1O25A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with dump at 2.4 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
214
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 73
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o25A00
4GTCA 1O2AA 1O26A 4P5BA 5IOQA 4GTLA 3AH5A 1KQ4A 2CFAB 4GTEA 1O28A 4KARA 5CHPA 1O24A 3G4CA 3N0BA 4GTBA 3G4AA 5JFEA 1O27A 4GTAA 4GT9A 5IOSA 4GTFA 5IOTA 4FZBA 1O25A 4KATA 1O29A 1O2BA 4P5AA 2CFAA 5IORA 3N0CA 4GTDA 3N3YA 4KASA
chains in the Genus database with same CATH superfamily
3H0GA 1Y1WA 3S1RC 1TWFA 4BY1K 2JA5K 2XCRB 3DXJA 3AQPA 3LAJA 4A3BK 1O24A 3GTJA 4GT9A 3GTPA 3S1MK 2XCOA 2R92C 2YU9A 3FKIA 4Y52K 4C2MK 2PA8D 2R7ZC 1Y1VC 4G7OA 4LR2A 3GTJC 2CW0A 1IQ0A 4A3KK 2R7ZK 5FLMC 3AD9C 4WILA 3RZOK 4YFKA 3OEPA 4PAAA 4G7ZA 3T00A 3HOWC 5C4JC 5IYDK 3S16C 4C3IC 1F7VA 1XZPB 2GAGC 2A69A 3S14C 2RH6A 4WJ4A 3OPFA 1PJ6A 1TWGA 1O25A 4G0WA 1O29A 3WODA 3FKIC 2R93A 3I4MC 1IL2A 3GTPC 2B63A 4A3LK 3S1NK 4OIOA 3HOVC 1TWGC 3BUEA 1J6XA 2ZUEA 4A3LC 3ERED 1TWFC 1XXCA 3GIRA 3H0GC 1WIHA 4M1XA 1C0AA 4A93C 4DDQA 3GTKK 4KATA 1K83C 4BKWA 3PO2K 3H3VL 3GEHA 2NVXC 3S14K 2R7ZA 1TWHK 5C4XK 3HOYC 3HKZD 5IYCK 2GSNA 1J98A 1DD5A 1I6HK 4KMDA 3FKIK 1YNNA 3PO3C 5IOSA 2YU9K 3GTOC 3LPXA 3H3VD 2E2HA 2JH3A 4G0UA 2GSOA 1EK8A 4KASA 1X31C 3S1NC 2PA8L 4KAWX 4P9SA 1F9NA 2A6HA 4A3CC 4KDDA 3QX3A 1Y1WK 1JOEA 5CJ9A 2Y3PA 2VUMA 3IPJA 5EGEA 1WQGA 3G4AA 1TWCK 1TWAC 4KC6A 4Y7NK 1TWAK 1USOA 1PJ7A 4XCHA 1I50C 1VGXA 4YFNA 3FHZA 2JA6C 1PJ5A 5IYCC 1EQRA 3TFJA 3S1QC 3A8JA 2D6FC 3GTLC 1IW7A 1GE9A 2B63C 4OIPA 4G7HA 1KQ4A 4GTEA 1BJTA 3GTMK 2V6SA 5E68A 4X6AK 1VJEA 1IS1A 3GTMC 3OREA 2V6UA 2JA8K 4A3MK 3S15C 2XCQA 4OIRA 2E2JK 3GTGC 3S0XA 4KM8A 1WORA 1WSVA 5C3EC 3FOEA 3S17K 4GTDA 4G0VA 1UV7A 1WCMK 1O2AA 5IYBC 4BY7C 3RZDC 4KMUA 5FJ8K 3M3YK 4AH6A 4A3GC 4KM9A 4BY1C 3AQOA 3N0BA 4C3JK 2P5MA 4GTAA 1ZYRA 3HKZL 3FOFA 5M5YK 4A3IK 1USMA 3GDZA 4OINA 2NVQK 4KB2A 2RGRA 2FQOA 4KB4A 2P8TA 3S1QK 2CFAA 2B63K 3N0CA 4MEYA 4BBRK 4BXXK 3GTMA 2R92K 4YG2A 5TJ3A 2O5IA 2EBBA 1O26A 1Y1VK 5M3MK 5IP7C 3AD8C 1L0WA 2E2JC 4BBSK 5CHPA 2A68A 2V6TA 2ZFZA 2FQTA 2PPBA 4KN4A 4JK1A 1WCMC 4FZBA 2GSUA 3S16K 1TWCA 3VA7A 5IYBK 2W7VA 5IORA 4A3DC 1ISEA 1R9TA 4QJVB 4KMAA 4O2DA 3AD7C 1WOOA 3I4NK 3NUHA 4A3BC 3I4NC 3T01A 1EI6A 2WB1L 4ILDA 2NVQC 1O2FB 2KWAA 4Q5SA 3A8IA 5HL8A 3A8KA 1VRQC 1RU0A 1O27A 4Y52C 3GTPK 2NVYC 4QIWD 4C3HK 3S1MC 3GTJK 3HOXK 4C2MC 3HOXC 1TWHA 4BBSC 1V5VA 2JA5A 5M5WK 2WB1D 4A3EC 4A3KC 4P5BA 5C4JK 1HQMA 4GTLA 4LLGA 4A3EK 2E2IA 2NVXA 5C44K 4C3IK 4KARA 3RZOC 2WAQL 4QIWL 1DCHA 4GTBA 2O5JA 2E2IC 4C45A 1G51A 3BP3A 4GTFA 3SZYA 1EFWA 1WQFA 3V4GA 4MEXA 1B4AA 3JSTA 4LOWA 3SZZA 4BLBA 5TMCA 3M4OC 3S2DK 1SFOA 5D4DA 3PO3K 3GTOK 4XLPA 1AB4A 2NVYA 4FM9A 1SFOC 4QJVA 3HOZK 1INNA 1XXBA 1O28A 3I4MK 4RMFA 1SFOK 3GTQC 4C3HC 2A6EA 3HOZC 4ZH4A 3MMLB 1SMYA 3GTQK 4A93K 1TWGK 3GTKC 1F7UA 1ZXOA 1DCOA 1EH1A 3TTGA 3S2HK 1TWCC 3EQLA 1XXAA 3S2HC 1XZQB 2NVXK 5IYDC 3HOWK 1WOPA 4NOIA 1YCLA 3GEIA 4GTCA 4LQYA 1TWHC 1ZBSA 1WCMA 4LK0A 4AYBD 1I50K 1VH2A 2PMZL 5JVOA 1IBAA 4A3FK 4MQ9A 2JA6K 1I6HC 1ZVUA 5L46A 3HOYK 3GTLK 1HI9A 3M4OK 4PABA 3S2DC 1J6WA 4KN7A 1BGWA 1BS2A 1XZPA 2YU9C 3TFIA 3ADAC 5M5XK 4AYBL 4A3MC 4LK1A 2PMZD 3BP8C 3L4JA 1WSRA 3HOVK 4J3NA 1BDFA 1R9TC 3Q3QA 1TWFK 2GAHC 3H0GK 2Y0SL 1R9TK 1DCPA 4YFXA 3T02A 5JFEA 4BY7K 1K83K 3PO2C 2WAQD 4A3JC 4XSXA 2ZUFA 4Y7NC 4A3JK 1YX2A 3GTGA 4A3FC 3K7AK 5C4XC 4GFQA 1WQHA 3N3YA 2Y0SD 1Y1VA 3K7AC 1XZQA 3TFHA 4BBRC 2R92A 1I3QK 4KMHA 1I6VA 2E2HK 1ZQ1C 1I3QC 1YNJA 3CQZK 4GZYA 4X6AC 4Q4ZA 1VLOA 3CQZC 3HOUC 3GTLA 5IOTA 3L4KA 2JA8C 4A3CK 2JA7K 4P5AA 3LAPA 2JA6A 1Y1WC 2JA7C 5IP9K 1I50A 3RZDK 3S17C 2BE5A 3HXAA 5IOQA 4A3GK 3GSIA 4BLAA 2VUMC 2PHCB 4LJZA 4C3JC 3G4CA 1JVIA 3GTKA 4A3IC 3M3YC 2JA7A 2NVTK 3GEEA 4XSZA 1B4BA 1J6VA 3GTQA 2NVTC 5M3FK 4OIQA 3CQZA 4WJ3M 3CAGA 5TMFA 1I3QA 2NVYK 2R93K 2E2HC 4BXXC 1XPPA 1F93A 5IP7K 3GTOA 1IE0A 2R93C 3AH5A 3S15K 2CFAB 4XLNA 3HOUK 5FLMK 3GTGK 1TWAA 5EGHA 5C3EK 5IP9C 5C44C 1K83A 4A3DK 1JQWA 1WOSA 1O2BA 2E2IK 3S1RK 2VUMK 2JA5C
chains in the Genus database with same CATH topology
4KAWX 3H0GA 3L4JA 1Y1WA 1F9NA 1TWFA 3NUHA 4J3NA 2XCRB 4KDDA 3Q3QA 3QX3A 3AQPA 3LAJA 5CJ9A 4ILDA 2KWAA 2Y3PA 2VUMA 1O24A 5EGEA 3GTJA 1WQGA 3G4AA 5JFEA 1O27A 4GT9A 3GTPA 2XCOA 4KC6A 2YU9A 3FKIA 3GTGA 3FHZA 4LR2A 4C2MC 4GFQA 1TWHA 3N3YA 1WQHA 1Y1VA 2JA5A 4P5BA 1GE9A 4GTLA 3OEPA 2E2IA 1KQ4A 2NVXA 4GTEA 1BJTA 2R92A 4KARA 4KMHA 1IS1A 4GTBA 4C3IC 3OREA 2RH6A 4GTFA 2XCQA 3OPFA 3GTLA 1TWGA 1WQFA 3V4GA 5IOTA 3L4KA 1O25A 1B4AA 4G0WA 1O29A 3S0XA 4KM8A 4P5AA 4BLBA 3LAPA 2JA6A 3FOEA 1SFOA 4GTDA 4G0VA 1I50A 1O2AA 2R93A 1AB4A 2NVYA 5IOQA 4FM9A 4BLAA 1XXBA 2B63A 1O28A 2PHCB 4C3JC 4C3HC 3G4CA 4KM9A 3BUEA 3GTKA 3MMLB 3AQOA 3N0BA 2JA7A 3ERED 2P5MA 4GTAA 1XXCA 3FOFA 1WIHA 4M1XA 1B4BA 3GTQA 1ZXOA 4KB2A 2RGRA 4KB4A 4DDQA 1EH1A 3CQZA 4KATA 3CAGA 2CFAA 4BKWA 3N0CA 1XXAA 1I3QA 3GTMA 5TJ3A 4GTCA 4LQYA 1O26A 1ZBSA 1WCMA 3GTOA 5JVOA 3AH5A 2CFAB 2R7ZA 5CHPA 2GSNA 1ZVUA 1DD5A 4KMDA 1TWAA 5EGHA 2ZFZA 5IOSA 1BGWA 3LPXA 4FZBA 2GSUA 1K83A 1TWCA 3VA7A 2JH3A 2E2HA 4G0UA 2GSOA 1O2BA 5IORA 1ISEA 1R9TA 1EK8A 4KASA 4KMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTC A;  1O2A A;  1O26 A;  4P5B A;  5IOQ A;  4GTL A;  3AH5 A;  1KQ4 A;  2CFA B;  4GTE A;  1O28 A;  4KAR A;  5CHP A;  1O24 A;  3G4C A;  3N0B A;  4GTB A;  3G4A A;  5JFE A;  1O27 A;  4GTA A;  4GT9 A;  5IOS A;  4GTF A;  5IOT A;  4FZB A;  1O25 A;  4KAT A;  1O29 A;  1O2B A;  4P5A A;  2CFA A;  5IOR A;  3N0C A;  4GTD A;  3N3Y A;  4KAS A; 
#chains in the Genus database with same CATH topology
 3H0G A;  1Y1W A;  3S1R C;  1TWF A;  4BY1 K;  2JA5 K;  2XCR B;  3DXJ A;  3AQP A;  3LAJ A;  4A3B K;  1O24 A;  3GTJ A;  4GT9 A;  3GTP A;  3S1M K;  2XCO A;  2R92 C;  2YU9 A;  3FKI A;  4Y52 K;  4C2M K;  2PA8 D;  2R7Z C;  1Y1V C;  4G7O A;  4LR2 A;  3GTJ C;  2CW0 A;  1IQ0 A;  4A3K K;  2R7Z K;  5FLM C;  3AD9 C;  4WIL A;  3RZO K;  4YFK A;  3OEP A;  4PAA A;  4G7Z A;  3T00 A;  3HOW C;  5C4J C;  5IYD K;  3S16 C;  4C3I C;  1F7V A;  1XZP B;  2GAG C;  2A69 A;  3S14 C;  2RH6 A;  4WJ4 A;  3OPF A;  1PJ6 A;  1TWG A;  1O25 A;  4G0W A;  1O29 A;  3WOD A;  3FKI C;  2R93 A;  3I4M C;  1IL2 A;  3GTP C;  2B63 A;  4A3L K;  3S1N K;  4OIO A;  3HOV C;  1TWG C;  3BUE A;  1J6X A;  2ZUE A;  4A3L C;  3ERE D;  1TWF C;  1XXC A;  3GIR A;  3H0G C;  1WIH A;  4M1X A;  1C0A A;  4A93 C;  4DDQ A;  3GTK K;  4KAT A;  1K83 C;  4BKW A;  3PO2 K;  3H3V L;  3GEH A;  2NVX C;  3S14 K;  2R7Z A;  1TWH K;  5C4X K;  3HOY C;  3HKZ D;  5IYC K;  2GSN A;  1J98 A;  1DD5 A;  1I6H K;  4KMD A;  3FKI K;  1YNN A;  3PO3 C;  5IOS A;  2YU9 K;  3GTO C;  3LPX A;  3H3V D;  2E2H A;  2JH3 A;  4G0U A;  2GSO A;  1EK8 A;  4KAS A;  1X31 C;  3S1N C;  2PA8 L;  4KAW X;  4P9S A;  1F9N A;  2A6H A;  4A3C C;  4KDD A;  3QX3 A;  1Y1W K;  1JOE A;  5CJ9 A;  2Y3P A;  2VUM A;  3IPJ A;  5EGE A;  1WQG A;  3G4A A;  1TWC K;  1TWA C;  4KC6 A;  4Y7N K;  1TWA K;  1USO A;  1PJ7 A;  4XCH A;  1I50 C;  1VGX A;  4YFN A;  3FHZ A;  2JA6 C;  1PJ5 A;  5IYC C;  1EQR A;  3TFJ A;  3S1Q C;  3A8J A;  2D6F C;  3GTL C;  1IW7 A;  1GE9 A;  2B63 C;  4OIP A;  4G7H A;  1KQ4 A;  4GTE A;  1BJT A;  3GTM K;  2V6S A;  5E68 A;  4X6A K;  1VJE A;  1IS1 A;  3GTM C;  3ORE A;  2V6U A;  2JA8 K;  4A3M K;  3S15 C;  2XCQ A;  4OIR A;  2E2J K;  3GTG C;  3S0X A;  4KM8 A;  1WOR A;  1WSV A;  5C3E C;  3FOE A;  3S17 K;  4GTD A;  4G0V A;  1UV7 A;  1WCM K;  1O2A A;  5IYB C;  4BY7 C;  3RZD C;  4KMU A;  5FJ8 K;  3M3Y K;  4AH6 A;  4A3G C;  4KM9 A;  4BY1 C;  3AQO A;  3N0B A;  4C3J K;  2P5M A;  4GTA A;  1ZYR A;  3HKZ L;  3FOF A;  5M5Y K;  4A3I K;  1USM A;  3GDZ A;  4OIN A;  2NVQ K;  4KB2 A;  2RGR A;  2FQO A;  4KB4 A;  2P8T A;  3S1Q K;  2CFA A;  2B63 K;  3N0C A;  4MEY A;  4BBR K;  4BXX K;  3GTM A;  2R92 K;  4YG2 A;  5TJ3 A;  2O5I A;  2EBB A;  1O26 A;  1Y1V K;  5M3M K;  5IP7 C;  3AD8 C;  1L0W A;  2E2J C;  4BBS K;  5CHP A;  2A68 A;  2V6T A;  2ZFZ A;  2FQT A;  2PPB A;  4KN4 A;  4JK1 A;  1WCM C;  4FZB A;  2GSU A;  3S16 K;  1TWC A;  3VA7 A;  5IYB K;  2W7V A;  5IOR A;  4A3D C;  1ISE A;  1R9T A;  4QJV B;  4KMA A;  4O2D A;  3AD7 C;  1WOO A;  3I4N K;  3NUH A;  4A3B C;  3I4N C;  3T01 A;  1EI6 A;  2WB1 L;  4ILD A;  2NVQ C;  1O2F B;  2KWA A;  4Q5S A;  3A8I A;  5HL8 A;  3A8K A;  1VRQ C;  1RU0 A;  1O27 A;  4Y52 C;  3GTP K;  2NVY C;  4QIW D;  4C3H K;  3S1M C;  3GTJ K;  3HOX K;  4C2M C;  3HOX C;  1TWH A;  4BBS C;  1V5V A;  2JA5 A;  5M5W K;  2WB1 D;  4A3E C;  4A3K C;  4P5B A;  5C4J K;  1HQM A;  4GTL A;  4LLG A;  4A3E K;  2E2I A;  2NVX A;  5C44 K;  4C3I K;  4KAR A;  3RZO C;  2WAQ L;  4QIW L;  1DCH A;  4GTB A;  2O5J A;  2E2I C;  4C45 A;  1G51 A;  3BP3 A;  4GTF A;  3SZY A;  1EFW A;  1WQF A;  3V4G A;  4MEX A;  1B4A A;  3JST A;  4LOW A;  3SZZ A;  4BLB A;  5TMC A;  3M4O C;  3S2D K;  1SFO A;  5D4D A;  3PO3 K;  3GTO K;  4XLP A;  1AB4 A;  2NVY A;  4FM9 A;  1SFO C;  4QJV A;  3HOZ K;  1INN A;  1XXB A;  1O28 A;  3I4M K;  4RMF A;  1SFO K;  3GTQ C;  4C3H C;  2A6E A;  3HOZ C;  4ZH4 A;  3MML B;  1SMY A;  3GTQ K;  4A93 K;  1TWG K;  3GTK C;  1F7U A;  1ZXO A;  1DCO A;  1EH1 A;  3TTG A;  3S2H K;  1TWC C;  3EQL A;  1XXA A;  3S2H C;  1XZQ B;  2NVX K;  5IYD C;  3HOW K;  1WOP A;  4NOI A;  1YCL A;  3GEI A;  4GTC A;  4LQY A;  1TWH C;  1ZBS A;  1WCM A;  4LK0 A;  4AYB D;  1I50 K;  1VH2 A;  2PMZ L;  5JVO A;  1IBA A;  4A3F K;  4MQ9 A;  2JA6 K;  1I6H C;  1ZVU A;  5L46 A;  3HOY K;  3GTL K;  1HI9 A;  3M4O K;  4PAB A;  3S2D C;  1J6W A;  4KN7 A;  1BGW A;  1BS2 A;  1XZP A;  2YU9 C;  3TFI A;  3ADA C;  5M5X K;  4AYB L;  4A3M C;  4LK1 A;  2PMZ D;  3BP8 C;  3L4J A;  1WSR A;  3HOV K;  4J3N A;  1BDF A;  1R9T C;  3Q3Q A;  1TWF K;  2GAH C;  3H0G K;  2Y0S L;  1R9T K;  1DCP A;  4YFX A;  3T02 A;  5JFE A;  4BY7 K;  1K83 K;  3PO2 C;  2WAQ D;  4A3J C;  4XSX A;  2ZUF A;  4Y7N C;  4A3J K;  1YX2 A;  3GTG A;  4A3F C;  3K7A K;  5C4X C;  4GFQ A;  1WQH A;  3N3Y A;  2Y0S D;  1Y1V A;  3K7A C;  1XZQ A;  3TFH A;  4BBR C;  2R92 A;  1I3Q K;  4KMH A;  1I6V A;  2E2H K;  1ZQ1 C;  1I3Q C;  1YNJ A;  3CQZ K;  4GZY A;  4X6A C;  4Q4Z A;  1VLO A;  3CQZ C;  3HOU C;  3GTL A;  5IOT A;  3L4K A;  2JA8 C;  4A3C K;  2JA7 K;  4P5A A;  3LAP A;  2JA6 A;  1Y1W C;  2JA7 C;  5IP9 K;  1I50 A;  3RZD K;  3S17 C;  2BE5 A;  3HXA A;  5IOQ A;  4A3G K;  3GSI A;  4BLA A;  2VUM C;  2PHC B;  4LJZ A;  4C3J C;  3G4C A;  1JVI A;  3GTK A;  4A3I C;  3M3Y C;  2JA7 A;  2NVT K;  3GEE A;  4XSZ A;  1B4B A;  1J6V A;  3GTQ A;  2NVT C;  5M3F K;  4OIQ A;  3CQZ A;  4WJ3 M;  3CAG A;  5TMF A;  1I3Q A;  2NVY K;  2R93 K;  2E2H C;  4BXX C;  1XPP A;  1F93 A;  5IP7 K;  3GTO A;  1IE0 A;  2R93 C;  3AH5 A;  3S15 K;  2CFA B;  4XLN A;  3HOU K;  5FLM K;  3GTG K;  1TWA A;  5EGH A;  5C3E K;  5IP9 C;  5C44 C;  1K83 A;  4A3D K;  1JQW A;  1WOS A;  1O2B A;  2E2I K;  3S1R K;  2VUM K;  2JA5 C; 
#chains in the Genus database with same CATH homology
 4KAW X;  3H0G A;  3L4J A;  1Y1W A;  1F9N A;  1TWF A;  3NUH A;  4J3N A;  2XCR B;  4KDD A;  3Q3Q A;  3QX3 A;  3AQP A;  3LAJ A;  5CJ9 A;  4ILD A;  2KWA A;  2Y3P A;  2VUM A;  1O24 A;  5EGE A;  3GTJ A;  1WQG A;  3G4A A;  5JFE A;  1O27 A;  4GT9 A;  3GTP A;  2XCO A;  4KC6 A;  2YU9 A;  3FKI A;  3GTG A;  3FHZ A;  4LR2 A;  4C2M C;  4GFQ A;  1TWH A;  3N3Y A;  1WQH A;  1Y1V A;  2JA5 A;  4P5B A;  1GE9 A;  4GTL A;  3OEP A;  2E2I A;  1KQ4 A;  2NVX A;  4GTE A;  1BJT A;  2R92 A;  4KAR A;  4KMH A;  1IS1 A;  4GTB A;  4C3I C;  3ORE A;  2RH6 A;  4GTF A;  2XCQ A;  3OPF A;  3GTL A;  1TWG A;  1WQF A;  3V4G A;  5IOT A;  3L4K A;  1O25 A;  1B4A A;  4G0W A;  1O29 A;  3S0X A;  4KM8 A;  4P5A A;  4BLB A;  3LAP A;  2JA6 A;  3FOE A;  1SFO A;  4GTD A;  4G0V A;  1I50 A;  1O2A A;  2R93 A;  1AB4 A;  2NVY A;  5IOQ A;  4FM9 A;  4BLA A;  1XXB A;  2B63 A;  1O28 A;  2PHC B;  4C3J C;  4C3H C;  3G4C A;  4KM9 A;  3BUE A;  3GTK A;  3MML B;  3AQO A;  3N0B A;  2JA7 A;  3ERE D;  2P5M A;  4GTA A;  1XXC A;  3FOF A;  1WIH A;  4M1X A;  1B4B A;  3GTQ A;  1ZXO A;  4KB2 A;  2RGR A;  4KB4 A;  4DDQ A;  1EH1 A;  3CQZ A;  4KAT A;  3CAG A;  2CFA A;  4BKW A;  3N0C A;  1XXA A;  1I3Q A;  3GTM A;  5TJ3 A;  4GTC A;  4LQY A;  1O26 A;  1ZBS A;  1WCM A;  3GTO A;  5JVO A;  3AH5 A;  2CFA B;  2R7Z A;  5CHP A;  2GSN A;  1ZVU A;  1DD5 A;  4KMD A;  1TWA A;  5EGH A;  2ZFZ A;  5IOS A;  1BGW A;  3LPX A;  4FZB A;  2GSU A;  1K83 A;  1TWC A;  3VA7 A;  2JH3 A;  2E2H A;  4G0U A;  2GSO A;  1O2B A;  5IOR A;  1ISE A;  1R9T A;  1EK8 A;  4KAS A;  4KMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...