2B63K

Complete rna polymerase ii-rna inhibitor complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 27
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2b63K00
4KMUA 1I3QC 4A3JK 2E2IK 4ZH4A 4Y52C 5M5YK 4QIWL 3HKZL 5FLMC 3I4NK 4KN4A 3M3YK 2JA6C 5IP7K 3CQZC 5M5WK 3PO3C 4X6AK 1TWHK 4A3JC 2Y0SD 2E2IC 4C3IK 4C3HK 4A3EK 2NVXK 3S2DK 3M3YC 3I4NC 2A69A 1HQMA 3S15K 4YFKA 4XSZA 1I6HK 5IP7C 2E2JK 2YU9K 1Y1WK 2PMZD 4BY7K 4JK1A 3S2HK 4LK0A 2WAQL 1YNNA 2NVXC 1IW7A 4A3EC 3HOYK 2A6HA 3S2DC 1Y1VK 3S15C 3GTPK 4G7HA 1I6HC 3DXJA 3HOUK 1I50K 4LLGA 2E2JC 2YU9C 1Y1WC 5IYDK 4BY7C 3GTLK 4NOIA 2WB1D 3HOYC 4A3CK 3WODA 2A6EA 4OINA 1Y1VC 3GTPC 3GTQK 5IYDC 4KN7A 1I50C 3HOUC 4A3KK 3FKIK 2NVTK 3GTLC 4GZYA 3GTGK 4A3CC 3I4MK 3GTMK 3M4OC 4YFNA 1SMYA 1TWAK 4A3BK 3GTQC 2R7ZK 4X6AC 3S1NK 2CW0A 3FKIC 4A3KC 3H3VD 1SFOK 2NVTC 3GTGC 3PO2K 2R93K 3GTKK 3I4MC 2O5IA 4MEXA 3GTMC 1TWAC 4A3BC 4A3LK 1R9TK 5IP9K 1WCMK 2VUMK 2R7ZC 3S17K 4QJVA 4XLPA 3S1MK 3S1NC 1TWHC 1SFOC 2R93C 3PO2C 4MQ9A 3GTKC 4A3MK 2WB1L 4BY1K 3S1QK 4A3LC 4BBSK 1R9TC 5IP9C 1WCMC 4Q5SA 2VUMC 5D4DA 3S1MC 3S2HC 4AYBD 1ZYRA 2NVYK 2JA5K 2R92K 1YNJA 3RZDK 4A3FK 2PA8D 5IYCK 4A3MC 4BY1C 4BXXK 3S1QC 4BBSC 4OIRA 5C44K 5M5XK 2JA5C 2NVYC 3HKZD 4QIWD 4C3JK 2R92C 3RZDC 2NVQK 4A3FC 2Y0SL 3S14K 4BXXC 4Y7NK 5C44C 5TMFA 2PMZL 1I6VA 1XPPA 2B63K 2NVQC 2BE5A 5C3EK 3S14C 4A3GK 4Y7NC 3EQLA 3S16K 2WAQD 3K7AK 5C4JK 2PPBA 4XSXA 1TWGK 5C4XK 5C3EC 4BBRK 3S17C 4YG2A 3S16C 2A68A 3K7AC 5C4JC 3GTOK 3HOWK 5IYBK 4A93K 4A3DK 5TMCA 4LK1A 1TWGC 4OIOA 4OIQA 5C4XC 4OIPA 4BBRC 4C2MK 3GTJK 2JA7K 4A3IK 4QJVB 3GTOC 1TWCK 5IYBC 3HOXK 3H3VL 3HOWC 3HOVK 5IYCC 4A93C 4YFXA 4A3DC 1K83K 1TWFK 3RZOK 2E2HK 3HOZK 4G7ZA 3GTJC 3S1RK 2O5JA 2JA7C 4A3IC 4XLNA 1TWCC 3H0GK 5FJ8K 3HOXC 3HOVC 4Q4ZA 1K83C 1TWFC 3RZOC 2E2HC 2JA8K 3HOZC 1I3QK 4LJZA 3S1RC 5M3FK 5M3MK 3H0GC 4AYBL 2B63C 4G7OA 1BDFA 5FLMK 3M4OK 4MEYA 4Y52K 2JA6K 4A3GC 2PA8L 3CQZK 3PO3K 2JA8C
chains in the Genus database with same CATH superfamily
1I3QC 2E2IK 3I4NK 5FLMC 4KB2A 5IP7K 3PO3C 2NVXK 1O2AA 3S2DK 2A69A 2JA6A 2E2JK 3AH5A 3V4GA 5IORA 4JK1A 1J6WA 4BLAA 3HOYK 1O27A 4G0VA 4WJ3M 3NUHA 3HOUK 1WORA 1Y1WC 2RH6A 1O28A 3VA7A 1BJTA 2A6EA 5JVOA 1Y1VC 4DDQA 3GTPC 4KN7A 1I50C 3FKIK 3GTLC 1J6VA 4O2DA 4A3CC 3I4MK 4YFNA 3GEHA 4A3BK 4PABA 2V6TA 3GTQC 3T02A 1WQHA 3GTGC 4A3LK 1ZVUA 3S17K 4QJVA 3S1NC 3L4KA 2WB1L 1WIHA 3GTMA 1R9TC 1TWAA 1WCMC 3GEEA 4Q5SA 4C45A 1YCLA 1ZYRA 4GTCA 2PA8D 3GTKA 4BXXK 2V6UA 5C44K 2VUMA 5M5XK 2NVYC 4GTEA 4C3JK 1PJ7A 3RZDC 3A8KA 1O25A 5TMFA 3FHZA 1JVIA 5C3EK 2RGRA 2WAQD 5C4JK 4AH6A 4KMHA 5C4XK 2D6FC 3S16C 5IYBK 1VH2A 4OIQA 1TWGC 4OIOA 3TFJA 3JSTA 3OPFA 4C2MK 4G0UA 1XXAA 3GIRA 1IQ0A 4A93C 4A3DC 3RZOK 3GTJC 2O5JA 2XCQA 4XLNA 3HOXC 1USOA 1O2FB 1K83C 3OEPA 4LJZA 5M3MK 2JA7A 3H0GC 4Y52K 1TWCA 4MEYA 2JA6K 4A3GC 2PA8L 2JA8C 1JQWA 2KWAA 3FOEA 5M5WK 3CQZC 2ZFZA 1I3QA 1PJ5A 4A3JC 4C3IK 1VJEA 4LQYA 3M3YC 1J98A 1HQMA 1I6HK 2EBBA 3GEIA 1EK8A 4BY7K 4LK0A 4M1XA 2WAQL 1YNNA 4A3EC 2CFAB 3AQOA 1WSRA 3S15C 4G7HA 3DXJA 5IYDK 2YU9C 2WB1D 4FM9A 3WODA 1Y1WA 4GZYA 3LAPA 3GTMK 1TWAK 1Y1VA 3GTPA 4A3KC 1I50A 3TFHA 3H3VD 2NVTC 3PO2K 3GTLA 4GTFA 3GTKK 1XZQB 2O5IA 3IPJA 2JH3A 2VUMK 1C0AA 2R7ZC 3G4CA 3GTQA 1TWHC 3MMLB 1SFOC 2R93C 3GTGA 4A3MK 4BY1K 1DD5A 3BP3A 1DCOA 5IP9C 5HL8A 5D4DA 3S1MC 2FQOA 4GTAA 3ERED 4A3FK 3S1QC 4BBSC 4OIRA 1R9TA 1WCMA 2JA5C 1WQFA 3HKZD 2R92C 3LPXA 2NVQK 1F93A 5TJ3A 2NVYA 4P9SA 3S14C 4A3GK 4Y7NC 3EQLA 1EQRA 2PPBA 4RMFA 3CAGA 3N0BA 1O24A 4BBRK 2A68A 3K7AC 3FOFA 4XCHA 3SZYA 4LK1A 3Q3QA 2JA7K 3GTOC 1TWCK 3HOWC 3H3VL 5IYCC 1WOOA 1TWGA 3S1RK 4A3IC 5FJ8K 5IOSA 3HOVC 3G4AA 1TWFC 4GTBA 2E2HC 3HOZC 1I3QK 4GTLA 3GTJA 3A8JA 2B63C 4G7OA 1BDFA 5FLMK 1K83A 3PO3K 5CJ9A 4KMUA 4ZH4A 3HKZL 3H0GA 4P5BA 4C3HC 1TWHK 2E2IC 4PAAA 3I4NC 4YFKA 4XSZA 3GDZA 4GTDA 5IP7C 3CQZA 1Y1WK 3ADAC 2NVXC 1XXCA 2A6HA 3S2DC 1Y1VK 1J6XA 3GTPK 4KASA 1I50K 4LLGA 2E2JC 3GTLK 4NOIA 3HOYC 4A3CK 3GTQK 3HOUC 2YU9A 1XXBA 3GTGK 3M4OC 1IBAA 1SMYA 4X6AC 3S1NK 3FKIC 3OREA 5EGHA 5JFEA 3I4MC 4MEXA 4A3BC 1VLOA 1GE9A 1R9TK 1WCMK 4KC6A 3L4JA 4XLPA 1WQGA 2GAHC 4MQ9A 4KMAA 3TTGA 1EI6A 4A3LC 2GSUA 1JOEA 4WJ4A 2GAGC 2R7ZA 3S2HC 1V5VA 4ILDA 2NVYK 1TWHA 1O29A 1KQ4A 3RZDK 1SFOA 1ISEA 5IYCK 2R93A 3LAJA 1WSVA 4WILA 4KDDA 2P8TA 1ZQ1C 1PJ6A 4QIWD 3SZZA 5CHPA 2ZUEA 1EFWA 4BXXC 1F7VA 4KM8A 2XCOA 5C44C 1G51A 4GT9A 4C3JC 2JA5A 2B63K 2R92A 2XCRB 3S16K 1BGWA 4KB4A 1INNA 3QX3A 1UV7A 4XSXA 1TWGK 5C3EC 5C4JC 1X31C 2CFAA 4A93K 4A3DK 5C4XC 5E68A 3AQPA 4GFQA 3GTJK 1B4BA 3HXAA 4QJVB 3HOXK 5IYBC 3N3YA 1K83K 1AB4A 1USMA 2P5MA 4C2MC 3H0GK 3GTOA 4Q4ZA 2V6SA 5EGEA 3AD9C 4G0WA 3RZOC 1YX2A 2JA8K 1B4AA 5IOQA 3S0XA 1XZQA 5M3FK 2GSNA 3M4OK 1L0WA 3CQZK 1TWFA 4X6AK 5L46A 1WOSA 3GSIA 1BS2A 5IOTA 2E2HA 4A3JK 4Y52C 5M5YK 4QIWL 3M3YK 2B63A 4KN4A 2Y3PA 2JA6C 1VGXA 2ZUFA 1DCPA 2Y0SD 4A3EK 2GSOA 3S15K 1HI9A 2YU9K 2PMZD 1WOPA 3S2HK 4KMDA 3A8IA 3BUEA 1IW7A 4C3IC 2E2IA 1EH1A 1I6HC 1IE0A 4BY7C 3AD7C 1IL2A 2NVXA 4FZBA 4OINA 5IYDC 4A3KK 3AD8C 2NVTK 4LR2A 4KARA 4J3NA 2R7ZK 2CW0A 1SFOK 3T00A 2R93K 3GTMC 3TFIA 1TWAC 5IP9K 3S1MK 1XZPB 3FKIA 3PO2C 3GTKC 4P5AA 1ZBSA 3S1QK 4BBSK 2VUMC 4AYBD 2JA5K 2R92K 1YNJA 2FQTA 4A3MC 4BY1C 4KAWX 1F7UA 4A3FC 2Y0SL 3S14K 4Y7NK 3T01A 2PMZL 3N0CA 1I6VA 1XPPA 2NVQC 2BE5A 2W7VA 4LOWA 3K7AK 1VRQC 1ZXOA 1XZPA 4BKWA 3S17C 4YG2A 1F9NA 3GTOK 3HOWK 4BLBA 5TMCA 4KATA 4OIPA 4BBRC 4KM9A 1O2BA 4A3IK 3HOVK 4YFXA 1TWFK 2PHCB 2E2HK 3HOZK 4G7ZA 2JA7C 1TWCC 1IS1A 1RU0A 3S1RC 1DCHA 1O26A 4AYBL 3BP8C 4C3HK
chains in the Genus database with same CATH topology
4KMUA 1I3QC 4A3JK 2E2IK 4ZH4A 4Y52C 5M5YK 4QIWL 3HKZL 5FLMC 3I4NK 4KN4A 3M3YK 2JA6C 5IP7K 3CQZC 5M5WK 3PO3C 4X6AK 1TWHK 4A3JC 2Y0SD 2E2IC 4C3IK 4C3HK 4A3EK 2NVXK 3S2DK 3M3YC 3I4NC 2A69A 1HQMA 3S15K 4YFKA 4XSZA 1I6HK 5IP7C 2E2JK 2YU9K 1Y1WK 2PMZD 4BY7K 4JK1A 3S2HK 4LK0A 2WAQL 1YNNA 2NVXC 1IW7A 4A3EC 3HOYK 2A6HA 3S2DC 1Y1VK 3S15C 3GTPK 4G7HA 1I6HC 3DXJA 3HOUK 1I50K 4LLGA 2E2JC 2YU9C 1Y1WC 5IYDK 4BY7C 3GTLK 4NOIA 2WB1D 3HOYC 4A3CK 3WODA 2A6EA 4OINA 1Y1VC 3GTPC 3GTQK 5IYDC 4KN7A 1I50C 3HOUC 4A3KK 3FKIK 2NVTK 3GTLC 4GZYA 3GTGK 4A3CC 3I4MK 3GTMK 3M4OC 4YFNA 1SMYA 1TWAK 4A3BK 3GTQC 2R7ZK 4X6AC 3S1NK 2CW0A 3FKIC 4A3KC 3H3VD 1SFOK 2NVTC 3GTGC 3PO2K 2R93K 3GTKK 3I4MC 2O5IA 4MEXA 3GTMC 1TWAC 4A3BC 4A3LK 1R9TK 5IP9K 1WCMK 2VUMK 2R7ZC 3S17K 4QJVA 4XLPA 3S1MK 3S1NC 1TWHC 1SFOC 2R93C 3PO2C 4MQ9A 3GTKC 4A3MK 2WB1L 4BY1K 3S1QK 4A3LC 4BBSK 1R9TC 5IP9C 1WCMC 4Q5SA 2VUMC 5D4DA 3S1MC 3S2HC 4AYBD 1ZYRA 2NVYK 2JA5K 2R92K 1YNJA 3RZDK 4A3FK 2PA8D 5IYCK 4A3MC 4BY1C 4BXXK 3S1QC 4BBSC 4OIRA 5C44K 5M5XK 2JA5C 2NVYC 3HKZD 4QIWD 4C3JK 2R92C 3RZDC 2NVQK 4A3FC 2Y0SL 3S14K 4BXXC 4Y7NK 5C44C 5TMFA 2PMZL 1I6VA 1XPPA 2B63K 2NVQC 2BE5A 5C3EK 3S14C 4A3GK 4Y7NC 3EQLA 3S16K 2WAQD 3K7AK 5C4JK 2PPBA 4XSXA 1TWGK 5C4XK 5C3EC 4BBRK 3S17C 4YG2A 3S16C 2A68A 3K7AC 5C4JC 3GTOK 3HOWK 5IYBK 4A93K 4A3DK 5TMCA 4LK1A 1TWGC 4OIOA 4OIQA 5C4XC 4OIPA 4BBRC 4C2MK 3GTJK 2JA7K 4A3IK 4QJVB 3GTOC 1TWCK 5IYBC 3HOXK 3H3VL 3HOWC 3HOVK 5IYCC 4A93C 4YFXA 4A3DC 1K83K 1TWFK 3RZOK 2E2HK 3HOZK 4G7ZA 3GTJC 3S1RK 2O5JA 2JA7C 4A3IC 4XLNA 1TWCC 3H0GK 5FJ8K 3HOXC 3HOVC 4Q4ZA 1K83C 1TWFC 3RZOC 2E2HC 2JA8K 3HOZC 1I3QK 4LJZA 3S1RC 5M3FK 5M3MK 3H0GC 4AYBL 2B63C 4G7OA 1BDFA 5FLMK 3M4OK 4MEYA 4Y52K 2JA6K 4A3GC 2PA8L 3CQZK 3PO3K 2JA8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMU A;  1I3Q C;  4A3J K;  2E2I K;  4ZH4 A;  4Y52 C;  5M5Y K;  4QIW L;  3HKZ L;  5FLM C;  3I4N K;  4KN4 A;  3M3Y K;  2JA6 C;  5IP7 K;  3CQZ C;  5M5W K;  3PO3 C;  4X6A K;  1TWH K;  4A3J C;  2Y0S D;  2E2I C;  4C3I K;  4C3H K;  4A3E K;  2NVX K;  3S2D K;  3M3Y C;  3I4N C;  2A69 A;  1HQM A;  3S15 K;  4YFK A;  4XSZ A;  1I6H K;  5IP7 C;  2E2J K;  2YU9 K;  1Y1W K;  2PMZ D;  4BY7 K;  4JK1 A;  3S2H K;  4LK0 A;  2WAQ L;  1YNN A;  2NVX C;  1IW7 A;  4A3E C;  3HOY K;  2A6H A;  3S2D C;  1Y1V K;  3S15 C;  3GTP K;  4G7H A;  1I6H C;  3DXJ A;  3HOU K;  1I50 K;  4LLG A;  2E2J C;  2YU9 C;  1Y1W C;  5IYD K;  4BY7 C;  3GTL K;  4NOI A;  2WB1 D;  3HOY C;  4A3C K;  3WOD A;  2A6E A;  4OIN A;  1Y1V C;  3GTP C;  3GTQ K;  5IYD C;  4KN7 A;  1I50 C;  3HOU C;  4A3K K;  3FKI K;  2NVT K;  3GTL C;  4GZY A;  3GTG K;  4A3C C;  3I4M K;  3GTM K;  3M4O C;  4YFN A;  1SMY A;  1TWA K;  4A3B K;  3GTQ C;  2R7Z K;  4X6A C;  3S1N K;  2CW0 A;  3FKI C;  4A3K C;  3H3V D;  1SFO K;  2NVT C;  3GTG C;  3PO2 K;  2R93 K;  3GTK K;  3I4M C;  2O5I A;  4MEX A;  3GTM C;  1TWA C;  4A3B C;  4A3L K;  1R9T K;  5IP9 K;  1WCM K;  2VUM K;  2R7Z C;  3S17 K;  4QJV A;  4XLP A;  3S1M K;  3S1N C;  1TWH C;  1SFO C;  2R93 C;  3PO2 C;  4MQ9 A;  3GTK C;  4A3M K;  2WB1 L;  4BY1 K;  3S1Q K;  4A3L C;  4BBS K;  1R9T C;  5IP9 C;  1WCM C;  4Q5S A;  2VUM C;  5D4D A;  3S1M C;  3S2H C;  4AYB D;  1ZYR A;  2NVY K;  2JA5 K;  2R92 K;  1YNJ A;  3RZD K;  4A3F K;  2PA8 D;  5IYC K;  4A3M C;  4BY1 C;  4BXX K;  3S1Q C;  4BBS C;  4OIR A;  5C44 K;  5M5X K;  2JA5 C;  2NVY C;  3HKZ D;  4QIW D;  4C3J K;  2R92 C;  3RZD C;  2NVQ K;  4A3F C;  2Y0S L;  3S14 K;  4BXX C;  4Y7N K;  5C44 C;  5TMF A;  2PMZ L;  1I6V A;  1XPP A;  2B63 K;  2NVQ C;  2BE5 A;  5C3E K;  3S14 C;  4A3G K;  4Y7N C;  3EQL A;  3S16 K;  2WAQ D;  3K7A K;  5C4J K;  2PPB A;  4XSX A;  1TWG K;  5C4X K;  5C3E C;  4BBR K;  3S17 C;  4YG2 A;  3S16 C;  2A68 A;  3K7A C;  5C4J C;  3GTO K;  3HOW K;  5IYB K;  4A93 K;  4A3D K;  5TMC A;  4LK1 A;  1TWG C;  4OIO A;  4OIQ A;  5C4X C;  4OIP A;  4BBR C;  4C2M K;  3GTJ K;  2JA7 K;  4A3I K;  4QJV B;  3GTO C;  1TWC K;  5IYB C;  3HOX K;  3H3V L;  3HOW C;  3HOV K;  5IYC C;  4A93 C;  4YFX A;  4A3D C;  1K83 K;  1TWF K;  3RZO K;  2E2H K;  3HOZ K;  4G7Z A;  3GTJ C;  3S1R K;  2O5J A;  2JA7 C;  4A3I C;  4XLN A;  1TWC C;  3H0G K;  5FJ8 K;  3HOX C;  3HOV C;  4Q4Z A;  1K83 C;  1TWF C;  3RZO C;  2E2H C;  2JA8 K;  3HOZ C;  1I3Q K;  4LJZ A;  3S1R C;  5M3F K;  5M3M K;  3H0G C;  4AYB L;  2B63 C;  4G7O A;  1BDF A;  5FLM K;  3M4O K;  4MEY A;  4Y52 K;  2JA6 K;  4A3G C;  2PA8 L;  3CQZ K;  3PO3 K;  2JA8 C; 
#chains in the Genus database with same CATH topology
 1I3Q C;  2E2I K;  3I4N K;  5FLM C;  4KB2 A;  5IP7 K;  3PO3 C;  2NVX K;  1O2A A;  3S2D K;  2A69 A;  2JA6 A;  2E2J K;  3AH5 A;  3V4G A;  5IOR A;  4JK1 A;  1J6W A;  4BLA A;  3HOY K;  1O27 A;  4G0V A;  4WJ3 M;  3NUH A;  3HOU K;  1WOR A;  1Y1W C;  2RH6 A;  1O28 A;  3VA7 A;  1BJT A;  2A6E A;  5JVO A;  1Y1V C;  4DDQ A;  3GTP C;  4KN7 A;  1I50 C;  3FKI K;  3GTL C;  1J6V A;  4O2D A;  4A3C C;  3I4M K;  4YFN A;  3GEH A;  4A3B K;  4PAB A;  2V6T A;  3GTQ C;  3T02 A;  1WQH A;  3GTG C;  4A3L K;  1ZVU A;  3S17 K;  4QJV A;  3S1N C;  3L4K A;  2WB1 L;  1WIH A;  3GTM A;  1R9T C;  1TWA A;  1WCM C;  3GEE A;  4Q5S A;  4C45 A;  1YCL A;  1ZYR A;  4GTC A;  2PA8 D;  3GTK A;  4BXX K;  2V6U A;  5C44 K;  2VUM A;  5M5X K;  2NVY C;  4GTE A;  4C3J K;  1PJ7 A;  3RZD C;  3A8K A;  1O25 A;  5TMF A;  3FHZ A;  1JVI A;  5C3E K;  2RGR A;  2WAQ D;  5C4J K;  4AH6 A;  4KMH A;  5C4X K;  2D6F C;  3S16 C;  5IYB K;  1VH2 A;  4OIQ A;  1TWG C;  4OIO A;  3TFJ A;  3JST A;  3OPF A;  4C2M K;  4G0U A;  1XXA A;  3GIR A;  1IQ0 A;  4A93 C;  4A3D C;  3RZO K;  3GTJ C;  2O5J A;  2XCQ A;  4XLN A;  3HOX C;  1USO A;  1O2F B;  1K83 C;  3OEP A;  4LJZ A;  5M3M K;  2JA7 A;  3H0G C;  4Y52 K;  1TWC A;  4MEY A;  2JA6 K;  4A3G C;  2PA8 L;  2JA8 C;  1JQW A;  2KWA A;  3FOE A;  5M5W K;  3CQZ C;  2ZFZ A;  1I3Q A;  1PJ5 A;  4A3J C;  4C3I K;  1VJE A;  4LQY A;  3M3Y C;  1J98 A;  1HQM A;  1I6H K;  2EBB A;  3GEI A;  1EK8 A;  4BY7 K;  4LK0 A;  4M1X A;  2WAQ L;  1YNN A;  4A3E C;  2CFA B;  3AQO A;  1WSR A;  3S15 C;  4G7H A;  3DXJ A;  5IYD K;  2YU9 C;  2WB1 D;  4FM9 A;  3WOD A;  1Y1W A;  4GZY A;  3LAP A;  3GTM K;  1TWA K;  1Y1V A;  3GTP A;  4A3K C;  1I50 A;  3TFH A;  3H3V D;  2NVT C;  3PO2 K;  3GTL A;  4GTF A;  3GTK K;  1XZQ B;  2O5I A;  3IPJ A;  2JH3 A;  2VUM K;  1C0A A;  2R7Z C;  3G4C A;  3GTQ A;  1TWH C;  3MML B;  1SFO C;  2R93 C;  3GTG A;  4A3M K;  4BY1 K;  1DD5 A;  3BP3 A;  1DCO A;  5IP9 C;  5HL8 A;  5D4D A;  3S1M C;  2FQO A;  4GTA A;  3ERE D;  4A3F K;  3S1Q C;  4BBS C;  4OIR A;  1R9T A;  1WCM A;  2JA5 C;  1WQF A;  3HKZ D;  2R92 C;  3LPX A;  2NVQ K;  1F93 A;  5TJ3 A;  2NVY A;  4P9S A;  3S14 C;  4A3G K;  4Y7N C;  3EQL A;  1EQR A;  2PPB A;  4RMF A;  3CAG A;  3N0B A;  1O24 A;  4BBR K;  2A68 A;  3K7A C;  3FOF A;  4XCH A;  3SZY A;  4LK1 A;  3Q3Q A;  2JA7 K;  3GTO C;  1TWC K;  3HOW C;  3H3V L;  5IYC C;  1WOO A;  1TWG A;  3S1R K;  4A3I C;  5FJ8 K;  5IOS A;  3HOV C;  3G4A A;  1TWF C;  4GTB A;  2E2H C;  3HOZ C;  1I3Q K;  4GTL A;  3GTJ A;  3A8J A;  2B63 C;  4G7O A;  1BDF A;  5FLM K;  1K83 A;  3PO3 K;  5CJ9 A;  4KMU A;  4ZH4 A;  3HKZ L;  3H0G A;  4P5B A;  4C3H C;  1TWH K;  2E2I C;  4PAA A;  3I4N C;  4YFK A;  4XSZ A;  3GDZ A;  4GTD A;  5IP7 C;  3CQZ A;  1Y1W K;  3ADA C;  2NVX C;  1XXC A;  2A6H A;  3S2D C;  1Y1V K;  1J6X A;  3GTP K;  4KAS A;  1I50 K;  4LLG A;  2E2J C;  3GTL K;  4NOI A;  3HOY C;  4A3C K;  3GTQ K;  3HOU C;  2YU9 A;  1XXB A;  3GTG K;  3M4O C;  1IBA A;  1SMY A;  4X6A C;  3S1N K;  3FKI C;  3ORE A;  5EGH A;  5JFE A;  3I4M C;  4MEX A;  4A3B C;  1VLO A;  1GE9 A;  1R9T K;  1WCM K;  4KC6 A;  3L4J A;  4XLP A;  1WQG A;  2GAH C;  4MQ9 A;  4KMA A;  3TTG A;  1EI6 A;  4A3L C;  2GSU A;  1JOE A;  4WJ4 A;  2GAG C;  2R7Z A;  3S2H C;  1V5V A;  4ILD A;  2NVY K;  1TWH A;  1O29 A;  1KQ4 A;  3RZD K;  1SFO A;  1ISE A;  5IYC K;  2R93 A;  3LAJ A;  1WSV A;  4WIL A;  4KDD A;  2P8T A;  1ZQ1 C;  1PJ6 A;  4QIW D;  3SZZ A;  5CHP A;  2ZUE A;  1EFW A;  4BXX C;  1F7V A;  4KM8 A;  2XCO A;  5C44 C;  1G51 A;  4GT9 A;  4C3J C;  2JA5 A;  2B63 K;  2R92 A;  2XCR B;  3S16 K;  1BGW A;  4KB4 A;  1INN A;  3QX3 A;  1UV7 A;  4XSX A;  1TWG K;  5C3E C;  5C4J C;  1X31 C;  2CFA A;  4A93 K;  4A3D K;  5C4X C;  5E68 A;  3AQP A;  4GFQ A;  3GTJ K;  1B4B A;  3HXA A;  4QJV B;  3HOX K;  5IYB C;  3N3Y A;  1K83 K;  1AB4 A;  1USM A;  2P5M A;  4C2M C;  3H0G K;  3GTO A;  4Q4Z A;  2V6S A;  5EGE A;  3AD9 C;  4G0W A;  3RZO C;  1YX2 A;  2JA8 K;  1B4A A;  5IOQ A;  3S0X A;  1XZQ A;  5M3F K;  2GSN A;  3M4O K;  1L0W A;  3CQZ K;  1TWF A;  4X6A K;  5L46 A;  1WOS A;  3GSI A;  1BS2 A;  5IOT A;  2E2H A;  4A3J K;  4Y52 C;  5M5Y K;  4QIW L;  3M3Y K;  2B63 A;  4KN4 A;  2Y3P A;  2JA6 C;  1VGX A;  2ZUF A;  1DCP A;  2Y0S D;  4A3E K;  2GSO A;  3S15 K;  1HI9 A;  2YU9 K;  2PMZ D;  1WOP A;  3S2H K;  4KMD A;  3A8I A;  3BUE A;  1IW7 A;  4C3I C;  2E2I A;  1EH1 A;  1I6H C;  1IE0 A;  4BY7 C;  3AD7 C;  1IL2 A;  2NVX A;  4FZB A;  4OIN A;  5IYD C;  4A3K K;  3AD8 C;  2NVT K;  4LR2 A;  4KAR A;  4J3N A;  2R7Z K;  2CW0 A;  1SFO K;  3T00 A;  2R93 K;  3GTM C;  3TFI A;  1TWA C;  5IP9 K;  3S1M K;  1XZP B;  3FKI A;  3PO2 C;  3GTK C;  4P5A A;  1ZBS A;  3S1Q K;  4BBS K;  2VUM C;  4AYB D;  2JA5 K;  2R92 K;  1YNJ A;  2FQT A;  4A3M C;  4BY1 C;  4KAW X;  1F7U A;  4A3F C;  2Y0S L;  3S14 K;  4Y7N K;  3T01 A;  2PMZ L;  3N0C A;  1I6V A;  1XPP A;  2NVQ C;  2BE5 A;  2W7V A;  4LOW A;  3K7A K;  1VRQ C;  1ZXO A;  1XZP A;  4BKW A;  3S17 C;  4YG2 A;  1F9N A;  3GTO K;  3HOW K;  4BLB A;  5TMC A;  4KAT A;  4OIP A;  4BBR C;  4KM9 A;  1O2B A;  4A3I K;  3HOV K;  4YFX A;  1TWF K;  2PHC B;  2E2H K;  3HOZ K;  4G7Z A;  2JA7 C;  1TWC C;  1IS1 A;  1RU0 A;  3S1R C;  1DCH A;  1O26 A;  4AYB L;  3BP8 C;  4C3H K; 
#chains in the Genus database with same CATH homology
 4KMU A;  1I3Q C;  4A3J K;  2E2I K;  4ZH4 A;  4Y52 C;  5M5Y K;  4QIW L;  3HKZ L;  5FLM C;  3I4N K;  4KN4 A;  3M3Y K;  2JA6 C;  5IP7 K;  3CQZ C;  5M5W K;  3PO3 C;  4X6A K;  1TWH K;  4A3J C;  2Y0S D;  2E2I C;  4C3I K;  4C3H K;  4A3E K;  2NVX K;  3S2D K;  3M3Y C;  3I4N C;  2A69 A;  1HQM A;  3S15 K;  4YFK A;  4XSZ A;  1I6H K;  5IP7 C;  2E2J K;  2YU9 K;  1Y1W K;  2PMZ D;  4BY7 K;  4JK1 A;  3S2H K;  4LK0 A;  2WAQ L;  1YNN A;  2NVX C;  1IW7 A;  4A3E C;  3HOY K;  2A6H A;  3S2D C;  1Y1V K;  3S15 C;  3GTP K;  4G7H A;  1I6H C;  3DXJ A;  3HOU K;  1I50 K;  4LLG A;  2E2J C;  2YU9 C;  1Y1W C;  5IYD K;  4BY7 C;  3GTL K;  4NOI A;  2WB1 D;  3HOY C;  4A3C K;  3WOD A;  2A6E A;  4OIN A;  1Y1V C;  3GTP C;  3GTQ K;  5IYD C;  4KN7 A;  1I50 C;  3HOU C;  4A3K K;  3FKI K;  2NVT K;  3GTL C;  4GZY A;  3GTG K;  4A3C C;  3I4M K;  3GTM K;  3M4O C;  4YFN A;  1SMY A;  1TWA K;  4A3B K;  3GTQ C;  2R7Z K;  4X6A C;  3S1N K;  2CW0 A;  3FKI C;  4A3K C;  3H3V D;  1SFO K;  2NVT C;  3GTG C;  3PO2 K;  2R93 K;  3GTK K;  3I4M C;  2O5I A;  4MEX A;  3GTM C;  1TWA C;  4A3B C;  4A3L K;  1R9T K;  5IP9 K;  1WCM K;  2VUM K;  2R7Z C;  3S17 K;  4QJV A;  4XLP A;  3S1M K;  3S1N C;  1TWH C;  1SFO C;  2R93 C;  3PO2 C;  4MQ9 A;  3GTK C;  4A3M K;  2WB1 L;  4BY1 K;  3S1Q K;  4A3L C;  4BBS K;  1R9T C;  5IP9 C;  1WCM C;  4Q5S A;  2VUM C;  5D4D A;  3S1M C;  3S2H C;  4AYB D;  1ZYR A;  2NVY K;  2JA5 K;  2R92 K;  1YNJ A;  3RZD K;  4A3F K;  2PA8 D;  5IYC K;  4A3M C;  4BY1 C;  4BXX K;  3S1Q C;  4BBS C;  4OIR A;  5C44 K;  5M5X K;  2JA5 C;  2NVY C;  3HKZ D;  4QIW D;  4C3J K;  2R92 C;  3RZD C;  2NVQ K;  4A3F C;  2Y0S L;  3S14 K;  4BXX C;  4Y7N K;  5C44 C;  5TMF A;  2PMZ L;  1I6V A;  1XPP A;  2B63 K;  2NVQ C;  2BE5 A;  5C3E K;  3S14 C;  4A3G K;  4Y7N C;  3EQL A;  3S16 K;  2WAQ D;  3K7A K;  5C4J K;  2PPB A;  4XSX A;  1TWG K;  5C4X K;  5C3E C;  4BBR K;  3S17 C;  4YG2 A;  3S16 C;  2A68 A;  3K7A C;  5C4J C;  3GTO K;  3HOW K;  5IYB K;  4A93 K;  4A3D K;  5TMC A;  4LK1 A;  1TWG C;  4OIO A;  4OIQ A;  5C4X C;  4OIP A;  4BBR C;  4C2M K;  3GTJ K;  2JA7 K;  4A3I K;  4QJV B;  3GTO C;  1TWC K;  5IYB C;  3HOX K;  3H3V L;  3HOW C;  3HOV K;  5IYC C;  4A93 C;  4YFX A;  4A3D C;  1K83 K;  1TWF K;  3RZO K;  2E2H K;  3HOZ K;  4G7Z A;  3GTJ C;  3S1R K;  2O5J A;  2JA7 C;  4A3I C;  4XLN A;  1TWC C;  3H0G K;  5FJ8 K;  3HOX C;  3HOV C;  4Q4Z A;  1K83 C;  1TWF C;  3RZO C;  2E2H C;  2JA8 K;  3HOZ C;  1I3Q K;  4LJZ A;  3S1R C;  5M3F K;  5M3M K;  3H0G C;  4AYB L;  2B63 C;  4G7O A;  1BDF A;  5FLM K;  3M4O K;  4MEY A;  4Y52 K;  2JA6 K;  4A3G C;  2PA8 L;  3CQZ K;  3PO3 K;  2JA8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...