4KB4A 2NVTK 5TMCA 1J6XA 1UV7A 3GTQK 4KASA 4XLPA 1SFOC 3K7AC 3GTPA 2XCOA 4MEYA 1O28A 1USOA 3AD8C 2JA8K 1TWAA 4A3KC 2R92C 1R9TC 3EQLA 4RMFA 3PO2C 2JA7A 4A3LK 3I4NC 1DD5A 4LK1A 5IOSA 2NVYA 2YU9A 1K83A 4A93C 1WQGA 3S1NK 3GTLC 1DCHA 3CAGA 1VGXA 2PPBA 4A3EC 2NVQK 4A3FK 2YU9K 3M4OK 2ZUEA 3MMLB 3S1QC 3T02A 4PAAA 4GTDA 1ZXOA 3M3YC 1I50K 4A3DK 1TWHK 3H0GA 2E2IA 3A8IA 3TFHA 5M3MK 3GTKC 4BLBA 1XZPB 4LQYA 1TWGK 4KDDA 2NVTC 3I4MK 1F7UA 4KMHA 2E2IK 3H3VL 4BY1K 3OREA 3HKZD 5TJ3A 2PMZL 4GFQA 4A3GC 3AQOA 5M5YK 1TWAC 2WAQL 4A3BK 3GEIA 1SFOA 3S1NC 5IYDC 1IS1A 5D4DA 3HXAA 2A6EA 4M1XA 4GTCA 3QX3A 1I3QK 4X6AC 2JA7C 3FKIK 3IPJA 3LAJA 4KN4A 5IP9K 5FLMK 2NVQC 5L46A 4A3FC 1Y1WK 2YU9C 3M4OC 1K83C 4LK0A 3GTMA 3LAPA 2P5MA 4C3IK 4DDQA 4BBRK 4BY7C 4GT9A 1I50C 2A68A 1C0AA 3GTJK 3GDZA 2NVXA 2WB1D 2FQOA 3GTMK 1TWGC 3H0GC 1WOOA 1PJ6A 2PHCB 2E2IC 1BGWA 2NVXK 2XCRB 3S1RK 1O2BA 4BY1C 4KMDA 2P8TA 4J3NA 3FOFA 3BUEA 3GTKA 1WQHA 1INNA 4A3MK 1XXBA 4XCHA 4P5BA 4G0WA 4AH6A 5C4JC 1ISEA 3BP8C 3GTQA 4A3BC 2EBBA 2B63K 4Y52K 4PABA 1BDFA 3LPXA 4BXXK 3FKIC 1XPPA 3S1MK 2ZUFA 1Y1WC 3T00A 1DCOA 3HKZL 4C3HK 4C3IC 4BBRC 1VH2A 2GAHC 1O29A 3GTOK 3S2HK 3GTJC 2V6UA 4OIRA 3SZYA 5JFEA 3GTMC 5IORA 3HOZK 4QJVB 3A8JA 2JA6K 3S14K 2NVXC 1RU0A 4ILDA 5E68A 4A3IK 2ZFZA 1I50A 1TWHA 1ZYRA 1EH1A 4KM8A 2Y3PA 1TWFA 3WODA 1IW7A 3GTGK 1TWGA 2WB1L 3BP3A 4QIWD 4Y7NK 2D6FC 4Q5SA 1USMA 1TWFK 2R7ZK 1JQWA 1WSRA 1YNNA 4KARA 2B63C 4Y52C 1WCMA 1XZQA 4BLAA 4BXXC 5M3FK 1BJTA 5IP7K 3S1MC 1WSVA 3GTQC 1VJEA 3S17K 5C44K 1WCMK 4C3HC 3S2DK 4YFXA 2JA8C 3S2HC 2JH3A 4KB2A 1XXCA 4AYBD 4A3JK 1O27A 4YFNA 1I3QA 5IYBK 3HOZC 3OEPA 1O2FB 3FKIA 4A3LC 2JA6C 2RH6A 2Y0SD 3AQPA 4YFKA 1Y1WA 3S15K 1B4BA 2PA8D 4GTEA 1HI9A 1YCLA 1O25A 4A3IC 3RZDK 2CFAB 3Q3QA 1YNJA 3GTJA
chains in the Genus database with same CATH topology
1HQMA 4JK1A 4BY7K 3HOYK 2JA8K 4A3MK 3S16C 4Q4ZA 4A3KC 3GTOC 3GTGC 4Y7NC 2R92C 4A3DC 1TWHC 5TMFA 1I6VA 4XLNA 1R9TC 3EQLA 5C3EK 3PO3C 5C4JC 4OINA 4NOIA 3PO2C 1TWFC 3HOVK 2R93C 4A3LK 3I4NC 4LK1A 4C3JK 4A3BC 3H0GK 2E2HK 4G7HA 3S14C 2B63K 3S1NK 1Y1VK 3GTLC 4A93C 4Y52K 1BDFA 4LLGA 3I4MC 5IP7C 4BXXK 5IYCC 3FKIC 1XPPA 3S1MK 2PPBA 4A3EC 3K7AK 3S17C 1Y1WC 2NVQK 2JA5K 5C44C 4A3FK 2YU9K 3M4OK 1WCMC 3HOXC 4BBSC 3S2DC 1I6HK 3HKZL 3S1QC 4C3HK 4QJVA 4BBRC 4QIWL 4ZH4A 3GTPC 3GTOK 3M3YC 1I50K 3RZOK 2A6HA 2R92K 4A3DK 1TWHK 3S2HK 3GTJC 4A3GK 4A3JC 4OIRA 5M3MK 5C4JK 5IYBC 3CQZK 3GTKC 3GTMC 3HOWK 3PO2K 1SMYA 3HOZK 4QJVB 2R7ZC 2JA6K 3S14K 5C4XC 1TWGK 3S15C 2NVTC 3I4MK 2NVXC 2E2JK 2E2IK 1I3QC 3H3VL 4KN7A 3RZDC 2NVYC 4A3EK 5IP9C 4A3IK 5FLMC 4BY1K 1SFOK 1TWCK 1ZYRA 4A3CC 3S1QK 2CW0A 3DXJA 2VUMK 3HOUC 4KMUA 3HOYC 3HKZD 2O5IA 3WODA 1IW7A 3S16K 4AYBL 4A3KK 3GTGK 2WB1L 4QIWD 4Y7NK 2PMZL 5M5XK 1R9TK 3PO3K 5FJ8K 4C2MK 2Y0SL 3HOVC 4Q5SA 4A3GC 1TWFK 2R93K 3I4NK 5M5YK 1TWAC 2WAQL 2R7ZK 2E2HC 1YNNA 4A3BK 2PA8L 2B63C 4Y52C 1Y1VC 4XSXA 5IYDC 3S1NC 5D4DA 4G7ZA 4A93K 2A6EA 3GTLK 4BXXC 1I3QK 5M3FK 5IP7K 3S1MC 2JA7C 5IYCK 3FKIK 4X6AC 4MQ9A 4KN4A 5IP9K 5FLMK 2A69A 3S1RC 4OIQA 2NVQC 2JA5C 4MEXA 3GTQC 4A3FC 3H3VD 3S17K 1Y1WK 2YU9C 3M4OC 1I6HC 1K83C 5C44K 4LK0A 1WCMK 3HOXK 4BBSK 3S2DK 2O5JA 4YFXA 4YG2A 4C3IK 4BY7C 4BBRK 1I50C 4LJZA 2A68A 4A3MC 2JA8C 3GTPK 3M3YK 3RZOC 3S2HC 4GZYA 4OIPA 3GTJK 4AYBD 2WB1D 3CQZC 5C3EC 2PMZD 4A3JK 3HOWC 4YFNA 5IYBK 3HOZC 3GTMK 3GTKK 4A3LC 1TWAK 4XSZA 2JA6C 2Y0SD 1TWGC 3H0GC 5C4XK 4YFKA 5IYDK 3S15K 2WAQD 4OIOA 2E2JC 2BE5A 2E2IC 2PA8D 2NVXK 2NVTK 5TMCA 4X6AK 2JA7K 3S1RK 5M5WK 4BY1C 4A3IC 4XLPA 3RZDK 3GTQK 2NVYK 1SFOC 3K7AC 1TWCC 1K83K 1YNJA 4MEYA 2VUMC 4G7OA 4A3CK 3HOUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM A;  4JK1 A;  4BY7 K;  3HOY K;  2JA8 K;  4A3M K;  3S16 C;  4Q4Z A;  4A3K C;  3GTO C;  3GTG C;  4Y7N C;  2R92 C;  4A3D C;  1TWH C;  5TMF A;  1I6V A;  4XLN A;  1R9T C;  3EQL A;  5C3E K;  3PO3 C;  5C4J C;  4OIN A;  4NOI A;  3PO2 C;  1TWF C;  3HOV K;  2R93 C;  4A3L K;  3I4N C;  4LK1 A;  4C3J K;  4A3B C;  3H0G K;  2E2H K;  4G7H A;  3S14 C;  2B63 K;  3S1N K;  1Y1V K;  3GTL C;  4A93 C;  4Y52 K;  1BDF A;  4LLG A;  3I4M C;  5IP7 C;  4BXX K;  5IYC C;  3FKI C;  1XPP A;  3S1M K;  2PPB A;  4A3E C;  3K7A K;  3S17 C;  1Y1W C;  2NVQ K;  2JA5 K;  5C44 C;  4A3F K;  2YU9 K;  3M4O K;  1WCM C;  3HOX C;  4BBS C;  3S2D C;  1I6H K;  3HKZ L;  3S1Q C;  4C3H K;  4QJV A;  4BBR C;  4QIW L;  4ZH4 A;  3GTP C;  3GTO K;  3M3Y C;  1I50 K;  3RZO K;  2A6H A;  2R92 K;  4A3D K;  1TWH K;  3S2H K;  3GTJ C;  4A3G K;  4A3J C;  4OIR A;  5M3M K;  5C4J K;  5IYB C;  3CQZ K;  3GTK C;  3GTM C;  3HOW K;  3PO2 K;  1SMY A;  3HOZ K;  4QJV B;  2R7Z C;  2JA6 K;  3S14 K;  5C4X C;  1TWG K;  3S15 C;  2NVT C;  3I4M K;  2NVX C;  2E2J K;  2E2I K;  1I3Q C;  3H3V L;  4KN7 A;  3RZD C;  2NVY C;  4A3E K;  5IP9 C;  4A3I K;  5FLM C;  4BY1 K;  1SFO K;  1TWC K;  1ZYR A;  4A3C C;  3S1Q K;  2CW0 A;  3DXJ A;  2VUM K;  3HOU C;  4KMU A;  3HOY C;  3HKZ D;  2O5I A;  3WOD A;  1IW7 A;  3S16 K;  4AYB L;  4A3K K;  3GTG K;  2WB1 L;  4QIW D;  4Y7N K;  2PMZ L;  5M5X K;  1R9T K;  3PO3 K;  5FJ8 K;  4C2M K;  2Y0S L;  3HOV C;  4Q5S A;  4A3G C;  1TWF K;  2R93 K;  3I4N K;  5M5Y K;  1TWA C;  2WAQ L;  2R7Z K;  2E2H C;  1YNN A;  4A3B K;  2PA8 L;  2B63 C;  4Y52 C;  1Y1V C;  4XSX A;  5IYD C;  3S1N C;  5D4D A;  4G7Z A;  4A93 K;  2A6E A;  3GTL K;  4BXX C;  1I3Q K;  5M3F K;  5IP7 K;  3S1M C;  2JA7 C;  5IYC K;  3FKI K;  4X6A C;  4MQ9 A;  4KN4 A;  5IP9 K;  5FLM K;  2A69 A;  3S1R C;  4OIQ A;  2NVQ C;  2JA5 C;  4MEX A;  3GTQ C;  4A3F C;  3H3V D;  3S17 K;  1Y1W K;  2YU9 C;  3M4O C;  1I6H C;  1K83 C;  5C44 K;  4LK0 A;  1WCM K;  3HOX K;  4BBS K;  3S2D K;  2O5J A;  4YFX A;  4YG2 A;  4C3I K;  4BY7 C;  4BBR K;  1I50 C;  4LJZ A;  2A68 A;  4A3M C;  2JA8 C;  3GTP K;  3M3Y K;  3RZO C;  3S2H C;  4GZY A;  4OIP A;  3GTJ K;  4AYB D;  2WB1 D;  3CQZ C;  5C3E C;  2PMZ D;  4A3J K;  3HOW C;  4YFN A;  5IYB K;  3HOZ C;  3GTM K;  3GTK K;  4A3L C;  1TWA K;  4XSZ A;  2JA6 C;  2Y0S D;  1TWG C;  3H0G C;  5C4X K;  4YFK A;  5IYD K;  3S15 K;  2WAQ D;  4OIO A;  2E2J C;  2BE5 A;  2E2I C;  2PA8 D;  2NVX K;  2NVT K;  5TMC A;  4X6A K;  2JA7 K;  3S1R K;  5M5W K;  4BY1 C;  4A3I C;  4XLP A;  3RZD K;  3GTQ K;  2NVY K;  1SFO C;  3K7A C;  1TWC C;  1K83 K;  1YNJ A;  4MEY A;  2VUM C;  4G7O A;  4A3C K;  3HOU K; 
#chains in the Genus database with same CATH topology
 3L4K A;  3GTG C;  1WOS A;  4Y7N C;  4C45 A;  4A3D C;  1TWH C;  1Y1V A;  3N0B A;  5TMF A;  1I6V A;  1VRQ C;  4XLN A;  5C3E K;  3OPF A;  3FOE A;  4NOI A;  1TWF C;  1IQ0 A;  2GAG C;  4C3J K;  3AD7 C;  2E2H K;  1IE0 A;  2V6T A;  1Y1V K;  4LLG A;  3I4M C;  1EK8 A;  5IP7 C;  4GTA A;  1F93 A;  4G0V A;  1ZVU A;  3K7A K;  3S17 C;  5C44 C;  1WCM C;  5IOQ A;  3S2D C;  3G4A A;  1XZP A;  4GTL A;  4G0U A;  2GSO A;  4QIW L;  3TFJ A;  4ZH4 A;  3RZO K;  2A6H A;  2R92 K;  1PJ5 A;  2B63 A;  2XCQ A;  4A3J C;  4KAW X;  5IYB C;  3PO2 K;  1J6W A;  4LR2 A;  3T01 A;  3NUH A;  3S15 C;  1J98 A;  1J6V A;  2VUM A;  2E2J K;  1I3Q C;  3RZD C;  1EQR A;  1XXA A;  4A3E K;  5IP9 C;  3GTO A;  5FLM C;  1WOR A;  1TWC K;  3JST A;  5EGH A;  3S1Q K;  2VUM K;  5JVO A;  4KMU A;  1YX2 A;  3L4J A;  1WOP A;  3S16 K;  2JA6 A;  4AYB L;  2FQT A;  2CFA A;  3PO3 K;  5FJ8 K;  4C2M K;  2Y0S L;  4FZB A;  4GTF A;  2R93 K;  4C3J C;  2E2H C;  3AD9 C;  1EFW A;  2PA8 L;  1Y1V C;  1EI6 A;  2KWA A;  2RGR A;  3GEH A;  5IYC K;  1X31 C;  3S1R C;  4MEX A;  3GTG A;  3AH5 A;  1JVI A;  1ZBS A;  3HOX K;  4BBS K;  3TTG A;  4WIL A;  3RZO C;  4A3M C;  2R7Z A;  3ADA C;  3GTP K;  1WIH A;  4A3G K;  1TWA K;  4XSZ A;  1AB4 A;  4WJ3 M;  5C4X K;  5IYD K;  3GEE A;  4OIO A;  2E2J C;  2BE5 A;  4X6A K;  4P9S A;  2JA7 K;  5M5W K;  2NVY K;  1TWC C;  1K83 K;  2VUM C;  4G7O A;  4A3C K;  4GTB A;  1BS2 A;  3HOU K;  1HQM A;  4JK1 A;  4BY7 K;  3HOY K;  5IOT A;  2W7V A;  3S16 C;  4Q4Z A;  3GTO C;  1O26 A;  4O2D A;  3PO3 C;  4C2M C;  4OIN A;  3HOV K;  2R93 C;  2JA5 A;  3H0G K;  3S14 C;  4G7H A;  1B4A A;  5CJ9 A;  5IYC C;  3ERE D;  1GE9 A;  2JA5 K;  4KC6 A;  4KAT A;  1I6H K;  3HOX C;  4BBS C;  1KQ4 A;  2GSU A;  3CQZ A;  3N3Y A;  2GSN A;  4KMA A;  4QJV A;  3FHZ A;  3GTP C;  2E2H A;  1V5V A;  1ZQ1 C;  2V6S A;  5C4J K;  3CQZ K;  3HOW K;  1SMY A;  2R7Z C;  5C4X C;  4KM9 A;  4BKW A;  1IBA A;  3GIR A;  4KN7 A;  3TFI A;  2NVY C;  1PJ7 A;  2R92 A;  1SFO K;  1VLO A;  1F7V A;  4A3C C;  1R9T A;  5EGE A;  2CW0 A;  3DXJ A;  3V4G A;  3HOU C;  1JOE A;  4WJ4 A;  3HOY C;  1WQF A;  2O5I A;  4A3K K;  3GSI A;  3GTL A;  5M5X K;  1R9T K;  3S0X A;  3HOV C;  3I4N K;  1DCP A;  4XSX A;  1TWC A;  4G7Z A;  4A93 K;  1F9N A;  3GTL K;  4P5A A;  4MQ9 A;  1IL2 A;  4OIQ A;  2A69 A;  2JA5 C;  3H3V D;  1I6H C;  1O24 A;  5CHP A;  2O5J A;  3A8K A;  3VA7 A;  4YG2 A;  1XZQ B;  2R93 A;  4LJZ A;  3M3Y K;  4FM9 A;  4GZY A;  4OIP A;  3G4C A;  5HL8 A;  4LOW A;  1G51 A;  1O2A A;  3CQZ C;  2PMZ D;  5C3E C;  3HOW C;  3GTK K;  3N0C A;  3SZZ A;  2WAQ D;  1L0W A;  4KB4 A;  2NVT K;  5TMC A;  1J6X A;  1UV7 A;  3GTQ K;  4KAS A;  4XLP A;  1SFO C;  3K7A C;  3GTP A;  2XCO A;  4MEY A;  1O28 A;  1USO A;  3AD8 C;  2JA8 K;  1TWA A;  4A3K C;  2R92 C;  1R9T C;  3EQL A;  4RMF A;  3PO2 C;  2JA7 A;  4A3L K;  3I4N C;  1DD5 A;  4LK1 A;  5IOS A;  2NVY A;  2YU9 A;  1K83 A;  4A93 C;  1WQG A;  3S1N K;  3GTL C;  1DCH A;  3CAG A;  1VGX A;  2PPB A;  4A3E C;  2NVQ K;  4A3F K;  2YU9 K;  3M4O K;  2ZUE A;  3MML B;  3S1Q C;  3T02 A;  4PAA A;  4GTD A;  1ZXO A;  3M3Y C;  1I50 K;  4A3D K;  1TWH K;  3H0G A;  2E2I A;  3A8I A;  3TFH A;  5M3M K;  3GTK C;  4BLB A;  1XZP B;  4LQY A;  1TWG K;  4KDD A;  2NVT C;  3I4M K;  1F7U A;  4KMH A;  2E2I K;  3H3V L;  4BY1 K;  3ORE A;  3HKZ D;  5TJ3 A;  2PMZ L;  4GFQ A;  4A3G C;  3AQO A;  5M5Y K;  1TWA C;  2WAQ L;  4A3B K;  3GEI A;  1SFO A;  3S1N C;  5IYD C;  1IS1 A;  5D4D A;  3HXA A;  2A6E A;  4M1X A;  4GTC A;  3QX3 A;  1I3Q K;  4X6A C;  2JA7 C;  3FKI K;  3IPJ A;  3LAJ A;  4KN4 A;  5IP9 K;  5FLM K;  2NVQ C;  5L46 A;  4A3F C;  1Y1W K;  2YU9 C;  3M4O C;  1K83 C;  4LK0 A;  3GTM A;  3LAP A;  2P5M A;  4C3I K;  4DDQ A;  4BBR K;  4BY7 C;  4GT9 A;  1I50 C;  2A68 A;  1C0A A;  3GTJ K;  3GDZ A;  2NVX A;  2WB1 D;  2FQO A;  3GTM K;  1TWG C;  3H0G C;  1WOO A;  1PJ6 A;  2PHC B;  2E2I C;  1BGW A;  2NVX K;  2XCR B;  3S1R K;  1O2B A;  4BY1 C;  4KMD A;  2P8T A;  4J3N A;  3FOF A;  3BUE A;  3GTK A;  1WQH A;  1INN A;  4A3M K;  1XXB A;  4XCH A;  4P5B A;  4G0W A;  4AH6 A;  5C4J C;  1ISE A;  3BP8 C;  3GTQ A;  4A3B C;  2EBB A;  2B63 K;  4Y52 K;  4PAB A;  1BDF A;  3LPX A;  4BXX K;  3FKI C;  1XPP A;  3S1M K;  2ZUF A;  1Y1W C;  3T00 A;  1DCO A;  3HKZ L;  4C3H K;  4C3I C;  4BBR C;  1VH2 A;  2GAH C;  1O29 A;  3GTO K;  3S2H K;  3GTJ C;  2V6U A;  4OIR A;  3SZY A;  5JFE A;  3GTM C;  5IOR A;  3HOZ K;  4QJV B;  3A8J A;  2JA6 K;  3S14 K;  2NVX C;  1RU0 A;  4ILD A;  5E68 A;  4A3I K;  2ZFZ A;  1I50 A;  1TWH A;  1ZYR A;  1EH1 A;  4KM8 A;  2Y3P A;  1TWF A;  3WOD A;  1IW7 A;  3GTG K;  1TWG A;  2WB1 L;  3BP3 A;  4QIW D;  4Y7N K;  2D6F C;  4Q5S A;  1USM A;  1TWF K;  2R7Z K;  1JQW A;  1WSR A;  1YNN A;  4KAR A;  2B63 C;  4Y52 C;  1WCM A;  1XZQ A;  4BLA A;  4BXX C;  5M3F K;  1BJT A;  5IP7 K;  3S1M C;  1WSV A;  3GTQ C;  1VJE A;  3S17 K;  5C44 K;  1WCM K;  4C3H C;  3S2D K;  4YFX A;  2JA8 C;  3S2H C;  2JH3 A;  4KB2 A;  1XXC A;  4AYB D;  4A3J K;  1O27 A;  4YFN A;  1I3Q A;  5IYB K;  3HOZ C;  3OEP A;  1O2F B;  3FKI A;  4A3L C;  2JA6 C;  2RH6 A;  2Y0S D;  3AQP A;  4YFK A;  1Y1W A;  3S15 K;  1B4B A;  2PA8 D;  4GTE A;  1HI9 A;  1YCL A;  1O25 A;  4A3I C;  3RZD K;  2CFA B;  3Q3Q A;  1YNJ A;  3GTJ A; 
#chains in the Genus database with same CATH homology
 1HQM A;  4JK1 A;  4BY7 K;  3HOY K;  2JA8 K;  4A3M K;  3S16 C;  4Q4Z A;  4A3K C;  3GTO C;  3GTG C;  4Y7N C;  2R92 C;  4A3D C;  1TWH C;  5TMF A;  1I6V A;  4XLN A;  1R9T C;  3EQL A;  5C3E K;  3PO3 C;  5C4J C;  4OIN A;  4NOI A;  3PO2 C;  1TWF C;  3HOV K;  2R93 C;  4A3L K;  3I4N C;  4LK1 A;  4C3J K;  4A3B C;  3H0G K;  2E2H K;  4G7H A;  3S14 C;  2B63 K;  3S1N K;  1Y1V K;  3GTL C;  4A93 C;  4Y52 K;  1BDF A;  4LLG A;  3I4M C;  5IP7 C;  4BXX K;  5IYC C;  3FKI C;  1XPP A;  3S1M K;  2PPB A;  4A3E C;  3K7A K;  3S17 C;  1Y1W C;  2NVQ K;  2JA5 K;  5C44 C;  4A3F K;  2YU9 K;  3M4O K;  1WCM C;  3HOX C;  4BBS C;  3S2D C;  1I6H K;  3HKZ L;  3S1Q C;  4C3H K;  4QJV A;  4BBR C;  4QIW L;  4ZH4 A;  3GTP C;  3GTO K;  3M3Y C;  1I50 K;  3RZO K;  2A6H A;  2R92 K;  4A3D K;  1TWH K;  3S2H K;  3GTJ C;  4A3G K;  4A3J C;  4OIR A;  5M3M K;  5C4J K;  5IYB C;  3CQZ K;  3GTK C;  3GTM C;  3HOW K;  3PO2 K;  1SMY A;  3HOZ K;  4QJV B;  2R7Z C;  2JA6 K;  3S14 K;  5C4X C;  1TWG K;  3S15 C;  2NVT C;  3I4M K;  2NVX C;  2E2J K;  2E2I K;  1I3Q C;  3H3V L;  4KN7 A;  3RZD C;  2NVY C;  4A3E K;  5IP9 C;  4A3I K;  5FLM C;  4BY1 K;  1SFO K;  1TWC K;  1ZYR A;  4A3C C;  3S1Q K;  2CW0 A;  3DXJ A;  2VUM K;  3HOU C;  4KMU A;  3HOY C;  3HKZ D;  2O5I A;  3WOD A;  1IW7 A;  3S16 K;  4AYB L;  4A3K K;  3GTG K;  2WB1 L;  4QIW D;  4Y7N K;  2PMZ L;  5M5X K;  1R9T K;  3PO3 K;  5FJ8 K;  4C2M K;  2Y0S L;  3HOV C;  4Q5S A;  4A3G C;  1TWF K;  2R93 K;  3I4N K;  5M5Y K;  1TWA C;  2WAQ L;  2R7Z K;  2E2H C;  1YNN A;  4A3B K;  2PA8 L;  2B63 C;  4Y52 C;  1Y1V C;  4XSX A;  5IYD C;  3S1N C;  5D4D A;  4G7Z A;  4A93 K;  2A6E A;  3GTL K;  4BXX C;  1I3Q K;  5M3F K;  5IP7 K;  3S1M C;  2JA7 C;  5IYC K;  3FKI K;  4X6A C;  4MQ9 A;  4KN4 A;  5IP9 K;  5FLM K;  2A69 A;  3S1R C;  4OIQ A;  2NVQ C;  2JA5 C;  4MEX A;  3GTQ C;  4A3F C;  3H3V D;  3S17 K;  1Y1W K;  2YU9 C;  3M4O C;  1I6H C;  1K83 C;  5C44 K;  4LK0 A;  1WCM K;  3HOX K;  4BBS K;  3S2D K;  2O5J A;  4YFX A;  4YG2 A;  4C3I K;  4BY7 C;  4BBR K;  1I50 C;  4LJZ A;  2A68 A;  4A3M C;  2JA8 C;  3GTP K;  3M3Y K;  3RZO C;  3S2H C;  4GZY A;  4OIP A;  3GTJ K;  4AYB D;  2WB1 D;  3CQZ C;  5C3E C;  2PMZ D;  4A3J K;  3HOW C;  4YFN A;  5IYB K;  3HOZ C;  3GTM K;  3GTK K;  4A3L C;  1TWA K;  4XSZ A;  2JA6 C;  2Y0S D;  1TWG C;  3H0G C;  5C4X K;  4YFK A;  5IYD K;  3S15 K;  2WAQ D;  4OIO A;  2E2J C;  2BE5 A;  2E2I C;  2PA8 D;  2NVX K;  2NVT K;  5TMC A;  4X6A K;  2JA7 K;  3S1R K;  5M5W K;  4BY1 C;  4A3I C;  4XLP A;  3RZD K;  3GTQ K;  2NVY K;  1SFO C;  3K7A C;  1TWC C;  1K83 K;  1YNJ A;  4MEY A;  2VUM C;  4G7O A;  4A3C K;  3HOU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...