1O25A

Crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with dump at 2.4 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
217
structure length
214
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Functional Analysis of Substrate and Cofactor Complex Structures of a Thymidylate Synthase-Complementing Protein
pubmed doi rcsb
source organism Thermotoga maritima
total genus 73
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2003-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1o25A00
4KATA 5IORA 3N0BA 4P5BA 1O27A 5CHPA 3N0CA 4KARA 1O28A 1O25A 1O26A 4GTLA 4GT9A 3G4AA 5IOSA 4GTBA 4GTFA 4GTAA 4FZBA 1KQ4A 1O2BA 3G4CA 4GTEA 2CFAA 4GTCA 4GTDA 1O29A 5IOTA 5JFEA 1O24A 4P5AA 3AH5A 1O2AA 4KASA 3N3YA 2CFAB 5IOQA
chains in the Genus database with same CATH superfamily
4A3JC 1R9TC 3SZYA 4BY1K 2XCOA 4XSZA 1O28A 1EQRA 1XXCA 1JVIA 1PJ5A 3LAJA 1Y1WC 2O5JA 3DXJA 4BBRK 5C44K 4Q5SA 1F9NA 4YFXA 3S16K 3S2HC 5EGEA 4BBSC 5C3EC 1IQ0A 1DD5A 4FM9A 1XZPB 5IP9C 3GTKA 4LOWA 3GTJC 3HKZL 3GTQK 1SFOA 3GSIA 3H0GA 4C2MC 4BLBA 4FZBA 3TFHA 3S14C 3GEHA 4Y52K 4KMHA 3GTLC 1PJ6A 3K7AC 1TWCK 1ZBSA 3GTMC 3ERED 2CFAB 4KAWX 4Y7NC 3HOXK 2YU9C 1VRQC 4GZYA 1TWHC 4XLNA 5FLMC 3LAPA 1O26A 3GTOK 4GTAA 2KWAA 3CQZK 1O2BA 3HKZD 4OIOA 1JOEA 2JA5K 3S15K 1IE0A 3FKIC 3VA7A 5FJ8K 1K83C 4GTDA 2NVYA 3HXAA 4KB2A 4XSXA 4AYBD 1DCOA 4X6AK 4GFQA 1J6XA 5M5YK 1TWCA 4G7ZA 4BLAA 3L4JA 2JA7C 4A3GK 4ZH4A 3HOZC 1L0WA 4A3EC 3S17K 5L46A 1WCMK 5C4XC 5M5WK 2JA6C 3RZOC 1ZQ1C 3QX3A 1YNNA 4C3IC 2R92K 3GTOA 4BXXK 4LR2A 2E2HA 1X31C 3PO2C 2ZFZA 2JA5A 3Q3QA 1O24A 4A93K 2R93K 3AQPA 1R9TK 5IYCK 3HOYC 4PAAA 1DCHA 1EH1A 1J6WA 3M4OC 3TFIA 5IP7C 2Y0SL 3GTGK 4GTEA 3M3YC 3A8KA 4OIPA 1WCMA 1XZQB 3S2HK 4LLGA 4BBSK 2R92A 1VJEA 3GTJK 1VLOA 1USMA 2R93A 1I3QC 1USOA 2P8TA 1TWGC 3FHZA 2NVQK 5C4JC 1SMYA 3GEEA 1B4BA 3H3VL 3TFJA 2NVXA 3NUHA 3S14K 3A8IA 1WIHA 3A8JA 4PABA 3S1QC 5JVOA 1WOOA 2WAQL 2XCRB 4OINA 1XZPA 3GEIA 4BKWA 3OREA 3S0XA 4A3FC 3SZZA 1GE9A 3S2DC 1TWFK 3GTGA 4G7OA 5IYBC 2V6UA 4Y7NK 4KN4A 4A3IK 3BP3A 1RU0A 4G0WA 4WJ3M 4C3HC 2Y0SD 4A3BC 5TMCA 1WQFA 5IOQA 3S1MK 4A3DK 4A3KK 1I50A 1YCLA 1TWHK 3CAGA 3N0BA 3BP8C 1C0AA 2B63K 5IYDK 4GTLA 3S1NC 2GAGC 2A68A 1WQHA 1ZVUA 3RZDC 1WSVA 3HOUK 2VUMK 5D4DA 1J6VA 3GTPK 4M1XA 2E2JC 3H3VD 4A3LC 4P5AA 3AH5A 1TWFA 4LK0A 3GTKC 3N3YA 2WAQD 4C45A 2E2IK 1ISEA 1SFOC 3H0GC 4BY1C 3PO3C 2NVTK 3GTQA 3G4AA 3RZOK 1XPPA 2B63A 1V5VA 4GTCA 2PMZL 3AD8C 4KM8A 5C44C 4G0UA 2PHCB 2GSNA 1I6HK 3AQOA 4C3JK 2VUMA 4KASA 1TWAK 1Y1VK 3GTPA 3FOFA 2O5IA 2EBBA 3I4NK 4OIQA 2XCQA 1XXAA 3HOWC 3GTQC 1XXBA 1J98A 2E2IA 5EGHA 1YX2A 4OIRA 2D6FC 2JA8C 3OEPA 4NOIA 4KDDA 1IL2A 1KQ4A 2R7ZK 3G4CA 4YG2A 2NVYC 1BS2A 4Y52C 3CQZA 1G51A 2GAHC 4KMDA 4A3MC 4A3JK 1TWCC 2RH6A 1TWAA 1Y1VA 1XZQA 3N0CA 1O25A 1Y1WK 4BY7C 1WORA 1VGXA 3V4GA 5TJ3A 3GTOC 2V6TA 3WODA 2E2HC 2JA5C 3S15C 4WJ4A 2R7ZA 4KB4A 4LK1A 4C3HK 5JFEA 2ZUFA 5M3FK 1O2AA 5C3EK 1I6VA 3S1RC 5IP9K 4X6AC 3AD9C 1O2FB 4MEYA 5CJ9A 2FQTA 1UV7A 1BDFA 1R9TA 1HQMA 3T00A 2PA8L 4C2MK 3I4MC 3S1NK 4QJVB 2PPBA 3GIRA 3IPJA 4A3GC 4GTFA 2GSUA 3S17C 1WCMC 4P9SA 1Y1WA 3LPXA 1BJTA 1BGWA 4QIWL 2R92C 4BXXC 2E2JK 4A3LK 3FOEA 3GTLK 1IBAA 3K7AK 3GTMK 5TMFA 2R93C 4A93C 1WOPA 3H0GK 2A6HA 1B4AA 4KATA 2YU9K 5IYCC 3PO3K 3GTJA 1IS1A 5CHPA 5FLMK 4KARA 4J3NA 2NVXC 3HOVC 4GT9A 4XCHA 1F93A 3FKIK 1K83K 2CFAA 4KM9A 3GTGC 4ILDA 2PA8D 1PJ7A 2A6EA 3GTLA 1I50C 3HOWK 3L4KA 4A3CC 3GTMA 4QIWD 3OPFA 2JA7K 2NVQC 2JA8K 2YU9A 3HOZK 4AYBL 4A3EK 1TWHA 5C4XK 2JA6K 4YFNA 2NVYK 4C3IK 4LQYA 3AD7C 3PO2K 4BBRC 3FKIA 1WOSA 1K83A 5IOTA 1TWFC 4A3MK 3S16C 4LJZA 4A3IC 1JQWA 4Q4ZA 3HOYK 5IORA 3S1MC 4A3DC 4A3KC 4MEXA 4G0VA 2FQOA 3BUEA 4KMAA 2BE5A 1EFWA 4BY7K 3M4OK 2B63C 5IP7K 5IYDC 4GTBA 2JA7A 2E2HK 1VH2A 4YFKA 2P5MA 3M3YK 2GSOA 4KMUA 3JSTA 2JA6A 3HOUC 1IW7A 4AH6A 2VUMC 3S1RK 1F7VA 3GTPC 5M5XK 1DCPA 1WSRA 1EK8A 1I3QK 4KC6A 1TWGK 2E2IC 2PMZD 4JK1A 2Y3PA 3I4MK 5C4JK 3HOXC 1O27A 2NVTC 3S1QK 5IOSA 2WB1L 1AB4A 5M3MK 4A3FK 3EQLA 2RGRA 2ZUEA 3S2DK 3CQZC 5IYBK 4G7HA 4WILA 1F7UA 1I6HC 3GDZA 4QJVA 4C3JC 4A3BK 1YNJA 3MMLB 1TWAC 1Y1VC 5E68A 3TTGA 1WQGA 4O2DA 2NVXK 5HL8A 3I4NC 1I3QA 3HOVK 4P5BA 1TWGA 1HI9A 1ZYRA 2CW0A 1INNA 4XLPA 1ZXOA 1EI6A 3RZDK 2A69A 2R7ZC 1O29A 2W7VA 4DDQA 2V6SA 3T02A 1I50K 3ADAC 2JH3A 3GTKK 4RMFA 2WB1D 4A3CK 4MQ9A 4KN7A 3T01A 1SFOK
chains in the Genus database with same CATH topology
3GTMA 2XCQA 1XXAA 2XCOA 1XXBA 1EH1A 3OPFA 2E2IA 5EGHA 1O28A 2YU9A 1XXCA 1TWHA 3LAJA 3OEPA 4KDDA 1KQ4A 3G4CA 4GTEA 4LQYA 1WCMA 1F9NA 3FKIA 1K83A 5IOTA 3CQZA 2R92A 5EGEA 4KMDA 1DD5A 4FM9A 3GTKA 2R93A 2RH6A 5IORA 1TWAA 1Y1VA 4G0VA 3FHZA 1SFOA 3BUEA 4KMAA 3H0GA 3N0CA 1O25A 4C2MC 1B4BA 2NVXA 3NUHA 4GTBA 4BLBA 2JA7A 1WIHA 4FZBA 5TJ3A 3V4GA 5JVOA 2P5MA 2XCRB 4BKWA 3OREA 2GSOA 3S0XA 2JA6A 1GE9A 2R7ZA 4KB4A 4KMHA 3GTGA 5JFEA 1O2AA 4G0WA 4C3HC 1ZBSA 3ERED 1EK8A 2CFAB 1WQFA 4KAWX 5IOQA 4KC6A 1I50A 3CAGA 5CJ9A 2Y3PA 1R9TA 3N0BA 1O27A 3LAPA 1O26A 4GTLA 5IOSA 4GTFA 4GTAA 1AB4A 2GSUA 2KWAA 1O2BA 1Y1WA 2RGRA 1WQHA 1ZVUA 3LPXA 3VA7A 1BJTA 1BGWA 4GTDA 3FOEA 2NVYA 4KB2A 4M1XA 4P5AA 3AH5A 1TWFA 4C3JC 3N3YA 3MMLB 4GFQA 1ISEA 1B4AA 1WQGA 4KATA 1TWCA 1I3QA 4BLAA 3GTJA 1IS1A 4P5BA 5CHPA 4KARA 4J3NA 1TWGA 3L4JA 3GTQA 4GT9A 3G4AA 1ZXOA 2B63A 2CFAA 4GTCA 4KM9A 3QX3A 4C3IC 4KM8A 3GTOA 1O29A 4ILDA 4G0UA 4LR2A 2E2HA 2JA5A 2ZFZA 2PHCB 2GSNA 3AQOA 4DDQA 3Q3QA 1O24A 2JH3A 2VUMA 4KASA 3AQPA 3GTLA 3GTPA 3FOFA 3L4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAT A;  5IOR A;  3N0B A;  4P5B A;  1O27 A;  5CHP A;  3N0C A;  4KAR A;  1O28 A;  1O25 A;  1O26 A;  4GTL A;  4GT9 A;  3G4A A;  5IOS A;  4GTB A;  4GTF A;  4GTA A;  4FZB A;  1KQ4 A;  1O2B A;  3G4C A;  4GTE A;  2CFA A;  4GTC A;  4GTD A;  1O29 A;  5IOT A;  5JFE A;  1O24 A;  4P5A A;  3AH5 A;  1O2A A;  4KAS A;  3N3Y A;  2CFA B;  5IOQ A; 
#chains in the Genus database with same CATH topology
 4A3J C;  1R9T C;  3SZY A;  4BY1 K;  2XCO A;  4XSZ A;  1O28 A;  1EQR A;  1XXC A;  1JVI A;  1PJ5 A;  3LAJ A;  1Y1W C;  2O5J A;  3DXJ A;  4BBR K;  5C44 K;  4Q5S A;  1F9N A;  4YFX A;  3S16 K;  3S2H C;  5EGE A;  4BBS C;  5C3E C;  1IQ0 A;  1DD5 A;  4FM9 A;  1XZP B;  5IP9 C;  3GTK A;  4LOW A;  3GTJ C;  3HKZ L;  3GTQ K;  1SFO A;  3GSI A;  3H0G A;  4C2M C;  4BLB A;  4FZB A;  3TFH A;  3S14 C;  3GEH A;  4Y52 K;  4KMH A;  3GTL C;  1PJ6 A;  3K7A C;  1TWC K;  1ZBS A;  3GTM C;  3ERE D;  2CFA B;  4KAW X;  4Y7N C;  3HOX K;  2YU9 C;  1VRQ C;  4GZY A;  1TWH C;  4XLN A;  5FLM C;  3LAP A;  1O26 A;  3GTO K;  4GTA A;  2KWA A;  3CQZ K;  1O2B A;  3HKZ D;  4OIO A;  1JOE A;  2JA5 K;  3S15 K;  1IE0 A;  3FKI C;  3VA7 A;  5FJ8 K;  1K83 C;  4GTD A;  2NVY A;  3HXA A;  4KB2 A;  4XSX A;  4AYB D;  1DCO A;  4X6A K;  4GFQ A;  1J6X A;  5M5Y K;  1TWC A;  4G7Z A;  4BLA A;  3L4J A;  2JA7 C;  4A3G K;  4ZH4 A;  3HOZ C;  1L0W A;  4A3E C;  3S17 K;  5L46 A;  1WCM K;  5C4X C;  5M5W K;  2JA6 C;  3RZO C;  1ZQ1 C;  3QX3 A;  1YNN A;  4C3I C;  2R92 K;  3GTO A;  4BXX K;  4LR2 A;  2E2H A;  1X31 C;  3PO2 C;  2ZFZ A;  2JA5 A;  3Q3Q A;  1O24 A;  4A93 K;  2R93 K;  3AQP A;  1R9T K;  5IYC K;  3HOY C;  4PAA A;  1DCH A;  1EH1 A;  1J6W A;  3M4O C;  3TFI A;  5IP7 C;  2Y0S L;  3GTG K;  4GTE A;  3M3Y C;  3A8K A;  4OIP A;  1WCM A;  1XZQ B;  3S2H K;  4LLG A;  4BBS K;  2R92 A;  1VJE A;  3GTJ K;  1VLO A;  1USM A;  2R93 A;  1I3Q C;  1USO A;  2P8T A;  1TWG C;  3FHZ A;  2NVQ K;  5C4J C;  1SMY A;  3GEE A;  1B4B A;  3H3V L;  3TFJ A;  2NVX A;  3NUH A;  3S14 K;  3A8I A;  1WIH A;  3A8J A;  4PAB A;  3S1Q C;  5JVO A;  1WOO A;  2WAQ L;  2XCR B;  4OIN A;  1XZP A;  3GEI A;  4BKW A;  3ORE A;  3S0X A;  4A3F C;  3SZZ A;  1GE9 A;  3S2D C;  1TWF K;  3GTG A;  4G7O A;  5IYB C;  2V6U A;  4Y7N K;  4KN4 A;  4A3I K;  3BP3 A;  1RU0 A;  4G0W A;  4WJ3 M;  4C3H C;  2Y0S D;  4A3B C;  5TMC A;  1WQF A;  5IOQ A;  3S1M K;  4A3D K;  4A3K K;  1I50 A;  1YCL A;  1TWH K;  3CAG A;  3N0B A;  3BP8 C;  1C0A A;  2B63 K;  5IYD K;  4GTL A;  3S1N C;  2GAG C;  2A68 A;  1WQH A;  1ZVU A;  3RZD C;  1WSV A;  3HOU K;  2VUM K;  5D4D A;  1J6V A;  3GTP K;  4M1X A;  2E2J C;  3H3V D;  4A3L C;  4P5A A;  3AH5 A;  1TWF A;  4LK0 A;  3GTK C;  3N3Y A;  2WAQ D;  4C45 A;  2E2I K;  1ISE A;  1SFO C;  3H0G C;  4BY1 C;  3PO3 C;  2NVT K;  3GTQ A;  3G4A A;  3RZO K;  1XPP A;  2B63 A;  1V5V A;  4GTC A;  2PMZ L;  3AD8 C;  4KM8 A;  5C44 C;  4G0U A;  2PHC B;  2GSN A;  1I6H K;  3AQO A;  4C3J K;  2VUM A;  4KAS A;  1TWA K;  1Y1V K;  3GTP A;  3FOF A;  2O5I A;  2EBB A;  3I4N K;  4OIQ A;  2XCQ A;  1XXA A;  3HOW C;  3GTQ C;  1XXB A;  1J98 A;  2E2I A;  5EGH A;  1YX2 A;  4OIR A;  2D6F C;  2JA8 C;  3OEP A;  4NOI A;  4KDD A;  1IL2 A;  1KQ4 A;  2R7Z K;  3G4C A;  4YG2 A;  2NVY C;  1BS2 A;  4Y52 C;  3CQZ A;  1G51 A;  2GAH C;  4KMD A;  4A3M C;  4A3J K;  1TWC C;  2RH6 A;  1TWA A;  1Y1V A;  1XZQ A;  3N0C A;  1O25 A;  1Y1W K;  4BY7 C;  1WOR A;  1VGX A;  3V4G A;  5TJ3 A;  3GTO C;  2V6T A;  3WOD A;  2E2H C;  2JA5 C;  3S15 C;  4WJ4 A;  2R7Z A;  4KB4 A;  4LK1 A;  4C3H K;  5JFE A;  2ZUF A;  5M3F K;  1O2A A;  5C3E K;  1I6V A;  3S1R C;  5IP9 K;  4X6A C;  3AD9 C;  1O2F B;  4MEY A;  5CJ9 A;  2FQT A;  1UV7 A;  1BDF A;  1R9T A;  1HQM A;  3T00 A;  2PA8 L;  4C2M K;  3I4M C;  3S1N K;  4QJV B;  2PPB A;  3GIR A;  3IPJ A;  4A3G C;  4GTF A;  2GSU A;  3S17 C;  1WCM C;  4P9S A;  1Y1W A;  3LPX A;  1BJT A;  1BGW A;  4QIW L;  2R92 C;  4BXX C;  2E2J K;  4A3L K;  3FOE A;  3GTL K;  1IBA A;  3K7A K;  3GTM K;  5TMF A;  2R93 C;  4A93 C;  1WOP A;  3H0G K;  2A6H A;  1B4A A;  4KAT A;  2YU9 K;  5IYC C;  3PO3 K;  3GTJ A;  1IS1 A;  5CHP A;  5FLM K;  4KAR A;  4J3N A;  2NVX C;  3HOV C;  4GT9 A;  4XCH A;  1F93 A;  3FKI K;  1K83 K;  2CFA A;  4KM9 A;  3GTG C;  4ILD A;  2PA8 D;  1PJ7 A;  2A6E A;  3GTL A;  1I50 C;  3HOW K;  3L4K A;  4A3C C;  3GTM A;  4QIW D;  3OPF A;  2JA7 K;  2NVQ C;  2JA8 K;  2YU9 A;  3HOZ K;  4AYB L;  4A3E K;  1TWH A;  5C4X K;  2JA6 K;  4YFN A;  2NVY K;  4C3I K;  4LQY A;  3AD7 C;  3PO2 K;  4BBR C;  3FKI A;  1WOS A;  1K83 A;  5IOT A;  1TWF C;  4A3M K;  3S16 C;  4LJZ A;  4A3I C;  1JQW A;  4Q4Z A;  3HOY K;  5IOR A;  3S1M C;  4A3D C;  4A3K C;  4MEX A;  4G0V A;  2FQO A;  3BUE A;  4KMA A;  2BE5 A;  1EFW A;  4BY7 K;  3M4O K;  2B63 C;  5IP7 K;  5IYD C;  4GTB A;  2JA7 A;  2E2H K;  1VH2 A;  4YFK A;  2P5M A;  3M3Y K;  2GSO A;  4KMU A;  3JST A;  2JA6 A;  3HOU C;  1IW7 A;  4AH6 A;  2VUM C;  3S1R K;  1F7V A;  3GTP C;  5M5X K;  1DCP A;  1WSR A;  1EK8 A;  1I3Q K;  4KC6 A;  1TWG K;  2E2I C;  2PMZ D;  4JK1 A;  2Y3P A;  3I4M K;  5C4J K;  3HOX C;  1O27 A;  2NVT C;  3S1Q K;  5IOS A;  2WB1 L;  1AB4 A;  5M3M K;  4A3F K;  3EQL A;  2RGR A;  2ZUE A;  3S2D K;  3CQZ C;  5IYB K;  4G7H A;  4WIL A;  1F7U A;  1I6H C;  3GDZ A;  4QJV A;  4C3J C;  4A3B K;  1YNJ A;  3MML B;  1TWA C;  1Y1V C;  5E68 A;  3TTG A;  1WQG A;  4O2D A;  2NVX K;  5HL8 A;  3I4N C;  1I3Q A;  3HOV K;  4P5B A;  1TWG A;  1HI9 A;  1ZYR A;  2CW0 A;  1INN A;  4XLP A;  1ZXO A;  1EI6 A;  3RZD K;  2A69 A;  2R7Z C;  1O29 A;  2W7V A;  4DDQ A;  2V6S A;  3T02 A;  1I50 K;  3ADA C;  2JH3 A;  3GTK K;  4RMF A;  2WB1 D;  4A3C K;  4MQ9 A;  4KN7 A;  3T01 A;  1SFO K; 
#chains in the Genus database with same CATH homology
 3GTM A;  2XCQ A;  1XXA A;  2XCO A;  1XXB A;  1EH1 A;  3OPF A;  2E2I A;  5EGH A;  1O28 A;  2YU9 A;  1XXC A;  1TWH A;  3LAJ A;  3OEP A;  4KDD A;  1KQ4 A;  3G4C A;  4GTE A;  4LQY A;  1WCM A;  1F9N A;  3FKI A;  1K83 A;  5IOT A;  3CQZ A;  2R92 A;  5EGE A;  4KMD A;  1DD5 A;  4FM9 A;  3GTK A;  2R93 A;  2RH6 A;  5IOR A;  1TWA A;  1Y1V A;  4G0V A;  3FHZ A;  1SFO A;  3BUE A;  4KMA A;  3H0G A;  3N0C A;  1O25 A;  4C2M C;  1B4B A;  2NVX A;  3NUH A;  4GTB A;  4BLB A;  2JA7 A;  1WIH A;  4FZB A;  5TJ3 A;  3V4G A;  5JVO A;  2P5M A;  2XCR B;  4BKW A;  3ORE A;  2GSO A;  3S0X A;  2JA6 A;  1GE9 A;  2R7Z A;  4KB4 A;  4KMH A;  3GTG A;  5JFE A;  1O2A A;  4G0W A;  4C3H C;  1ZBS A;  3ERE D;  1EK8 A;  2CFA B;  1WQF A;  4KAW X;  5IOQ A;  4KC6 A;  1I50 A;  3CAG A;  5CJ9 A;  2Y3P A;  1R9T A;  3N0B A;  1O27 A;  3LAP A;  1O26 A;  4GTL A;  5IOS A;  4GTF A;  4GTA A;  1AB4 A;  2GSU A;  2KWA A;  1O2B A;  1Y1W A;  2RGR A;  1WQH A;  1ZVU A;  3LPX A;  3VA7 A;  1BJT A;  1BGW A;  4GTD A;  3FOE A;  2NVY A;  4KB2 A;  4M1X A;  4P5A A;  3AH5 A;  1TWF A;  4C3J C;  3N3Y A;  3MML B;  4GFQ A;  1ISE A;  1B4A A;  1WQG A;  4KAT A;  1TWC A;  1I3Q A;  4BLA A;  3GTJ A;  1IS1 A;  4P5B A;  5CHP A;  4KAR A;  4J3N A;  1TWG A;  3L4J A;  3GTQ A;  4GT9 A;  3G4A A;  1ZXO A;  2B63 A;  2CFA A;  4GTC A;  4KM9 A;  3QX3 A;  4C3I C;  4KM8 A;  3GTO A;  1O29 A;  4ILD A;  4G0U A;  4LR2 A;  2E2H A;  2JA5 A;  2ZFZ A;  2PHC B;  2GSN A;  3AQO A;  4DDQ A;  3Q3Q A;  1O24 A;  2JH3 A;  2VUM A;  4KAS A;  3AQP A;  3GTL A;  3GTP A;  3FOF A;  3L4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...