2B63K

Complete rna polymerase ii-rna inhibitor complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2b63K00
4C3IK 3GTLC 3HOZC 5M5YK 4XSXA 3GTLK 1ZYRA 4BBSC 1I50C 2WAQD 4A3IK 4G7OA 4A3MC 1K83K 4OIQA 4BBSK 1I50K 4AYBD 4A3MK 3S16K 1IW7A 2A6HA 1TWCC 3RZDC 3H3VL 4OIRA 4X6AC 4YFNA 1TWCK 4C3JK 3RZDK 4A3KC 2JA5C 4BY7C 4A3GC 2PMZL 2JA5K 4BY7K 4A3KK 4GZYA 4A3GK 5IP7C 3I4NC 5IYBC 4Y52C 3HOXC 5FJ8K 5IP7K 4YFKA 3S14C 3EQLA 4OIOA 5IYBK 3DXJA 4BBRK 4QJVB 5C3EC 3S14K 3GTQC 4Y52K 2R92C 4BY1C 1WCMC 3GTQK 2CW0A 2WAQL 4BY1K 2O5IA 1WCMK 2R92K 2VUMC 5IP9C 2BE5A 2A69A 2VUMK 4AYBL 5IP9K 4MQ9A 4OINA 3S1MC 2PPBA 4A3IC 2B63C 5C4JC 2A68A 2JA8K 4QIWD 4Q5SA 1K83C 5D4DA 3S1MK 5C4XC 2B63K 5C4XK 5C4JK 3S16C 5IYCC 2YU9C 4JK1A 4KN4A 5IYCK 2YU9K 5FLMC 5FLMK 5TMFA 5M3MK 3HOUC 4A3JC 3S2DK 4Y7NC 3HOUK 4BBRC 4A3JK 2E2JC 4XLPA 4Y7NK 1XPPA 1TWHC 2E2JK 1I3QC 4MEYA 4C3HK 4QIWL 3H0GC 1TWHK 1I3QK 3M3YC 2Y0SD 3H0GK 1I6VA 2PA8D 3M3YK 4Q4ZA 2JA8C 3PO2C 1TWAC 4C2MK 3S15C 2A6EA 3PO2K 1TWAK 3S15K 4A3CK 3S1NC 4LK0A 4G7ZA 3S1NK 1TWFC 1YNJA 5M5WK 4BXXC 1TWFK 2NVYC 4A3FK 4BXXK 1Y1WK 4XSZA 4XLNA 2NVYK 3S2DC 2O5JA 1TWGC 3I4MC 3GTPC 1HQMA 1TWGK 3I4MK 2Y0SL 3HKZD 2WB1D 2R7ZC 4NOIA 3PO3C 2JA7C 3GTMC 3GTPK 4OIPA 1SMYA 2R7ZK 4LLGA 5M3FK 3K7AC 4YFXA 4LK1A 2JA7K 3GTMK 3RZOK 3PO3K 4A3DC 4ZH4A 1I6HK 3K7AK 4A3DK 2NVQC 1SFOC 5IYDC 2E2IC 3S2HC 2NVXC 2NVQK 3GTKC 1SFOK 3HOZK 3CQZC 2E2IK 3GTOC 4QJVA 5M5XK 2NVXK 3GTKK 3S2HK 5IYDK 3M4OC 3CQZK 3HOYC 2JA6C 3GTOK 4A93C 4A3CC 3M4OK 2NVTC 3HOYK 2JA6K 3WODA 4A93K 5C44C 4G7HA 3S1QC 2NVTK 4A3LC 3HOWC 5C44K 4X6AK 3S1QK 4A3LK 4A3FC 3HOWK 1BDFA 1Y1WC 3HKZL 2WB1L 3H3VD 3I4NK 4KN7A 1I6HC 3HOXK 3S1RC 4LJZA 4A3EC 5TMCA 3GTGC 4A3BC 3FKIC 2PMZD 5C3EK 3S1RK 2E2HC 4A3BK 4KMUA 2PA8L 4YG2A 4A3EK 1R9TC 3FKIK 3GTJC 3GTGK 3RZOC 2E2HK 3S17C 4MEXA 2R93C 3HOVC 1Y1VC 1YNNA 3GTJK 1R9TK 3S17K 2R93K 3HOVK 1Y1VK
chains in the Genus database with same CATH superfamily
3MMLB 5JFEA 1I50C 4OIQA 4C3JC 1O2AA 1TWCC 3RZDC 4X6AC 1G51A 4BY7C 4A3GC 2JA5K 4A3KK 4GZYA 3A8JA 1IE0A 3HOXC 4YFKA 5IYBK 4LQYA 3GTQK 2R92K 1EK8A 2VUMK 3JSTA 2B63C 1XZPA 3S1MK 5C4XK 1F93A 2YU9K 1DCHA 5FLMK 1JOEA 4P9SA 4G0WA 2CFAB 4GFQA 3HOUK 4BBRC 2E2JC 2YU9A 5EGEA 1XPPA 2GSUA 1I3QC 2P5MA 2NVYA 3M3YC 4J3NA 4KB2A 1ZVUA 3PO2C 3G4CA 2FQOA 1B4BA 1WQHA 3TFJA 1TWFK 2NVXA 1O26A 4XLNA 2D6FC 3BP3A 3GEHA 2O5JA 3GEEA 2JA6A 1PJ7A 1INNA 4NOIA 5L46A 3GTPK 2JH3A 1RU0A 4WJ4A 3K7AC 4YFXA 2JA7K 4A3DC 4KAWX 2NVQC 5IYDC 1SFOK 3S2HK 1EFWA 3GTOC 2GSNA 3Q3QA 3FKIA 3OEPA 3HOYK 2Y3PA 3GTJA 4A3LC 5IORA 5CJ9A 4KC6A 5C44K 4X6AK 3N0CA 3HOWK 1Y1WC 1WOOA 3FOEA 3OREA 3N3YA 3HOXK 1J6VA 4LJZA 3S1RC 1XXBA 4A3BC 2PMZD 1I6HK 4BKWA 3GTGK 2E2HK 1Y1VC 4C3IC 3S17K 2R93K 3HOVK 2V6TA 4O2DA 5M5YK 3GTLK 2PHCB 1USOA 2GSOA 4BBSK 4AYBD 4A3MK 3V4GA 2E2HA 4G0VA 1USMA 1ISEA 2ZUEA 2PMZL 1O27A 1UV7A 4GTBA 3I4NC 4Y52C 5IP7K 3S14C 3QX3A 4BBRK 3GEIA 3FHZA 4BY1C 1WCMC 2BE5A 1PJ6A 4AYBL 5IP9K 4G0UA 4OINA 4KDDA 4Q5SA 2A68A 4QIWD 1K83C 5IOTA 5D4DA 1C0AA 5C4JK 1AB4A 1WQFA 3AD7C 4JK1A 1XXCA 1WQGA 5IYCK 1I3QA 1ZXOA 2V6SA 1J98A 4XCHA 1YCLA 4A3JC 2FQTA 4Y7NK 4C3HC 2V6UA 3AQPA 4QIWL 3H0GC 1TWHK 4KARA 1J6XA 2PA8D 4Q4ZA 1TWAC 3G4AA 4C2MK 4KASA 3S15C 2A6EA 3BUEA 1EQRA 4LK0A 1IBAA 4G7ZA 3S1NK 4GTEA 1TWHA 3LAJA 1VH2A 1ZBSA 1WORA 4BXXK 1Y1WK 2GAHC 2NVYK 4BLBA 3GTOA 2RH6A 3S2DC 1TWGC 4KMDA 3I4MC 1HQMA 3HKZD 3PO3C 4GT9A 2R7ZK 3GDZA 1JVIA 3GTMK 4ZH4A 1Y1WA 1DCPA 2CFAA 2E2IC 3GTKC 3A8KA 3CQZC 4QJVA 5M5XK 2NVXK 1B4AA 4A3CC 3M4OK 4A93K 2R7ZA 2JA6K 3GTMA 3S1QC 3T00A 2NVTK 3N0BA 1IS1A 4A3FC 1XZQA 3HKZL 3TFHA 3H3VD 1O24A 3I4NK 4KN7A 2ZFZA 4KMUA 4A3EK 3RZOC 1F7VA 1R9TC 3FKIK 4GTFA 3GTJK 3T02A 1BS2A 3HOZC 1ZYRA 2WAQD 1K83K 1I50K 1IW7A 1J6WA 1WCMA 2A6HA 3H3VL 4OIRA 5JVOA 4YFNA 1TWCK 4C3JK 3RZDK 4A3KC 2JA5C 4BY7K 1ZQ1C 4A3GK 1O2BA 4KMHA 5IYBC 3AH5A 1K83A 5FJ8K 1I50A 1XXAA 4OIOA 5C3EC 3DXJA 3GTQC 2R92C 1TWCA 2WAQL 2O5IA 2VUMC 2KWAA 4PABA 3IPJA 3S1MC 2PPBA 4A3IC 5C4XC 1KQ4A 4ILDA 2B63K 1WIHA 2YU9C 3S16C 3SZZA 5FLMC 3H0GA 5EGHA 5CHPA 5TMFA 3ERED 2XCOA 3HOUC 3S2DK 2B63A 4XLPA 4RMFA 3TFIA 2E2JK 4MEYA 4GTDA 1I3QK 1F7UA 1I6VA 5HL8A 3M3YK 1TWGA 3A8IA 2JA8C 4KMAA 1O2FB 2ZUFA 3PO2K 3FOFA 4A3CK 4DDQA 1TWFC 3OPFA 1GE9A 4BLAA 5IOSA 4A3FK 2GAGC 3GTKA 4XSZA 3CQZA 3LAPA 1DCOA 3GTPC 2WB1D 2JA7C 1WSRA 4LLGA 3RZOK 4WILA 3K7AK 4A3DK 4FZBA 1SFOC 3S2HC 2NVQK 1V5VA 3HOZK 3LPXA 5IYDK 1O28A 2RGRA 1IL2A 3HOYC 3GTOK 3S0XA 4P5AA 1R9TA 5C44C 4P5BA 3HOWC 2EBBA 4A3LK 3ADAC 2P8TA 2WB1L 1X31C 5IOQA 1BJTA 1EI6A 4LOWA 4WJ3M 4GTLA 1I6HC 1IQ0A 4KATA 5TMCA 3GTGC 5C3EK 3S1RK 2E2HC 4A3BK 2PA8L 4C45A 1XZPB 4MEXA 3S17C 3HOVC 1YNNA 2R93C 2JA5A 3BP8C 1Y1VK 3T01A 4C3IK 3GTLC 4XSXA 1O25A 4BBSC 4A3IK 4G7OA 4A3MC 1L0WA 1YX2A 3GTQA 2R92A 3S16K 2VUMA 1WOSA 1Y1VA 4AH6A 3SZYA 1EH1A 5IP7C 3CAGA 1PJ5A 4KB4A 3EQLA 4Y52K 4QJVB 3S14K 1JQWA 2CW0A 4BY1K 1F9NA 1WCMK 3GSIA 5IP9C 2A69A 4MQ9A 1XZQB 4LR2A 5C4JC 2JA8K 4KM9A 5IYCC 4KN4A 1O29A 1HI9A 5M3MK 1VGXA 3L4KA 3TTGA 4Y7NC 4A3JK 3AD8C 1TWFA 1TWHC 4C3HK 1VRQC 4GTAA 2Y0SD 3H0GK 4C2MC 1WOPA 4KM8A 3GTPA 1TWAK 3S15K 2JA7A 3S1NC 1VJEA 4FM9A 5TJ3A 5M5WK 1YNJA 4BXXC 1SFOA 2NVYC 4M1XA 2W7VA 1TWAA 3AQOA 1TWGK 3L4JA 3I4MK 2Y0SL 3HXAA 1WSVA 3GIRA 2R7ZC 3GTMC 4OIPA 1SMYA 5M3FK 5E68A 3PO3K 4LK1A 4PAAA 2XCRB 2NVXC 2E2IK 3GTKK 3NUHA 3CQZK 3M4OC 2JA6C 4A93C 3GTGA 2NVTC 3WODA 4G7HA 2R93A 3S1QK 3VA7A 3AD9C 1BDFA 1BGWA 3GTLA 2E2IA 4A3EC 3FKIC 4YG2A 4GTCA 3GTJC 1R9TK 1VLOA 1DD5A 2XCQA
chains in the Genus database with same CATH topology
4C3IK 3GTLC 3HOZC 5M5YK 4XSXA 3GTLK 1ZYRA 4BBSC 1I50C 2WAQD 4A3IK 4G7OA 4A3MC 1K83K 4OIQA 4BBSK 1I50K 4AYBD 4A3MK 3S16K 1IW7A 2A6HA 1TWCC 3RZDC 3H3VL 4OIRA 4X6AC 4YFNA 1TWCK 4C3JK 3RZDK 4A3KC 2JA5C 4BY7C 4A3GC 2PMZL 2JA5K 4BY7K 4A3KK 4GZYA 4A3GK 5IP7C 3I4NC 5IYBC 4Y52C 3HOXC 5FJ8K 5IP7K 4YFKA 3S14C 3EQLA 4OIOA 5IYBK 3DXJA 4BBRK 4QJVB 5C3EC 3S14K 3GTQC 4Y52K 2R92C 4BY1C 1WCMC 3GTQK 2CW0A 2WAQL 4BY1K 2O5IA 1WCMK 2R92K 2VUMC 5IP9C 2BE5A 2A69A 2VUMK 4AYBL 5IP9K 4MQ9A 4OINA 3S1MC 2PPBA 4A3IC 2B63C 5C4JC 2A68A 2JA8K 4QIWD 4Q5SA 1K83C 5D4DA 3S1MK 5C4XC 2B63K 5C4XK 5C4JK 3S16C 5IYCC 2YU9C 4JK1A 4KN4A 5IYCK 2YU9K 5FLMC 5FLMK 5TMFA 5M3MK 3HOUC 4A3JC 3S2DK 4Y7NC 3HOUK 4BBRC 4A3JK 2E2JC 4XLPA 4Y7NK 1XPPA 1TWHC 2E2JK 1I3QC 4MEYA 4C3HK 4QIWL 3H0GC 1TWHK 1I3QK 3M3YC 2Y0SD 3H0GK 1I6VA 2PA8D 3M3YK 4Q4ZA 2JA8C 3PO2C 1TWAC 4C2MK 3S15C 2A6EA 3PO2K 1TWAK 3S15K 4A3CK 3S1NC 4LK0A 4G7ZA 3S1NK 1TWFC 1YNJA 5M5WK 4BXXC 1TWFK 2NVYC 4A3FK 4BXXK 1Y1WK 4XSZA 4XLNA 2NVYK 3S2DC 2O5JA 1TWGC 3I4MC 3GTPC 1HQMA 1TWGK 3I4MK 2Y0SL 3HKZD 2WB1D 2R7ZC 4NOIA 3PO3C 2JA7C 3GTMC 3GTPK 4OIPA 1SMYA 2R7ZK 4LLGA 5M3FK 3K7AC 4YFXA 4LK1A 2JA7K 3GTMK 3RZOK 3PO3K 4A3DC 4ZH4A 1I6HK 3K7AK 4A3DK 2NVQC 1SFOC 5IYDC 2E2IC 3S2HC 2NVXC 2NVQK 3GTKC 1SFOK 3HOZK 3CQZC 2E2IK 3GTOC 4QJVA 5M5XK 2NVXK 3GTKK 3S2HK 5IYDK 3M4OC 3CQZK 3HOYC 2JA6C 3GTOK 4A93C 4A3CC 3M4OK 2NVTC 3HOYK 2JA6K 3WODA 4A93K 5C44C 4G7HA 3S1QC 2NVTK 4A3LC 3HOWC 5C44K 4X6AK 3S1QK 4A3LK 4A3FC 3HOWK 1BDFA 1Y1WC 3HKZL 2WB1L 3H3VD 3I4NK 4KN7A 1I6HC 3HOXK 3S1RC 4LJZA 4A3EC 5TMCA 3GTGC 4A3BC 3FKIC 2PMZD 5C3EK 3S1RK 2E2HC 4A3BK 4KMUA 2PA8L 4YG2A 4A3EK 1R9TC 3FKIK 3GTJC 3GTGK 3RZOC 2E2HK 3S17C 4MEXA 2R93C 3HOVC 1Y1VC 1YNNA 3GTJK 1R9TK 3S17K 2R93K 3HOVK 1Y1VK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I K;  3GTL C;  3HOZ C;  5M5Y K;  4XSX A;  3GTL K;  1ZYR A;  4BBS C;  1I50 C;  2WAQ D;  4A3I K;  4G7O A;  4A3M C;  1K83 K;  4OIQ A;  4BBS K;  1I50 K;  4AYB D;  4A3M K;  3S16 K;  1IW7 A;  2A6H A;  1TWC C;  3RZD C;  3H3V L;  4OIR A;  4X6A C;  4YFN A;  1TWC K;  4C3J K;  3RZD K;  4A3K C;  2JA5 C;  4BY7 C;  4A3G C;  2PMZ L;  2JA5 K;  4BY7 K;  4A3K K;  4GZY A;  4A3G K;  5IP7 C;  3I4N C;  5IYB C;  4Y52 C;  3HOX C;  5FJ8 K;  5IP7 K;  4YFK A;  3S14 C;  3EQL A;  4OIO A;  5IYB K;  3DXJ A;  4BBR K;  4QJV B;  5C3E C;  3S14 K;  3GTQ C;  4Y52 K;  2R92 C;  4BY1 C;  1WCM C;  3GTQ K;  2CW0 A;  2WAQ L;  4BY1 K;  2O5I A;  1WCM K;  2R92 K;  2VUM C;  5IP9 C;  2BE5 A;  2A69 A;  2VUM K;  4AYB L;  5IP9 K;  4MQ9 A;  4OIN A;  3S1M C;  2PPB A;  4A3I C;  2B63 C;  5C4J C;  2A68 A;  2JA8 K;  4QIW D;  4Q5S A;  1K83 C;  5D4D A;  3S1M K;  5C4X C;  2B63 K;  5C4X K;  5C4J K;  3S16 C;  5IYC C;  2YU9 C;  4JK1 A;  4KN4 A;  5IYC K;  2YU9 K;  5FLM C;  5FLM K;  5TMF A;  5M3M K;  3HOU C;  4A3J C;  3S2D K;  4Y7N C;  3HOU K;  4BBR C;  4A3J K;  2E2J C;  4XLP A;  4Y7N K;  1XPP A;  1TWH C;  2E2J K;  1I3Q C;  4MEY A;  4C3H K;  4QIW L;  3H0G C;  1TWH K;  1I3Q K;  3M3Y C;  2Y0S D;  3H0G K;  1I6V A;  2PA8 D;  3M3Y K;  4Q4Z A;  2JA8 C;  3PO2 C;  1TWA C;  4C2M K;  3S15 C;  2A6E A;  3PO2 K;  1TWA K;  3S15 K;  4A3C K;  3S1N C;  4LK0 A;  4G7Z A;  3S1N K;  1TWF C;  1YNJ A;  5M5W K;  4BXX C;  1TWF K;  2NVY C;  4A3F K;  4BXX K;  1Y1W K;  4XSZ A;  4XLN A;  2NVY K;  3S2D C;  2O5J A;  1TWG C;  3I4M C;  3GTP C;  1HQM A;  1TWG K;  3I4M K;  2Y0S L;  3HKZ D;  2WB1 D;  2R7Z C;  4NOI A;  3PO3 C;  2JA7 C;  3GTM C;  3GTP K;  4OIP A;  1SMY A;  2R7Z K;  4LLG A;  5M3F K;  3K7A C;  4YFX A;  4LK1 A;  2JA7 K;  3GTM K;  3RZO K;  3PO3 K;  4A3D C;  4ZH4 A;  1I6H K;  3K7A K;  4A3D K;  2NVQ C;  1SFO C;  5IYD C;  2E2I C;  3S2H C;  2NVX C;  2NVQ K;  3GTK C;  1SFO K;  3HOZ K;  3CQZ C;  2E2I K;  3GTO C;  4QJV A;  5M5X K;  2NVX K;  3GTK K;  3S2H K;  5IYD K;  3M4O C;  3CQZ K;  3HOY C;  2JA6 C;  3GTO K;  4A93 C;  4A3C C;  3M4O K;  2NVT C;  3HOY K;  2JA6 K;  3WOD A;  4A93 K;  5C44 C;  4G7H A;  3S1Q C;  2NVT K;  4A3L C;  3HOW C;  5C44 K;  4X6A K;  3S1Q K;  4A3L K;  4A3F C;  3HOW K;  1BDF A;  1Y1W C;  3HKZ L;  2WB1 L;  3H3V D;  3I4N K;  4KN7 A;  1I6H C;  3HOX K;  3S1R C;  4LJZ A;  4A3E C;  5TMC A;  3GTG C;  4A3B C;  3FKI C;  2PMZ D;  5C3E K;  3S1R K;  2E2H C;  4A3B K;  4KMU A;  2PA8 L;  4YG2 A;  4A3E K;  1R9T C;  3FKI K;  3GTJ C;  3GTG K;  3RZO C;  2E2H K;  3S17 C;  4MEX A;  2R93 C;  3HOV C;  1Y1V C;  1YNN A;  3GTJ K;  1R9T K;  3S17 K;  2R93 K;  3HOV K;  1Y1V K; 
#chains in the Genus database with same CATH topology
 3MML B;  5JFE A;  1I50 C;  4OIQ A;  4C3J C;  1O2A A;  1TWC C;  3RZD C;  4X6A C;  1G51 A;  4BY7 C;  4A3G C;  2JA5 K;  4A3K K;  4GZY A;  3A8J A;  1IE0 A;  3HOX C;  4YFK A;  5IYB K;  4LQY A;  3GTQ K;  2R92 K;  1EK8 A;  2VUM K;  3JST A;  2B63 C;  1XZP A;  3S1M K;  5C4X K;  1F93 A;  2YU9 K;  1DCH A;  5FLM K;  1JOE A;  4P9S A;  4G0W A;  2CFA B;  4GFQ A;  3HOU K;  4BBR C;  2E2J C;  2YU9 A;  5EGE A;  1XPP A;  2GSU A;  1I3Q C;  2P5M A;  2NVY A;  3M3Y C;  4J3N A;  4KB2 A;  1ZVU A;  3PO2 C;  3G4C A;  2FQO A;  1B4B A;  1WQH A;  3TFJ A;  1TWF K;  2NVX A;  1O26 A;  4XLN A;  2D6F C;  3BP3 A;  3GEH A;  2O5J A;  3GEE A;  2JA6 A;  1PJ7 A;  1INN A;  4NOI A;  5L46 A;  3GTP K;  2JH3 A;  1RU0 A;  4WJ4 A;  3K7A C;  4YFX A;  2JA7 K;  4A3D C;  4KAW X;  2NVQ C;  5IYD C;  1SFO K;  3S2H K;  1EFW A;  3GTO C;  2GSN A;  3Q3Q A;  3FKI A;  3OEP A;  3HOY K;  2Y3P A;  3GTJ A;  4A3L C;  5IOR A;  5CJ9 A;  4KC6 A;  5C44 K;  4X6A K;  3N0C A;  3HOW K;  1Y1W C;  1WOO A;  3FOE A;  3ORE A;  3N3Y A;  3HOX K;  1J6V A;  4LJZ A;  3S1R C;  1XXB A;  4A3B C;  2PMZ D;  1I6H K;  4BKW A;  3GTG K;  2E2H K;  1Y1V C;  4C3I C;  3S17 K;  2R93 K;  3HOV K;  2V6T A;  4O2D A;  5M5Y K;  3GTL K;  2PHC B;  1USO A;  2GSO A;  4BBS K;  4AYB D;  4A3M K;  3V4G A;  2E2H A;  4G0V A;  1USM A;  1ISE A;  2ZUE A;  2PMZ L;  1O27 A;  1UV7 A;  4GTB A;  3I4N C;  4Y52 C;  5IP7 K;  3S14 C;  3QX3 A;  4BBR K;  3GEI A;  3FHZ A;  4BY1 C;  1WCM C;  2BE5 A;  1PJ6 A;  4AYB L;  5IP9 K;  4G0U A;  4OIN A;  4KDD A;  4Q5S A;  2A68 A;  4QIW D;  1K83 C;  5IOT A;  5D4D A;  1C0A A;  5C4J K;  1AB4 A;  1WQF A;  3AD7 C;  4JK1 A;  1XXC A;  1WQG A;  5IYC K;  1I3Q A;  1ZXO A;  2V6S A;  1J98 A;  4XCH A;  1YCL A;  4A3J C;  2FQT A;  4Y7N K;  4C3H C;  2V6U A;  3AQP A;  4QIW L;  3H0G C;  1TWH K;  4KAR A;  1J6X A;  2PA8 D;  4Q4Z A;  1TWA C;  3G4A A;  4C2M K;  4KAS A;  3S15 C;  2A6E A;  3BUE A;  1EQR A;  4LK0 A;  1IBA A;  4G7Z A;  3S1N K;  4GTE A;  1TWH A;  3LAJ A;  1VH2 A;  1ZBS A;  1WOR A;  4BXX K;  1Y1W K;  2GAH C;  2NVY K;  4BLB A;  3GTO A;  2RH6 A;  3S2D C;  1TWG C;  4KMD A;  3I4M C;  1HQM A;  3HKZ D;  3PO3 C;  4GT9 A;  2R7Z K;  3GDZ A;  1JVI A;  3GTM K;  4ZH4 A;  1Y1W A;  1DCP A;  2CFA A;  2E2I C;  3GTK C;  3A8K A;  3CQZ C;  4QJV A;  5M5X K;  2NVX K;  1B4A A;  4A3C C;  3M4O K;  4A93 K;  2R7Z A;  2JA6 K;  3GTM A;  3S1Q C;  3T00 A;  2NVT K;  3N0B A;  1IS1 A;  4A3F C;  1XZQ A;  3HKZ L;  3TFH A;  3H3V D;  1O24 A;  3I4N K;  4KN7 A;  2ZFZ A;  4KMU A;  4A3E K;  3RZO C;  1F7V A;  1R9T C;  3FKI K;  4GTF A;  3GTJ K;  3T02 A;  1BS2 A;  3HOZ C;  1ZYR A;  2WAQ D;  1K83 K;  1I50 K;  1IW7 A;  1J6W A;  1WCM A;  2A6H A;  3H3V L;  4OIR A;  5JVO A;  4YFN A;  1TWC K;  4C3J K;  3RZD K;  4A3K C;  2JA5 C;  4BY7 K;  1ZQ1 C;  4A3G K;  1O2B A;  4KMH A;  5IYB C;  3AH5 A;  1K83 A;  5FJ8 K;  1I50 A;  1XXA A;  4OIO A;  5C3E C;  3DXJ A;  3GTQ C;  2R92 C;  1TWC A;  2WAQ L;  2O5I A;  2VUM C;  2KWA A;  4PAB A;  3IPJ A;  3S1M C;  2PPB A;  4A3I C;  5C4X C;  1KQ4 A;  4ILD A;  2B63 K;  1WIH A;  2YU9 C;  3S16 C;  3SZZ A;  5FLM C;  3H0G A;  5EGH A;  5CHP A;  5TMF A;  3ERE D;  2XCO A;  3HOU C;  3S2D K;  2B63 A;  4XLP A;  4RMF A;  3TFI A;  2E2J K;  4MEY A;  4GTD A;  1I3Q K;  1F7U A;  1I6V A;  5HL8 A;  3M3Y K;  1TWG A;  3A8I A;  2JA8 C;  4KMA A;  1O2F B;  2ZUF A;  3PO2 K;  3FOF A;  4A3C K;  4DDQ A;  1TWF C;  3OPF A;  1GE9 A;  4BLA A;  5IOS A;  4A3F K;  2GAG C;  3GTK A;  4XSZ A;  3CQZ A;  3LAP A;  1DCO A;  3GTP C;  2WB1 D;  2JA7 C;  1WSR A;  4LLG A;  3RZO K;  4WIL A;  3K7A K;  4A3D K;  4FZB A;  1SFO C;  3S2H C;  2NVQ K;  1V5V A;  3HOZ K;  3LPX A;  5IYD K;  1O28 A;  2RGR A;  1IL2 A;  3HOY C;  3GTO K;  3S0X A;  4P5A A;  1R9T A;  5C44 C;  4P5B A;  3HOW C;  2EBB A;  4A3L K;  3ADA C;  2P8T A;  2WB1 L;  1X31 C;  5IOQ A;  1BJT A;  1EI6 A;  4LOW A;  4WJ3 M;  4GTL A;  1I6H C;  1IQ0 A;  4KAT A;  5TMC A;  3GTG C;  5C3E K;  3S1R K;  2E2H C;  4A3B K;  2PA8 L;  4C45 A;  1XZP B;  4MEX A;  3S17 C;  3HOV C;  1YNN A;  2R93 C;  2JA5 A;  3BP8 C;  1Y1V K;  3T01 A;  4C3I K;  3GTL C;  4XSX A;  1O25 A;  4BBS C;  4A3I K;  4G7O A;  4A3M C;  1L0W A;  1YX2 A;  3GTQ A;  2R92 A;  3S16 K;  2VUM A;  1WOS A;  1Y1V A;  4AH6 A;  3SZY A;  1EH1 A;  5IP7 C;  3CAG A;  1PJ5 A;  4KB4 A;  3EQL A;  4Y52 K;  4QJV B;  3S14 K;  1JQW A;  2CW0 A;  4BY1 K;  1F9N A;  1WCM K;  3GSI A;  5IP9 C;  2A69 A;  4MQ9 A;  1XZQ B;  4LR2 A;  5C4J C;  2JA8 K;  4KM9 A;  5IYC C;  4KN4 A;  1O29 A;  1HI9 A;  5M3M K;  1VGX A;  3L4K A;  3TTG A;  4Y7N C;  4A3J K;  3AD8 C;  1TWF A;  1TWH C;  4C3H K;  1VRQ C;  4GTA A;  2Y0S D;  3H0G K;  4C2M C;  1WOP A;  4KM8 A;  3GTP A;  1TWA K;  3S15 K;  2JA7 A;  3S1N C;  1VJE A;  4FM9 A;  5TJ3 A;  5M5W K;  1YNJ A;  4BXX C;  1SFO A;  2NVY C;  4M1X A;  2W7V A;  1TWA A;  3AQO A;  1TWG K;  3L4J A;  3I4M K;  2Y0S L;  3HXA A;  1WSV A;  3GIR A;  2R7Z C;  3GTM C;  4OIP A;  1SMY A;  5M3F K;  5E68 A;  3PO3 K;  4LK1 A;  4PAA A;  2XCR B;  2NVX C;  2E2I K;  3GTK K;  3NUH A;  3CQZ K;  3M4O C;  2JA6 C;  4A93 C;  3GTG A;  2NVT C;  3WOD A;  4G7H A;  2R93 A;  3S1Q K;  3VA7 A;  3AD9 C;  1BDF A;  1BGW A;  3GTL A;  2E2I A;  4A3E C;  3FKI C;  4YG2 A;  4GTC A;  3GTJ C;  1R9T K;  1VLO A;  1DD5 A;  2XCQ A; 
#chains in the Genus database with same CATH homology
 4C3I K;  3GTL C;  3HOZ C;  5M5Y K;  4XSX A;  3GTL K;  1ZYR A;  4BBS C;  1I50 C;  2WAQ D;  4A3I K;  4G7O A;  4A3M C;  1K83 K;  4OIQ A;  4BBS K;  1I50 K;  4AYB D;  4A3M K;  3S16 K;  1IW7 A;  2A6H A;  1TWC C;  3RZD C;  3H3V L;  4OIR A;  4X6A C;  4YFN A;  1TWC K;  4C3J K;  3RZD K;  4A3K C;  2JA5 C;  4BY7 C;  4A3G C;  2PMZ L;  2JA5 K;  4BY7 K;  4A3K K;  4GZY A;  4A3G K;  5IP7 C;  3I4N C;  5IYB C;  4Y52 C;  3HOX C;  5FJ8 K;  5IP7 K;  4YFK A;  3S14 C;  3EQL A;  4OIO A;  5IYB K;  3DXJ A;  4BBR K;  4QJV B;  5C3E C;  3S14 K;  3GTQ C;  4Y52 K;  2R92 C;  4BY1 C;  1WCM C;  3GTQ K;  2CW0 A;  2WAQ L;  4BY1 K;  2O5I A;  1WCM K;  2R92 K;  2VUM C;  5IP9 C;  2BE5 A;  2A69 A;  2VUM K;  4AYB L;  5IP9 K;  4MQ9 A;  4OIN A;  3S1M C;  2PPB A;  4A3I C;  2B63 C;  5C4J C;  2A68 A;  2JA8 K;  4QIW D;  4Q5S A;  1K83 C;  5D4D A;  3S1M K;  5C4X C;  2B63 K;  5C4X K;  5C4J K;  3S16 C;  5IYC C;  2YU9 C;  4JK1 A;  4KN4 A;  5IYC K;  2YU9 K;  5FLM C;  5FLM K;  5TMF A;  5M3M K;  3HOU C;  4A3J C;  3S2D K;  4Y7N C;  3HOU K;  4BBR C;  4A3J K;  2E2J C;  4XLP A;  4Y7N K;  1XPP A;  1TWH C;  2E2J K;  1I3Q C;  4MEY A;  4C3H K;  4QIW L;  3H0G C;  1TWH K;  1I3Q K;  3M3Y C;  2Y0S D;  3H0G K;  1I6V A;  2PA8 D;  3M3Y K;  4Q4Z A;  2JA8 C;  3PO2 C;  1TWA C;  4C2M K;  3S15 C;  2A6E A;  3PO2 K;  1TWA K;  3S15 K;  4A3C K;  3S1N C;  4LK0 A;  4G7Z A;  3S1N K;  1TWF C;  1YNJ A;  5M5W K;  4BXX C;  1TWF K;  2NVY C;  4A3F K;  4BXX K;  1Y1W K;  4XSZ A;  4XLN A;  2NVY K;  3S2D C;  2O5J A;  1TWG C;  3I4M C;  3GTP C;  1HQM A;  1TWG K;  3I4M K;  2Y0S L;  3HKZ D;  2WB1 D;  2R7Z C;  4NOI A;  3PO3 C;  2JA7 C;  3GTM C;  3GTP K;  4OIP A;  1SMY A;  2R7Z K;  4LLG A;  5M3F K;  3K7A C;  4YFX A;  4LK1 A;  2JA7 K;  3GTM K;  3RZO K;  3PO3 K;  4A3D C;  4ZH4 A;  1I6H K;  3K7A K;  4A3D K;  2NVQ C;  1SFO C;  5IYD C;  2E2I C;  3S2H C;  2NVX C;  2NVQ K;  3GTK C;  1SFO K;  3HOZ K;  3CQZ C;  2E2I K;  3GTO C;  4QJV A;  5M5X K;  2NVX K;  3GTK K;  3S2H K;  5IYD K;  3M4O C;  3CQZ K;  3HOY C;  2JA6 C;  3GTO K;  4A93 C;  4A3C C;  3M4O K;  2NVT C;  3HOY K;  2JA6 K;  3WOD A;  4A93 K;  5C44 C;  4G7H A;  3S1Q C;  2NVT K;  4A3L C;  3HOW C;  5C44 K;  4X6A K;  3S1Q K;  4A3L K;  4A3F C;  3HOW K;  1BDF A;  1Y1W C;  3HKZ L;  2WB1 L;  3H3V D;  3I4N K;  4KN7 A;  1I6H C;  3HOX K;  3S1R C;  4LJZ A;  4A3E C;  5TMC A;  3GTG C;  4A3B C;  3FKI C;  2PMZ D;  5C3E K;  3S1R K;  2E2H C;  4A3B K;  4KMU A;  2PA8 L;  4YG2 A;  4A3E K;  1R9T C;  3FKI K;  3GTJ C;  3GTG K;  3RZO C;  2E2H K;  3S17 C;  4MEX A;  2R93 C;  3HOV C;  1Y1V C;  1YNN A;  3GTJ K;  1R9T K;  3S17 K;  2R93 K;  3HOV K;  1Y1V K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...