4GTBA

T. maritima fdts with fad, dump, and raltitrexed.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
216
structure length
211
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 77
structure length 211
sequence length 216
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtbA00
1O27A 1O26A 4P5AA 1O24A 4GTDA 5CHPA 5IOQA 1O28A 4FZBA 1O25A 4GTFA 3N0BA 1KQ4A 1O2AA 3G4AA 4GT9A 4P5BA 4GTAA 1O2BA 2CFAB 4GTCA 4GTEA 5IOTA 3AH5A 4KARA 4GTLA 3N0CA 5JFEA 5IOSA 4KATA 3G4CA 3N3YA 4GTBA 4KASA 1O29A 2CFAA 5IORA
chains in the Genus database with same CATH superfamily
3GTPA 4G0WA 1J6WA 1TWAC 2R93A 2E2HA 1VJEA 1WCMA 4BLAA 4P5BA 3S1QK 4FM9A 5C4JK 5IP9K 3S17C 4OINA 4A3CC 4A3JK 5IYDK 1EFWA 1SMYA 4WJ3M 4GTBA 3HXAA 4Y7NK 4RMFA 3IPJA 2WAQL 4C2MC 4BY7K 3GTJA 1I3QC 2R92K 1EI6A 4KMUA 1J98A 4A3KC 1WCMC 4A3DK 3GTKK 3GTGK 2O5IA 1DCHA 3S2HC 4A3IC 2E2JK 2NVYA 3CAGA 2JA8C 4OIPA 3BP8C 3HKZL 4LR2A 1I50A 3GTLA 3M4OK 2PMZL 4Q5SA 4OIRA 4O2DA 2E2IC 4XCHA 3T01A 3GIRA 3HOVK 4C3HK 4G0VA 5D4DA 1O24A 2JA5K 1IBAA 3ADAC 2NVTC 3S0XA 5FLMC 5C4XC 1R9TK 3OREA 1USOA 1RU0A 3HOYK 3HKZD 3VA7A 1WOSA 1YNJA 3DXJA 1USMA 5IYBC 4AH6A 5FJ8K 4G7ZA 4MEYA 2FQOA 5JFEA 4P9SA 1HQMA 4QJVB 3TFIA 1O27A 1XZQA 1TWGA 1TWFA 1PJ7A 5IP7K 2PA8D 4C3IK 4QIWL 3GTGA 5HL8A 1F9NA 2R7ZK 1IL2A 3S1QC 3AD9C 5C4JC 3LPXA 5C3EK 4XSXA 3GTOA 1VRQC 5EGHA 5IP9C 3S2DK 4A3JC 5IYDC 1JOEA 5M5YK 3V4GA 4LK1A 1GE9A 4ILDA 4KN4A 4Y7NC 4C3JK 4BY7C 1XXAA 2R92C 2V6TA 3EQLA 4A3FK 3AQPA 4A3DC 3GTKC 3GTGC 2JA5A 2RH6A 4QIWD 2E2JC 2O5JA 1UV7A 3G4AA 3SZYA 4LJZA 2CFAB 3M4OC 1TWAA 1WSRA 4NOIA 3HOVC 4C3HC 1XZPB 3HOZK 2JA7K 4KDDA 3RZOK 2JA5C 4KC6A 1B4AA 2A6HA 1F7VA 1R9TC 1WOPA 4M1XA 2YU9K 4WJ4A 2Y0SL 3HOYC 2GSNA 3GSIA 1I3QA 1EH1A 3PO2K 1WIHA 1O2BA 1TWHK 1X31C 3GEHA 4GTCA 4A93K 1IQ0A 1SFOK 4JK1A 4KARA 1PJ5A 3M3YK 1DCOA 3N0CA 3TFJA 3GEIA 3N3YA 5IP7C 2RGRA 4C3IC 3HOUK 2E2IA 1JQWA 1VH2A 5CHPA 1F7UA 2R7ZC 4YFNA 2Y0SD 4PABA 3S15K 1BGWA 5C3EC 3TTGA 3S2DC 3GEEA 4KM9A 1J6VA 4KB4A 5M5WK 4YFXA 3L4JA 4C3JC 3HOXK 2W7VA 4A3FC 1K83K 1ZXOA 2GSUA 4KATA 1I6HK 2XCRB 3K7AK 4LLGA 4J3NA 4XLNA 2PA8L 2P8TA 1WSVA 3RZDK 4LOWA 4BLBA 3AQOA 4A3MK 3FOEA 2B63K 1C0AA 3HOZC 2JA7C 2PPBA 5JVOA 3RZOC 1SFOA 4G7HA 3A8KA 4BKWA 5IOSA 5M3FK 3JSTA 3I4MK 3SZZA 4YG2A 2GSOA 3TFHA 2YU9C 3A8JA 4Q4ZA 3GTMK 2VUMK 2R92A 3H0GK 1O28A 1ZQ1C 3PO2C 2NVQK 1WQGA 1O25A 1Y1VK 3FKIK 3GTKA 1TWHC 1XPPA 4A93C 2JA6K 4BBSK 1SFOC 4GTAA 3M3YC 1YCLA 3GDZA 3GTQK 5M3MK 1O2FB 2Y3PA 2JH3A 3OPFA 4A3EK 3HOUC 2NVXK 1ZVUA 4KASA 3S15C 3OEPA 2D6FC 3NUHA 3GTPK 3S1NK 3AD8C 1TWCK 4FZBA 2R93K 2E2HK 1R9TA 2A6EA 3HOXC 1IW7A 1Y1WK 4MQ9A 2EBBA 2B63A 1K83C 4BBRK 4X6AK 1I6HC 1WQFA 3LAPA 3K7AC 4KMHA 3S14K 5IORA 3GTJK 2P5MA 3RZDC 3LAJA 3HOWK 4A3MC 4BXXK 4BY1K 4G0UA 3I4NK 4GTFA 2B63C 2R7ZA 4QJVA 3CQZK 2NVYK 1I50K 1XXBA 3GTLK 3PO3K 3I4MC 5CJ9A 2XCOA 3WODA 3GTMC 2VUMC 1O29A 3H0GC 2ZUEA 3FHZA 3BP3A 2NVQC 4A3BK 3FKIC 1Y1VC 3Q3QA 5M5XK 1JVIA 1TWCA 2PHCB 2JA6C 4BBSC 1XXCA 5L46A 4KN7A 4A3GK 3GTQC 1Y1WA 1BDFA 5EGEA 4A3EC 1XZQB 4AYBD 1DD5A 2NVXC 3S1MK 1L0WA 5TJ3A 2JA7A 3GTPC 3S1NC 4Y52K 4ZH4A 1G51A 1ZYRA 1TWCC 2CFAA 5IOQA 1TWGK 2V6SA 1TWFK 2GAHC 1O26A 1AB4A 1YNNA 1ZBSA 4KAWX 2R93C 2E2HC 4LQYA 2YU9A 1PJ6A 1XZPA 3MMLB 2ZFZA 1Y1WC 1IS1A 5IYCK 1HI9A 4BBRC 3GTOK 3CQZA 4X6AC 2FQTA 1VGXA 1INNA 3L4KA 1J6XA 1TWHA 4KM8A 3S14C 2XCQA 1V5VA 4GTLA 3S1RK 4A3LK 2V6UA 3GTJC 2WAQD 4KMDA 3QX3A 4OIQA 1ISEA 3HOWC 1BJTA 4BXXC 4BY1C 3FOFA 4KB2A 5C44K 3I4NC 1VLOA 4G7OA 3T00A 4GFQA 1F93A 3CQZC 2KWAA 2NVYC 3S16C 2GAGC 1I50C 3GTLC 3N0BA 1KQ4A 1O2AA 1WORA 4GT9A 4OIOA 1TWAK 3PO3C 1YX2A 4YFKA 5IOTA 3AH5A 2PMZD 1K83A 4XSZA 4A3BC 3S17K 4A3CK 3AD7C 4MEXA 4A3GC 4C2MK 4GZYA 1I3QK 1WQHA 1B4BA 4C45A 4A3KK 1WCMK 5TMCA 1WOOA 2ZUFA 3S1MC 3H3VL 3A8IA 2A69A 3S2HK 2WB1L 4A3IK 4Y52C 2JA8K 1I6VA 1DCPA 1TWGC 1TWFC 4LK0A 2E2IK 4P5AA 3GTMA 2VUMA 4GTDA 5IYCC 3T02A 3H0GA 3GTOC 2A68A 4KMAA 1BS2A 1Y1VA 3FKIA 4WILA 1IE0A 2NVTK 3BUEA 4PAAA 2JA6A 5FLMK 5C4XK 1EQRA 4DDQA 3H3VD 2WB1D 4GTEA 3S16K 3S1RC 2BE5A 4A3LC 4AYBL 3GTQA 3ERED 5IYBK 5E68A 5TMFA 4XLPA 2NVXA 3G4CA 1EK8A 5C44C 2CW0A
chains in the Genus database with same CATH topology
1O26A 1AB4A 1ZBSA 4KAWX 3GTPA 2JA5A 2R92A 2RH6A 4LQYA 4G0WA 1O28A 2YU9A 1WQGA 3MMLB 1O25A 2ZFZA 1IS1A 3GTKA 2R93A 2E2HA 1WCMA 4BLAA 3G4AA 3CQZA 4P5BA 4GTAA 2CFAB 1TWAA 3L4KA 1TWHA 4FM9A 2Y3PA 2JH3A 3OPFA 4KM8A 4C3HC 2XCQA 4GTLA 4KDDA 1ZVUA 4KMDA 4GTBA 4KASA 4KC6A 3QX3A 3OEPA 4C2MC 1ISEA 3NUHA 1B4AA 1BJTA 3FOFA 3GTJA 4KB2A 4M1XA 4GFQA 4FZBA 2KWAA 2GSNA 1I3QA 1EH1A 3N0BA 1R9TA 1KQ4A 1O2AA 4GT9A 1O2BA 1WIHA 2NVYA 3CAGA 2B63A 4GTCA 1I50A 4LR2A 5IOTA 3GTLA 3AH5A 1WQFA 4KARA 3N0CA 1K83A 3LAPA 4KMHA 3N3YA 4G0VA 2RGRA 4C3IC 5IORA 2E2IA 1O24A 5CHPA 2P5MA 3LAJA 1BGWA 3S0XA 4G0UA 1WQHA 4GTFA 1B4BA 2R7ZA 4KM9A 3OREA 4KB4A 3VA7A 1XXBA 3L4JA 4C3JC 1ZXOA 5CJ9A 2XCOA 5JFEA 2GSUA 4KATA 1O29A 2XCRB 3FHZA 1O27A 4P5AA 1TWGA 3GTMA 1TWFA 2VUMA 3Q3QA 4GTDA 1TWCA 5IOQA 2PHCB 3H0GA 4J3NA 1XXCA 3GTGA 1F9NA 4KMAA 3FKIA 1Y1VA 4BLBA 3AQOA 3BUEA 3LPXA 1Y1WA 2JA6A 3GTOA 5EGHA 5EGEA 4DDQA 3FOEA 4GTEA 1DD5A 5JVOA 3V4GA 1SFOA 1GE9A 3GTQA 3ERED 4ILDA 5TJ3A 4BKWA 5IOSA 2JA7A 1XXAA 2NVXA 3G4CA 1EK8A 2GSOA 3AQPA 2CFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O27 A;  1O26 A;  4P5A A;  1O24 A;  4GTD A;  5CHP A;  5IOQ A;  1O28 A;  4FZB A;  1O25 A;  4GTF A;  3N0B A;  1KQ4 A;  1O2A A;  3G4A A;  4GT9 A;  4P5B A;  4GTA A;  1O2B A;  2CFA B;  4GTC A;  4GTE A;  5IOT A;  3AH5 A;  4KAR A;  4GTL A;  3N0C A;  5JFE A;  5IOS A;  4KAT A;  3G4C A;  3N3Y A;  4GTB A;  4KAS A;  1O29 A;  2CFA A;  5IOR A; 
#chains in the Genus database with same CATH topology
 3GTP A;  4G0W A;  1J6W A;  1TWA C;  2R93 A;  2E2H A;  1VJE A;  1WCM A;  4BLA A;  4P5B A;  3S1Q K;  4FM9 A;  5C4J K;  5IP9 K;  3S17 C;  4OIN A;  4A3C C;  4A3J K;  5IYD K;  1EFW A;  1SMY A;  4WJ3 M;  4GTB A;  3HXA A;  4Y7N K;  4RMF A;  3IPJ A;  2WAQ L;  4C2M C;  4BY7 K;  3GTJ A;  1I3Q C;  2R92 K;  1EI6 A;  4KMU A;  1J98 A;  4A3K C;  1WCM C;  4A3D K;  3GTK K;  3GTG K;  2O5I A;  1DCH A;  3S2H C;  4A3I C;  2E2J K;  2NVY A;  3CAG A;  2JA8 C;  4OIP A;  3BP8 C;  3HKZ L;  4LR2 A;  1I50 A;  3GTL A;  3M4O K;  2PMZ L;  4Q5S A;  4OIR A;  4O2D A;  2E2I C;  4XCH A;  3T01 A;  3GIR A;  3HOV K;  4C3H K;  4G0V A;  5D4D A;  1O24 A;  2JA5 K;  1IBA A;  3ADA C;  2NVT C;  3S0X A;  5FLM C;  5C4X C;  1R9T K;  3ORE A;  1USO A;  1RU0 A;  3HOY K;  3HKZ D;  3VA7 A;  1WOS A;  1YNJ A;  3DXJ A;  1USM A;  5IYB C;  4AH6 A;  5FJ8 K;  4G7Z A;  4MEY A;  2FQO A;  5JFE A;  4P9S A;  1HQM A;  4QJV B;  3TFI A;  1O27 A;  1XZQ A;  1TWG A;  1TWF A;  1PJ7 A;  5IP7 K;  2PA8 D;  4C3I K;  4QIW L;  3GTG A;  5HL8 A;  1F9N A;  2R7Z K;  1IL2 A;  3S1Q C;  3AD9 C;  5C4J C;  3LPX A;  5C3E K;  4XSX A;  3GTO A;  1VRQ C;  5EGH A;  5IP9 C;  3S2D K;  4A3J C;  5IYD C;  1JOE A;  5M5Y K;  3V4G A;  4LK1 A;  1GE9 A;  4ILD A;  4KN4 A;  4Y7N C;  4C3J K;  4BY7 C;  1XXA A;  2R92 C;  2V6T A;  3EQL A;  4A3F K;  3AQP A;  4A3D C;  3GTK C;  3GTG C;  2JA5 A;  2RH6 A;  4QIW D;  2E2J C;  2O5J A;  1UV7 A;  3G4A A;  3SZY A;  4LJZ A;  2CFA B;  3M4O C;  1TWA A;  1WSR A;  4NOI A;  3HOV C;  4C3H C;  1XZP B;  3HOZ K;  2JA7 K;  4KDD A;  3RZO K;  2JA5 C;  4KC6 A;  1B4A A;  2A6H A;  1F7V A;  1R9T C;  1WOP A;  4M1X A;  2YU9 K;  4WJ4 A;  2Y0S L;  3HOY C;  2GSN A;  3GSI A;  1I3Q A;  1EH1 A;  3PO2 K;  1WIH A;  1O2B A;  1TWH K;  1X31 C;  3GEH A;  4GTC A;  4A93 K;  1IQ0 A;  1SFO K;  4JK1 A;  4KAR A;  1PJ5 A;  3M3Y K;  1DCO A;  3N0C A;  3TFJ A;  3GEI A;  3N3Y A;  5IP7 C;  2RGR A;  4C3I C;  3HOU K;  2E2I A;  1JQW A;  1VH2 A;  5CHP A;  1F7U A;  2R7Z C;  4YFN A;  2Y0S D;  4PAB A;  3S15 K;  1BGW A;  5C3E C;  3TTG A;  3S2D C;  3GEE A;  4KM9 A;  1J6V A;  4KB4 A;  5M5W K;  4YFX A;  3L4J A;  4C3J C;  3HOX K;  2W7V A;  4A3F C;  1K83 K;  1ZXO A;  2GSU A;  4KAT A;  1I6H K;  2XCR B;  3K7A K;  4LLG A;  4J3N A;  4XLN A;  2PA8 L;  2P8T A;  1WSV A;  3RZD K;  4LOW A;  4BLB A;  3AQO A;  4A3M K;  3FOE A;  2B63 K;  1C0A A;  3HOZ C;  2JA7 C;  2PPB A;  5JVO A;  3RZO C;  1SFO A;  4G7H A;  3A8K A;  4BKW A;  5IOS A;  5M3F K;  3JST A;  3I4M K;  3SZZ A;  4YG2 A;  2GSO A;  3TFH A;  2YU9 C;  3A8J A;  4Q4Z A;  3GTM K;  2VUM K;  2R92 A;  3H0G K;  1O28 A;  1ZQ1 C;  3PO2 C;  2NVQ K;  1WQG A;  1O25 A;  1Y1V K;  3FKI K;  3GTK A;  1TWH C;  1XPP A;  4A93 C;  2JA6 K;  4BBS K;  1SFO C;  4GTA A;  3M3Y C;  1YCL A;  3GDZ A;  3GTQ K;  5M3M K;  1O2F B;  2Y3P A;  2JH3 A;  3OPF A;  4A3E K;  3HOU C;  2NVX K;  1ZVU A;  4KAS A;  3S15 C;  3OEP A;  2D6F C;  3NUH A;  3GTP K;  3S1N K;  3AD8 C;  1TWC K;  4FZB A;  2R93 K;  2E2H K;  1R9T A;  2A6E A;  3HOX C;  1IW7 A;  1Y1W K;  4MQ9 A;  2EBB A;  2B63 A;  1K83 C;  4BBR K;  4X6A K;  1I6H C;  1WQF A;  3LAP A;  3K7A C;  4KMH A;  3S14 K;  5IOR A;  3GTJ K;  2P5M A;  3RZD C;  3LAJ A;  3HOW K;  4A3M C;  4BXX K;  4BY1 K;  4G0U A;  3I4N K;  4GTF A;  2B63 C;  2R7Z A;  4QJV A;  3CQZ K;  2NVY K;  1I50 K;  1XXB A;  3GTL K;  3PO3 K;  3I4M C;  5CJ9 A;  2XCO A;  3WOD A;  3GTM C;  2VUM C;  1O29 A;  3H0G C;  2ZUE A;  3FHZ A;  3BP3 A;  2NVQ C;  4A3B K;  3FKI C;  1Y1V C;  3Q3Q A;  5M5X K;  1JVI A;  1TWC A;  2PHC B;  2JA6 C;  4BBS C;  1XXC A;  5L46 A;  4KN7 A;  4A3G K;  3GTQ C;  1Y1W A;  1BDF A;  5EGE A;  4A3E C;  1XZQ B;  4AYB D;  1DD5 A;  2NVX C;  3S1M K;  1L0W A;  5TJ3 A;  2JA7 A;  3GTP C;  3S1N C;  4Y52 K;  4ZH4 A;  1G51 A;  1ZYR A;  1TWC C;  2CFA A;  5IOQ A;  1TWG K;  2V6S A;  1TWF K;  2GAH C;  1O26 A;  1AB4 A;  1YNN A;  1ZBS A;  4KAW X;  2R93 C;  2E2H C;  4LQY A;  2YU9 A;  1PJ6 A;  1XZP A;  3MML B;  2ZFZ A;  1Y1W C;  1IS1 A;  5IYC K;  1HI9 A;  4BBR C;  3GTO K;  3CQZ A;  4X6A C;  2FQT A;  1VGX A;  1INN A;  3L4K A;  1J6X A;  1TWH A;  4KM8 A;  3S14 C;  2XCQ A;  1V5V A;  4GTL A;  3S1R K;  4A3L K;  2V6U A;  3GTJ C;  2WAQ D;  4KMD A;  3QX3 A;  4OIQ A;  1ISE A;  3HOW C;  1BJT A;  4BXX C;  4BY1 C;  3FOF A;  4KB2 A;  5C44 K;  3I4N C;  1VLO A;  4G7O A;  3T00 A;  4GFQ A;  1F93 A;  3CQZ C;  2KWA A;  2NVY C;  3S16 C;  2GAG C;  1I50 C;  3GTL C;  3N0B A;  1KQ4 A;  1O2A A;  1WOR A;  4GT9 A;  4OIO A;  1TWA K;  3PO3 C;  1YX2 A;  4YFK A;  5IOT A;  3AH5 A;  2PMZ D;  1K83 A;  4XSZ A;  4A3B C;  3S17 K;  4A3C K;  3AD7 C;  4MEX A;  4A3G C;  4C2M K;  4GZY A;  1I3Q K;  1WQH A;  1B4B A;  4C45 A;  4A3K K;  1WCM K;  5TMC A;  1WOO A;  2ZUF A;  3S1M C;  3H3V L;  3A8I A;  2A69 A;  3S2H K;  2WB1 L;  4A3I K;  4Y52 C;  2JA8 K;  1I6V A;  1DCP A;  1TWG C;  1TWF C;  4LK0 A;  2E2I K;  4P5A A;  3GTM A;  2VUM A;  4GTD A;  5IYC C;  3T02 A;  3H0G A;  3GTO C;  2A68 A;  4KMA A;  1BS2 A;  1Y1V A;  3FKI A;  4WIL A;  1IE0 A;  2NVT K;  3BUE A;  4PAA A;  2JA6 A;  5FLM K;  5C4X K;  1EQR A;  4DDQ A;  3H3V D;  2WB1 D;  4GTE A;  3S16 K;  3S1R C;  2BE5 A;  4A3L C;  4AYB L;  3GTQ A;  3ERE D;  5IYB K;  5E68 A;  5TMF A;  4XLP A;  2NVX A;  3G4C A;  1EK8 A;  5C44 C;  2CW0 A; 
#chains in the Genus database with same CATH homology
 1O26 A;  1AB4 A;  1ZBS A;  4KAW X;  3GTP A;  2JA5 A;  2R92 A;  2RH6 A;  4LQY A;  4G0W A;  1O28 A;  2YU9 A;  1WQG A;  3MML B;  1O25 A;  2ZFZ A;  1IS1 A;  3GTK A;  2R93 A;  2E2H A;  1WCM A;  4BLA A;  3G4A A;  3CQZ A;  4P5B A;  4GTA A;  2CFA B;  1TWA A;  3L4K A;  1TWH A;  4FM9 A;  2Y3P A;  2JH3 A;  3OPF A;  4KM8 A;  4C3H C;  2XCQ A;  4GTL A;  4KDD A;  1ZVU A;  4KMD A;  4GTB A;  4KAS A;  4KC6 A;  3QX3 A;  3OEP A;  4C2M C;  1ISE A;  3NUH A;  1B4A A;  1BJT A;  3FOF A;  3GTJ A;  4KB2 A;  4M1X A;  4GFQ A;  4FZB A;  2KWA A;  2GSN A;  1I3Q A;  1EH1 A;  3N0B A;  1R9T A;  1KQ4 A;  1O2A A;  4GT9 A;  1O2B A;  1WIH A;  2NVY A;  3CAG A;  2B63 A;  4GTC A;  1I50 A;  4LR2 A;  5IOT A;  3GTL A;  3AH5 A;  1WQF A;  4KAR A;  3N0C A;  1K83 A;  3LAP A;  4KMH A;  3N3Y A;  4G0V A;  2RGR A;  4C3I C;  5IOR A;  2E2I A;  1O24 A;  5CHP A;  2P5M A;  3LAJ A;  1BGW A;  3S0X A;  4G0U A;  1WQH A;  4GTF A;  1B4B A;  2R7Z A;  4KM9 A;  3ORE A;  4KB4 A;  3VA7 A;  1XXB A;  3L4J A;  4C3J C;  1ZXO A;  5CJ9 A;  2XCO A;  5JFE A;  2GSU A;  4KAT A;  1O29 A;  2XCR B;  3FHZ A;  1O27 A;  4P5A A;  1TWG A;  3GTM A;  1TWF A;  2VUM A;  3Q3Q A;  4GTD A;  1TWC A;  5IOQ A;  2PHC B;  3H0G A;  4J3N A;  1XXC A;  3GTG A;  1F9N A;  4KMA A;  3FKI A;  1Y1V A;  4BLB A;  3AQO A;  3BUE A;  3LPX A;  1Y1W A;  2JA6 A;  3GTO A;  5EGH A;  5EGE A;  4DDQ A;  3FOE A;  4GTE A;  1DD5 A;  5JVO A;  3V4G A;  1SFO A;  1GE9 A;  3GTQ A;  3ERE D;  4ILD A;  5TJ3 A;  4BKW A;  5IOS A;  2JA7 A;  1XXA A;  2NVX A;  3G4C A;  1EK8 A;  2GSO A;  3AQP A;  2CFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...