2B63K

Complete rna polymerase ii-rna inhibitor complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
molecule keywords 31-MER
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2b63K00
5D4DA 2R92C 3HOVC 5IYDK 2JA7C 4OIPA 3S15K 3K7AK 3H3VL 4QIWD 1BDFA 2CW0A 4XSZA 3HOXC 3S1MC 5C44C 3S1QC 5IP9K 1TWAK 5TMCA 3HOYK 2JA6K 2A68A 4C2MK 3S16K 4A3CC 3HOZC 3H0GC 3GTLC 3GTPC 3GTMK 2JA8K 4Y7NC 3H3VD 3GTKK 4A3BK 3PO2C 5FLMC 4A3IK 3EQLA 2YU9C 5IYCK 3GTOC 2R7ZK 3S16C 4A3JC 1K83K 4OIRA 3HKZD 1Y1VC 3GTGC 2NVXC 4BY1K 3PO3C 2PA8D 4C3HK 2R93C 4QIWL 5M3MK 4A3MC 2VUMC 1TWFK 3CQZK 3GTQC 4G7HA 2PMZL 2NVTK 3HOUK 1TWGC 2E2IC 3RZOC 4A3DK 2A6HA 4JK1A 2E2IK 4XSXA 3RZOK 3GTQK 4A3EK 2E2JC 4Y52C 4BBRK 1Y1WC 3PO3K 4BY1C 4Q5SA 2NVQK 2E2JK 5M5XK 5IYBK 1K83C 4GZYA 1I3QC 4A3DC 4A93K 2YU9K 3HOUC 3PO2K 5IYBC 1TWFC 5C3EC 4Y7NK 4YFNA 3GTMC 2WAQD 3FKIC 4OINA 3FKIK 4BBRC 1Y1WK 3GTGK 4LJZA 4Y52K 1Y1VK 2O5JA 5C3EK 4G7ZA 5M5WK 4AYBL 2A69A 5IP9C 4A3JK 4A93C 4YG2A 5IYCC 1TWGK 1I3QK 2NVTC 3CQZC 2NVQC 2JA8C 3GTLK 2WAQL 2JA7K 3HOZK 2NVXK 4XLPA 3HOVK 2WB1L 4A3EC 4MEXA 4MQ9A 1XPPA 5C44K 2R7ZC 3GTOK 3S1QK 4BXXK 3HOXK 4X6AK 3GTKC 4MEYA 5M5YK 4BY7C 4A3MK 2VUMK 2R93K 3GTPK 4A3FC 3H0GK 1SMYA 1TWCK 4A3GC 1I6HC 4ZH4A 2O5IA 1SFOK 4KN4A 2PMZD 5FLMK 2Y0SD 4A3IC 3S1MK 4A3BC 5TMFA 2PA8L 4QJVB 1TWHC 1YNJA 3S17K 2PPBA 2E2HC 2JA5C 1WCMK 3DXJA 4OIOA 4YFXA 4Q4ZA 4NOIA 5M3FK 2JA6C 1TWAC 1YNNA 3HOWC 3HOYC 4C3JK 4YFKA 4G7OA 2WB1D 5FJ8K 4BBSK 4A3KC 3S14C 4A3LK 2B63C 3S2HC 3K7AC 2B63K 3S2HK 4A3CK 4C3IK 3M3YK 3S14K 5IP7C 5C4JC 3S1RC 5IYDC 2R92K 1I50K 3HKZL 2NVYK 4OIQA 4KMUA 3S1NK 3M4OC 4LK1A 3I4NK 3I4NC 3HOWK 2BE5A 2NVYC 1WCMC 3M4OK 3S1NC 3RZDK 4LLGA 3S17C 1HQMA 3GTJC 3I4MK 3S2DK 1I6VA 4A3LC 3I4MC 2Y0SL 3RZDC 1ZYRA 1SFOC 1I6HK 5C4XK 1TWCC 1R9TK 3WODA 4A3GK 4QJVA 1IW7A 1R9TC 5C4XC 1I50C 2E2HK 2JA5K 3S15C 5IP7K 5C4JK 4A3FK 3S1RK 3M3YC 1TWHK 4KN7A 3GTJK 3S2DC 4A3KK 4BY7K 4LK0A 4BXXC 4X6AC 4BBSC 2A6EA 4XLNA 4AYBD
chains in the Genus database with same CATH superfamily
4BLAA 1EI6A 5D4DA 2JH3A 3HOVC 1XXAA 3Q3QA 3HOXC 1TWAK 2GSNA 3G4AA 4A3CC 3H0GC 2XCOA 3GTPA 4A3IK 1BJTA 2R7ZK 1O2FB 1TWFA 4A3JC 4KMAA 1WOSA 3GTMA 3HKZD 1WIHA 3GTGC 1INNA 3GTQA 2E2IC 3N3YA 3RZOK 4A3EK 1ZVUA 4Y52C 3PO3K 4Q5SA 2B63A 2GAGC 5IYBK 1JVIA 4A93K 3T01A 5JVOA 1EH1A 2XCQA 3T02A 3GTMC 2WAQD 1O29A 3GTGK 4LJZA 1Y1VK 2O5JA 5C3EK 4G7ZA 1PJ5A 4AYBL 4A3JK 1IBAA 2NVTC 2E2HA 4GTDA 2JA7K 3HOZK 4XLPA 1RU0A 2GSOA 3S1QK 1IS1A 1DCOA 3VA7A 3GTLA 3GTKC 5TJ3A 4C3HC 2R93K 4GT9A 1G51A 3ADAC 4C2MC 3BUEA 1SMYA 1B4BA 1TWCK 5JFEA 1I6HC 2O5IA 1SFOK 5CJ9A 1TWHC 3CQZA 3S17K 2JA5C 4Q4ZA 3DXJA 5IOSA 3HOWC 2FQOA 4G7OA 2WB1D 3JSTA 3S14K 1XZQB 5IP7C 5C4JC 4GTAA 3M4OC 2ZUEA 3FHZA 3G4CA 4LK1A 3I4NK 3I4NC 4KMDA 3HOWK 2BE5A 3M4OK 1WORA 4LLGA 3S17C 3I4MK 3GTJC 3S2DK 1I6VA 1VGXA 4FZBA 4LR2A 1TWCC 4QJVA 1IW7A 1R9TC 2P8TA 5IORA 2NVXA 1TWHK 1F9NA 1R9TA 4BY7K 4LK0A 3FKIA 4X6AC 4BBSC 4XLNA 4AYBD 3GEIA 4P9SA 2R92C 2JA7C 3K7AK 1BGWA 3S1MC 3S1QC 4PAAA 2JA6K 2A68A 3S16K 3HOZC 3GTPC 1B4AA 3H3VD 4A3BK 3N0BA 3GTOC 5HL8A 1K83K 3QX3A 3TTGA 1Y1VC 1L0WA 2R92A 4QIWL 3BP3A 3N0CA 1J6VA 5M3MK 4A3MC 3CQZK 3CAGA 1XZPB 2A6HA 4JK1A 2E2IK 2E2JC 1WSRA 3A8KA 3T00A 2V6TA 2NVQK 5M5XK 1YX2A 4P5AA 1K83C 2RGRA 4A3DC 3MMLB 3SZZA 3NUHA 1J98A 3S0XA 4ILDA 1Y1WK 4GTEA 2YU9A 3GEHA 5IYCC 1TWGK 1I3QK 5L46A 4LQYA 3BP8C 2NVQC 2JA5A 3GTLK 2WAQL 1BS2A 2WB1L 4GTFA 4MEXA 3H0GA 2CFAB 3V4GA 4X6AK 3HOXK 4MEYA 4BY7C 4A3MK 4KM8A 1WQHA 1J6XA 1WQFA 5FLMK 2KWAA 4A3BC 2Y3PA 1YNJA 3SZYA 4GTBA 2E2HC 3S15K 1WCMK 3S16C 4GFQA 4OIOA 1O2AA 4YFKA 2R7ZA 3AQOA 1K83A 4A3KC 3S14C 5IOTA 3K7AC 3S1RC 4KDDA 2R92K 1I50K 4OIQA 1X31C 3OEPA 4KMHA 2NVYC 3S1NC 1O26A 1YCLA 1HQMA 3LAJA 4DDQA 2W7VA 1EQRA 3RZDC 1SFOC 1TWHA 1I6HK 1R9TK 3LAPA 1I50C 3S1RK 4A3FK 3HXAA 5E68A 4KN7A 1O27A 4A3KK 1O25A 4GTCA 3IPJA 4J3NA 1O24A 3GTOA 3GSIA 2JA6A 2ZUFA 4QIWD 1J6WA 1BDFA 4XSZA 1WQGA 4PABA 5C44C 3A8JA 3TFIA 5TMCA 4FM9A 3GTMK 4P5BA 5FLMC 4G0WA 4OIRA 2NVXC 4BY1K 3PO3C 2NVYA 2RH6A 2PMZL 3RZOC 1JOEA 1USOA 2EBBA 4M1XA 3GTQK 1ZXOA 4KAWX 4BBRK 3AD9C 4GTLA 3L4KA 1IQ0A 1I3QC 1Y1WA 3HOUC 4WILA 3PO2K 4C45A 1TWFC 1USMA 4YFNA 4BBRC 2JA7A 2PHCB 4A93C 2XCRB 1PJ7A 1V5VA 2FQTA 2GAHC 3CQZC 3OREA 5IOQA 1GE9A 2JA8C 1EFWA 2NVXK 3HOVK 1C0AA 1XPPA 3GTOK 4AH6A 3GTKA 3GIRA 4WJ3M 4A3GC 2VUMA 3AQPA 4KN4A 5CHPA 2PA8L 4YFXA 2JA6C 4BLBA 1TWAC 4C3JK 4BBSK 4KB2A 4A3LK 2B63C 3S2HC 1EK8A 2V6SA 2B63K 1ZBSA 4C3IK 3S2HK 1DD5A 3S1NK 3HKZL 4WJ4A 4KMUA 5EGHA 4C3JC 1AB4A 4G0UA 3RZDK 4KARA 1Y1VA 4A3LC 1O28A 2Y0SL 1ZYRA 4A3GK 5C4XC 1WOOA 1ZQ1C 3AD8C 2E2HK 3S15C 5IP7K 5C4JK 4KM9A 3AH5A 3GTJK 3S2DC 4BXXC 2A6EA 1JQWA 5M3FK 2R93A 5IYDK 4OIPA 3H3VL 2CW0A 5IP9K 1SFOA 3HOYK 1VJEA 4G0VA 4C2MK 3GTLC 2JA8K 4Y7NC 3GTKK 1F7VA 3PO2C 2YU9C 3EQLA 5IYCK 3AD7C 1F7UA 2E2IA 2PA8D 4C3HK 2R93C 2VUMC 1TWFK 3GTQC 4G7HA 1XXBA 2NVTK 2GSUA 1TWGC 3HOUK 1WCMA 4A3DK 4XSXA 1F93A 1Y1WC 4BY1C 2E2JK 1IE0A 5EGEA 4GZYA 4LOWA 1IL2A 1I50A 2YU9K 5IYBC 5C3EC 4Y7NK 1DCHA 3FKIC 1UV7A 4OINA 2CFAA 3FKIK 4Y52K 1XXCA 5M5WK 2A69A 5IP9C 4YG2A 3GTGA 4BKWA 2ZFZA 4A3EC 1TWGA 1I3QA 1WSVA 1TWAA 3TFHA 4MQ9A 5C44K 2D6FC 1XZQA 2R7ZC 4BXXK 3GEEA 5M5YK 1DCPA 2VUMK 3GDZA 3GTPK 4A3FC 3H0GK 3OPFA 4ZH4A 2PMZD 3FOEA 1VH2A 2Y0SD 4A3IC 3S1MK 1HI9A 1VRQC 4O2DA 5TMFA 4QJVB 4XCHA 2PPBA 1TWCA 4A3CK 4NOIA 1YNNA 3HOYC 2V6UA 3A8IA 1ISEA 5FJ8K 1XZPA 1WOPA 4C3IC 3M3YK 1VLOA 5IYDC 2NVYK 3ERED 4KC6A 1WCMC 3L4JA 4KB4A 3I4MC 4KATA 4RMFA 5C4XK 3GTJA 3WODA 1PJ6A 4KASA 1KQ4A 1O2BA 2P5MA 3TFJA 2JA5K 3FOFA 3M3YC 3LPXA
chains in the Genus database with same CATH topology
5D4DA 2R92C 3HOVC 5IYDK 2JA7C 4OIPA 3S15K 3K7AK 3H3VL 4QIWD 1BDFA 2CW0A 4XSZA 3HOXC 3S1MC 5C44C 3S1QC 5IP9K 1TWAK 5TMCA 3HOYK 2JA6K 2A68A 4C2MK 3S16K 4A3CC 3HOZC 3H0GC 3GTLC 3GTPC 3GTMK 2JA8K 4Y7NC 3H3VD 3GTKK 4A3BK 3PO2C 5FLMC 4A3IK 3EQLA 2YU9C 5IYCK 3GTOC 2R7ZK 3S16C 4A3JC 1K83K 4OIRA 3HKZD 1Y1VC 3GTGC 2NVXC 4BY1K 3PO3C 2PA8D 4C3HK 2R93C 4QIWL 5M3MK 4A3MC 2VUMC 1TWFK 3CQZK 3GTQC 4G7HA 2PMZL 2NVTK 3HOUK 1TWGC 2E2IC 3RZOC 4A3DK 2A6HA 4JK1A 2E2IK 4XSXA 3RZOK 3GTQK 4A3EK 2E2JC 4Y52C 4BBRK 1Y1WC 3PO3K 4BY1C 4Q5SA 2NVQK 2E2JK 5M5XK 5IYBK 1K83C 4GZYA 1I3QC 4A3DC 4A93K 2YU9K 3HOUC 3PO2K 5IYBC 1TWFC 5C3EC 4Y7NK 4YFNA 3GTMC 2WAQD 3FKIC 4OINA 3FKIK 4BBRC 1Y1WK 3GTGK 4LJZA 4Y52K 1Y1VK 2O5JA 5C3EK 4G7ZA 5M5WK 4AYBL 2A69A 5IP9C 4A3JK 4A93C 4YG2A 5IYCC 1TWGK 1I3QK 2NVTC 3CQZC 2NVQC 2JA8C 3GTLK 2WAQL 2JA7K 3HOZK 2NVXK 4XLPA 3HOVK 2WB1L 4A3EC 4MEXA 4MQ9A 1XPPA 5C44K 2R7ZC 3GTOK 3S1QK 4BXXK 3HOXK 4X6AK 3GTKC 4MEYA 5M5YK 4BY7C 4A3MK 2VUMK 2R93K 3GTPK 4A3FC 3H0GK 1SMYA 1TWCK 4A3GC 1I6HC 4ZH4A 2O5IA 1SFOK 4KN4A 2PMZD 5FLMK 2Y0SD 4A3IC 3S1MK 4A3BC 5TMFA 2PA8L 4QJVB 1TWHC 1YNJA 3S17K 2PPBA 2E2HC 2JA5C 1WCMK 3DXJA 4OIOA 4YFXA 4Q4ZA 4NOIA 5M3FK 2JA6C 1TWAC 1YNNA 3HOWC 3HOYC 4C3JK 4YFKA 4G7OA 2WB1D 5FJ8K 4BBSK 4A3KC 3S14C 4A3LK 2B63C 3S2HC 3K7AC 2B63K 3S2HK 4A3CK 4C3IK 3M3YK 3S14K 5IP7C 5C4JC 3S1RC 5IYDC 2R92K 1I50K 3HKZL 2NVYK 4OIQA 4KMUA 3S1NK 3M4OC 4LK1A 3I4NK 3I4NC 3HOWK 2BE5A 2NVYC 1WCMC 3M4OK 3S1NC 3RZDK 4LLGA 3S17C 1HQMA 3GTJC 3I4MK 3S2DK 1I6VA 4A3LC 3I4MC 2Y0SL 3RZDC 1ZYRA 1SFOC 1I6HK 5C4XK 1TWCC 1R9TK 3WODA 4A3GK 4QJVA 1IW7A 1R9TC 5C4XC 1I50C 2E2HK 2JA5K 3S15C 5IP7K 5C4JK 4A3FK 3S1RK 3M3YC 1TWHK 4KN7A 3GTJK 3S2DC 4A3KK 4BY7K 4LK0A 4BXXC 4X6AC 4BBSC 2A6EA 4XLNA 4AYBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D4D A;  2R92 C;  3HOV C;  5IYD K;  2JA7 C;  4OIP A;  3S15 K;  3K7A K;  3H3V L;  4QIW D;  1BDF A;  2CW0 A;  4XSZ A;  3HOX C;  3S1M C;  5C44 C;  3S1Q C;  5IP9 K;  1TWA K;  5TMC A;  3HOY K;  2JA6 K;  2A68 A;  4C2M K;  3S16 K;  4A3C C;  3HOZ C;  3H0G C;  3GTL C;  3GTP C;  3GTM K;  2JA8 K;  4Y7N C;  3H3V D;  3GTK K;  4A3B K;  3PO2 C;  5FLM C;  4A3I K;  3EQL A;  2YU9 C;  5IYC K;  3GTO C;  2R7Z K;  3S16 C;  4A3J C;  1K83 K;  4OIR A;  3HKZ D;  1Y1V C;  3GTG C;  2NVX C;  4BY1 K;  3PO3 C;  2PA8 D;  4C3H K;  2R93 C;  4QIW L;  5M3M K;  4A3M C;  2VUM C;  1TWF K;  3CQZ K;  3GTQ C;  4G7H A;  2PMZ L;  2NVT K;  3HOU K;  1TWG C;  2E2I C;  3RZO C;  4A3D K;  2A6H A;  4JK1 A;  2E2I K;  4XSX A;  3RZO K;  3GTQ K;  4A3E K;  2E2J C;  4Y52 C;  4BBR K;  1Y1W C;  3PO3 K;  4BY1 C;  4Q5S A;  2NVQ K;  2E2J K;  5M5X K;  5IYB K;  1K83 C;  4GZY A;  1I3Q C;  4A3D C;  4A93 K;  2YU9 K;  3HOU C;  3PO2 K;  5IYB C;  1TWF C;  5C3E C;  4Y7N K;  4YFN A;  3GTM C;  2WAQ D;  3FKI C;  4OIN A;  3FKI K;  4BBR C;  1Y1W K;  3GTG K;  4LJZ A;  4Y52 K;  1Y1V K;  2O5J A;  5C3E K;  4G7Z A;  5M5W K;  4AYB L;  2A69 A;  5IP9 C;  4A3J K;  4A93 C;  4YG2 A;  5IYC C;  1TWG K;  1I3Q K;  2NVT C;  3CQZ C;  2NVQ C;  2JA8 C;  3GTL K;  2WAQ L;  2JA7 K;  3HOZ K;  2NVX K;  4XLP A;  3HOV K;  2WB1 L;  4A3E C;  4MEX A;  4MQ9 A;  1XPP A;  5C44 K;  2R7Z C;  3GTO K;  3S1Q K;  4BXX K;  3HOX K;  4X6A K;  3GTK C;  4MEY A;  5M5Y K;  4BY7 C;  4A3M K;  2VUM K;  2R93 K;  3GTP K;  4A3F C;  3H0G K;  1SMY A;  1TWC K;  4A3G C;  1I6H C;  4ZH4 A;  2O5I A;  1SFO K;  4KN4 A;  2PMZ D;  5FLM K;  2Y0S D;  4A3I C;  3S1M K;  4A3B C;  5TMF A;  2PA8 L;  4QJV B;  1TWH C;  1YNJ A;  3S17 K;  2PPB A;  2E2H C;  2JA5 C;  1WCM K;  3DXJ A;  4OIO A;  4YFX A;  4Q4Z A;  4NOI A;  5M3F K;  2JA6 C;  1TWA C;  1YNN A;  3HOW C;  3HOY C;  4C3J K;  4YFK A;  4G7O A;  2WB1 D;  5FJ8 K;  4BBS K;  4A3K C;  3S14 C;  4A3L K;  2B63 C;  3S2H C;  3K7A C;  2B63 K;  3S2H K;  4A3C K;  4C3I K;  3M3Y K;  3S14 K;  5IP7 C;  5C4J C;  3S1R C;  5IYD C;  2R92 K;  1I50 K;  3HKZ L;  2NVY K;  4OIQ A;  4KMU A;  3S1N K;  3M4O C;  4LK1 A;  3I4N K;  3I4N C;  3HOW K;  2BE5 A;  2NVY C;  1WCM C;  3M4O K;  3S1N C;  3RZD K;  4LLG A;  3S17 C;  1HQM A;  3GTJ C;  3I4M K;  3S2D K;  1I6V A;  4A3L C;  3I4M C;  2Y0S L;  3RZD C;  1ZYR A;  1SFO C;  1I6H K;  5C4X K;  1TWC C;  1R9T K;  3WOD A;  4A3G K;  4QJV A;  1IW7 A;  1R9T C;  5C4X C;  1I50 C;  2E2H K;  2JA5 K;  3S15 C;  5IP7 K;  5C4J K;  4A3F K;  3S1R K;  3M3Y C;  1TWH K;  4KN7 A;  3GTJ K;  3S2D C;  4A3K K;  4BY7 K;  4LK0 A;  4BXX C;  4X6A C;  4BBS C;  2A6E A;  4XLN A;  4AYB D; 
#chains in the Genus database with same CATH topology
 4BLA A;  1EI6 A;  5D4D A;  2JH3 A;  3HOV C;  1XXA A;  3Q3Q A;  3HOX C;  1TWA K;  2GSN A;  3G4A A;  4A3C C;  3H0G C;  2XCO A;  3GTP A;  4A3I K;  1BJT A;  2R7Z K;  1O2F B;  1TWF A;  4A3J C;  4KMA A;  1WOS A;  3GTM A;  3HKZ D;  1WIH A;  3GTG C;  1INN A;  3GTQ A;  2E2I C;  3N3Y A;  3RZO K;  4A3E K;  1ZVU A;  4Y52 C;  3PO3 K;  4Q5S A;  2B63 A;  2GAG C;  5IYB K;  1JVI A;  4A93 K;  3T01 A;  5JVO A;  1EH1 A;  2XCQ A;  3T02 A;  3GTM C;  2WAQ D;  1O29 A;  3GTG K;  4LJZ A;  1Y1V K;  2O5J A;  5C3E K;  4G7Z A;  1PJ5 A;  4AYB L;  4A3J K;  1IBA A;  2NVT C;  2E2H A;  4GTD A;  2JA7 K;  3HOZ K;  4XLP A;  1RU0 A;  2GSO A;  3S1Q K;  1IS1 A;  1DCO A;  3VA7 A;  3GTL A;  3GTK C;  5TJ3 A;  4C3H C;  2R93 K;  4GT9 A;  1G51 A;  3ADA C;  4C2M C;  3BUE A;  1SMY A;  1B4B A;  1TWC K;  5JFE A;  1I6H C;  2O5I A;  1SFO K;  5CJ9 A;  1TWH C;  3CQZ A;  3S17 K;  2JA5 C;  4Q4Z A;  3DXJ A;  5IOS A;  3HOW C;  2FQO A;  4G7O A;  2WB1 D;  3JST A;  3S14 K;  1XZQ B;  5IP7 C;  5C4J C;  4GTA A;  3M4O C;  2ZUE A;  3FHZ A;  3G4C A;  4LK1 A;  3I4N K;  3I4N C;  4KMD A;  3HOW K;  2BE5 A;  3M4O K;  1WOR A;  4LLG A;  3S17 C;  3I4M K;  3GTJ C;  3S2D K;  1I6V A;  1VGX A;  4FZB A;  4LR2 A;  1TWC C;  4QJV A;  1IW7 A;  1R9T C;  2P8T A;  5IOR A;  2NVX A;  1TWH K;  1F9N A;  1R9T A;  4BY7 K;  4LK0 A;  3FKI A;  4X6A C;  4BBS C;  4XLN A;  4AYB D;  3GEI A;  4P9S A;  2R92 C;  2JA7 C;  3K7A K;  1BGW A;  3S1M C;  3S1Q C;  4PAA A;  2JA6 K;  2A68 A;  3S16 K;  3HOZ C;  3GTP C;  1B4A A;  3H3V D;  4A3B K;  3N0B A;  3GTO C;  5HL8 A;  1K83 K;  3QX3 A;  3TTG A;  1Y1V C;  1L0W A;  2R92 A;  4QIW L;  3BP3 A;  3N0C A;  1J6V A;  5M3M K;  4A3M C;  3CQZ K;  3CAG A;  1XZP B;  2A6H A;  4JK1 A;  2E2I K;  2E2J C;  1WSR A;  3A8K A;  3T00 A;  2V6T A;  2NVQ K;  5M5X K;  1YX2 A;  4P5A A;  1K83 C;  2RGR A;  4A3D C;  3MML B;  3SZZ A;  3NUH A;  1J98 A;  3S0X A;  4ILD A;  1Y1W K;  4GTE A;  2YU9 A;  3GEH A;  5IYC C;  1TWG K;  1I3Q K;  5L46 A;  4LQY A;  3BP8 C;  2NVQ C;  2JA5 A;  3GTL K;  2WAQ L;  1BS2 A;  2WB1 L;  4GTF A;  4MEX A;  3H0G A;  2CFA B;  3V4G A;  4X6A K;  3HOX K;  4MEY A;  4BY7 C;  4A3M K;  4KM8 A;  1WQH A;  1J6X A;  1WQF A;  5FLM K;  2KWA A;  4A3B C;  2Y3P A;  1YNJ A;  3SZY A;  4GTB A;  2E2H C;  3S15 K;  1WCM K;  3S16 C;  4GFQ A;  4OIO A;  1O2A A;  4YFK A;  2R7Z A;  3AQO A;  1K83 A;  4A3K C;  3S14 C;  5IOT A;  3K7A C;  3S1R C;  4KDD A;  2R92 K;  1I50 K;  4OIQ A;  1X31 C;  3OEP A;  4KMH A;  2NVY C;  3S1N C;  1O26 A;  1YCL A;  1HQM A;  3LAJ A;  4DDQ A;  2W7V A;  1EQR A;  3RZD C;  1SFO C;  1TWH A;  1I6H K;  1R9T K;  3LAP A;  1I50 C;  3S1R K;  4A3F K;  3HXA A;  5E68 A;  4KN7 A;  1O27 A;  4A3K K;  1O25 A;  4GTC A;  3IPJ A;  4J3N A;  1O24 A;  3GTO A;  3GSI A;  2JA6 A;  2ZUF A;  4QIW D;  1J6W A;  1BDF A;  4XSZ A;  1WQG A;  4PAB A;  5C44 C;  3A8J A;  3TFI A;  5TMC A;  4FM9 A;  3GTM K;  4P5B A;  5FLM C;  4G0W A;  4OIR A;  2NVX C;  4BY1 K;  3PO3 C;  2NVY A;  2RH6 A;  2PMZ L;  3RZO C;  1JOE A;  1USO A;  2EBB A;  4M1X A;  3GTQ K;  1ZXO A;  4KAW X;  4BBR K;  3AD9 C;  4GTL A;  3L4K A;  1IQ0 A;  1I3Q C;  1Y1W A;  3HOU C;  4WIL A;  3PO2 K;  4C45 A;  1TWF C;  1USM A;  4YFN A;  4BBR C;  2JA7 A;  2PHC B;  4A93 C;  2XCR B;  1PJ7 A;  1V5V A;  2FQT A;  2GAH C;  3CQZ C;  3ORE A;  5IOQ A;  1GE9 A;  2JA8 C;  1EFW A;  2NVX K;  3HOV K;  1C0A A;  1XPP A;  3GTO K;  4AH6 A;  3GTK A;  3GIR A;  4WJ3 M;  4A3G C;  2VUM A;  3AQP A;  4KN4 A;  5CHP A;  2PA8 L;  4YFX A;  2JA6 C;  4BLB A;  1TWA C;  4C3J K;  4BBS K;  4KB2 A;  4A3L K;  2B63 C;  3S2H C;  1EK8 A;  2V6S A;  2B63 K;  1ZBS A;  4C3I K;  3S2H K;  1DD5 A;  3S1N K;  3HKZ L;  4WJ4 A;  4KMU A;  5EGH A;  4C3J C;  1AB4 A;  4G0U A;  3RZD K;  4KAR A;  1Y1V A;  4A3L C;  1O28 A;  2Y0S L;  1ZYR A;  4A3G K;  5C4X C;  1WOO A;  1ZQ1 C;  3AD8 C;  2E2H K;  3S15 C;  5IP7 K;  5C4J K;  4KM9 A;  3AH5 A;  3GTJ K;  3S2D C;  4BXX C;  2A6E A;  1JQW A;  5M3F K;  2R93 A;  5IYD K;  4OIP A;  3H3V L;  2CW0 A;  5IP9 K;  1SFO A;  3HOY K;  1VJE A;  4G0V A;  4C2M K;  3GTL C;  2JA8 K;  4Y7N C;  3GTK K;  1F7V A;  3PO2 C;  2YU9 C;  3EQL A;  5IYC K;  3AD7 C;  1F7U A;  2E2I A;  2PA8 D;  4C3H K;  2R93 C;  2VUM C;  1TWF K;  3GTQ C;  4G7H A;  1XXB A;  2NVT K;  2GSU A;  1TWG C;  3HOU K;  1WCM A;  4A3D K;  4XSX A;  1F93 A;  1Y1W C;  4BY1 C;  2E2J K;  1IE0 A;  5EGE A;  4GZY A;  4LOW A;  1IL2 A;  1I50 A;  2YU9 K;  5IYB C;  5C3E C;  4Y7N K;  1DCH A;  3FKI C;  1UV7 A;  4OIN A;  2CFA A;  3FKI K;  4Y52 K;  1XXC A;  5M5W K;  2A69 A;  5IP9 C;  4YG2 A;  3GTG A;  4BKW A;  2ZFZ A;  4A3E C;  1TWG A;  1I3Q A;  1WSV A;  1TWA A;  3TFH A;  4MQ9 A;  5C44 K;  2D6F C;  1XZQ A;  2R7Z C;  4BXX K;  3GEE A;  5M5Y K;  1DCP A;  2VUM K;  3GDZ A;  3GTP K;  4A3F C;  3H0G K;  3OPF A;  4ZH4 A;  2PMZ D;  3FOE A;  1VH2 A;  2Y0S D;  4A3I C;  3S1M K;  1HI9 A;  1VRQ C;  4O2D A;  5TMF A;  4QJV B;  4XCH A;  2PPB A;  1TWC A;  4A3C K;  4NOI A;  1YNN A;  3HOY C;  2V6U A;  3A8I A;  1ISE A;  5FJ8 K;  1XZP A;  1WOP A;  4C3I C;  3M3Y K;  1VLO A;  5IYD C;  2NVY K;  3ERE D;  4KC6 A;  1WCM C;  3L4J A;  4KB4 A;  3I4M C;  4KAT A;  4RMF A;  5C4X K;  3GTJ A;  3WOD A;  1PJ6 A;  4KAS A;  1KQ4 A;  1O2B A;  2P5M A;  3TFJ A;  2JA5 K;  3FOF A;  3M3Y C;  3LPX A; 
#chains in the Genus database with same CATH homology
 5D4D A;  2R92 C;  3HOV C;  5IYD K;  2JA7 C;  4OIP A;  3S15 K;  3K7A K;  3H3V L;  4QIW D;  1BDF A;  2CW0 A;  4XSZ A;  3HOX C;  3S1M C;  5C44 C;  3S1Q C;  5IP9 K;  1TWA K;  5TMC A;  3HOY K;  2JA6 K;  2A68 A;  4C2M K;  3S16 K;  4A3C C;  3HOZ C;  3H0G C;  3GTL C;  3GTP C;  3GTM K;  2JA8 K;  4Y7N C;  3H3V D;  3GTK K;  4A3B K;  3PO2 C;  5FLM C;  4A3I K;  3EQL A;  2YU9 C;  5IYC K;  3GTO C;  2R7Z K;  3S16 C;  4A3J C;  1K83 K;  4OIR A;  3HKZ D;  1Y1V C;  3GTG C;  2NVX C;  4BY1 K;  3PO3 C;  2PA8 D;  4C3H K;  2R93 C;  4QIW L;  5M3M K;  4A3M C;  2VUM C;  1TWF K;  3CQZ K;  3GTQ C;  4G7H A;  2PMZ L;  2NVT K;  3HOU K;  1TWG C;  2E2I C;  3RZO C;  4A3D K;  2A6H A;  4JK1 A;  2E2I K;  4XSX A;  3RZO K;  3GTQ K;  4A3E K;  2E2J C;  4Y52 C;  4BBR K;  1Y1W C;  3PO3 K;  4BY1 C;  4Q5S A;  2NVQ K;  2E2J K;  5M5X K;  5IYB K;  1K83 C;  4GZY A;  1I3Q C;  4A3D C;  4A93 K;  2YU9 K;  3HOU C;  3PO2 K;  5IYB C;  1TWF C;  5C3E C;  4Y7N K;  4YFN A;  3GTM C;  2WAQ D;  3FKI C;  4OIN A;  3FKI K;  4BBR C;  1Y1W K;  3GTG K;  4LJZ A;  4Y52 K;  1Y1V K;  2O5J A;  5C3E K;  4G7Z A;  5M5W K;  4AYB L;  2A69 A;  5IP9 C;  4A3J K;  4A93 C;  4YG2 A;  5IYC C;  1TWG K;  1I3Q K;  2NVT C;  3CQZ C;  2NVQ C;  2JA8 C;  3GTL K;  2WAQ L;  2JA7 K;  3HOZ K;  2NVX K;  4XLP A;  3HOV K;  2WB1 L;  4A3E C;  4MEX A;  4MQ9 A;  1XPP A;  5C44 K;  2R7Z C;  3GTO K;  3S1Q K;  4BXX K;  3HOX K;  4X6A K;  3GTK C;  4MEY A;  5M5Y K;  4BY7 C;  4A3M K;  2VUM K;  2R93 K;  3GTP K;  4A3F C;  3H0G K;  1SMY A;  1TWC K;  4A3G C;  1I6H C;  4ZH4 A;  2O5I A;  1SFO K;  4KN4 A;  2PMZ D;  5FLM K;  2Y0S D;  4A3I C;  3S1M K;  4A3B C;  5TMF A;  2PA8 L;  4QJV B;  1TWH C;  1YNJ A;  3S17 K;  2PPB A;  2E2H C;  2JA5 C;  1WCM K;  3DXJ A;  4OIO A;  4YFX A;  4Q4Z A;  4NOI A;  5M3F K;  2JA6 C;  1TWA C;  1YNN A;  3HOW C;  3HOY C;  4C3J K;  4YFK A;  4G7O A;  2WB1 D;  5FJ8 K;  4BBS K;  4A3K C;  3S14 C;  4A3L K;  2B63 C;  3S2H C;  3K7A C;  2B63 K;  3S2H K;  4A3C K;  4C3I K;  3M3Y K;  3S14 K;  5IP7 C;  5C4J C;  3S1R C;  5IYD C;  2R92 K;  1I50 K;  3HKZ L;  2NVY K;  4OIQ A;  4KMU A;  3S1N K;  3M4O C;  4LK1 A;  3I4N K;  3I4N C;  3HOW K;  2BE5 A;  2NVY C;  1WCM C;  3M4O K;  3S1N C;  3RZD K;  4LLG A;  3S17 C;  1HQM A;  3GTJ C;  3I4M K;  3S2D K;  1I6V A;  4A3L C;  3I4M C;  2Y0S L;  3RZD C;  1ZYR A;  1SFO C;  1I6H K;  5C4X K;  1TWC C;  1R9T K;  3WOD A;  4A3G K;  4QJV A;  1IW7 A;  1R9T C;  5C4X C;  1I50 C;  2E2H K;  2JA5 K;  3S15 C;  5IP7 K;  5C4J K;  4A3F K;  3S1R K;  3M3Y C;  1TWH K;  4KN7 A;  3GTJ K;  3S2D C;  4A3K K;  4BY7 K;  4LK0 A;  4BXX C;  4X6A C;  4BBS C;  2A6E A;  4XLN A;  4AYB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...