1O25A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with dump at 2.4 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
214
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 73
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o25A00
1O2AA 3G4CA 1O28A 5CHPA 4KASA 1O2BA 4KARA 4KATA 1O27A 1KQ4A 2CFAB 4GTCA 4GTEA 3N0BA 5JFEA 3G4AA 4GTBA 4P5AA 3N0CA 3N3YA 2CFAA 4GTLA 1O26A 4GTFA 4GT9A 5IOQA 5IOSA 1O25A 1O24A 1O29A 4FZBA 3AH5A 4GTAA 4GTDA 5IORA 5IOTA 4P5BA
chains in the Genus database with same CATH superfamily
3I4MC 5IYBK 1WOPA 3ADAC 4G7OA 5C3EC 5M5XK 2JA6K 3RZOK 1PJ6A 4GTEA 4XLNA 3GTGK 4LQYA 2PPBA 4OIPA 1IW7A 1I3QK 3PO2K 3S15C 3TFIA 2A6EA 1O26A 1WCMA 3EQLA 5IP7K 1Y1VA 4KMDA 2JA8K 3M4OK 1BGWA 3BP3A 4BBRK 1PJ7A 4A3EK 1INNA 1EI6A 2ZUEA 5CHPA 2NVXK 3GTLK 2JA7A 2WAQD 3GTMA 2D6FC 1AB4A 1DCPA 1XZPB 4GFQA 5IYBC 4WJ4A 4Q4ZA 3GTGA 1GE9A 3S2HK 1I6HK 1VRQC 3HOZK 1I50K 1I50C 3HOWC 3HOZC 3S0XA 5L46A 1ZQ1C 3T02A 1ISEA 3HOYK 1TWCA 4QIWL 2XCQA 3AQPA 5IP7C 3H3VD 3CQZC 1XXBA 3A8IA 3GTQC 3GIRA 2XCRB 2JA7K 4XSXA 1HI9A 1USOA 4KMAA 3HOVC 5EGHA 4A3KK 2FQOA 1IBAA 4X6AK 2FQTA 4Y52C 3S17K 2O5IA 3N0CA 4KM9A 5D4DA 3FKIC 5IYDC 1TWAA 4KB2A 4A3IK 1SFOA 4P9SA 5IOTA 1XXCA 3S1MK 5M5WK 3GEHA 3S1MC 3GTPK 3BP8C 5C4JC 3K7AC 3A8KA 1TWCC 2NVQC 2R93K 1TWCK 1I6VA 4BKWA 2NVYA 2B63K 3PO3C 3ERED 4C45A 3GTOC 3T01A 4GTLA 3HKZL 3S1QC 4A3DC 1TWGK 5C44C 2R92A 4GTDA 2Y3PA 3FHZA 1K83K 1JVIA 4BY7K 1O2FB 2JA5C 1TWAC 1F7VA 4Y52K 3WODA 2CFAB 2Y0SL 1TWHA 4A3IC 3CAGA 3H0GC 1EQRA 2GAHC 5HL8A 2GSUA 3S17C 5IOSA 1SMYA 1O24A 4LLGA 3AD7C 3AD8C 5IORA 4A3FK 4A3EC 5CJ9A 1WCMK 4G0VA 2PA8L 3S14K 2EBBA 1VH2A 3FOEA 4RMFA 3GTLC 4MEYA 1EFWA 3GTJA 4QIWD 3T00A 3GTKA 1PJ5A 3TFJA 1WIHA 3GTLA 3N3YA 2CFAA 4A3JK 5C4XK 5IOQA 4C3IK 5IP9K 5TJ3A 4C3IC 3MMLB 5M3MK 3GDZA 1O2AA 3GTQA 1Y1VC 2A69A 1O28A 1B4BA 3L4KA 4A93K 2E2HA 1HQMA 4M1XA 1I3QC 3PO2C 4C3JK 1F93A 3S15K 4OIOA 4C3HC 5IYCC 3Q3QA 2O5JA 1WQFA 3HXAA 1WSRA 3LPXA 2PHCB 3GTKK 1XZQA 1UV7A 3AD9C 1ZBSA 3GTOK 2VUMA 2JA5A 2E2JK 4KDDA 1DCOA 1USMA 3RZDC 3M3YC 2PMZL 2E2IC 1IQ0A 1XXAA 4LJZA 1XZQB 1K83C 2JA6A 2R7ZA 4XSZA 3HOUK 4X6AC 4BLAA 4Y7NC 3LAPA 2E2IA 4G7HA 4O2DA 5TMCA 3A8JA 4LK1A 4BXXC 4BXXK 3CQZA 3G4AA 4JK1A 1WQHA 4LR2A 4NOIA 1L0WA 2KWAA 3IPJA 1TWAK 1F7UA 5IYCK 4C3HK 2E2JC 2PMZD 5C4JK 3TTGA 4BLBA 4A3KC 2RH6A 4KB4A 1JQWA 3GTJC 4A3LK 3CQZK 3HOUC 3GTKC 5EGEA 4BY1C 2R7ZC 1J98A 5C4XC 1KQ4A 3I4NC 2NVQK 2R93C 3S2DK 2WAQL 4GTBA 4KC6A 4ZH4A 4MEXA 1F9NA 1WORA 3OEPA 1O29A 2GSOA 2RGRA 3NUHA 2XCOA 3FOFA 1C0AA 2CW0A 4G0WA 2Y0SD 4C3JC 1SFOK 2VUMK 3S2HC 1I6HC 4A93C 2YU9C 4PABA 2NVXA 1WQGA 4LK0A 1O27A 1X31C 1YNJA 4BBRC 5JFEA 4BBSK 3M4OC 4A3LC 4FM9A 2BE5A 3SZYA 4YFXA 4G0UA 1TWHC 2GSNA 3L4JA 2E2HK 1I3QA 4P5BA 4MQ9A 2V6UA 1ZVUA 1R9TC 3S2DC 3G4CA 4QJVB 1YCLA 3SZZA 4XLPA 3RZOC 2PA8D 1WSVA 4A3CK 3GTJK 4AYBD 4KN4A 2NVTC 4GTCA 3TFHA 3AQOA 3FKIA 4A3GK 1TWFK 1EH1A 3PO3K 1SFOC 4P5AA 1TWGA 2R92K 4GT9A 3OPFA 1YX2A 4A3BK 3S1QK 3HKZD 5E68A 4KMHA 1EK8A 1DCHA 4WILA 3GTPA 4C2MC 2JH3A 1ZYRA 4GZYA 2NVYC 3DXJA 3GSIA 1JOEA 2R93A 3FKIK 5IYDK 1O2BA 4KARA 3GEEA 4BY7C 3OREA 3BUEA 3RZDK 3M3YK 1BS2A 4OIQA 3K7AK 3S1NK 2A68A 4Y7NK 4A3CC 4FZBA 2W7VA 5IP9C 3HOXC 1G51A 1IL2A 2WB1D 5FLMC 5JVOA 2E2IK 2YU9A 1RU0A 1XZPA 2R92C 2B63A 4YFNA 1V5VA 3GTPC 2V6SA 4KATA 1Y1WK 4WJ3M 5M3FK 1TWFA 4PAAA 4G7ZA 4LOWA 3S14C 4BBSC 1R9TK 3HOYC 3S16C 5FJ8K 2P5MA 5M5YK 1O25A 1BDFA 3GTOA 3JSTA 2E2HC 2NVTK 2JA7C 3H3VL 1XPPA 1VLOA 4Q5SA 3H0GK 4A3MC 4KM8A 3GTMK 2GAGC 4A3JC 4KN7A 2YU9K 4QJVA 4ILDA 1J6WA 1ZXOA 3LAJA 2V6TA 4OINA 2NVXC 2VUMC 3GEIA 4XCHA 4AYBL 1Y1VK 1TWHK 4OIRA 3I4NK 3H0GA 1K83A 4YG2A 2JA6C 5C44K 2ZUFA 1WCMC 1IE0A 2ZFZA 3V4GA 1I50A 1Y1WA 1R9TA 2R7ZK 3QX3A 2JA8C 4A3MK 3GTMC 4J3NA 4C2MK 4A3DK 2WB1L 4GTFA 1VGXA 3S1NC 4A3FC 1J6XA 4GTAA 3GTGC 4YFKA 4A3BC 2A6HA 2JA5K 2B63C 5FLMK 4KAWX 1BJTA 3S16K 4BY1K 5C3EK 1TWFC 1WOOA 4KASA 3I4MK 3S1RC 3HOVK 3S1RK 4DDQA 5TMFA 1WOSA 3GTQK 1VJEA 1Y1WC 3N0BA 4AH6A 1DD5A 1YNNA 2NVYK 3HOWK 3VA7A 3HOXK 2P8TA 3AH5A 1J6VA 4A3GC 1TWGC 1IS1A 4KMUA 1B4AA
chains in the Genus database with same CATH topology
5JVOA 2YU9A 2RH6A 2B63A 4KB4A 5EGEA 4KATA 1KQ4A 2CFAB 1TWFA 4GTEA 1TWHA 3CAGA 4LQYA 4GTBA 4KC6A 1F9NA 2GSUA 1O26A 2P5MA 1WCMA 5IOSA 1O25A 1O24A 3OEPA 1O29A 2GSOA 1Y1VA 4KMDA 3GTOA 2RGRA 3NUHA 5IORA 2XCOA 3FOFA 5CJ9A 1BGWA 4G0WA 4G0VA 4C3JC 4KM8A 5CHPA 2JA7A 3FOEA 1WQGA 2NVXA 1O27A 3GTMA 3GTJA 4ILDA 3GTKA 1AB4A 1ZXOA 5JFEA 3LAJA 4GFQA 4FM9A 4G0UA 1WIHA 3GTLA 3N3YA 3GTGA 2CFAA 2GSNA 1GE9A 5IOQA 3L4JA 3H0GA 1K83A 1I3QA 4P5BA 5TJ3A 4C3IC 3MMLB 3S0XA 1ISEA 1O2AA 1ZVUA 2ZFZA 3GTQA 3G4CA 1TWCA 1O28A 1B4BA 2XCQA 3L4KA 2E2HA 4M1XA 3AQPA 3V4GA 1I50A 1Y1WA 1XXBA 1R9TA 4C3HC 2XCRB 3Q3QA 4KMAA 4GTCA 1WQFA 5EGHA 3QX3A 3AQOA 3FKIA 3LPXA 2PHCB 1EH1A 4P5AA 3N0CA 4J3NA 1ZBSA 1TWGA 4KM9A 4GTFA 4GT9A 3OPFA 2VUMA 2JA5A 1TWAA 4GTAA 4KB2A 4KDDA 1SFOA 5IOTA 4KMHA 1EK8A 1XXAA 1XXCA 4KAWX 1BJTA 4C2MC 3GTPA 2JA6A 2R7ZA 2JH3A 4BLAA 2R93A 4KASA 3LAPA 2E2IA 1O2BA 4KARA 4DDQA 4BKWA 3N0BA 3OREA 3BUEA 3CQZA 2NVYA 3G4AA 1DD5A 1WQHA 3ERED 4LR2A 2KWAA 4GTLA 3VA7A 2R92A 4FZBA 3AH5A 4GTDA 2Y3PA 3FHZA 1IS1A 1B4AA 4BLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2A A;  3G4C A;  1O28 A;  5CHP A;  4KAS A;  1O2B A;  4KAR A;  4KAT A;  1O27 A;  1KQ4 A;  2CFA B;  4GTC A;  4GTE A;  3N0B A;  5JFE A;  3G4A A;  4GTB A;  4P5A A;  3N0C A;  3N3Y A;  2CFA A;  4GTL A;  1O26 A;  4GTF A;  4GT9 A;  5IOQ A;  5IOS A;  1O25 A;  1O24 A;  1O29 A;  4FZB A;  3AH5 A;  4GTA A;  4GTD A;  5IOR A;  5IOT A;  4P5B A; 
#chains in the Genus database with same CATH topology
 3I4M C;  5IYB K;  1WOP A;  3ADA C;  4G7O A;  5C3E C;  5M5X K;  2JA6 K;  3RZO K;  1PJ6 A;  4GTE A;  4XLN A;  3GTG K;  4LQY A;  2PPB A;  4OIP A;  1IW7 A;  1I3Q K;  3PO2 K;  3S15 C;  3TFI A;  2A6E A;  1O26 A;  1WCM A;  3EQL A;  5IP7 K;  1Y1V A;  4KMD A;  2JA8 K;  3M4O K;  1BGW A;  3BP3 A;  4BBR K;  1PJ7 A;  4A3E K;  1INN A;  1EI6 A;  2ZUE A;  5CHP A;  2NVX K;  3GTL K;  2JA7 A;  2WAQ D;  3GTM A;  2D6F C;  1AB4 A;  1DCP A;  1XZP B;  4GFQ A;  5IYB C;  4WJ4 A;  4Q4Z A;  3GTG A;  1GE9 A;  3S2H K;  1I6H K;  1VRQ C;  3HOZ K;  1I50 K;  1I50 C;  3HOW C;  3HOZ C;  3S0X A;  5L46 A;  1ZQ1 C;  3T02 A;  1ISE A;  3HOY K;  1TWC A;  4QIW L;  2XCQ A;  3AQP A;  5IP7 C;  3H3V D;  3CQZ C;  1XXB A;  3A8I A;  3GTQ C;  3GIR A;  2XCR B;  2JA7 K;  4XSX A;  1HI9 A;  1USO A;  4KMA A;  3HOV C;  5EGH A;  4A3K K;  2FQO A;  1IBA A;  4X6A K;  2FQT A;  4Y52 C;  3S17 K;  2O5I A;  3N0C A;  4KM9 A;  5D4D A;  3FKI C;  5IYD C;  1TWA A;  4KB2 A;  4A3I K;  1SFO A;  4P9S A;  5IOT A;  1XXC A;  3S1M K;  5M5W K;  3GEH A;  3S1M C;  3GTP K;  3BP8 C;  5C4J C;  3K7A C;  3A8K A;  1TWC C;  2NVQ C;  2R93 K;  1TWC K;  1I6V A;  4BKW A;  2NVY A;  2B63 K;  3PO3 C;  3ERE D;  4C45 A;  3GTO C;  3T01 A;  4GTL A;  3HKZ L;  3S1Q C;  4A3D C;  1TWG K;  5C44 C;  2R92 A;  4GTD A;  2Y3P A;  3FHZ A;  1K83 K;  1JVI A;  4BY7 K;  1O2F B;  2JA5 C;  1TWA C;  1F7V A;  4Y52 K;  3WOD A;  2CFA B;  2Y0S L;  1TWH A;  4A3I C;  3CAG A;  3H0G C;  1EQR A;  2GAH C;  5HL8 A;  2GSU A;  3S17 C;  5IOS A;  1SMY A;  1O24 A;  4LLG A;  3AD7 C;  3AD8 C;  5IOR A;  4A3F K;  4A3E C;  5CJ9 A;  1WCM K;  4G0V A;  2PA8 L;  3S14 K;  2EBB A;  1VH2 A;  3FOE A;  4RMF A;  3GTL C;  4MEY A;  1EFW A;  3GTJ A;  4QIW D;  3T00 A;  3GTK A;  1PJ5 A;  3TFJ A;  1WIH A;  3GTL A;  3N3Y A;  2CFA A;  4A3J K;  5C4X K;  5IOQ A;  4C3I K;  5IP9 K;  5TJ3 A;  4C3I C;  3MML B;  5M3M K;  3GDZ A;  1O2A A;  3GTQ A;  1Y1V C;  2A69 A;  1O28 A;  1B4B A;  3L4K A;  4A93 K;  2E2H A;  1HQM A;  4M1X A;  1I3Q C;  3PO2 C;  4C3J K;  1F93 A;  3S15 K;  4OIO A;  4C3H C;  5IYC C;  3Q3Q A;  2O5J A;  1WQF A;  3HXA A;  1WSR A;  3LPX A;  2PHC B;  3GTK K;  1XZQ A;  1UV7 A;  3AD9 C;  1ZBS A;  3GTO K;  2VUM A;  2JA5 A;  2E2J K;  4KDD A;  1DCO A;  1USM A;  3RZD C;  3M3Y C;  2PMZ L;  2E2I C;  1IQ0 A;  1XXA A;  4LJZ A;  1XZQ B;  1K83 C;  2JA6 A;  2R7Z A;  4XSZ A;  3HOU K;  4X6A C;  4BLA A;  4Y7N C;  3LAP A;  2E2I A;  4G7H A;  4O2D A;  5TMC A;  3A8J A;  4LK1 A;  4BXX C;  4BXX K;  3CQZ A;  3G4A A;  4JK1 A;  1WQH A;  4LR2 A;  4NOI A;  1L0W A;  2KWA A;  3IPJ A;  1TWA K;  1F7U A;  5IYC K;  4C3H K;  2E2J C;  2PMZ D;  5C4J K;  3TTG A;  4BLB A;  4A3K C;  2RH6 A;  4KB4 A;  1JQW A;  3GTJ C;  4A3L K;  3CQZ K;  3HOU C;  3GTK C;  5EGE A;  4BY1 C;  2R7Z C;  1J98 A;  5C4X C;  1KQ4 A;  3I4N C;  2NVQ K;  2R93 C;  3S2D K;  2WAQ L;  4GTB A;  4KC6 A;  4ZH4 A;  4MEX A;  1F9N A;  1WOR A;  3OEP A;  1O29 A;  2GSO A;  2RGR A;  3NUH A;  2XCO A;  3FOF A;  1C0A A;  2CW0 A;  4G0W A;  2Y0S D;  4C3J C;  1SFO K;  2VUM K;  3S2H C;  1I6H C;  4A93 C;  2YU9 C;  4PAB A;  2NVX A;  1WQG A;  4LK0 A;  1O27 A;  1X31 C;  1YNJ A;  4BBR C;  5JFE A;  4BBS K;  3M4O C;  4A3L C;  4FM9 A;  2BE5 A;  3SZY A;  4YFX A;  4G0U A;  1TWH C;  2GSN A;  3L4J A;  2E2H K;  1I3Q A;  4P5B A;  4MQ9 A;  2V6U A;  1ZVU A;  1R9T C;  3S2D C;  3G4C A;  4QJV B;  1YCL A;  3SZZ A;  4XLP A;  3RZO C;  2PA8 D;  1WSV A;  4A3C K;  3GTJ K;  4AYB D;  4KN4 A;  2NVT C;  4GTC A;  3TFH A;  3AQO A;  3FKI A;  4A3G K;  1TWF K;  1EH1 A;  3PO3 K;  1SFO C;  4P5A A;  1TWG A;  2R92 K;  4GT9 A;  3OPF A;  1YX2 A;  4A3B K;  3S1Q K;  3HKZ D;  5E68 A;  4KMH A;  1EK8 A;  1DCH A;  4WIL A;  3GTP A;  4C2M C;  2JH3 A;  1ZYR A;  4GZY A;  2NVY C;  3DXJ A;  3GSI A;  1JOE A;  2R93 A;  3FKI K;  5IYD K;  1O2B A;  4KAR A;  3GEE A;  4BY7 C;  3ORE A;  3BUE A;  3RZD K;  3M3Y K;  1BS2 A;  4OIQ A;  3K7A K;  3S1N K;  2A68 A;  4Y7N K;  4A3C C;  4FZB A;  2W7V A;  5IP9 C;  3HOX C;  1G51 A;  1IL2 A;  2WB1 D;  5FLM C;  5JVO A;  2E2I K;  2YU9 A;  1RU0 A;  1XZP A;  2R92 C;  2B63 A;  4YFN A;  1V5V A;  3GTP C;  2V6S A;  4KAT A;  1Y1W K;  4WJ3 M;  5M3F K;  1TWF A;  4PAA A;  4G7Z A;  4LOW A;  3S14 C;  4BBS C;  1R9T K;  3HOY C;  3S16 C;  5FJ8 K;  2P5M A;  5M5Y K;  1O25 A;  1BDF A;  3GTO A;  3JST A;  2E2H C;  2NVT K;  2JA7 C;  3H3V L;  1XPP A;  1VLO A;  4Q5S A;  3H0G K;  4A3M C;  4KM8 A;  3GTM K;  2GAG C;  4A3J C;  4KN7 A;  2YU9 K;  4QJV A;  4ILD A;  1J6W A;  1ZXO A;  3LAJ A;  2V6T A;  4OIN A;  2NVX C;  2VUM C;  3GEI A;  4XCH A;  4AYB L;  1Y1V K;  1TWH K;  4OIR A;  3I4N K;  3H0G A;  1K83 A;  4YG2 A;  2JA6 C;  5C44 K;  2ZUF A;  1WCM C;  1IE0 A;  2ZFZ A;  3V4G A;  1I50 A;  1Y1W A;  1R9T A;  2R7Z K;  3QX3 A;  2JA8 C;  4A3M K;  3GTM C;  4J3N A;  4C2M K;  4A3D K;  2WB1 L;  4GTF A;  1VGX A;  3S1N C;  4A3F C;  1J6X A;  4GTA A;  3GTG C;  4YFK A;  4A3B C;  2A6H A;  2JA5 K;  2B63 C;  5FLM K;  4KAW X;  1BJT A;  3S16 K;  4BY1 K;  5C3E K;  1TWF C;  1WOO A;  4KAS A;  3I4M K;  3S1R C;  3HOV K;  3S1R K;  4DDQ A;  5TMF A;  1WOS A;  3GTQ K;  1VJE A;  1Y1W C;  3N0B A;  4AH6 A;  1DD5 A;  1YNN A;  2NVY K;  3HOW K;  3VA7 A;  3HOX K;  2P8T A;  3AH5 A;  1J6V A;  4A3G C;  1TWG C;  1IS1 A;  4KMU A;  1B4A A; 
#chains in the Genus database with same CATH homology
 5JVO A;  2YU9 A;  2RH6 A;  2B63 A;  4KB4 A;  5EGE A;  4KAT A;  1KQ4 A;  2CFA B;  1TWF A;  4GTE A;  1TWH A;  3CAG A;  4LQY A;  4GTB A;  4KC6 A;  1F9N A;  2GSU A;  1O26 A;  2P5M A;  1WCM A;  5IOS A;  1O25 A;  1O24 A;  3OEP A;  1O29 A;  2GSO A;  1Y1V A;  4KMD A;  3GTO A;  2RGR A;  3NUH A;  5IOR A;  2XCO A;  3FOF A;  5CJ9 A;  1BGW A;  4G0W A;  4G0V A;  4C3J C;  4KM8 A;  5CHP A;  2JA7 A;  3FOE A;  1WQG A;  2NVX A;  1O27 A;  3GTM A;  3GTJ A;  4ILD A;  3GTK A;  1AB4 A;  1ZXO A;  5JFE A;  3LAJ A;  4GFQ A;  4FM9 A;  4G0U A;  1WIH A;  3GTL A;  3N3Y A;  3GTG A;  2CFA A;  2GSN A;  1GE9 A;  5IOQ A;  3L4J A;  3H0G A;  1K83 A;  1I3Q A;  4P5B A;  5TJ3 A;  4C3I C;  3MML B;  3S0X A;  1ISE A;  1O2A A;  1ZVU A;  2ZFZ A;  3GTQ A;  3G4C A;  1TWC A;  1O28 A;  1B4B A;  2XCQ A;  3L4K A;  2E2H A;  4M1X A;  3AQP A;  3V4G A;  1I50 A;  1Y1W A;  1XXB A;  1R9T A;  4C3H C;  2XCR B;  3Q3Q A;  4KMA A;  4GTC A;  1WQF A;  5EGH A;  3QX3 A;  3AQO A;  3FKI A;  3LPX A;  2PHC B;  1EH1 A;  4P5A A;  3N0C A;  4J3N A;  1ZBS A;  1TWG A;  4KM9 A;  4GTF A;  4GT9 A;  3OPF A;  2VUM A;  2JA5 A;  1TWA A;  4GTA A;  4KB2 A;  4KDD A;  1SFO A;  5IOT A;  4KMH A;  1EK8 A;  1XXA A;  1XXC A;  4KAW X;  1BJT A;  4C2M C;  3GTP A;  2JA6 A;  2R7Z A;  2JH3 A;  4BLA A;  2R93 A;  4KAS A;  3LAP A;  2E2I A;  1O2B A;  4KAR A;  4DDQ A;  4BKW A;  3N0B A;  3ORE A;  3BUE A;  3CQZ A;  2NVY A;  3G4A A;  1DD5 A;  1WQH A;  3ERE D;  4LR2 A;  2KWA A;  4GTL A;  3VA7 A;  2R92 A;  4FZB A;  3AH5 A;  4GTD A;  2Y3P A;  3FHZ A;  1IS1 A;  1B4A A;  4BLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...