1O25A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with dump at 2.4 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
214
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 73
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o25A00
1KQ4A 1O2AA 2CFAB 4KATA 4P5AA 4GT9A 1O24A 5IOSA 3G4AA 5JFEA 1O25A 5CHPA 1O26A 2CFAA 4P5BA 4GTEA 4GTDA 5IOTA 4GTCA 1O27A 5IOQA 3AH5A 3N0BA 4GTBA 4KARA 5IORA 3N0CA 4GTAA 1O29A 3G4CA 3N3YA 1O28A 4GTFA 4KASA 4FZBA 1O2BA 4GTLA
chains in the Genus database with same CATH superfamily
2VUMA 3S17K 4GT9A 2NVYA 3H0GK 4KMHA 4YFKA 3ERED 2GSOA 4GTDA 3AQOA 1ZYRA 3I4NC 4Y52K 1VH2A 2NVTK 1J98A 3S17C 2XCOA 2JA5A 1JQWA 3HOVK 4KASA 1TWHK 1V5VA 1XZQB 4A3LK 2WB1D 4KMUA 2WAQD 1F7VA 5IP9K 1F9NA 5TMFA 2PA8D 1GE9A 2NVTC 5M5YK 4GZYA 1TWFK 1SFOA 3HOVC 3AH5A 1R9TA 4BKWA 2JA6A 2YU9K 2WB1L 4A3LC 3N3YA 1Y1WC 5IP9C 2PA8L 3AD7C 3CQZK 3HOYC 3GEEA 4GTLA 4LQYA 3JSTA 4KC6A 4A3CK 1TWFC 4A3EC 5JVOA 2B63A 3QX3A 3GTPA 4BLAA 4YFNA 3S1NC 2E2HK 4OIRA 3M3YK 1Y1WA 5IOQA 1O2FB 1WCMA 5IYBK 4KDDA 3CQZC 2D6FC 2V6TA 5IP7C 2E2JK 2JA8K 4A3CC 1JOEA 2ZUFA 5C4JC 5M3FK 4FM9A 4O2DA 1BGWA 3GTOA 5TMCA 3A8KA 1G51A 3K7AK 2E2HC 5C44C 1KQ4A 3M3YC 2R92K 3GTQA 3EQLA 3GTJC 5IYBC 2R93K 2PPBA 1Y1VK 4BY7C 1O24A 2E2JC 3LAPA 2PHCB 3GTGA 1RU0A 1X31C 1XZPB 2NVXC 1I6HK 3HXAA 1I50C 2XCQA 3BP8C 3L4KA 3K7AC 3N0BA 4Q5SA 1WOOA 1YNNA 2R93C 4G0WA 1DCPA 2VUMK 2NVYK 4FZBA 3S2DK 1J6WA 5C3EK 1I50A 3HOXK 4A3BK 1I6HC 4MEYA 3CAGA 1HQMA 5IOSA 1BDFA 1JVIA 3TFJA 5IYDK 1F7UA 1YNJA 4G0UA 2JA7C 5TJ3A 2VUMC 2RGRA 3A8IA 3PO3K 1DCHA 2NVYC 4XLPA 3FKIA 3N0CA 3S2DC 5L46A 4A3IK 2JA5K 1INNA 1DCOA 3HOXC 4A3BC 1WSVA 2V6SA 2JA7A 4KATA 3PO3C 1ZXOA 4ILDA 3S1RK 4DDQA 1SFOK 4A3IC 2JA5C 2E2IA 1YCLA 1I6VA 1R9TK 5EGEA 3WODA 1IL2A 4A3FC 1XXBA 1VLOA 1TWGA 4KB4A 4PABA 3SZYA 3S0XA 3S1RC 4LR2A 1SFOC 1F93A 4LJZA 4A3GK 4KM9A 2B63K 3GTPK 1R9TC 2JA6C 1EH1A 4LK1A 4QJVB 1Y1WK 3S16K 5JFEA 4AYBD 3HOYK 1WCMK 5CHPA 3RZOC 4A3EK 1WORA 1XXAA 2R7ZA 4A3GC 2B63C 3M4OK 3GDZA 3GTPC 3G4CA 3S1NK 3GTOK 4YG2A 4A3KK 1IQ0A 2WAQL 4GTFA 5HL8A 3S16C 3GTQK 4WJ4A 1USMA 1WCMC 4Q4ZA 3FHZA 4A3MC 5IP7K 1O2AA 2CFAB 1BS2A 2W7VA 4BXXK 4P5AA 1B4AA 3S2HK 1EQRA 5C4JK 4BY1C 3AQPA 4G7OA 3GTGK 3AD9C 3GTKC 3GSIA 3FOFA 3M4OC 1B4BA 3GTOC 4A3KC 2ZFZA 5C44K 4XSZA 4MEXA 1SMYA 1VRQC 4KB2A 3AD8C 3GTJK 3GTQC 2XCRB 5IORA 4BY7K 3OREA 1IBAA 1TWCA 4BXXC 1BJTA 3S2HC 4OIOA 3GTKA 3S15K 3GTGC 2NVXK 1I50K 1WOPA 1O2BA 3S1QC 3HKZD 1ISEA 2GAGC 3S15C 3FKIK 5CJ9A 4KARA 1PJ5A 2PMZD 3HKZL 4GTAA 3TFIA 3HOWK 3L4JA 2YU9A 1VJEA 1PJ6A 2JA7K 4BBSK 3S14K 4P9SA 3FKIC 4A3JC 1WIHA 3GTLA 2A6EA 3HOWC 4YFXA 1XZQA 4XSXA 1J6XA 4BBSC 4LLGA 3S14C 2V6UA 4G7ZA 4A93K 3GTMA 1J6VA 1O29A 1YX2A 2E2IC 1WQHA 3TTGA 4C3IK 2Y0SD 5M3MK 1USOA 1I3QC 3BP3A 1EFWA 4OINA 4KM8A 3RZDK 4A3FK 2R92A 1TWGC 4OIQA 1Y1VA 4A93C 4M1XA 2JA6K 5EGHA 1I3QA 4C3IC 3Q3QA 1K83C 3RZDC 3T02A 3PO2C 4PAAA 3RZOK 2O5JA 4OIPA 4A3DK 1UV7A 2R7ZC 4C3HC 4LOWA 1HI9A 5E68A 1C0AA 1K83A 2GSNA 5M5XK 1TWAA 4KN4A 3T00A 1IW7A 4A3MK 4C3JK 5IOTA 1O27A 4C2MK 1TWCK 4BY1K 4XLNA 3HOUK 3GTKK 4A3DC 1IE0A 4QIWD 1WSRA 3H0GC 2NVQK 1XZPA 3LAJA 4KN7A 3FOEA 5D4DA 1EK8A 4AYBL 4KAWX 2P8TA 4MQ9A 1ZBSA 4C3JC 4Y52C 4C2MC 1TWCC 2P5MA 3HOUC 1ZQ1C 3G4AA 3SZZA 4QIWL 3H0GA 1O25A 2RH6A 2NVQC 3S1QK 3OEPA 4RMFA 4AH6A 4KMAA 1TWHC 1WQFA 5C4XK 4XCHA 5FLMK 1DD5A 1XXCA 4Y7NK 1IS1A 5IYCK 4G7HA 3NUHA 2A6HA 3GTLK 4ZH4A 1TWHA 2A68A 3GIRA 2YU9C 5C4XC 4C45A 5FJ8K 2FQTA 2BE5A 3DXJA 5FLMC 1O26A 3GEHA 4P5BA 4X6AK 4Y7NC 3TFHA 3GTMK 5IYCC 3BUEA 4A3JK 1WOSA 1TWFA 3GEIA 4KMDA 3V4GA 3GTLC 1ZVUA 2KWAA 3H3VD 3S1MK 1WQGA 4X6AC 3CQZA 3GTMC 2GAHC 2E2IK 2JA8C 2PMZL 4GFQA 2Y3PA 4NOIA 2CW0A 1I3QK 4GTEA 3A8JA 2EBBA 4GTCA 2E2HA 3H3VL 1PJ7A 3HOZK 2O5IA 4QJVA 4GTBA 3VA7A 2JH3A 3S1MC 2R92C 1TWGK 3GTJA 1Y1VC 3T01A 4BLBA 4LK0A 4BBRK 1L0WA 2NVXA 4JK1A 1VGXA 1K83K 1XPPA 3I4MK 1TWAK 3PO2K 3HOZC 1EI6A 2R93A 3OPFA 2CFAA 1AB4A 4J3NA 2ZUEA 2GSUA 2R7ZK 4C3HK 2A69A 4G0VA 4BBRC 2Y0SL 3I4MC 5C3EC 3LPXA 2FQOA 1TWAC 3IPJA 3MMLB 1O28A 4WJ3M 3ADAC 5M5WK 4WILA 5IYDC 3I4NK
chains in the Genus database with same CATH topology
4KAWX 1ZBSA 2VUMA 4C3JC 4GT9A 2NVYA 1ISEA 1I50A 4C2MC 2P5MA 4KMHA 3CAGA 3ERED 5IOSA 3G4AA 2GSOA 3H0GA 1O25A 2RH6A 4G0UA 3OEPA 4GTDA 3AQOA 5TJ3A 5CJ9A 4KMAA 2RGRA 1WQFA 4KARA 3FKIA 3N0CA 4GTAA 3L4JA 1DD5A 2YU9A 1XXCA 1IS1A 2XCOA 2JA5A 4KASA 3NUHA 2JA7A 4KATA 1WIHA 1TWHA 1ZXOA 1F9NA 4ILDA 3GTLA 4DDQA 1GE9A 2E2IA 1O26A 4P5BA 1SFOA 5EGEA 3BUEA 1TWFA 3AH5A 4BKWA 4KMDA 1R9TA 2JA6A 1XXBA 3GTMA 3V4GA 1O29A 3N3YA 1TWGA 1ZVUA 2KWAA 4KB4A 1WQHA 3S0XA 4LR2A 4KM9A 1WQGA 4GTLA 4LQYA 4KC6A 4KM8A 1EK8A 5JVOA 3CQZA 2B63A 3QX3A 1EH1A 2R92A 3GTPA 4BLAA 1Y1VA 4GFQA 2Y3PA 5JFEA 5CHPA 4GTEA 1Y1WA 4M1XA 4GTCA 5IOQA 2E2HA 1XXAA 1WCMA 5EGHA 4KDDA 1I3QA 4C3IC 2R7ZA 3Q3QA 4GTBA 3VA7A 2JH3A 3GTJA 3G4CA 4FM9A 1BGWA 4BLBA 4GTFA 3GTOA 2NVXA 1KQ4A 3FHZA 4C3HC 1O2AA 2CFAB 4P5AA 1B4AA 3GTQA 3AQPA 1K83A 2GSNA 3FOFA 1O24A 1TWAA 3LAPA 1B4BA 2PHCB 3GTGA 2R93A 3OPFA 2CFAA 1AB4A 4J3NA 2ZFZA 2GSUA 5IOTA 1O27A 4KB2A 4G0VA 2XCQA 3L4KA 3N0BA 5IORA 2XCRB 3OREA 1TWCA 1BJTA 3LPXA 3MMLB 3LAJA 3GTKA 1O28A 4G0WA 3FOEA 4FZBA 1O2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ4 A;  1O2A A;  2CFA B;  4KAT A;  4P5A A;  4GT9 A;  1O24 A;  5IOS A;  3G4A A;  5JFE A;  1O25 A;  5CHP A;  1O26 A;  2CFA A;  4P5B A;  4GTE A;  4GTD A;  5IOT A;  4GTC A;  1O27 A;  5IOQ A;  3AH5 A;  3N0B A;  4GTB A;  4KAR A;  5IOR A;  3N0C A;  4GTA A;  1O29 A;  3G4C A;  3N3Y A;  1O28 A;  4GTF A;  4KAS A;  4FZB A;  1O2B A;  4GTL A; 
#chains in the Genus database with same CATH topology
 2VUM A;  3S17 K;  4GT9 A;  2NVY A;  3H0G K;  4KMH A;  4YFK A;  3ERE D;  2GSO A;  4GTD A;  3AQO A;  1ZYR A;  3I4N C;  4Y52 K;  1VH2 A;  2NVT K;  1J98 A;  3S17 C;  2XCO A;  2JA5 A;  1JQW A;  3HOV K;  4KAS A;  1TWH K;  1V5V A;  1XZQ B;  4A3L K;  2WB1 D;  4KMU A;  2WAQ D;  1F7V A;  5IP9 K;  1F9N A;  5TMF A;  2PA8 D;  1GE9 A;  2NVT C;  5M5Y K;  4GZY A;  1TWF K;  1SFO A;  3HOV C;  3AH5 A;  1R9T A;  4BKW A;  2JA6 A;  2YU9 K;  2WB1 L;  4A3L C;  3N3Y A;  1Y1W C;  5IP9 C;  2PA8 L;  3AD7 C;  3CQZ K;  3HOY C;  3GEE A;  4GTL A;  4LQY A;  3JST A;  4KC6 A;  4A3C K;  1TWF C;  4A3E C;  5JVO A;  2B63 A;  3QX3 A;  3GTP A;  4BLA A;  4YFN A;  3S1N C;  2E2H K;  4OIR A;  3M3Y K;  1Y1W A;  5IOQ A;  1O2F B;  1WCM A;  5IYB K;  4KDD A;  3CQZ C;  2D6F C;  2V6T A;  5IP7 C;  2E2J K;  2JA8 K;  4A3C C;  1JOE A;  2ZUF A;  5C4J C;  5M3F K;  4FM9 A;  4O2D A;  1BGW A;  3GTO A;  5TMC A;  3A8K A;  1G51 A;  3K7A K;  2E2H C;  5C44 C;  1KQ4 A;  3M3Y C;  2R92 K;  3GTQ A;  3EQL A;  3GTJ C;  5IYB C;  2R93 K;  2PPB A;  1Y1V K;  4BY7 C;  1O24 A;  2E2J C;  3LAP A;  2PHC B;  3GTG A;  1RU0 A;  1X31 C;  1XZP B;  2NVX C;  1I6H K;  3HXA A;  1I50 C;  2XCQ A;  3BP8 C;  3L4K A;  3K7A C;  3N0B A;  4Q5S A;  1WOO A;  1YNN A;  2R93 C;  4G0W A;  1DCP A;  2VUM K;  2NVY K;  4FZB A;  3S2D K;  1J6W A;  5C3E K;  1I50 A;  3HOX K;  4A3B K;  1I6H C;  4MEY A;  3CAG A;  1HQM A;  5IOS A;  1BDF A;  1JVI A;  3TFJ A;  5IYD K;  1F7U A;  1YNJ A;  4G0U A;  2JA7 C;  5TJ3 A;  2VUM C;  2RGR A;  3A8I A;  3PO3 K;  1DCH A;  2NVY C;  4XLP A;  3FKI A;  3N0C A;  3S2D C;  5L46 A;  4A3I K;  2JA5 K;  1INN A;  1DCO A;  3HOX C;  4A3B C;  1WSV A;  2V6S A;  2JA7 A;  4KAT A;  3PO3 C;  1ZXO A;  4ILD A;  3S1R K;  4DDQ A;  1SFO K;  4A3I C;  2JA5 C;  2E2I A;  1YCL A;  1I6V A;  1R9T K;  5EGE A;  3WOD A;  1IL2 A;  4A3F C;  1XXB A;  1VLO A;  1TWG A;  4KB4 A;  4PAB A;  3SZY A;  3S0X A;  3S1R C;  4LR2 A;  1SFO C;  1F93 A;  4LJZ A;  4A3G K;  4KM9 A;  2B63 K;  3GTP K;  1R9T C;  2JA6 C;  1EH1 A;  4LK1 A;  4QJV B;  1Y1W K;  3S16 K;  5JFE A;  4AYB D;  3HOY K;  1WCM K;  5CHP A;  3RZO C;  4A3E K;  1WOR A;  1XXA A;  2R7Z A;  4A3G C;  2B63 C;  3M4O K;  3GDZ A;  3GTP C;  3G4C A;  3S1N K;  3GTO K;  4YG2 A;  4A3K K;  1IQ0 A;  2WAQ L;  4GTF A;  5HL8 A;  3S16 C;  3GTQ K;  4WJ4 A;  1USM A;  1WCM C;  4Q4Z A;  3FHZ A;  4A3M C;  5IP7 K;  1O2A A;  2CFA B;  1BS2 A;  2W7V A;  4BXX K;  4P5A A;  1B4A A;  3S2H K;  1EQR A;  5C4J K;  4BY1 C;  3AQP A;  4G7O A;  3GTG K;  3AD9 C;  3GTK C;  3GSI A;  3FOF A;  3M4O C;  1B4B A;  3GTO C;  4A3K C;  2ZFZ A;  5C44 K;  4XSZ A;  4MEX A;  1SMY A;  1VRQ C;  4KB2 A;  3AD8 C;  3GTJ K;  3GTQ C;  2XCR B;  5IOR A;  4BY7 K;  3ORE A;  1IBA A;  1TWC A;  4BXX C;  1BJT A;  3S2H C;  4OIO A;  3GTK A;  3S15 K;  3GTG C;  2NVX K;  1I50 K;  1WOP A;  1O2B A;  3S1Q C;  3HKZ D;  1ISE A;  2GAG C;  3S15 C;  3FKI K;  5CJ9 A;  4KAR A;  1PJ5 A;  2PMZ D;  3HKZ L;  4GTA A;  3TFI A;  3HOW K;  3L4J A;  2YU9 A;  1VJE A;  1PJ6 A;  2JA7 K;  4BBS K;  3S14 K;  4P9S A;  3FKI C;  4A3J C;  1WIH A;  3GTL A;  2A6E A;  3HOW C;  4YFX A;  1XZQ A;  4XSX A;  1J6X A;  4BBS C;  4LLG A;  3S14 C;  2V6U A;  4G7Z A;  4A93 K;  3GTM A;  1J6V A;  1O29 A;  1YX2 A;  2E2I C;  1WQH A;  3TTG A;  4C3I K;  2Y0S D;  5M3M K;  1USO A;  1I3Q C;  3BP3 A;  1EFW A;  4OIN A;  4KM8 A;  3RZD K;  4A3F K;  2R92 A;  1TWG C;  4OIQ A;  1Y1V A;  4A93 C;  4M1X A;  2JA6 K;  5EGH A;  1I3Q A;  4C3I C;  3Q3Q A;  1K83 C;  3RZD C;  3T02 A;  3PO2 C;  4PAA A;  3RZO K;  2O5J A;  4OIP A;  4A3D K;  1UV7 A;  2R7Z C;  4C3H C;  4LOW A;  1HI9 A;  5E68 A;  1C0A A;  1K83 A;  2GSN A;  5M5X K;  1TWA A;  4KN4 A;  3T00 A;  1IW7 A;  4A3M K;  4C3J K;  5IOT A;  1O27 A;  4C2M K;  1TWC K;  4BY1 K;  4XLN A;  3HOU K;  3GTK K;  4A3D C;  1IE0 A;  4QIW D;  1WSR A;  3H0G C;  2NVQ K;  1XZP A;  3LAJ A;  4KN7 A;  3FOE A;  5D4D A;  1EK8 A;  4AYB L;  4KAW X;  2P8T A;  4MQ9 A;  1ZBS A;  4C3J C;  4Y52 C;  4C2M C;  1TWC C;  2P5M A;  3HOU C;  1ZQ1 C;  3G4A A;  3SZZ A;  4QIW L;  3H0G A;  1O25 A;  2RH6 A;  2NVQ C;  3S1Q K;  3OEP A;  4RMF A;  4AH6 A;  4KMA A;  1TWH C;  1WQF A;  5C4X K;  4XCH A;  5FLM K;  1DD5 A;  1XXC A;  4Y7N K;  1IS1 A;  5IYC K;  4G7H A;  3NUH A;  2A6H A;  3GTL K;  4ZH4 A;  1TWH A;  2A68 A;  3GIR A;  2YU9 C;  5C4X C;  4C45 A;  5FJ8 K;  2FQT A;  2BE5 A;  3DXJ A;  5FLM C;  1O26 A;  3GEH A;  4P5B A;  4X6A K;  4Y7N C;  3TFH A;  3GTM K;  5IYC C;  3BUE A;  4A3J K;  1WOS A;  1TWF A;  3GEI A;  4KMD A;  3V4G A;  3GTL C;  1ZVU A;  2KWA A;  3H3V D;  3S1M K;  1WQG A;  4X6A C;  3CQZ A;  3GTM C;  2GAH C;  2E2I K;  2JA8 C;  2PMZ L;  4GFQ A;  2Y3P A;  4NOI A;  2CW0 A;  1I3Q K;  4GTE A;  3A8J A;  2EBB A;  4GTC A;  2E2H A;  3H3V L;  1PJ7 A;  3HOZ K;  2O5I A;  4QJV A;  4GTB A;  3VA7 A;  2JH3 A;  3S1M C;  2R92 C;  1TWG K;  3GTJ A;  1Y1V C;  3T01 A;  4BLB A;  4LK0 A;  4BBR K;  1L0W A;  2NVX A;  4JK1 A;  1VGX A;  1K83 K;  1XPP A;  3I4M K;  1TWA K;  3PO2 K;  3HOZ C;  1EI6 A;  2R93 A;  3OPF A;  2CFA A;  1AB4 A;  4J3N A;  2ZUE A;  2GSU A;  2R7Z K;  4C3H K;  2A69 A;  4G0V A;  4BBR C;  2Y0S L;  3I4M C;  5C3E C;  3LPX A;  2FQO A;  1TWA C;  3IPJ A;  3MML B;  1O28 A;  4WJ3 M;  3ADA C;  5M5W K;  4WIL A;  5IYD C;  3I4N K; 
#chains in the Genus database with same CATH homology
 4KAW X;  1ZBS A;  2VUM A;  4C3J C;  4GT9 A;  2NVY A;  1ISE A;  1I50 A;  4C2M C;  2P5M A;  4KMH A;  3CAG A;  3ERE D;  5IOS A;  3G4A A;  2GSO A;  3H0G A;  1O25 A;  2RH6 A;  4G0U A;  3OEP A;  4GTD A;  3AQO A;  5TJ3 A;  5CJ9 A;  4KMA A;  2RGR A;  1WQF A;  4KAR A;  3FKI A;  3N0C A;  4GTA A;  3L4J A;  1DD5 A;  2YU9 A;  1XXC A;  1IS1 A;  2XCO A;  2JA5 A;  4KAS A;  3NUH A;  2JA7 A;  4KAT A;  1WIH A;  1TWH A;  1ZXO A;  1F9N A;  4ILD A;  3GTL A;  4DDQ A;  1GE9 A;  2E2I A;  1O26 A;  4P5B A;  1SFO A;  5EGE A;  3BUE A;  1TWF A;  3AH5 A;  4BKW A;  4KMD A;  1R9T A;  2JA6 A;  1XXB A;  3GTM A;  3V4G A;  1O29 A;  3N3Y A;  1TWG A;  1ZVU A;  2KWA A;  4KB4 A;  1WQH A;  3S0X A;  4LR2 A;  4KM9 A;  1WQG A;  4GTL A;  4LQY A;  4KC6 A;  4KM8 A;  1EK8 A;  5JVO A;  3CQZ A;  2B63 A;  3QX3 A;  1EH1 A;  2R92 A;  3GTP A;  4BLA A;  1Y1V A;  4GFQ A;  2Y3P A;  5JFE A;  5CHP A;  4GTE A;  1Y1W A;  4M1X A;  4GTC A;  5IOQ A;  2E2H A;  1XXA A;  1WCM A;  5EGH A;  4KDD A;  1I3Q A;  4C3I C;  2R7Z A;  3Q3Q A;  4GTB A;  3VA7 A;  2JH3 A;  3GTJ A;  3G4C A;  4FM9 A;  1BGW A;  4BLB A;  4GTF A;  3GTO A;  2NVX A;  1KQ4 A;  3FHZ A;  4C3H C;  1O2A A;  2CFA B;  4P5A A;  1B4A A;  3GTQ A;  3AQP A;  1K83 A;  2GSN A;  3FOF A;  1O24 A;  1TWA A;  3LAP A;  1B4B A;  2PHC B;  3GTG A;  2R93 A;  3OPF A;  2CFA A;  1AB4 A;  4J3N A;  2ZFZ A;  2GSU A;  5IOT A;  1O27 A;  4KB2 A;  4G0V A;  2XCQ A;  3L4K A;  3N0B A;  5IOR A;  2XCR B;  3ORE A;  1TWC A;  1BJT A;  3LPX A;  3MML B;  3LAJ A;  3GTK A;  1O28 A;  4G0W A;  3FOE A;  4FZB A;  1O2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...