4GTBA

T. maritima fdts with fad, dump, and raltitrexed.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
211
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase thyX
total genus 77
structure length 211
sequence length 216
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtbA00
4P5AA 4GTFA 4GT9A 4KARA 5IORA 5IOSA 5JFEA 3AH5A 4GTAA 5CHPA 4GTBA 4KATA 4KASA 1O29A 1O2AA 3G4AA 4P5BA 1O26A 2CFAA 5IOQA 4GTDA 1O24A 1O28A 1O27A 1O2BA 4GTLA 5IOTA 1KQ4A 3N0CA 3G4CA 1O25A 3N0BA 4FZBA 4GTEA 2CFAB 3N3YA 4GTCA
chains in the Genus database with same CATH superfamily
2NVQC 5JFEA 4A3EK 1TWHK 1K83K 4JK1A 4BLAA 3HOUC 1BDFA 5FJ8K 5C4JC 3H3VL 4XSZA 3S2HK 4Q4ZA 5M5YK 5C4XK 2JA7C 2NVTK 2W7VA 5TJ3A 3HOWC 3FKIA 4Y52K 4BKWA 1C0AA 2XCQA 2NVYC 5C3EK 2PA8L 2JA7K 2V6SA 5C44K 3GTPA 1J6VA 4C3HC 3S2DK 2V6UA 3G4AA 1YX2A 4A93K 2O5JA 2CFAA 2R92A 4X6AK 5EGHA 3T01A 1IE0A 1TWAK 4G7ZA 4A3DC 4AYBD 2E2IK 3HOYC 3PO2K 4WILA 4XLNA 2E2IC 4GZYA 5M5WK 4OIQA 1Y1VK 2PPBA 3CAGA 2JH3A 2JA5C 4BXXK 4A3KC 3S17C 4PAAA 1I3QA 4G0VA 2ZUFA 1WOOA 2VUMC 3S1RK 1O2AA 3S16K 3GTKA 3S1QK 5C44C 3TFIA 4GTDA 5FLMC 2WAQL 3GTMA 3GDZA 1I50K 4G7OA 1IL2A 4LOWA 4KMAA 1BJTA 1XZPA 2R92C 4GTCA 4GFQA 1BGWA 3S1QC 1Y1WK 3M3YC 2R7ZK 1VH2A 5IORA 5IOSA 2D6FC 3AQPA 2EBBA 3S1MK 4A3MC 4YG2A 4BBRC 2JA5A 3V4GA 4KN4A 1IQ0A 2FQOA 4KASA 4P9SA 2NVYA 4KB4A 1XXBA 4OIRA 1O26A 3GTPC 1IBAA 4Q5SA 4A3KK 2GAGC 1R9TC 2R93A 4C3IK 4AH6A 1J6XA 1XXAA 3S15C 3EQLA 4C45A 5CJ9A 2PMZL 2PA8D 2JA6A 4A3FK 4KC6A 5IP9K 1EFWA 3FKIK 4QJVA 2KWAA 5IP9C 3FHZA 5IYDK 2JA7A 3SZYA 3Q3QA 1K83C 1INNA 4A3CC 1TWCA 4OINA 4YFNA 4G7HA 4KMHA 3ERED 5C4XC 1R9TK 1VGXA 3S2HC 3GTGC 5E68A 4KB2A 3HOZC 1WCMC 5IYBC 1ZXOA 3GSIA 4M1XA 1I6HC 1I3QK 4BBRK 1TWFA 3I4NC 1TWCC 1V5VA 3H3VD 1VRQC 4BY7K 3GTPK 1AB4A 3A8KA 4XLPA 1HQMA 1F7VA 4KARA 4LR2A 3GTOA 1B4BA 2R7ZA 1I50C 2B63K 3GTLC 3GTJK 1Y1WC 3M3YK 4LQYA 4G0WA 2RH6A 2JA6C 1L0WA 3RZOK 4A3IK 1XXCA 3AQOA 4LJZA 5IOTA 3MMLB 2WB1D 2PHCB 4A3BC 2CFAB 1XZQB 2NVXK 5TMCA 2XCOA 4DDQA 4BBSK 1F9NA 2R93C 5EGEA 1WIHA 3VA7A 3JSTA 2A69A 4KAWX 2ZFZA 1I50A 4X6AC 2PMZD 3AD7C 4LK0A 3LPXA 3GTGA 1EI6A 1G51A 4KN7A 3HOYK 1PJ5A 1YNNA 3OEPA 1KQ4A 1ZQ1C 1Y1WA 1ZVUA 1IW7A 1EH1A 3GEEA 5C3EC 1DCOA 3NUHA 4P5AA 3M4OC 5M3FK 5IYCC 3PO3C 1B4AA 3FKIC 3BP8C 1EQRA 4C3IC 4Y7NC 5IYDC 2E2HK 4OIOA 2R93K 3FOFA 2YU9C 2E2JK 3M4OK 1I6VA 4XCHA 3A8IA 5TMFA 2NVTC 1TWGC 3DXJA 1GE9A 3L4KA 4WJ3M 4C3JK 1F93A 1TWFK 1SFOK 4BLBA 1DCHA 4O2DA 4YFXA 3GEIA 4A3IC 3AH5A 2O5IA 3CQZA 4A3JC 3S1MC 1WOSA 3S1NC 3GTLK 4C2MC 2GAHC 4ZH4A 2E2HC 1WORA 4Y7NK 3ADAC 3HOVC 3I4MK 4KM9A 4A3GC 3OPFA 2WB1L 2B63A 5IYCK 3PO3K 1O27A 3GTJA 4XSXA 3HKZL 5FLMK 1O25A 4FZBA 4BY7C 1R9TA 1PJ6A 1DD5A 1WSRA 3GTMC 2R7ZC 2VUMK 1YCLA 4GTAA 5HL8A 3PO2C 3H0GC 3HKZD 2NVXA 2A68A 4BXXC 3S1RC 3S16C 4KATA 1J98A 1ZBSA 4MEXA 3S17K 1I6HK 2Y3PA 4GTLA 1WCMK 3LAPA 5L46A 4C3HK 3S2DC 3GTGK 4C3JC 4WJ4A 4A3DK 3GTOK 1SMYA 4KDDA 4G0UA 3I4NK 1ZYRA 3FOEA 2YU9K 4A93C 1UV7A 1VLOA 5IYBK 1O2FB 3H0GA 3HOZK 4Y52C 3IPJA 3GIRA 4A3FC 3TTGA 2CW0A 3A8JA 1EK8A 4QJVB 2P5MA 3HOXK 4A3GK 4QIWL 3GTQC 1WQHA 4KM8A 1XZQA 4GT9A 3TFJA 1SFOA 4A3EC 4FM9A 3GEHA 2E2JC 4J3NA 1XPPA 3T00A 4PABA 3BUEA 2NVQK 2WAQD 3CQZK 1TWGA 5M3MK 3GTQK 3RZDK 2RGRA 1X31C 2GSOA 3GTLA 1O24A 5IP7K 2NVXC 2Y0SL 5IP7C 2R92K 4A3MK 4GTEA 1TWFC 3N3YA 3CQZC 3HOXC 1TWAA 5JVOA 1TWHA 2E2IA 4KMDA 4MQ9A 3S0XA 3AD9C 1YNJA 1K83A 1XZPB 2E2HA 5D4DA 5CHPA 3GTJC 3K7AC 4A3CK 4AYBL 1PJ7A 3S14C 3QX3A 2GSUA 1USOA 3GTOC 4LLGA 3T02A 1J6WA 1USMA 2JA8K 4A3LC 3GTKK 4BBSC 2GSNA 4BY1K 3LAJA 4A3BK 2FQTA 3S15K 1WCMA 1F7UA 4GTFA 1WQGA 3TFHA 1JOEA 4BY1C 1TWAC 2JA8C 4A3LK 2B63C 2JA5K 1ISEA 4RMFA 5IOQA 3H0GK 3L4JA 1O28A 1O2BA 2NVYK 1Y1VA 4ILDA 2Y0SD 3K7AK 1HI9A 3GTKC 2VUMA 3N0BA 4LK1A 1WQFA 3RZOC 3SZZA 2V6TA 5C4JK 2BE5A 1JVIA 5M5XK 3S1NK 1VJEA 3WODA 1RU0A 3HOWK 2P8TA 3HOUK 4GTBA 3S14K 2JA6K 3HXAA 1O29A 2A6EA 1BS2A 1TWHC 4P5BA 3GTMK 4NOIA 3OREA 2XCRB 3HOVK 3I4MC 2ZUEA 4QIWD 4A3JK 1WOPA 2A6HA 1JQWA 4C2MK 1TWGK 3GTQA 1TWCK 3N0CA 4KMUA 3G4CA 4OIPA 1Y1VC 2YU9A 1I3QC 1SFOC 3RZDC 4MEYA 3BP3A 1DCPA 1WSVA 1IS1A 4YFKA 3AD8C
chains in the Genus database with same CATH topology
1WQHA 4P5AA 3NUHA 4KM8A 2JA6A 4GT9A 4KC6A 5JFEA 1SFOA 4FM9A 1B4AA 4J3NA 2KWAA 3FHZA 4C3IC 2JA7A 3BUEA 3Q3QA 4BLAA 1TWGA 3FOFA 2RGRA 1TWCA 2GSOA 3GTLA 1O24A 1GE9A 3L4KA 5TJ3A 4GTEA 4BLBA 3FKIA 3N3YA 4KMHA 4BKWA 3ERED 1TWAA 2XCQA 1TWHA 5JVOA 2E2IA 4KMDA 3S0XA 1K83A 3GTPA 3AH5A 2E2HA 3CQZA 5CHPA 4C3HC 4KB2A 4C2MC 3G4AA 2GSUA 3QX3A 1ZXOA 4M1XA 4KM9A 2CFAA 3OPFA 2R92A 2B63A 1TWFA 5EGHA 1O27A 3GTJA 2GSNA 1O25A 4FZBA 3LAJA 1AB4A 1R9TA 1DD5A 1WCMA 3CAGA 4GTFA 2JH3A 4KARA 4LR2A 1WQGA 4GTAA 3GTOA 1B4BA 2NVXA 2R7ZA 1I3QA 4G0VA 4KATA 3GTKA 1O2AA 1ZBSA 4LQYA 4G0WA 2RH6A 1ISEA 5IOQA 1XXCA 3L4JA 4GTDA 3AQOA 1O28A 2Y3PA 1O2BA 3GTMA 4GTLA 5IOTA 1Y1VA 4ILDA 3MMLB 3LAPA 4KMAA 2VUMA 3N0BA 2PHCB 1WQFA 1BJTA 4C3JC 2CFAB 4GTCA 4GFQA 1BGWA 4KDDA 4G0UA 2XCOA 5IORA 4DDQA 5IOSA 3FOEA 3AQPA 1F9NA 2JA5A 4GTBA 5EGEA 3V4GA 4KASA 3H0GA 1WIHA 1O29A 3VA7A 4KAWX 2NVYA 4KB4A 2ZFZA 4P5BA 1XXBA 1I50A 3OREA 2XCRB 1O26A 3LPXA 3GTGA 2R93A 3OEPA 1KQ4A 3GTQA 1EK8A 1Y1WA 1ZVUA 3N0CA 3G4CA 2P5MA 1EH1A 1XXAA 2YU9A 1IS1A 5CJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5A A;  4GTF A;  4GT9 A;  4KAR A;  5IOR A;  5IOS A;  5JFE A;  3AH5 A;  4GTA A;  5CHP A;  4GTB A;  4KAT A;  4KAS A;  1O29 A;  1O2A A;  3G4A A;  4P5B A;  1O26 A;  2CFA A;  5IOQ A;  4GTD A;  1O24 A;  1O28 A;  1O27 A;  1O2B A;  4GTL A;  5IOT A;  1KQ4 A;  3N0C A;  3G4C A;  1O25 A;  3N0B A;  4FZB A;  4GTE A;  2CFA B;  3N3Y A;  4GTC A; 
#chains in the Genus database with same CATH topology
 2NVQ C;  5JFE A;  4A3E K;  1TWH K;  1K83 K;  4JK1 A;  4BLA A;  3HOU C;  1BDF A;  5FJ8 K;  5C4J C;  3H3V L;  4XSZ A;  3S2H K;  4Q4Z A;  5M5Y K;  5C4X K;  2JA7 C;  2NVT K;  2W7V A;  5TJ3 A;  3HOW C;  3FKI A;  4Y52 K;  4BKW A;  1C0A A;  2XCQ A;  2NVY C;  5C3E K;  2PA8 L;  2JA7 K;  2V6S A;  5C44 K;  3GTP A;  1J6V A;  4C3H C;  3S2D K;  2V6U A;  3G4A A;  1YX2 A;  4A93 K;  2O5J A;  2CFA A;  2R92 A;  4X6A K;  5EGH A;  3T01 A;  1IE0 A;  1TWA K;  4G7Z A;  4A3D C;  4AYB D;  2E2I K;  3HOY C;  3PO2 K;  4WIL A;  4XLN A;  2E2I C;  4GZY A;  5M5W K;  4OIQ A;  1Y1V K;  2PPB A;  3CAG A;  2JH3 A;  2JA5 C;  4BXX K;  4A3K C;  3S17 C;  4PAA A;  1I3Q A;  4G0V A;  2ZUF A;  1WOO A;  2VUM C;  3S1R K;  1O2A A;  3S16 K;  3GTK A;  3S1Q K;  5C44 C;  3TFI A;  4GTD A;  5FLM C;  2WAQ L;  3GTM A;  3GDZ A;  1I50 K;  4G7O A;  1IL2 A;  4LOW A;  4KMA A;  1BJT A;  1XZP A;  2R92 C;  4GTC A;  4GFQ A;  1BGW A;  3S1Q C;  1Y1W K;  3M3Y C;  2R7Z K;  1VH2 A;  5IOR A;  5IOS A;  2D6F C;  3AQP A;  2EBB A;  3S1M K;  4A3M C;  4YG2 A;  4BBR C;  2JA5 A;  3V4G A;  4KN4 A;  1IQ0 A;  2FQO A;  4KAS A;  4P9S A;  2NVY A;  4KB4 A;  1XXB A;  4OIR A;  1O26 A;  3GTP C;  1IBA A;  4Q5S A;  4A3K K;  2GAG C;  1R9T C;  2R93 A;  4C3I K;  4AH6 A;  1J6X A;  1XXA A;  3S15 C;  3EQL A;  4C45 A;  5CJ9 A;  2PMZ L;  2PA8 D;  2JA6 A;  4A3F K;  4KC6 A;  5IP9 K;  1EFW A;  3FKI K;  4QJV A;  2KWA A;  5IP9 C;  3FHZ A;  5IYD K;  2JA7 A;  3SZY A;  3Q3Q A;  1K83 C;  1INN A;  4A3C C;  1TWC A;  4OIN A;  4YFN A;  4G7H A;  4KMH A;  3ERE D;  5C4X C;  1R9T K;  1VGX A;  3S2H C;  3GTG C;  5E68 A;  4KB2 A;  3HOZ C;  1WCM C;  5IYB C;  1ZXO A;  3GSI A;  4M1X A;  1I6H C;  1I3Q K;  4BBR K;  1TWF A;  3I4N C;  1TWC C;  1V5V A;  3H3V D;  1VRQ C;  4BY7 K;  3GTP K;  1AB4 A;  3A8K A;  4XLP A;  1HQM A;  1F7V A;  4KAR A;  4LR2 A;  3GTO A;  1B4B A;  2R7Z A;  1I50 C;  2B63 K;  3GTL C;  3GTJ K;  1Y1W C;  3M3Y K;  4LQY A;  4G0W A;  2RH6 A;  2JA6 C;  1L0W A;  3RZO K;  4A3I K;  1XXC A;  3AQO A;  4LJZ A;  5IOT A;  3MML B;  2WB1 D;  2PHC B;  4A3B C;  2CFA B;  1XZQ B;  2NVX K;  5TMC A;  2XCO A;  4DDQ A;  4BBS K;  1F9N A;  2R93 C;  5EGE A;  1WIH A;  3VA7 A;  3JST A;  2A69 A;  4KAW X;  2ZFZ A;  1I50 A;  4X6A C;  2PMZ D;  3AD7 C;  4LK0 A;  3LPX A;  3GTG A;  1EI6 A;  1G51 A;  4KN7 A;  3HOY K;  1PJ5 A;  1YNN A;  3OEP A;  1KQ4 A;  1ZQ1 C;  1Y1W A;  1ZVU A;  1IW7 A;  1EH1 A;  3GEE A;  5C3E C;  1DCO A;  3NUH A;  4P5A A;  3M4O C;  5M3F K;  5IYC C;  3PO3 C;  1B4A A;  3FKI C;  3BP8 C;  1EQR A;  4C3I C;  4Y7N C;  5IYD C;  2E2H K;  4OIO A;  2R93 K;  3FOF A;  2YU9 C;  2E2J K;  3M4O K;  1I6V A;  4XCH A;  3A8I A;  5TMF A;  2NVT C;  1TWG C;  3DXJ A;  1GE9 A;  3L4K A;  4WJ3 M;  4C3J K;  1F93 A;  1TWF K;  1SFO K;  4BLB A;  1DCH A;  4O2D A;  4YFX A;  3GEI A;  4A3I C;  3AH5 A;  2O5I A;  3CQZ A;  4A3J C;  3S1M C;  1WOS A;  3S1N C;  3GTL K;  4C2M C;  2GAH C;  4ZH4 A;  2E2H C;  1WOR A;  4Y7N K;  3ADA C;  3HOV C;  3I4M K;  4KM9 A;  4A3G C;  3OPF A;  2WB1 L;  2B63 A;  5IYC K;  3PO3 K;  1O27 A;  3GTJ A;  4XSX A;  3HKZ L;  5FLM K;  1O25 A;  4FZB A;  4BY7 C;  1R9T A;  1PJ6 A;  1DD5 A;  1WSR A;  3GTM C;  2R7Z C;  2VUM K;  1YCL A;  4GTA A;  5HL8 A;  3PO2 C;  3H0G C;  3HKZ D;  2NVX A;  2A68 A;  4BXX C;  3S1R C;  3S16 C;  4KAT A;  1J98 A;  1ZBS A;  4MEX A;  3S17 K;  1I6H K;  2Y3P A;  4GTL A;  1WCM K;  3LAP A;  5L46 A;  4C3H K;  3S2D C;  3GTG K;  4C3J C;  4WJ4 A;  4A3D K;  3GTO K;  1SMY A;  4KDD A;  4G0U A;  3I4N K;  1ZYR A;  3FOE A;  2YU9 K;  4A93 C;  1UV7 A;  1VLO A;  5IYB K;  1O2F B;  3H0G A;  3HOZ K;  4Y52 C;  3IPJ A;  3GIR A;  4A3F C;  3TTG A;  2CW0 A;  3A8J A;  1EK8 A;  4QJV B;  2P5M A;  3HOX K;  4A3G K;  4QIW L;  3GTQ C;  1WQH A;  4KM8 A;  1XZQ A;  4GT9 A;  3TFJ A;  1SFO A;  4A3E C;  4FM9 A;  3GEH A;  2E2J C;  4J3N A;  1XPP A;  3T00 A;  4PAB A;  3BUE A;  2NVQ K;  2WAQ D;  3CQZ K;  1TWG A;  5M3M K;  3GTQ K;  3RZD K;  2RGR A;  1X31 C;  2GSO A;  3GTL A;  1O24 A;  5IP7 K;  2NVX C;  2Y0S L;  5IP7 C;  2R92 K;  4A3M K;  4GTE A;  1TWF C;  3N3Y A;  3CQZ C;  3HOX C;  1TWA A;  5JVO A;  1TWH A;  2E2I A;  4KMD A;  4MQ9 A;  3S0X A;  3AD9 C;  1YNJ A;  1K83 A;  1XZP B;  2E2H A;  5D4D A;  5CHP A;  3GTJ C;  3K7A C;  4A3C K;  4AYB L;  1PJ7 A;  3S14 C;  3QX3 A;  2GSU A;  1USO A;  3GTO C;  4LLG A;  3T02 A;  1J6W A;  1USM A;  2JA8 K;  4A3L C;  3GTK K;  4BBS C;  2GSN A;  4BY1 K;  3LAJ A;  4A3B K;  2FQT A;  3S15 K;  1WCM A;  1F7U A;  4GTF A;  1WQG A;  3TFH A;  1JOE A;  4BY1 C;  1TWA C;  2JA8 C;  4A3L K;  2B63 C;  2JA5 K;  1ISE A;  4RMF A;  5IOQ A;  3H0G K;  3L4J A;  1O28 A;  1O2B A;  2NVY K;  1Y1V A;  4ILD A;  2Y0S D;  3K7A K;  1HI9 A;  3GTK C;  2VUM A;  3N0B A;  4LK1 A;  1WQF A;  3RZO C;  3SZZ A;  2V6T A;  5C4J K;  2BE5 A;  1JVI A;  5M5X K;  3S1N K;  1VJE A;  3WOD A;  1RU0 A;  3HOW K;  2P8T A;  3HOU K;  4GTB A;  3S14 K;  2JA6 K;  3HXA A;  1O29 A;  2A6E A;  1BS2 A;  1TWH C;  4P5B A;  3GTM K;  4NOI A;  3ORE A;  2XCR B;  3HOV K;  3I4M C;  2ZUE A;  4QIW D;  4A3J K;  1WOP A;  2A6H A;  1JQW A;  4C2M K;  1TWG K;  3GTQ A;  1TWC K;  3N0C A;  4KMU A;  3G4C A;  4OIP A;  1Y1V C;  2YU9 A;  1I3Q C;  1SFO C;  3RZD C;  4MEY A;  3BP3 A;  1DCP A;  1WSV A;  1IS1 A;  4YFK A;  3AD8 C; 
#chains in the Genus database with same CATH homology
 1WQH A;  4P5A A;  3NUH A;  4KM8 A;  2JA6 A;  4GT9 A;  4KC6 A;  5JFE A;  1SFO A;  4FM9 A;  1B4A A;  4J3N A;  2KWA A;  3FHZ A;  4C3I C;  2JA7 A;  3BUE A;  3Q3Q A;  4BLA A;  1TWG A;  3FOF A;  2RGR A;  1TWC A;  2GSO A;  3GTL A;  1O24 A;  1GE9 A;  3L4K A;  5TJ3 A;  4GTE A;  4BLB A;  3FKI A;  3N3Y A;  4KMH A;  4BKW A;  3ERE D;  1TWA A;  2XCQ A;  1TWH A;  5JVO A;  2E2I A;  4KMD A;  3S0X A;  1K83 A;  3GTP A;  3AH5 A;  2E2H A;  3CQZ A;  5CHP A;  4C3H C;  4KB2 A;  4C2M C;  3G4A A;  2GSU A;  3QX3 A;  1ZXO A;  4M1X A;  4KM9 A;  2CFA A;  3OPF A;  2R92 A;  2B63 A;  1TWF A;  5EGH A;  1O27 A;  3GTJ A;  2GSN A;  1O25 A;  4FZB A;  3LAJ A;  1AB4 A;  1R9T A;  1DD5 A;  1WCM A;  3CAG A;  4GTF A;  2JH3 A;  4KAR A;  4LR2 A;  1WQG A;  4GTA A;  3GTO A;  1B4B A;  2NVX A;  2R7Z A;  1I3Q A;  4G0V A;  4KAT A;  3GTK A;  1O2A A;  1ZBS A;  4LQY A;  4G0W A;  2RH6 A;  1ISE A;  5IOQ A;  1XXC A;  3L4J A;  4GTD A;  3AQO A;  1O28 A;  2Y3P A;  1O2B A;  3GTM A;  4GTL A;  5IOT A;  1Y1V A;  4ILD A;  3MML B;  3LAP A;  4KMA A;  2VUM A;  3N0B A;  2PHC B;  1WQF A;  1BJT A;  4C3J C;  2CFA B;  4GTC A;  4GFQ A;  1BGW A;  4KDD A;  4G0U A;  2XCO A;  5IOR A;  4DDQ A;  5IOS A;  3FOE A;  3AQP A;  1F9N A;  2JA5 A;  4GTB A;  5EGE A;  3V4G A;  4KAS A;  3H0G A;  1WIH A;  1O29 A;  3VA7 A;  4KAW X;  2NVY A;  4KB4 A;  2ZFZ A;  4P5B A;  1XXB A;  1I50 A;  3ORE A;  2XCR B;  1O26 A;  3LPX A;  3GTG A;  2R93 A;  3OEP A;  1KQ4 A;  3GTQ A;  1EK8 A;  1Y1W A;  1ZVU A;  3N0C A;  3G4C A;  2P5M A;  1EH1 A;  1XXA A;  2YU9 A;  1IS1 A;  5CJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...