1O25A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with dump at 2.4 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
214
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 73
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o25A00
1O2BA 3N0BA 1O24A 4GTDA 4GTCA 1O29A 5CHPA 4GTBA 1O2AA 3AH5A 3N3YA 4GT9A 5IOTA 4GTLA 4KATA 5JFEA 4KASA 4P5BA 1O25A 1O27A 2CFAA 4KARA 1KQ4A 5IOQA 4FZBA 4P5AA 2CFAB 1O26A 3G4CA 4GTAA 4GTEA 5IORA 4GTFA 5IOSA 3G4AA 1O28A 3N0CA
chains in the Genus database with same CATH superfamily
4C3JC 2NVXK 3CQZK 1I3QK 1HQMA 3BP8C 2RGRA 1XXAA 4C3JK 1XXBA 3AH5A 2JA7C 1INNA 3GTGA 4G0WA 2JA7K 1KQ4A 1G51A 2NVXA 3CQZA 1RU0A 4QJVA 1I3QA 4OINA 5C4XC 4A3GC 1YCLA 5IOSA 2A68A 1K83C 3GEHA 5C4XK 1ZQ1C 4A3GK 5TMCA 4LJZA 1K83K 3T01A 5CHPA 2JA7A 3WODA 4GTLA 4KATA 1ZVUA 3L4JA 1L0WA 3S15C 1O25A 2CFAA 5IYCC 3HOUC 5TJ3A 3GTMC 4KC6A 3S15K 1J6VA 2E2IC 4WJ4A 4KMAA 5IYCK 3HOUK 3GTMK 3HKZL 3HOYC 2NVQC 1K83A 3S1NK 3RZOK 4QJVB 1WQGA 2E2IK 1HI9A 1WSRA 1WORA 4JK1A 1GE9A 3HOYK 2NVQK 1IS1A 1WQHA 3A8KA 1O29A 4XCHA 4AH6A 3HKZD 1VGXA 4GZYA 2PPBA 4KASA 3SZZA 4P5BA 3GTMA 4LLGA 4XLPA 2E2IA 5C3EC 3GTPC 1WSVA 2GAGC 5C3EK 4KMUA 2VUMC 2O5JA 3GTPK 4A3BC 3SZYA 4PAAA 3T02A 2VUMK 3M4OC 3T00A 4A3BK 5FLMC 4KB2A 1O2AA 4OIPA 3M4OK 5FLMK 2GAHC 4A3IC 1O27A 3RZDC 4A3FC 3GTPA 4YFXA 2R92C 3S0XA 4A3IK 3RZDK 4A3FK 2VUMA 1IL2A 4BY7C 1TWCC 2R92K 1YNJA 3GTJC 1IQ0A 1VH2A 4MQ9A 3V4GA 4BY7K 1TWCK 3GTJK 2RH6A 3AQPA 2V6TA 4KMHA 1X31C 2PA8L 3QX3A 5IOTA 2R93C 2WB1L 4AYBL 4A3EC 5M5XK 2R92A 2R93K 4BLAA 3S14C 1V5VA 3GTOC 2PA8D 4A3EK 1TWCA 3S14K 3GTJA 2WB1D 4AYBD 3GTOK 4Y52C 2O5IA 3GTLC 1O2BA 5TMFA 1J6WA 4LR2A 4Y52K 3GTLK 1BJTA 2R93A 4MEYA 3HOWC 4A93C 4KM9A 1VLOA 3FHZA 3HOZC 3OREA 3HOWK 3S17C 3GTOA 1F7UA 4A93K 2XCRB 1C0AA 3HOZK 3S17K 4KMDA 3HOXC 3GTLA 4YG2A 1PJ7A 3GSIA 3HOXK 3BUEA 2A6HA 3GDZA 1EQRA 4Q5SA 4A3LC 3PO2C 4Q4ZA 3K7AC 4DDQA 1AB4A 4A3LK 5CJ9A 3PO2K 3K7AK 5JFEA 1F93A 4KARA 3TTGA 1J6XA 5C4JC 1TWFC 3AD8C 3NUHA 2P8TA 4OIQA 5M5YK 1TWFK 2WAQL 3N0CA 4A3KC 2JA6C 3AQOA 3AD9C 2NVYC 2JA8C 4YFKA 3LPXA 1Y1VC 4G7ZA 2D6FC 3IPJA 4A3KK 2JA6K 2NVYK 3MMLB 4MEXA 2JA8K 2WAQD 3GTQC 1TWHC 1EFWA 5E68A 4BXXC 2W7VA 4LOWA 4WILA 3GTQK 1TWFA 3S1QC 1TWHK 5L46A 4BXXK 4RMFA 1WOPA 4GTFA 3S1QK 2JA6A 1EK8A 2NVYA 2PHCB 3A8IA 4C2MC 4ZH4A 1Y1VA 3ADAC 5IYDC 4C2MK 3GTQA 1WQFA 4PABA 3Q3QA 2Y3PA 4G7HA 5IYDK 1EI6A 1DCHA 1TWHA 1R9TC 1VJEA 1YNNA 4KM8A 3FOFA 1R9TK 5IOQA 1ZXOA 3S2DC 2BE5A 3EQLA 3HOVC 1USMA 3S2DK 5C44C 3L4KA 5IP9C 4C45A 3HOVK 1J98A 4P9SA 2A6EA 5C44K 4GTBA 5IP9K 1R9TA 5EGHA 2P5MA 3PO3C 1DCPA 4KN4A 4A3JC 2E2JC 3DXJA 1BDFA 1IW7A 3PO3K 2V6UA 4XSZA 3S1MC 1XXCA 4A3JK 2E2JK 3ERED 4X6AC 1I6HC 5IYBC 3S1MK 1B4BA 5IORA 1UV7A 5M5WK 4X6AK 3JSTA 3BP3A 4NOIA 1I6HK 5IYBK 3LAJA 1XPPA 5JVOA 4G0VA 4KB4A 3FKIC 4LK1A 2XCQA 1IE0A 4A3DC 3CAGA 4BBRC 3FKIK 2A69A 1JVIA 1USOA 4LK0A 4KN7A 3I4MC 1XZPA 4FZBA 4A3DK 2KWAA 4BBRK 4FM9A 3M3YC 2JA5C 2NVTC 3I4MK 3OPFA 5IP7C 1ISEA 3M3YK 2JA5K 3HXAA 1F7VA 4Y7NC 2NVTK 3N0BA 5IP7K 3H3VL 3FKIA 4Y7NK 2ZFZA 3N3YA 2FQOA 3GEEA 4LQYA 4G0UA 4XSXA 3H3VD 3OEPA 3GIRA 2JA5A 1TWGC 2XCOA 5HL8A 3TFIA 1WOSA 1XZPB 5C4JK 1TWGK 4WJ3M 5FJ8K 2V6SA 3S2HC 4BKWA 2PMZL 2B63C 4OIRA 3S2HK 1BS2A 1Y1VK 1YX2A 2B63K 4C3HC 1TWGA 3S1NC 2PMZD 1VRQC 4P5AA 1ZYRA 4OIOA 5M3MK 3RZOC 4C3HK 1TWAC 1SFOC 4C3IC 1PJ6A 1I6VA 4BLBA 1TWAK 4J3NA 1SFOK 4C3IK 3AD7C 4QIWL 2B63A 1XZQA 1DCOA 1Y1WC 2ZUEA 2ZUFA 1B4AA 4BY1C 2E2HC 4G7OA 3TFHA 4QIWD 4BBSC 1Y1WK 4ILDA 1JOEA 4M1XA 2CFAB 1TWAA 4BY1K 1F9NA 1O26A 1SFOA 2E2HK 3I4NC 3LAPA 4BBSK 4KDDA 1O28A 3I4NK 1WOOA 4KAWX 4YFNA 4A3MC 5M3FK 2EBBA 3VA7A 1IBAA 4GTCA 3TFJA 2CW0A 4A3MK 1Y1WA 1BGWA 5D4DA 4A3CC 4GT9A 3S1RC 1XZQB 3H0GC 2R7ZC 2E2HA 2GSUA 2YU9C 4A3CK 3S1RK 3GTKC 1WCMC 3H0GK 2R7ZK 2Y0SL 3G4CA 4GTAA 2YU9K 2GSOA 3GTKK 1WCMK 1I50C 1DD5A 3GEIA 3G4AA 3S16C 1I50K 1O24A 2Y0SD 4GFQA 4GTDA 2JH3A 1O2FB 1SMYA 3S16K 3H0GA 2R7ZA 3FOEA 3A8JA 1JQWA 2YU9A 2GSNA 5EGEA 3GTKA 1WCMA 3GTGC 1PJ5A 4O2DA 2FQTA 3GTGK 1I50A 4GTEA 2NVXC 3CQZC 4XLNA 1ZBSA 1I3QC 1EH1A 1WIHA
chains in the Genus database with same CATH topology
1EK8A 2NVYA 4C3JC 2PHCB 3V4GA 4C2MC 1Y1VA 2RGRA 1XXAA 2RH6A 3AQPA 4BKWA 4KMHA 1XXBA 3AH5A 3GTQA 1WQFA 3QX3A 3Q3QA 5IOTA 2Y3PA 1TWHA 3GTGA 4C3HC 4G0WA 1KQ4A 2R92A 4KM8A 3FOFA 4BLAA 1TWGA 5IOQA 4P5AA 1ZXOA 2NVXA 3CQZA 1I3QA 1TWCA 4C3IC 3GTJA 5IOSA 4BLBA 4J3NA 1O2BA 3L4KA 4LR2A 2B63A 5CHPA 4GTBA 2JA7A 1BJTA 2R93A 1R9TA 5EGHA 2P5MA 4GTLA 4KATA 1B4AA 1ZVUA 3L4JA 4KM9A 3FHZA 1O25A 2CFAA 3OREA 5TJ3A 3GTOA 1XXCA 4ILDA 4M1XA 2XCRB 2CFAB 1TWAA 4KC6A 1O26A 1F9NA 3ERED 1SFOA 3LAPA 4KMAA 4KMDA 1B4BA 5IORA 1K83A 3GTLA 4KDDA 1O28A 1WQGA 4KAWX 3LAJA 5JVOA 1GE9A 3VA7A 3BUEA 1IS1A 1WQHA 4G0VA 4GTCA 1O29A 4KB4A 1Y1WA 1BGWA 4DDQA 1AB4A 4GT9A 5CJ9A 2E2HA 2GSUA 2XCQA 5JFEA 3CAGA 4KASA 4P5BA 3GTMA 4KARA 4FZBA 2E2IA 2KWAA 3G4CA 4GTAA 4FM9A 2GSOA 3NUHA 1DD5A 3OPFA 1ISEA 3N0CA 3G4AA 3AQOA 3N0BA 1O24A 4GFQA 4GTDA 2JH3A 3LPXA 3FKIA 4KB2A 1O2AA 3MMLB 2ZFZA 3H0GA 3N3YA 2R7ZA 3FOEA 2YU9A 2GSNA 5EGEA 4LQYA 3GTKA 1WCMA 4G0UA 1O27A 1TWFA 3OEPA 3GTPA 2JA5A 2XCOA 3S0XA 1I50A 4GTEA 2VUMA 1ZBSA 4GTFA 1EH1A 1WIHA 2JA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2B A;  3N0B A;  1O24 A;  4GTD A;  4GTC A;  1O29 A;  5CHP A;  4GTB A;  1O2A A;  3AH5 A;  3N3Y A;  4GT9 A;  5IOT A;  4GTL A;  4KAT A;  5JFE A;  4KAS A;  4P5B A;  1O25 A;  1O27 A;  2CFA A;  4KAR A;  1KQ4 A;  5IOQ A;  4FZB A;  4P5A A;  2CFA B;  1O26 A;  3G4C A;  4GTA A;  4GTE A;  5IOR A;  4GTF A;  5IOS A;  3G4A A;  1O28 A;  3N0C A; 
#chains in the Genus database with same CATH topology
 4C3J C;  2NVX K;  3CQZ K;  1I3Q K;  1HQM A;  3BP8 C;  2RGR A;  1XXA A;  4C3J K;  1XXB A;  3AH5 A;  2JA7 C;  1INN A;  3GTG A;  4G0W A;  2JA7 K;  1KQ4 A;  1G51 A;  2NVX A;  3CQZ A;  1RU0 A;  4QJV A;  1I3Q A;  4OIN A;  5C4X C;  4A3G C;  1YCL A;  5IOS A;  2A68 A;  1K83 C;  3GEH A;  5C4X K;  1ZQ1 C;  4A3G K;  5TMC A;  4LJZ A;  1K83 K;  3T01 A;  5CHP A;  2JA7 A;  3WOD A;  4GTL A;  4KAT A;  1ZVU A;  3L4J A;  1L0W A;  3S15 C;  1O25 A;  2CFA A;  5IYC C;  3HOU C;  5TJ3 A;  3GTM C;  4KC6 A;  3S15 K;  1J6V A;  2E2I C;  4WJ4 A;  4KMA A;  5IYC K;  3HOU K;  3GTM K;  3HKZ L;  3HOY C;  2NVQ C;  1K83 A;  3S1N K;  3RZO K;  4QJV B;  1WQG A;  2E2I K;  1HI9 A;  1WSR A;  1WOR A;  4JK1 A;  1GE9 A;  3HOY K;  2NVQ K;  1IS1 A;  1WQH A;  3A8K A;  1O29 A;  4XCH A;  4AH6 A;  3HKZ D;  1VGX A;  4GZY A;  2PPB A;  4KAS A;  3SZZ A;  4P5B A;  3GTM A;  4LLG A;  4XLP A;  2E2I A;  5C3E C;  3GTP C;  1WSV A;  2GAG C;  5C3E K;  4KMU A;  2VUM C;  2O5J A;  3GTP K;  4A3B C;  3SZY A;  4PAA A;  3T02 A;  2VUM K;  3M4O C;  3T00 A;  4A3B K;  5FLM C;  4KB2 A;  1O2A A;  4OIP A;  3M4O K;  5FLM K;  2GAH C;  4A3I C;  1O27 A;  3RZD C;  4A3F C;  3GTP A;  4YFX A;  2R92 C;  3S0X A;  4A3I K;  3RZD K;  4A3F K;  2VUM A;  1IL2 A;  4BY7 C;  1TWC C;  2R92 K;  1YNJ A;  3GTJ C;  1IQ0 A;  1VH2 A;  4MQ9 A;  3V4G A;  4BY7 K;  1TWC K;  3GTJ K;  2RH6 A;  3AQP A;  2V6T A;  4KMH A;  1X31 C;  2PA8 L;  3QX3 A;  5IOT A;  2R93 C;  2WB1 L;  4AYB L;  4A3E C;  5M5X K;  2R92 A;  2R93 K;  4BLA A;  3S14 C;  1V5V A;  3GTO C;  2PA8 D;  4A3E K;  1TWC A;  3S14 K;  3GTJ A;  2WB1 D;  4AYB D;  3GTO K;  4Y52 C;  2O5I A;  3GTL C;  1O2B A;  5TMF A;  1J6W A;  4LR2 A;  4Y52 K;  3GTL K;  1BJT A;  2R93 A;  4MEY A;  3HOW C;  4A93 C;  4KM9 A;  1VLO A;  3FHZ A;  3HOZ C;  3ORE A;  3HOW K;  3S17 C;  3GTO A;  1F7U A;  4A93 K;  2XCR B;  1C0A A;  3HOZ K;  3S17 K;  4KMD A;  3HOX C;  3GTL A;  4YG2 A;  1PJ7 A;  3GSI A;  3HOX K;  3BUE A;  2A6H A;  3GDZ A;  1EQR A;  4Q5S A;  4A3L C;  3PO2 C;  4Q4Z A;  3K7A C;  4DDQ A;  1AB4 A;  4A3L K;  5CJ9 A;  3PO2 K;  3K7A K;  5JFE A;  1F93 A;  4KAR A;  3TTG A;  1J6X A;  5C4J C;  1TWF C;  3AD8 C;  3NUH A;  2P8T A;  4OIQ A;  5M5Y K;  1TWF K;  2WAQ L;  3N0C A;  4A3K C;  2JA6 C;  3AQO A;  3AD9 C;  2NVY C;  2JA8 C;  4YFK A;  3LPX A;  1Y1V C;  4G7Z A;  2D6F C;  3IPJ A;  4A3K K;  2JA6 K;  2NVY K;  3MML B;  4MEX A;  2JA8 K;  2WAQ D;  3GTQ C;  1TWH C;  1EFW A;  5E68 A;  4BXX C;  2W7V A;  4LOW A;  4WIL A;  3GTQ K;  1TWF A;  3S1Q C;  1TWH K;  5L46 A;  4BXX K;  4RMF A;  1WOP A;  4GTF A;  3S1Q K;  2JA6 A;  1EK8 A;  2NVY A;  2PHC B;  3A8I A;  4C2M C;  4ZH4 A;  1Y1V A;  3ADA C;  5IYD C;  4C2M K;  3GTQ A;  1WQF A;  4PAB A;  3Q3Q A;  2Y3P A;  4G7H A;  5IYD K;  1EI6 A;  1DCH A;  1TWH A;  1R9T C;  1VJE A;  1YNN A;  4KM8 A;  3FOF A;  1R9T K;  5IOQ A;  1ZXO A;  3S2D C;  2BE5 A;  3EQL A;  3HOV C;  1USM A;  3S2D K;  5C44 C;  3L4K A;  5IP9 C;  4C45 A;  3HOV K;  1J98 A;  4P9S A;  2A6E A;  5C44 K;  4GTB A;  5IP9 K;  1R9T A;  5EGH A;  2P5M A;  3PO3 C;  1DCP A;  4KN4 A;  4A3J C;  2E2J C;  3DXJ A;  1BDF A;  1IW7 A;  3PO3 K;  2V6U A;  4XSZ A;  3S1M C;  1XXC A;  4A3J K;  2E2J K;  3ERE D;  4X6A C;  1I6H C;  5IYB C;  3S1M K;  1B4B A;  5IOR A;  1UV7 A;  5M5W K;  4X6A K;  3JST A;  3BP3 A;  4NOI A;  1I6H K;  5IYB K;  3LAJ A;  1XPP A;  5JVO A;  4G0V A;  4KB4 A;  3FKI C;  4LK1 A;  2XCQ A;  1IE0 A;  4A3D C;  3CAG A;  4BBR C;  3FKI K;  2A69 A;  1JVI A;  1USO A;  4LK0 A;  4KN7 A;  3I4M C;  1XZP A;  4FZB A;  4A3D K;  2KWA A;  4BBR K;  4FM9 A;  3M3Y C;  2JA5 C;  2NVT C;  3I4M K;  3OPF A;  5IP7 C;  1ISE A;  3M3Y K;  2JA5 K;  3HXA A;  1F7V A;  4Y7N C;  2NVT K;  3N0B A;  5IP7 K;  3H3V L;  3FKI A;  4Y7N K;  2ZFZ A;  3N3Y A;  2FQO A;  3GEE A;  4LQY A;  4G0U A;  4XSX A;  3H3V D;  3OEP A;  3GIR A;  2JA5 A;  1TWG C;  2XCO A;  5HL8 A;  3TFI A;  1WOS A;  1XZP B;  5C4J K;  1TWG K;  4WJ3 M;  5FJ8 K;  2V6S A;  3S2H C;  4BKW A;  2PMZ L;  2B63 C;  4OIR A;  3S2H K;  1BS2 A;  1Y1V K;  1YX2 A;  2B63 K;  4C3H C;  1TWG A;  3S1N C;  2PMZ D;  1VRQ C;  4P5A A;  1ZYR A;  4OIO A;  5M3M K;  3RZO C;  4C3H K;  1TWA C;  1SFO C;  4C3I C;  1PJ6 A;  1I6V A;  4BLB A;  1TWA K;  4J3N A;  1SFO K;  4C3I K;  3AD7 C;  4QIW L;  2B63 A;  1XZQ A;  1DCO A;  1Y1W C;  2ZUE A;  2ZUF A;  1B4A A;  4BY1 C;  2E2H C;  4G7O A;  3TFH A;  4QIW D;  4BBS C;  1Y1W K;  4ILD A;  1JOE A;  4M1X A;  2CFA B;  1TWA A;  4BY1 K;  1F9N A;  1O26 A;  1SFO A;  2E2H K;  3I4N C;  3LAP A;  4BBS K;  4KDD A;  1O28 A;  3I4N K;  1WOO A;  4KAW X;  4YFN A;  4A3M C;  5M3F K;  2EBB A;  3VA7 A;  1IBA A;  4GTC A;  3TFJ A;  2CW0 A;  4A3M K;  1Y1W A;  1BGW A;  5D4D A;  4A3C C;  4GT9 A;  3S1R C;  1XZQ B;  3H0G C;  2R7Z C;  2E2H A;  2GSU A;  2YU9 C;  4A3C K;  3S1R K;  3GTK C;  1WCM C;  3H0G K;  2R7Z K;  2Y0S L;  3G4C A;  4GTA A;  2YU9 K;  2GSO A;  3GTK K;  1WCM K;  1I50 C;  1DD5 A;  3GEI A;  3G4A A;  3S16 C;  1I50 K;  1O24 A;  2Y0S D;  4GFQ A;  4GTD A;  2JH3 A;  1O2F B;  1SMY A;  3S16 K;  3H0G A;  2R7Z A;  3FOE A;  3A8J A;  1JQW A;  2YU9 A;  2GSN A;  5EGE A;  3GTK A;  1WCM A;  3GTG C;  1PJ5 A;  4O2D A;  2FQT A;  3GTG K;  1I50 A;  4GTE A;  2NVX C;  3CQZ C;  4XLN A;  1ZBS A;  1I3Q C;  1EH1 A;  1WIH A; 
#chains in the Genus database with same CATH homology
 1EK8 A;  2NVY A;  4C3J C;  2PHC B;  3V4G A;  4C2M C;  1Y1V A;  2RGR A;  1XXA A;  2RH6 A;  3AQP A;  4BKW A;  4KMH A;  1XXB A;  3AH5 A;  3GTQ A;  1WQF A;  3QX3 A;  3Q3Q A;  5IOT A;  2Y3P A;  1TWH A;  3GTG A;  4C3H C;  4G0W A;  1KQ4 A;  2R92 A;  4KM8 A;  3FOF A;  4BLA A;  1TWG A;  5IOQ A;  4P5A A;  1ZXO A;  2NVX A;  3CQZ A;  1I3Q A;  1TWC A;  4C3I C;  3GTJ A;  5IOS A;  4BLB A;  4J3N A;  1O2B A;  3L4K A;  4LR2 A;  2B63 A;  5CHP A;  4GTB A;  2JA7 A;  1BJT A;  2R93 A;  1R9T A;  5EGH A;  2P5M A;  4GTL A;  4KAT A;  1B4A A;  1ZVU A;  3L4J A;  4KM9 A;  3FHZ A;  1O25 A;  2CFA A;  3ORE A;  5TJ3 A;  3GTO A;  1XXC A;  4ILD A;  4M1X A;  2XCR B;  2CFA B;  1TWA A;  4KC6 A;  1O26 A;  1F9N A;  3ERE D;  1SFO A;  3LAP A;  4KMA A;  4KMD A;  1B4B A;  5IOR A;  1K83 A;  3GTL A;  4KDD A;  1O28 A;  1WQG A;  4KAW X;  3LAJ A;  5JVO A;  1GE9 A;  3VA7 A;  3BUE A;  1IS1 A;  1WQH A;  4G0V A;  4GTC A;  1O29 A;  4KB4 A;  1Y1W A;  1BGW A;  4DDQ A;  1AB4 A;  4GT9 A;  5CJ9 A;  2E2H A;  2GSU A;  2XCQ A;  5JFE A;  3CAG A;  4KAS A;  4P5B A;  3GTM A;  4KAR A;  4FZB A;  2E2I A;  2KWA A;  3G4C A;  4GTA A;  4FM9 A;  2GSO A;  3NUH A;  1DD5 A;  3OPF A;  1ISE A;  3N0C A;  3G4A A;  3AQO A;  3N0B A;  1O24 A;  4GFQ A;  4GTD A;  2JH3 A;  3LPX A;  3FKI A;  4KB2 A;  1O2A A;  3MML B;  2ZFZ A;  3H0G A;  3N3Y A;  2R7Z A;  3FOE A;  2YU9 A;  2GSN A;  5EGE A;  4LQY A;  3GTK A;  1WCM A;  4G0U A;  1O27 A;  1TWF A;  3OEP A;  3GTP A;  2JA5 A;  2XCO A;  3S0X A;  1I50 A;  4GTE A;  2VUM A;  1ZBS A;  4GTF A;  1EH1 A;  1WIH A;  2JA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...