4GTBA

T. maritima fdts with fad, dump, and raltitrexed.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
211
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase thyX
total genus 77
structure length 211
sequence length 216
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtbA00
2CFAA 5IOQA 1O27A 4GTFA 5IOTA 3N3YA 2CFAB 4GTCA 1O29A 5JFEA 4P5AA 4GTDA 4FZBA 4GTBA 4P5BA 4KATA 4KASA 3AH5A 5IORA 5CHPA 1O26A 4GTEA 4KARA 1O2AA 3G4CA 1KQ4A 1O2BA 4GTLA 3N0BA 1O28A 1O25A 4GTAA 3N0CA 5IOSA 1O24A 3G4AA 4GT9A
chains in the Genus database with same CATH superfamily
1DCOA 5JVOA 3HOWC 1UV7A 2PA8D 1DCPA 2NVQC 4Q5SA 4P5AA 2R92A 1V5VA 3VA7A 5C3EC 3GTMK 2E2HA 4A3LC 1XZQB 5L46A 4GTEA 2NVTC 2NVTK 4AYBD 4A3LK 4Y7NK 4GTLA 5IP9C 2JA8C 3K7AC 1TWFK 1I3QA 1R9TC 4C3HK 3L4KA 2NVQK 4A3CK 4BY7C 1SFOC 4XLPA 2CFAA 2KWAA 1YNNA 4GTFA 3ERED 3RZOC 2PA8L 5TMFA 2VUMC 3LAPA 1WCMA 4GTDA 1YCLA 4O2DA 3GTOK 3I4NC 1O2FB 5M3FK 3BUEA 2Y0SD 1J6WA 3FOEA 4X6AC 1IW7A 3GIRA 4QJVB 5IYDK 2E2HC 3S15C 4BBSC 4BBRC 1WQHA 1DD5A 3BP8C 3PO2K 3N0CA 3S2HK 1ZXOA 3GSIA 2FQTA 3QX3A 5C44C 1R9TA 5CJ9A 2W7VA 5M5XK 3GTQA 3HKZL 5C4XK 1SFOA 2JA6K 1TWCC 4OIRA 4OIPA 5IP7C 4OIOA 4LQYA 1ZVUA 4FZBA 2B63C 2A6EA 4G0VA 5CHPA 4WJ4A 4GZYA 4C2MC 1Y1VA 3LAJA 4Q4ZA 4PAAA 3L4JA 4KN7A 2D6FC 3OPFA 1DCHA 2XCQA 4FM9A 4A3DK 3HOVC 2P8TA 4WILA 1VGXA 1WORA 3OREA 2E2JC 1WCMK 5D4DA 4G7ZA 3GTQC 1IS1A 3GTJC 4KB4A 1TWCA 4GTBA 2JA5K 3FHZA 1J6VA 4AH6A 4BY7K 3GTPK 4LR2A 3GTGA 3CAGA 2P5MA 3TTGA 2ZFZA 1YX2A 2XCOA 4Y7NC 1Y1VC 1O25A 1TWAK 1TWFA 5C44K 1O24A 3G4AA 1I50A 1XXBA 1O27A 3GEHA 4M1XA 1BJTA 1HQMA 4RMFA 4P5BA 2R93A 1WSRA 3HXAA 1TWAC 2NVYC 3GTKA 1I6VA 3GTGK 4LK1A 1EH1A 4MEYA 3S1QK 1TWFC 1R9TK 1TWHA 1WSVA 3HOUK 3GTQK 4PABA 4A93K 1JOEA 2PMZL 4GFQA 4A3FK 1J98A 1WQGA 4KARA 3GEEA 2YU9A 2BE5A 3G4CA 4ZH4A 1KQ4A 3S1NC 1TWAA 3HOWK 1TWHK 3GTLC 3S17C 4C2MK 2NVYA 3S17K 3S2DK 3AD8C 3GTKK 5TJ3A 2B63K 2VUMA 3HOYC 2PPBA 4A3BC 5IOTA 3N3YA 1C0AA 2A68A 5IYCC 1IL2A 2V6UA 1RU0A 1TWGC 2FQOA 1O26A 1WOOA 4A3IK 3HOXC 4NOIA 2WAQD 4G7HA 3PO3K 2E2HK 5IYDC 4BBSK 4ILDA 1IE0A 4OIQA 4KMUA 5M3MK 4BLAA 4QJVA 3S1MK 5TMCA 4A3GK 2GSUA 3Q3QA 2JA5A 1K83C 2B63A 4G0UA 3S2DC 3TFHA 1EK8A 4KC6A 2E2IK 4LLGA 3K7AK 2RH6A 4C3IK 4BY1C 1TWCK 2JA6C 1O28A 1XXAA 3T00A 4A3FC 3T01A 4KN4A 3FKIK 1HI9A 2PMZD 3GEIA 2R93K 3S2HC 3GDZA 3HOUC 2WAQL 1XXCA 3GTJA 2E2IC 1AB4A 5C4JK 2XCRB 2CFAB 1IQ0A 3HKZD 1O29A 5JFEA 1ISEA 1USMA 2JA5C 1K83A 3S14C 4KATA 3GTGC 3DXJA 1F7VA 3GTPA 3RZDK 2E2JK 1Y1WC 3JSTA 3I4MK 1L0WA 2JA7C 4DDQA 4G7OA 4XSZA 2R7ZK 4YFKA 3NUHA 5HL8A 1SFOK 2JA6A 4A3IC 5IOQA 1G51A 3S0XA 4KDDA 2R93C 3FKIA 3T02A 1EFWA 5IP9K 2GAHC 1JVIA 2E2IA 1XZPB 1Y1VK 1YNJA 3M3YK 3A8IA 4BY1K 2RGRA 4LJZA 3EQLA 1BGWA 3GTPC 3A8KA 1VLOA 3H3VL 3AQOA 1VH2A 1Y1WA 3GTJK 2JH3A 1TWHC 2V6SA 3GTLK 3S1NK 2YU9K 4YFNA 3CQZC 4X6AK 3I4NK 1XZPA 4A3DC 4KMAA 2GAGC 4KAWX 4LOWA 4KM9A 4A3JC 3GTMA 1BS2A 5FLMK 3S1RC 2YU9C 3AH5A 4KB2A 4P9SA 2WB1L 4A3KK 3S16C 4C45A 4XLNA 3GTLA 3S1QC 1PJ5A 1TWGK 3AD9C 1PJ6A 3H3VD 4A3CC 3N0BA 2R7ZA 4C3HC 5M5WK 4BXXK 4JK1A 3AQPA 5IYBK 5IYBC 1I6HK 3M3YC 2A69A 1ZQ1C 3CQZA 3AD7C 1EQRA 3H0GC 1TWGA 1IBAA 4QIWD 2GSNA 2WB1D 3S15K 1B4AA 1SMYA 3BP3A 2R92C 1INNA 4A3JK 1WOPA 2JA7K 2Y0SL 1O2BA 3I4MC 1Y1WK 3WODA 4KM8A 4BLBA 3CQZK 3TFIA 1F7UA 1I3QC 3S14K 5EGHA 1BDFA 4MEXA 1F9NA 4Y52K 3OEPA 4QIWL 4KASA 2JA8K 5FJ8K 4YFXA 3H0GA 1WCMC 2NVYK 1I50K 1PJ7A 4KMHA 2ZUFA 5C3EK 4J3NA 4C3IC 3A8JA 3HOVK 3IPJA 2GSOA 1ZBSA 3ADAC 4GTAA 4LK0A 4BKWA 3GTOA 3H0GK 3HOZC 1XPPA 4GTCA 3SZYA 3LPXA 3SZZA 4A3EK 1K83K 4MQ9A 4WJ3M 3M4OK 2NVXK 3RZDC 5IP7K 1GE9A 1I6HC 4C3JC 4OINA 2JA7A 2Y3PA 4A3MK 1WQFA 1J6XA 5C4JC 1USOA 1XZQA 4BBRK 4G0WA 3FKIC 4KMDA 5EGEA 3TFJA 3GTOC 4A3BK 1EI6A 2A6HA 2R92K 4A3EC 3FOFA 2CW0A 2V6TA 2ZUEA 2NVXA 1O2AA 3V4GA 2O5JA 4A3GC 3S1MC 4XSXA 1WIHA 1X31C 1F93A 1VJEA 5C4XC 4BXXC 1I50C 5M5YK 3GTMC 4A93C 2EBBA 3PO3C 4AYBL 3HOXK 1JQWA 3PO2C 1VRQC 4Y52C 3S16K 4A3KC 1B4BA 5IORA 4A3MC 5FLMC 3S1RK 2PHCB 2R7ZC 5IYCK 3MMLB 1I3QK 1WOSA 2O5IA 4XCHA 5E68A 4C3JK 1ZYRA 2NVXC 3M4OC 3HOYK 5IOSA 3GTKC 2VUMK 3RZOK 4YG2A 4GT9A 3HOZK
chains in the Genus database with same CATH topology
1XXBA 1XXCA 5EGHA 3GTJA 1O27A 5JVOA 4M1XA 1AB4A 2XCRB 1BJTA 2CFAB 1F9NA 1O29A 5JFEA 1ISEA 4P5AA 2R92A 3OEPA 1K83A 4P5BA 2R93A 4KATA 4KASA 3VA7A 3GTPA 3H0GA 2E2HA 4GTEA 4KMHA 4GTLA 4J3NA 4C3IC 3GTKA 2GSOA 1ZBSA 4DDQA 1I3QA 1EH1A 3NUHA 4GTAA 3L4KA 4BKWA 2JA6A 3GTOA 2CFAA 2KWAA 5IOQA 3S0XA 1TWHA 4GTFA 3ERED 4KDDA 3FKIA 4GTCA 3LPXA 3LAPA 4GFQA 1WCMA 2E2IA 4GTDA 1GE9A 4C3JC 2RGRA 1WQGA 3BUEA 3FOEA 2JA7A 1BGWA 4KARA 2YU9A 2Y3PA 3G4CA 1KQ4A 1WQFA 1TWAA 1WQHA 3AQOA 2NVYA 1DD5A 1Y1WA 3N0CA 2JH3A 1ZXOA 3QX3A 4G0WA 5TJ3A 1R9TA 2VUMA 5CJ9A 3GTQA 1SFOA 4KMDA 5IOTA 3N3YA 5EGEA 4KMAA 4KAWX 4KM9A 3GTMA 4LQYA 1ZVUA 4FZBA 3AH5A 4KB2A 3FOFA 4G0VA 5CHPA 3GTLA 1O26A 4C2MC 1Y1VA 3LAJA 2NVXA 1O2AA 4ILDA 3L4JA 3N0BA 2R7ZA 3V4GA 4C3HC 3OPFA 2XCQA 4FM9A 3AQPA 4BLAA 1WIHA 2GSUA 3Q3QA 3OREA 2JA5A 2B63A 4G0UA 3CQZA 1IS1A 1TWGA 4KB4A 1TWCA 4GTBA 2GSNA 1B4BA 3FHZA 1EK8A 1B4AA 5IORA 4KC6A 2PHCB 4LR2A 3GTGA 3CAGA 2P5MA 3MMLB 1O2BA 2RH6A 2ZFZA 2XCOA 4KM8A 1O28A 1O25A 1XXAA 4BLBA 5IOSA 1TWFA 1O24A 3G4AA 1I50A 4GT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA A;  5IOQ A;  1O27 A;  4GTF A;  5IOT A;  3N3Y A;  2CFA B;  4GTC A;  1O29 A;  5JFE A;  4P5A A;  4GTD A;  4FZB A;  4GTB A;  4P5B A;  4KAT A;  4KAS A;  3AH5 A;  5IOR A;  5CHP A;  1O26 A;  4GTE A;  4KAR A;  1O2A A;  3G4C A;  1KQ4 A;  1O2B A;  4GTL A;  3N0B A;  1O28 A;  1O25 A;  4GTA A;  3N0C A;  5IOS A;  1O24 A;  3G4A A;  4GT9 A; 
#chains in the Genus database with same CATH topology
 1DCO A;  5JVO A;  3HOW C;  1UV7 A;  2PA8 D;  1DCP A;  2NVQ C;  4Q5S A;  4P5A A;  2R92 A;  1V5V A;  3VA7 A;  5C3E C;  3GTM K;  2E2H A;  4A3L C;  1XZQ B;  5L46 A;  4GTE A;  2NVT C;  2NVT K;  4AYB D;  4A3L K;  4Y7N K;  4GTL A;  5IP9 C;  2JA8 C;  3K7A C;  1TWF K;  1I3Q A;  1R9T C;  4C3H K;  3L4K A;  2NVQ K;  4A3C K;  4BY7 C;  1SFO C;  4XLP A;  2CFA A;  2KWA A;  1YNN A;  4GTF A;  3ERE D;  3RZO C;  2PA8 L;  5TMF A;  2VUM C;  3LAP A;  1WCM A;  4GTD A;  1YCL A;  4O2D A;  3GTO K;  3I4N C;  1O2F B;  5M3F K;  3BUE A;  2Y0S D;  1J6W A;  3FOE A;  4X6A C;  1IW7 A;  3GIR A;  4QJV B;  5IYD K;  2E2H C;  3S15 C;  4BBS C;  4BBR C;  1WQH A;  1DD5 A;  3BP8 C;  3PO2 K;  3N0C A;  3S2H K;  1ZXO A;  3GSI A;  2FQT A;  3QX3 A;  5C44 C;  1R9T A;  5CJ9 A;  2W7V A;  5M5X K;  3GTQ A;  3HKZ L;  5C4X K;  1SFO A;  2JA6 K;  1TWC C;  4OIR A;  4OIP A;  5IP7 C;  4OIO A;  4LQY A;  1ZVU A;  4FZB A;  2B63 C;  2A6E A;  4G0V A;  5CHP A;  4WJ4 A;  4GZY A;  4C2M C;  1Y1V A;  3LAJ A;  4Q4Z A;  4PAA A;  3L4J A;  4KN7 A;  2D6F C;  3OPF A;  1DCH A;  2XCQ A;  4FM9 A;  4A3D K;  3HOV C;  2P8T A;  4WIL A;  1VGX A;  1WOR A;  3ORE A;  2E2J C;  1WCM K;  5D4D A;  4G7Z A;  3GTQ C;  1IS1 A;  3GTJ C;  4KB4 A;  1TWC A;  4GTB A;  2JA5 K;  3FHZ A;  1J6V A;  4AH6 A;  4BY7 K;  3GTP K;  4LR2 A;  3GTG A;  3CAG A;  2P5M A;  3TTG A;  2ZFZ A;  1YX2 A;  2XCO A;  4Y7N C;  1Y1V C;  1O25 A;  1TWA K;  1TWF A;  5C44 K;  1O24 A;  3G4A A;  1I50 A;  1XXB A;  1O27 A;  3GEH A;  4M1X A;  1BJT A;  1HQM A;  4RMF A;  4P5B A;  2R93 A;  1WSR A;  3HXA A;  1TWA C;  2NVY C;  3GTK A;  1I6V A;  3GTG K;  4LK1 A;  1EH1 A;  4MEY A;  3S1Q K;  1TWF C;  1R9T K;  1TWH A;  1WSV A;  3HOU K;  3GTQ K;  4PAB A;  4A93 K;  1JOE A;  2PMZ L;  4GFQ A;  4A3F K;  1J98 A;  1WQG A;  4KAR A;  3GEE A;  2YU9 A;  2BE5 A;  3G4C A;  4ZH4 A;  1KQ4 A;  3S1N C;  1TWA A;  3HOW K;  1TWH K;  3GTL C;  3S17 C;  4C2M K;  2NVY A;  3S17 K;  3S2D K;  3AD8 C;  3GTK K;  5TJ3 A;  2B63 K;  2VUM A;  3HOY C;  2PPB A;  4A3B C;  5IOT A;  3N3Y A;  1C0A A;  2A68 A;  5IYC C;  1IL2 A;  2V6U A;  1RU0 A;  1TWG C;  2FQO A;  1O26 A;  1WOO A;  4A3I K;  3HOX C;  4NOI A;  2WAQ D;  4G7H A;  3PO3 K;  2E2H K;  5IYD C;  4BBS K;  4ILD A;  1IE0 A;  4OIQ A;  4KMU A;  5M3M K;  4BLA A;  4QJV A;  3S1M K;  5TMC A;  4A3G K;  2GSU A;  3Q3Q A;  2JA5 A;  1K83 C;  2B63 A;  4G0U A;  3S2D C;  3TFH A;  1EK8 A;  4KC6 A;  2E2I K;  4LLG A;  3K7A K;  2RH6 A;  4C3I K;  4BY1 C;  1TWC K;  2JA6 C;  1O28 A;  1XXA A;  3T00 A;  4A3F C;  3T01 A;  4KN4 A;  3FKI K;  1HI9 A;  2PMZ D;  3GEI A;  2R93 K;  3S2H C;  3GDZ A;  3HOU C;  2WAQ L;  1XXC A;  3GTJ A;  2E2I C;  1AB4 A;  5C4J K;  2XCR B;  2CFA B;  1IQ0 A;  3HKZ D;  1O29 A;  5JFE A;  1ISE A;  1USM A;  2JA5 C;  1K83 A;  3S14 C;  4KAT A;  3GTG C;  3DXJ A;  1F7V A;  3GTP A;  3RZD K;  2E2J K;  1Y1W C;  3JST A;  3I4M K;  1L0W A;  2JA7 C;  4DDQ A;  4G7O A;  4XSZ A;  2R7Z K;  4YFK A;  3NUH A;  5HL8 A;  1SFO K;  2JA6 A;  4A3I C;  5IOQ A;  1G51 A;  3S0X A;  4KDD A;  2R93 C;  3FKI A;  3T02 A;  1EFW A;  5IP9 K;  2GAH C;  1JVI A;  2E2I A;  1XZP B;  1Y1V K;  1YNJ A;  3M3Y K;  3A8I A;  4BY1 K;  2RGR A;  4LJZ A;  3EQL A;  1BGW A;  3GTP C;  3A8K A;  1VLO A;  3H3V L;  3AQO A;  1VH2 A;  1Y1W A;  3GTJ K;  2JH3 A;  1TWH C;  2V6S A;  3GTL K;  3S1N K;  2YU9 K;  4YFN A;  3CQZ C;  4X6A K;  3I4N K;  1XZP A;  4A3D C;  4KMA A;  2GAG C;  4KAW X;  4LOW A;  4KM9 A;  4A3J C;  3GTM A;  1BS2 A;  5FLM K;  3S1R C;  2YU9 C;  3AH5 A;  4KB2 A;  4P9S A;  2WB1 L;  4A3K K;  3S16 C;  4C45 A;  4XLN A;  3GTL A;  3S1Q C;  1PJ5 A;  1TWG K;  3AD9 C;  1PJ6 A;  3H3V D;  4A3C C;  3N0B A;  2R7Z A;  4C3H C;  5M5W K;  4BXX K;  4JK1 A;  3AQP A;  5IYB K;  5IYB C;  1I6H K;  3M3Y C;  2A69 A;  1ZQ1 C;  3CQZ A;  3AD7 C;  1EQR A;  3H0G C;  1TWG A;  1IBA A;  4QIW D;  2GSN A;  2WB1 D;  3S15 K;  1B4A A;  1SMY A;  3BP3 A;  2R92 C;  1INN A;  4A3J K;  1WOP A;  2JA7 K;  2Y0S L;  1O2B A;  3I4M C;  1Y1W K;  3WOD A;  4KM8 A;  4BLB A;  3CQZ K;  3TFI A;  1F7U A;  1I3Q C;  3S14 K;  5EGH A;  1BDF A;  4MEX A;  1F9N A;  4Y52 K;  3OEP A;  4QIW L;  4KAS A;  2JA8 K;  5FJ8 K;  4YFX A;  3H0G A;  1WCM C;  2NVY K;  1I50 K;  1PJ7 A;  4KMH A;  2ZUF A;  5C3E K;  4J3N A;  4C3I C;  3A8J A;  3HOV K;  3IPJ A;  2GSO A;  1ZBS A;  3ADA C;  4GTA A;  4LK0 A;  4BKW A;  3GTO A;  3H0G K;  3HOZ C;  1XPP A;  4GTC A;  3SZY A;  3LPX A;  3SZZ A;  4A3E K;  1K83 K;  4MQ9 A;  4WJ3 M;  3M4O K;  2NVX K;  3RZD C;  5IP7 K;  1GE9 A;  1I6H C;  4C3J C;  4OIN A;  2JA7 A;  2Y3P A;  4A3M K;  1WQF A;  1J6X A;  5C4J C;  1USO A;  1XZQ A;  4BBR K;  4G0W A;  3FKI C;  4KMD A;  5EGE A;  3TFJ A;  3GTO C;  4A3B K;  1EI6 A;  2A6H A;  2R92 K;  4A3E C;  3FOF A;  2CW0 A;  2V6T A;  2ZUE A;  2NVX A;  1O2A A;  3V4G A;  2O5J A;  4A3G C;  3S1M C;  4XSX A;  1WIH A;  1X31 C;  1F93 A;  1VJE A;  5C4X C;  4BXX C;  1I50 C;  5M5Y K;  3GTM C;  4A93 C;  2EBB A;  3PO3 C;  4AYB L;  3HOX K;  1JQW A;  3PO2 C;  1VRQ C;  4Y52 C;  3S16 K;  4A3K C;  1B4B A;  5IOR A;  4A3M C;  5FLM C;  3S1R K;  2PHC B;  2R7Z C;  5IYC K;  3MML B;  1I3Q K;  1WOS A;  2O5I A;  4XCH A;  5E68 A;  4C3J K;  1ZYR A;  2NVX C;  3M4O C;  3HOY K;  5IOS A;  3GTK C;  2VUM K;  3RZO K;  4YG2 A;  4GT9 A;  3HOZ K; 
#chains in the Genus database with same CATH homology
 1XXB A;  1XXC A;  5EGH A;  3GTJ A;  1O27 A;  5JVO A;  4M1X A;  1AB4 A;  2XCR B;  1BJT A;  2CFA B;  1F9N A;  1O29 A;  5JFE A;  1ISE A;  4P5A A;  2R92 A;  3OEP A;  1K83 A;  4P5B A;  2R93 A;  4KAT A;  4KAS A;  3VA7 A;  3GTP A;  3H0G A;  2E2H A;  4GTE A;  4KMH A;  4GTL A;  4J3N A;  4C3I C;  3GTK A;  2GSO A;  1ZBS A;  4DDQ A;  1I3Q A;  1EH1 A;  3NUH A;  4GTA A;  3L4K A;  4BKW A;  2JA6 A;  3GTO A;  2CFA A;  2KWA A;  5IOQ A;  3S0X A;  1TWH A;  4GTF A;  3ERE D;  4KDD A;  3FKI A;  4GTC A;  3LPX A;  3LAP A;  4GFQ A;  1WCM A;  2E2I A;  4GTD A;  1GE9 A;  4C3J C;  2RGR A;  1WQG A;  3BUE A;  3FOE A;  2JA7 A;  1BGW A;  4KAR A;  2YU9 A;  2Y3P A;  3G4C A;  1KQ4 A;  1WQF A;  1TWA A;  1WQH A;  3AQO A;  2NVY A;  1DD5 A;  1Y1W A;  3N0C A;  2JH3 A;  1ZXO A;  3QX3 A;  4G0W A;  5TJ3 A;  1R9T A;  2VUM A;  5CJ9 A;  3GTQ A;  1SFO A;  4KMD A;  5IOT A;  3N3Y A;  5EGE A;  4KMA A;  4KAW X;  4KM9 A;  3GTM A;  4LQY A;  1ZVU A;  4FZB A;  3AH5 A;  4KB2 A;  3FOF A;  4G0V A;  5CHP A;  3GTL A;  1O26 A;  4C2M C;  1Y1V A;  3LAJ A;  2NVX A;  1O2A A;  4ILD A;  3L4J A;  3N0B A;  2R7Z A;  3V4G A;  4C3H C;  3OPF A;  2XCQ A;  4FM9 A;  3AQP A;  4BLA A;  1WIH A;  2GSU A;  3Q3Q A;  3ORE A;  2JA5 A;  2B63 A;  4G0U A;  3CQZ A;  1IS1 A;  1TWG A;  4KB4 A;  1TWC A;  4GTB A;  2GSN A;  1B4B A;  3FHZ A;  1EK8 A;  1B4A A;  5IOR A;  4KC6 A;  2PHC B;  4LR2 A;  3GTG A;  3CAG A;  2P5M A;  3MML B;  1O2B A;  2RH6 A;  2ZFZ A;  2XCO A;  4KM8 A;  1O28 A;  1O25 A;  1XXA A;  4BLB A;  5IOS A;  1TWF A;  1O24 A;  3G4A A;  1I50 A;  4GT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...