4GTBA

T. maritima fdts with fad, dump, and raltitrexed.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
211
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 211
sequence length 216
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtbA00
1KQ4A 4KASA 4GTFA 3N3YA 4GTEA 4FZBA 3G4CA 2CFAB 4GTLA 4GT9A 1O26A 5IOSA 5CHPA 1O24A 5IORA 5JFEA 5IOQA 4GTCA 1O2BA 3G4AA 3N0BA 1O2AA 4KARA 4P5BA 5IOTA 4GTAA 4KATA 1O28A 1O25A 4GTBA 1O27A 1O29A 3N0CA 4GTDA 3AH5A 2CFAA 4P5AA
chains in the Genus database with same CATH superfamily
4LK1A 5M3MK 3T02A 2JA7A 5C3EC 3G4CA 4QIWL 3S14C 5FLMK 4GT9A 3A8KA 1F7VA 1HQMA 3GTPK 5IYDC 2NVYK 4OIOA 1I3QC 1I6HK 5IOQA 4G0VA 3G4AA 1IW7A 3S17K 5TJ3A 1RU0A 4A3KK 2JA8K 1I6VA 4KASA 1F93A 5EGEA 3V4GA 5FJ8K 3S1MK 3S1NC 4ZH4A 1TWFC 3GTGC 4NOIA 5D4DA 3S16K 2NVQC 3GTMK 2EBBA 5M5WK 1Y1WK 1O2BA 3FKIC 5IP9K 4C2MK 1I3QA 4WJ3M 4WJ4A 5IYCK 4AYBL 2PA8D 3HOXC 1ZQ1C 2NVTK 3AD9C 3M4OC 3DXJA 3S2DK 2B63C 4OINA 2VUMK 2A68A 4C3JK 1SFOK 4JK1A 3GSIA 1ZXOA 4A93C 4O2DA 3AQPA 4GFQA 3CQZC 1TWFA 1YNNA 2A69A 3GTGA 1VRQC 4MEYA 1TWAA 2Y0SD 3JSTA 4G0WA 4A3BC 4GTAA 4A3JK 4BBSK 4A3IC 2YU9K 1DCPA 1WOPA 3AH5A 2P5MA 1I50C 3EQLA 4A3MK 1VJEA 2V6SA 3S0XA 4KB2A 3H0GK 4A3GK 3S2HC 1DD5A 4G7ZA 2B63A 2O5JA 2A6EA 4G7HA 1XZPA 3S1RK 4KAWX 2P8TA 4KB4A 3M3YK 2JA6C 3CQZA 2PA8L 2JA7K 4A3FC 1IE0A 2A6HA 3AD8C 3HOVK 2WB1D 4A3CC 2FQTA 3TFHA 2XCQA 4XCHA 1I50A 1WIHA 4KMHA 2Y3PA 1EFWA 4A3LK 4X6AC 4MQ9A 1XXAA 5C4XK 3HKZL 4Y7NC 4KM8A 2PMZD 2E2JC 3GEIA 1XZQB 1HI9A 1IL2A 2JA6A 2BE5A 2NVXC 3PO3K 1K83A 3PO2C 3HOUC 1WCMC 4QJVA 1C0AA 5C3EK 4BXXC 2CFAA 4A3EC 3FHZA 3S14K 3HOYC 4C45A 2RGRA 1USOA 2E2HC 4G7OA 4FM9A 3RZOK 1I3QK 5HL8A 3GTOK 5IOSA 3HOWC 1XXBA 1ZBSA 4XSXA 2WB1L 3GTLC 2W7VA 1X31C 3GTKC 2NVXA 1XXCA 3GTQC 3S1NK 1WCMA 4YFNA 4LJZA 1J6VA 1TWGC 1TWFK 3I4NC 3GTGK 5L46A 4GTLA 2R93C 2NVQK 1L0WA 2E2HA 2PMZL 3HOZC 1IBAA 3FKIK 4PAAA 3RZDC 3ADAC 1ISEA 1TWAC 4KMUA 3HOXK 1F7UA 4Q4ZA 1XPPA 4RMFA 3I4MC 2E2IC 5M5YK 4C3IC 4BY1C 3M4OK 2KWAA 2B63K 1BGWA 5TMCA 3GTLA 4MEXA 4BBRC 3GTKA 3GTQA 4A93K 3TFIA 2XCRB 1O2FB 3OREA 1TWGA 2CFAB 3CQZK 3GTJC 3CAGA 2R93A 5E68A 5IP7K 3AD7C 4J3NA 4A3BK 4GTCA 2JA5C 3N0BA 3GTPA 3HKZD 4A3IK 5M5XK 1WOOA 1I50K 5IYBC 1BS2A 2E2IA 3S15C 4P9SA 3S2HK 1PJ7A 1SMYA 1YCLA 1PJ6A 3QX3A 1J6XA 1VH2A 3GTJA 2O5IA 1O24A 5JFEA 4A3FK 4ILDA 4YFKA 4KN7A 3VA7A 3LAJA 1K83C 2JA5A 4A3CK 1AB4A 3AQOA 2R7ZC 1Y1WA 2CW0A 3H3VL 4BY7C 2WAQL 4BLAA 4BKWA 4DDQA 1BJTA 1UV7A 4X6AK 1WQFA 4YFXA 4XLPA 3L4JA 4Y7NK 1O26A 5C44C 2E2JK 2VUMA 1JOEA 1SFOA 1O2AA 4KARA 3PO2K 3HOUK 1WCMK 4G0UA 1YX2A 4BXXK 4C3HC 3OPFA 4A3EK 3IPJA 1O29A 1TWHC 4GTDA 3HOYK 1IS1A 4LLGA 2R7ZA 1VGXA 1TWCC 3K7AC 2E2HK 4OIQA 4Y52C 1WQGA 3HOWK 5IYDK 2V6UA 4A3LC 1EI6A 5CHPA 4WILA 1EK8A 3A8JA 4A3DC 3S1QC 3T00A 1V5VA 1B4AA 1R9TC 3GTLK 1XZPB 4KDDA 3GTQK 2ZUFA 1Y1VC 1J6WA 1TWGK 3I4NK 5C4JC 4OIRA 1TWHA 4GTFA 1BDFA 2R93K 2R92C 1TWCA 3HOZK 1WSRA 3RZDK 2D6FC 3RZOC 1TWAK 5FLMC 3BP8C 4YG2A 5IORA 3GTOC 3A8IA 3FOFA 3I4MK 3GTPC 2E2IK 4BY1K 4C3IK 2NVYC 1I6HC 2GAGC 4KATA 1O28A 1O25A 5EGHA 1R9TA 3S17C 4BBRK 1WSVA 3GEHA 3L4KA 1Y1VA 4A3KC 4AH6A 2JA8C 3SZZA 3GTJK 3H3VD 2WAQD 4GTEA 4FZBA 1PJ5A 3GDZA 5CJ9A 4QJVB 2FQOA 1G51A 2GSOA 2R92A 3SZYA 4GZYA 3S1MC 2JA5K 3NUHA 4KM9A 3LAPA 3S16C 1J98A 3GTOA 1INNA 3GTMC 3Q3QA 5IYBK 3S15K 1Y1WC 2NVYA 5IP9C 4C2MC 4GTBA 1O27A 5IYCC 1KQ4A 1IQ0A 2NVTC 3OEPA 3LPXA 3N3YA 5JVOA 4LK0A 3S2DC 1WQHA 1XZQA 2VUMC 4LQYA 1SFOC 4C3JC 2RH6A 2JA6K 1EQRA 4BLBA 1K83K 5IP7C 4KMAA 2R7ZK 4KC6A 3FKIA 1DCHA 4P5BA 5IOTA 2JH3A 4BY7K 3GTMA 1JQWA 3PO3C 4LOWA 3BUEA 1ZVUA 4A3JC 4BBSC 2GSNA 5TMFA 2YU9C 1WORA 1JVIA 3GIRA 4A3MC 5C44K 3GEEA 1DCOA 3H0GC 4A3GC 4QIWD 2ZUEA 2ZFZA 4KN4A 2PHCB 3WODA 3S1RC 4C3HK 2NVXK 1YNJA 1TWHK 1F9NA 3M3YC 3MMLB 4XLNA 3T01A 3N0CA 1TWCK 3K7AK 1USMA 2V6TA 2JA7C 4M1XA 4P5AA 3HOVC 1VLOA 4Y52K 3TFJA 1ZYRA 1EH1A 3FOEA 2YU9A 3HXAA 2XCOA 4KMDA 4Q5SA 4PABA 4A3DK 3S1QK 2Y0SL 1B4BA 3H0GA 3ERED 2GSUA 1R9TK 4XSZA 4OIPA 5C4XC 2PPBA 1Y1VK 5M3FK 3TTGA 3BP3A 4LR2A 3GTKK 5C4JK 1WOSA 1GE9A 2GAHC 4AYBD 2R92K
chains in the Genus database with same CATH topology
2JA7A 2XCQA 4GTEA 4FZBA 5CJ9A 1I50A 1WIHA 3G4CA 4KMHA 2Y3PA 2GSOA 4GT9A 2R92A 3QX3A 1XXAA 3GTJA 3NUHA 1O24A 4KM8A 5JFEA 4KM9A 3LAPA 5IOQA 4G0VA 3G4AA 4ILDA 3GTOA 5TJ3A 3VA7A 3Q3QA 3LAJA 2JA6A 2JA5A 2NVYA 4C2MC 1AB4A 4GTBA 1O27A 3AQOA 1K83A 1Y1WA 4BLAA 2CFAA 1KQ4A 4KASA 4BKWA 4DDQA 1BJTA 5EGEA 3V4GA 3FHZA 3OEPA 3LPXA 2RGRA 3N3YA 1WQFA 5JVOA 3L4JA 4FM9A 1WQHA 4LQYA 1O26A 4C3JC 5IOSA 2RH6A 2VUMA 1SFOA 4BLBA 1XXBA 1O2BA 1I3QA 1ZBSA 1O2AA 4KMAA 4KARA 4KC6A 4G0UA 3FKIA 4P5BA 5IOTA 2JH3A 4C3HC 3OPFA 3GTMA 1O29A 3BUEA 4GTDA 2NVXA 1XXCA 1ZVUA 1IS1A 2GSNA 2R7ZA 1WCMA 4GTLA 1ZXOA 1WQGA 3AQPA 4GFQA 2E2HA 1TWFA 2ZFZA 5CHPA 3GTGA 2PHCB 1ISEA 1EK8A 1B4AA 1TWAA 1F9NA 4G0WA 4KDDA 4GTAA 3MMLB 4C3IC 2KWAA 3N0CA 3AH5A 4M1XA 1BGWA 2P5MA 4P5AA 3GTLA 1TWHA 3GTKA 4GTFA 3GTQA 3S0XA 4KB2A 2XCRB 1EH1A 1DD5A 3FOEA 1TWCA 3OREA 2YU9A 2B63A 1TWGA 2CFAB 2XCOA 4KMDA 3CAGA 2R93A 4KAWX 1B4BA 3H0GA 3ERED 2GSUA 4KB4A 5IORA 3FOFA 4J3NA 3CQZA 4GTCA 3N0BA 3GTPA 4LR2A 4KATA 1O28A 1O25A 5EGHA 1R9TA 1GE9A 2E2IA 3L4KA 1Y1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ4 A;  4KAS A;  4GTF A;  3N3Y A;  4GTE A;  4FZB A;  3G4C A;  2CFA B;  4GTL A;  4GT9 A;  1O26 A;  5IOS A;  5CHP A;  1O24 A;  5IOR A;  5JFE A;  5IOQ A;  4GTC A;  1O2B A;  3G4A A;  3N0B A;  1O2A A;  4KAR A;  4P5B A;  5IOT A;  4GTA A;  4KAT A;  1O28 A;  1O25 A;  4GTB A;  1O27 A;  1O29 A;  3N0C A;  4GTD A;  3AH5 A;  2CFA A;  4P5A A; 
#chains in the Genus database with same CATH topology
 4LK1 A;  5M3M K;  3T02 A;  2JA7 A;  5C3E C;  3G4C A;  4QIW L;  3S14 C;  5FLM K;  4GT9 A;  3A8K A;  1F7V A;  1HQM A;  3GTP K;  5IYD C;  2NVY K;  4OIO A;  1I3Q C;  1I6H K;  5IOQ A;  4G0V A;  3G4A A;  1IW7 A;  3S17 K;  5TJ3 A;  1RU0 A;  4A3K K;  2JA8 K;  1I6V A;  4KAS A;  1F93 A;  5EGE A;  3V4G A;  5FJ8 K;  3S1M K;  3S1N C;  4ZH4 A;  1TWF C;  3GTG C;  4NOI A;  5D4D A;  3S16 K;  2NVQ C;  3GTM K;  2EBB A;  5M5W K;  1Y1W K;  1O2B A;  3FKI C;  5IP9 K;  4C2M K;  1I3Q A;  4WJ3 M;  4WJ4 A;  5IYC K;  4AYB L;  2PA8 D;  3HOX C;  1ZQ1 C;  2NVT K;  3AD9 C;  3M4O C;  3DXJ A;  3S2D K;  2B63 C;  4OIN A;  2VUM K;  2A68 A;  4C3J K;  1SFO K;  4JK1 A;  3GSI A;  1ZXO A;  4A93 C;  4O2D A;  3AQP A;  4GFQ A;  3CQZ C;  1TWF A;  1YNN A;  2A69 A;  3GTG A;  1VRQ C;  4MEY A;  1TWA A;  2Y0S D;  3JST A;  4G0W A;  4A3B C;  4GTA A;  4A3J K;  4BBS K;  4A3I C;  2YU9 K;  1DCP A;  1WOP A;  3AH5 A;  2P5M A;  1I50 C;  3EQL A;  4A3M K;  1VJE A;  2V6S A;  3S0X A;  4KB2 A;  3H0G K;  4A3G K;  3S2H C;  1DD5 A;  4G7Z A;  2B63 A;  2O5J A;  2A6E A;  4G7H A;  1XZP A;  3S1R K;  4KAW X;  2P8T A;  4KB4 A;  3M3Y K;  2JA6 C;  3CQZ A;  2PA8 L;  2JA7 K;  4A3F C;  1IE0 A;  2A6H A;  3AD8 C;  3HOV K;  2WB1 D;  4A3C C;  2FQT A;  3TFH A;  2XCQ A;  4XCH A;  1I50 A;  1WIH A;  4KMH A;  2Y3P A;  1EFW A;  4A3L K;  4X6A C;  4MQ9 A;  1XXA A;  5C4X K;  3HKZ L;  4Y7N C;  4KM8 A;  2PMZ D;  2E2J C;  3GEI A;  1XZQ B;  1HI9 A;  1IL2 A;  2JA6 A;  2BE5 A;  2NVX C;  3PO3 K;  1K83 A;  3PO2 C;  3HOU C;  1WCM C;  4QJV A;  1C0A A;  5C3E K;  4BXX C;  2CFA A;  4A3E C;  3FHZ A;  3S14 K;  3HOY C;  4C45 A;  2RGR A;  1USO A;  2E2H C;  4G7O A;  4FM9 A;  3RZO K;  1I3Q K;  5HL8 A;  3GTO K;  5IOS A;  3HOW C;  1XXB A;  1ZBS A;  4XSX A;  2WB1 L;  3GTL C;  2W7V A;  1X31 C;  3GTK C;  2NVX A;  1XXC A;  3GTQ C;  3S1N K;  1WCM A;  4YFN A;  4LJZ A;  1J6V A;  1TWG C;  1TWF K;  3I4N C;  3GTG K;  5L46 A;  4GTL A;  2R93 C;  2NVQ K;  1L0W A;  2E2H A;  2PMZ L;  3HOZ C;  1IBA A;  3FKI K;  4PAA A;  3RZD C;  3ADA C;  1ISE A;  1TWA C;  4KMU A;  3HOX K;  1F7U A;  4Q4Z A;  1XPP A;  4RMF A;  3I4M C;  2E2I C;  5M5Y K;  4C3I C;  4BY1 C;  3M4O K;  2KWA A;  2B63 K;  1BGW A;  5TMC A;  3GTL A;  4MEX A;  4BBR C;  3GTK A;  3GTQ A;  4A93 K;  3TFI A;  2XCR B;  1O2F B;  3ORE A;  1TWG A;  2CFA B;  3CQZ K;  3GTJ C;  3CAG A;  2R93 A;  5E68 A;  5IP7 K;  3AD7 C;  4J3N A;  4A3B K;  4GTC A;  2JA5 C;  3N0B A;  3GTP A;  3HKZ D;  4A3I K;  5M5X K;  1WOO A;  1I50 K;  5IYB C;  1BS2 A;  2E2I A;  3S15 C;  4P9S A;  3S2H K;  1PJ7 A;  1SMY A;  1YCL A;  1PJ6 A;  3QX3 A;  1J6X A;  1VH2 A;  3GTJ A;  2O5I A;  1O24 A;  5JFE A;  4A3F K;  4ILD A;  4YFK A;  4KN7 A;  3VA7 A;  3LAJ A;  1K83 C;  2JA5 A;  4A3C K;  1AB4 A;  3AQO A;  2R7Z C;  1Y1W A;  2CW0 A;  3H3V L;  4BY7 C;  2WAQ L;  4BLA A;  4BKW A;  4DDQ A;  1BJT A;  1UV7 A;  4X6A K;  1WQF A;  4YFX A;  4XLP A;  3L4J A;  4Y7N K;  1O26 A;  5C44 C;  2E2J K;  2VUM A;  1JOE A;  1SFO A;  1O2A A;  4KAR A;  3PO2 K;  3HOU K;  1WCM K;  4G0U A;  1YX2 A;  4BXX K;  4C3H C;  3OPF A;  4A3E K;  3IPJ A;  1O29 A;  1TWH C;  4GTD A;  3HOY K;  1IS1 A;  4LLG A;  2R7Z A;  1VGX A;  1TWC C;  3K7A C;  2E2H K;  4OIQ A;  4Y52 C;  1WQG A;  3HOW K;  5IYD K;  2V6U A;  4A3L C;  1EI6 A;  5CHP A;  4WIL A;  1EK8 A;  3A8J A;  4A3D C;  3S1Q C;  3T00 A;  1V5V A;  1B4A A;  1R9T C;  3GTL K;  1XZP B;  4KDD A;  3GTQ K;  2ZUF A;  1Y1V C;  1J6W A;  1TWG K;  3I4N K;  5C4J C;  4OIR A;  1TWH A;  4GTF A;  1BDF A;  2R93 K;  2R92 C;  1TWC A;  3HOZ K;  1WSR A;  3RZD K;  2D6F C;  3RZO C;  1TWA K;  5FLM C;  3BP8 C;  4YG2 A;  5IOR A;  3GTO C;  3A8I A;  3FOF A;  3I4M K;  3GTP C;  2E2I K;  4BY1 K;  4C3I K;  2NVY C;  1I6H C;  2GAG C;  4KAT A;  1O28 A;  1O25 A;  5EGH A;  1R9T A;  3S17 C;  4BBR K;  1WSV A;  3GEH A;  3L4K A;  1Y1V A;  4A3K C;  4AH6 A;  2JA8 C;  3SZZ A;  3GTJ K;  3H3V D;  2WAQ D;  4GTE A;  4FZB A;  1PJ5 A;  3GDZ A;  5CJ9 A;  4QJV B;  2FQO A;  1G51 A;  2GSO A;  2R92 A;  3SZY A;  4GZY A;  3S1M C;  2JA5 K;  3NUH A;  4KM9 A;  3LAP A;  3S16 C;  1J98 A;  3GTO A;  1INN A;  3GTM C;  3Q3Q A;  5IYB K;  3S15 K;  1Y1W C;  2NVY A;  5IP9 C;  4C2M C;  4GTB A;  1O27 A;  5IYC C;  1KQ4 A;  1IQ0 A;  2NVT C;  3OEP A;  3LPX A;  3N3Y A;  5JVO A;  4LK0 A;  3S2D C;  1WQH A;  1XZQ A;  2VUM C;  4LQY A;  1SFO C;  4C3J C;  2RH6 A;  2JA6 K;  1EQR A;  4BLB A;  1K83 K;  5IP7 C;  4KMA A;  2R7Z K;  4KC6 A;  3FKI A;  1DCH A;  4P5B A;  5IOT A;  2JH3 A;  4BY7 K;  3GTM A;  1JQW A;  3PO3 C;  4LOW A;  3BUE A;  1ZVU A;  4A3J C;  4BBS C;  2GSN A;  5TMF A;  2YU9 C;  1WOR A;  1JVI A;  3GIR A;  4A3M C;  5C44 K;  3GEE A;  1DCO A;  3H0G C;  4A3G C;  4QIW D;  2ZUE A;  2ZFZ A;  4KN4 A;  2PHC B;  3WOD A;  3S1R C;  4C3H K;  2NVX K;  1YNJ A;  1TWH K;  1F9N A;  3M3Y C;  3MML B;  4XLN A;  3T01 A;  3N0C A;  1TWC K;  3K7A K;  1USM A;  2V6T A;  2JA7 C;  4M1X A;  4P5A A;  3HOV C;  1VLO A;  4Y52 K;  3TFJ A;  1ZYR A;  1EH1 A;  3FOE A;  2YU9 A;  3HXA A;  2XCO A;  4KMD A;  4Q5S A;  4PAB A;  4A3D K;  3S1Q K;  2Y0S L;  1B4B A;  3H0G A;  3ERE D;  2GSU A;  1R9T K;  4XSZ A;  4OIP A;  5C4X C;  2PPB A;  1Y1V K;  5M3F K;  3TTG A;  3BP3 A;  4LR2 A;  3GTK K;  5C4J K;  1WOS A;  1GE9 A;  2GAH C;  4AYB D;  2R92 K; 
#chains in the Genus database with same CATH homology
 2JA7 A;  2XCQ A;  4GTE A;  4FZB A;  5CJ9 A;  1I50 A;  1WIH A;  3G4C A;  4KMH A;  2Y3P A;  2GSO A;  4GT9 A;  2R92 A;  3QX3 A;  1XXA A;  3GTJ A;  3NUH A;  1O24 A;  4KM8 A;  5JFE A;  4KM9 A;  3LAP A;  5IOQ A;  4G0V A;  3G4A A;  4ILD A;  3GTO A;  5TJ3 A;  3VA7 A;  3Q3Q A;  3LAJ A;  2JA6 A;  2JA5 A;  2NVY A;  4C2M C;  1AB4 A;  4GTB A;  1O27 A;  3AQO A;  1K83 A;  1Y1W A;  4BLA A;  2CFA A;  1KQ4 A;  4KAS A;  4BKW A;  4DDQ A;  1BJT A;  5EGE A;  3V4G A;  3FHZ A;  3OEP A;  3LPX A;  2RGR A;  3N3Y A;  1WQF A;  5JVO A;  3L4J A;  4FM9 A;  1WQH A;  4LQY A;  1O26 A;  4C3J C;  5IOS A;  2RH6 A;  2VUM A;  1SFO A;  4BLB A;  1XXB A;  1O2B A;  1I3Q A;  1ZBS A;  1O2A A;  4KMA A;  4KAR A;  4KC6 A;  4G0U A;  3FKI A;  4P5B A;  5IOT A;  2JH3 A;  4C3H C;  3OPF A;  3GTM A;  1O29 A;  3BUE A;  4GTD A;  2NVX A;  1XXC A;  1ZVU A;  1IS1 A;  2GSN A;  2R7Z A;  1WCM A;  4GTL A;  1ZXO A;  1WQG A;  3AQP A;  4GFQ A;  2E2H A;  1TWF A;  2ZFZ A;  5CHP A;  3GTG A;  2PHC B;  1ISE A;  1EK8 A;  1B4A A;  1TWA A;  1F9N A;  4G0W A;  4KDD A;  4GTA A;  3MML B;  4C3I C;  2KWA A;  3N0C A;  3AH5 A;  4M1X A;  1BGW A;  2P5M A;  4P5A A;  3GTL A;  1TWH A;  3GTK A;  4GTF A;  3GTQ A;  3S0X A;  4KB2 A;  2XCR B;  1EH1 A;  1DD5 A;  3FOE A;  1TWC A;  3ORE A;  2YU9 A;  2B63 A;  1TWG A;  2CFA B;  2XCO A;  4KMD A;  3CAG A;  2R93 A;  4KAW X;  1B4B A;  3H0G A;  3ERE D;  2GSU A;  4KB4 A;  5IOR A;  3FOF A;  4J3N A;  3CQZ A;  4GTC A;  3N0B A;  3GTP A;  4LR2 A;  4KAT A;  1O28 A;  1O25 A;  5EGH A;  1R9T A;  1GE9 A;  2E2I A;  3L4K A;  1Y1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...