4X6AK

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4x6aK00
2A6EA 5TMCA 5IYBC 1I3QK 4QIWD 3HOYK 3S1RC 1TWGK 3K7AC 3HOWC 5M3MK 2A69A 2E2JK 4A93C 2Y0SL 3RZOC 2NVQK 2O5IA 4A3FC 1Y1VC 3PO3K 1TWHK 1HQMA 1R9TC 4LK1A 5C3EC 3S2HC 3HOVC 2R93C 3GTKC 1IW7A 3H0GC 3GTGK 3S17K 3GTPK 1WCMK 3HOZC 3PO2C 3S14K 3HKZD 4GZYA 3M4OK 3GTMC 2VUMK 2WAQD 4A3GC 5FLMK 3S15K 3S16C 2O5JA 4XSZA 4BY7K 2PMZD 4ZH4A 1I50K 5C4JK 5C44C 1Y1WC 3S2DK 2JA6C 5C4XK 3S1NC 1K83C 4XLPA 4C2MK 5M5WK 4X6AC 4Y7NC 3HOUC 3I4NC 2A68A 3RZDK 1I6HK 2NVYK 3S1MC 4A3DK 4LLGA 4LJZA 3GTJK 4Y52K 5M5YK 4Q4ZA 5IYDC 3GTLK 4Q5SA 1SMYA 2PA8D 1TWAC 3K7AK 2PPBA 3HOWK 4A93K 1BDFA 4G7ZA 3RZOK 2NVXK 4A3FK 1SFOC 2NVTC 4BBRC 4A3EK 4OIQA 2JA7C 4QJVA 4BY1C 3S2HK 4XSXA 3HOVK 3H0GK 4G7HA 2R92C 4LK0A 2A6HA 3I4MK 3PO2K 5IYCC 4XLNA 3HOXC 2B63K 4A3LC 5IP7C 4A3IC 2R7ZC 3GTMK 4A3GK 1TWCC 2WB1D 3S2DC 4A3MK 4MEXA 2E2IC 2E2HK 3S1QC 4AYBL 5C44K 1Y1WK 3HOYC 2JA6K 3S1NK 1TWFK 4QIWL 3H3VD 2NVQC 4X6AK 4Y7NK 4OIPA 3PO3C 3GTOK 4BXXC 4BBSK 4A3KC 4OIOA 1ZYRA 4YFKA 2CW0A 4NOIA 3GTGC 3S17C 5IYBK 5TMFA 1WCMC 2YU9C 5IYDK 4A3BC 1YNNA 2Y0SD 3S14C 3S1RK 3GTQC 4C3JK 4OIRA 1TWAK 3HKZL 5IP9C 2JA8C 4MQ9A 1Y1VK 2VUMC 3M3YC 4MEYA 5FLMC 1R9TK 2R93K 5C3EK 4QJVB 4BBRK 2WAQL 2JA7K 4BY7C 3GTKK 4A3CC 4BY1K 5M3FK 4YFXA 1YNJA 2PMZL 5C4JC 3HOZK 2R92K 2JA5C 3EQLA 5IYCK 4A3JC 4A3LK 3WODA 5FJ8K 4YG2A 3RZDC 3CQZC 3S16K 4A3IK 2R7ZK 4A3DC 4C3IK 1TWCK 3FKIC 4Y52C 4KMUA 1I3QC 3DXJA 2E2IK 3S1QK 1TWGC 1K83K 2E2JC 4C3HK 3HOUK 3I4NK 1TWHC 4KN4A 2PA8L 2NVXC 3S1MK 4BXXK 5M5XK 4A3EC 4G7OA 4A3KK 3GTPC 4YFNA 2YU9K 4JK1A 3I4MC 3M4OC 4A3BK 2B63C 3GTQK 2JA8K 5IP9K 1SFOK 2NVTK 3M3YK 3S15C 1I50C 2BE5A 4A3MC 4A3CK 2WB1L 2E2HC 5C4XC 3HOXK 2JA5K 1TWFC 1I6VA 5IP7K 1XPPA 4A3JK 5D4DA 4KN7A 4OINA 2NVYC 3GTOC 3H3VL 1I6HC 4BBSC 3CQZK 3GTJC 4AYBD 3GTLC 3FKIK
chains in the Genus database with same CATH superfamily
1TWGK 4A93C 2E2JK 4G0UA 1B4BA 1B4AA 4A3FC 2NVQK 4G0VA 2O5IA 1HQMA 3GTJA 1XXCA 5C3EC 4FM9A 3GTKC 1IW7A 3GTPK 3NUHA 1USOA 5IORA 3M4OK 1TWAA 1WOPA 1Y1VA 3GTMC 2VUMK 4GFQA 2CFAB 5FLMK 3S15K 2O5JA 4BLAA 1RU0A 2P8TA 3H0GA 4ZH4A 1I50K 2XCQA 5C44C 2JA6C 4XLPA 4Y7NC 3ERED 1I6HK 2NVYK 1XXAA 3T02A 3T01A 5IYDC 1Y1WA 1WORA 2GSUA 4DDQA 3L4KA 2PPBA 3FOEA 3RZOK 2NVXK 1O24A 4OIQA 4KMHA 4LQYA 4XLNA 1KQ4A 1SFOA 1F93A 2JA7A 1O2FB 3GEIA 2R92A 4PAAA 3S1NK 4PABA 4QIWL 2R7ZA 4A3KC 2CW0A 3S17C 4GTEA 4A3BC 1YNNA 2Y0SD 3S14C 3SZYA 2JA8C 4KASA 1R9TK 1O25A 4BY7C 1XZQB 2CFAA 4A3CC 1BJTA 3GTPA 4YFXA 1BS2A 2YU9A 3HOZK 1J98A 1IBAA 2V6UA 1WQGA 2VUMA 3WODA 3S16K 4A3DC 1J6WA 4Y52C 2GAGC 1I3QC 2GSOA 3DXJA 2E2IK 4GTCA 4C45A 1YCLA 1GE9A 1IS1A 3QX3A 2NVXA 4KARA 2WB1L 3LAPA 1XXBA 1YX2A 4P5BA 2JA5K 1I6VA 5IP7K 1XPPA 4A3JK 4OINA 4KN7A 3GTJC 3S2DK 3FKIK 5IYBC 3BUEA 3HOYK 3K7AC 3HOWC 1EQRA 2A69A 5M3MK 1Y1VC 3PO3K 1TWHK 3V4GA 5JVOA 1VJEA 3TFJA 3HOVC 1XZQA 3H0GC 1WCMK 3ADAC 3PO2C 3FHZA 3HKZD 1G51A 3CAGA 4P5AA 1R9TA 2WAQD 4A3GC 2ZUEA 2PMZD 5C4JK 1Y1WC 3AD9C 5M5WK 3VA7A 2ZFZA 5E68A 3TFHA 3HOUC 3I4NC 2A68A 3RZDK 3S1MC 2ZUFA 3N3YA 4LJZA 1EH1A 3GTLK 4KAWX 4KB2A 1IQ0A 2PA8D 4A93K 1BDFA 4A3FK 1SFOC 2NVTC 1IE0A 4A3EK 2JA7C 2XCOA 4BY1C 1DCPA 1PJ7A 2R92C 2A6HA 3I4MK 5HL8A 3HOXC 1V5VA 4A3IC 2R7ZC 3GTMK 4MEXA 2E2HK 3S1QC 5C44K 2JA5A 2JA6K 1TWFK 2PHCB 2NVQC 4Y7NK 4OIPA 4BXXC 1WSRA 1WIHA 1TWCA 3GTOK 4OIOA 4P9SA 3AH5A 2YU9C 4WJ4A 5IYDK 3S1RK 4C3JK 4OIRA 4WILA 5IP9C 2VUMC 2RGRA 5FLMC 1VRQC 2R93K 1XZPB 4QJVB 1WCMA 5M3FK 3GTQA 3OREA 4C3IK 4XCHA 1VLOA 1K83K 4C3HK 4KN4A 3CQZA 1DCOA 2NVXC 4KDDA 4A3KK 1O29A 4YFNA 1TWGA 5CJ9A 1ZVUA 1JOEA 4JK1A 4A3BK 2JA8K 3FOFA 1O2BA 3GDZA 4M1XA 4A3CK 5C4XC 3LAJA 2GSNA 4C2MC 3A8JA 5D4DA 2Y3PA 1I50A 4AYBD 2E2HA 1I3QK 1O27A 1TWFA 3SZZA 4BKWA 5IOSA 4KM8A 2Y0SL 2NVYA 3GTOA 1R9TC 4LK1A 3S2HC 3GTGK 3HOZC 4FZBA 4GZYA 1PJ6A 2EBBA 3BP8C 3T00A 2R93A 3S16C 5EGHA 1EI6A 3G4AA 3N0BA 4X6AC 1VGXA 3MMLB 2V6SA 3GTJK 1C0AA 5M5YK 4Q4ZA 1K83A 1TWAC 3K7AK 3HOWK 4KATA 3LPXA 4BBRC 3HOVK 3H0GK 3Q3QA 4LK0A 3PO2K 3GIRA 2FQOA 5IYCC 2B63K 4A3LC 5IP7C 4GTDA 1UV7A 3AQOA 4A3GK 1TWCC 3S2DC 1ZQ1C 3AQPA 4A3MK 3TTGA 3TFIA 1Y1WK 5IOTA 3HOYC 3H3VD 3IPJA 2XCRB 3PO3C 4O2DA 4BBSK 1ZYRA 2E2IA 5EGEA 1WCMC 1O28A 1X31C 4ILDA 3GTQC 3HXAA 3HKZL 3M3YC 4MEYA 5C3EK 3L4JA 2WAQL 2JA7K 3GTKK 3GTGA 4BY1K 5C4JC 1YNJA 2PMZL 4WJ3M 2R92K 3EQLA 3GEEA 1ZXOA 3RZDC 1JQWA 3CQZC 4A3IK 2R7ZK 5JFEA 4KMUA 3S1QK 1TWGC 1ZBSA 2E2JC 4J3NA 1O2AA 2PA8L 4KC6A 4BXXK 1F7UA 5M5XK 4A3EC 3FKIA 4RMFA 3GTPC 1PJ5A 2YU9K 3GTLC 2W7VA 3I4MC 2JH3A 3M4OC 1TWHA 5L46A 5IP9K 3S15C 1WQHA 1HI9A 1I50C 2BE5A 2E2HC 2B63A 1TWFC 1L0WA 1I6HC 2NVYC 3GTOC 2A6EA 5TMCA 4QIWD 3S1RC 4C3JC 3RZOC 1WSVA 3GSIA 2R93C 3GTLA 3S17K 4BLBA 3S14K 4GT9A 4XSZA 4BY7K 3GTKA 4C3IC 1ISEA 1AB4A 1EK8A 3S1NC 5TJ3A 5C4XK 3S0XA 1K83C 1WQFA 4C2MK 1IL2A 4C3HC 3GTMA 3N0CA 1USMA 4A3DK 4LLGA 4Y52K 4KB4A 4Q5SA 2JA6A 2V6TA 1SMYA 3BP3A 4G7ZA 1XZPA 4QJVA 3S2HK 4XSXA 4G7HA 1F9NA 3GEHA 1F7VA 1BGWA 2GAHC 2WB1D 4KMDA 2P5MA 2E2IC 4AYBL 3AD8C 2FQTA 3OPFA 3A8KA 4GTFA 4X6AK 4GTBA 1J6XA 1J6VA 4YFKA 4NOIA 3GTGC 5IYBK 5TMFA 4KM9A 1TWAK 4MQ9A 1Y1VK 4BBRK 4G0WA 4GTLA 2JA5C 5IYCK 4A3JC 4A3LK 5FJ8K 1WOOA 3AD7C 4YG2A 5IOQA 1EFWA 4KMAA 1TWCK 3FKIC 3G4CA 4GTAA 3OEPA 3HOUK 3I4NK 1JVIA 1TWHC 1O26A 3JSTA 1DD5A 4LOWA 3S1MK 4G7OA 3A8IA 1I3QA 2B63C 3GTQK 1VH2A 4LR2A 3M3YK 1SFOK 2NVTK 5CHPA 4A3MC 1WOSA 1DCHA 4AH6A 2D6FC 3HOXK 1INNA 3H3VL 4BBSC 3CQZK 2RH6A 2KWAA
chains in the Genus database with same CATH topology
2A6EA 5TMCA 5IYBC 1I3QK 4QIWD 3HOYK 3S1RC 1TWGK 3K7AC 3HOWC 5M3MK 2A69A 2E2JK 4A93C 2Y0SL 3RZOC 2NVQK 2O5IA 4A3FC 1Y1VC 3PO3K 1TWHK 1HQMA 1R9TC 4LK1A 5C3EC 3S2HC 3HOVC 2R93C 3GTKC 1IW7A 3H0GC 3GTGK 3S17K 3GTPK 1WCMK 3HOZC 3PO2C 3S14K 3HKZD 4GZYA 3M4OK 3GTMC 2VUMK 2WAQD 4A3GC 5FLMK 3S15K 3S16C 2O5JA 4XSZA 4BY7K 2PMZD 4ZH4A 1I50K 5C4JK 5C44C 1Y1WC 3S2DK 2JA6C 5C4XK 3S1NC 1K83C 4XLPA 4C2MK 5M5WK 4X6AC 4Y7NC 3HOUC 3I4NC 2A68A 3RZDK 1I6HK 2NVYK 3S1MC 4A3DK 4LLGA 4LJZA 3GTJK 4Y52K 5M5YK 4Q4ZA 5IYDC 3GTLK 4Q5SA 1SMYA 2PA8D 1TWAC 3K7AK 2PPBA 3HOWK 4A93K 1BDFA 4G7ZA 3RZOK 2NVXK 4A3FK 1SFOC 2NVTC 4BBRC 4A3EK 4OIQA 2JA7C 4QJVA 4BY1C 3S2HK 4XSXA 3HOVK 3H0GK 4G7HA 2R92C 4LK0A 2A6HA 3I4MK 3PO2K 5IYCC 4XLNA 3HOXC 2B63K 4A3LC 5IP7C 4A3IC 2R7ZC 3GTMK 4A3GK 1TWCC 2WB1D 3S2DC 4A3MK 4MEXA 2E2IC 2E2HK 3S1QC 4AYBL 5C44K 1Y1WK 3HOYC 2JA6K 3S1NK 1TWFK 4QIWL 3H3VD 2NVQC 4X6AK 4Y7NK 4OIPA 3PO3C 3GTOK 4BXXC 4BBSK 4A3KC 4OIOA 1ZYRA 4YFKA 2CW0A 4NOIA 3GTGC 3S17C 5IYBK 5TMFA 1WCMC 2YU9C 5IYDK 4A3BC 1YNNA 2Y0SD 3S14C 3S1RK 3GTQC 4C3JK 4OIRA 1TWAK 3HKZL 5IP9C 2JA8C 4MQ9A 1Y1VK 2VUMC 3M3YC 4MEYA 5FLMC 1R9TK 2R93K 5C3EK 4QJVB 4BBRK 2WAQL 2JA7K 4BY7C 3GTKK 4A3CC 4BY1K 5M3FK 4YFXA 1YNJA 2PMZL 5C4JC 3HOZK 2R92K 2JA5C 3EQLA 5IYCK 4A3JC 4A3LK 3WODA 5FJ8K 4YG2A 3RZDC 3CQZC 3S16K 4A3IK 2R7ZK 4A3DC 4C3IK 1TWCK 3FKIC 4Y52C 4KMUA 1I3QC 3DXJA 2E2IK 3S1QK 1TWGC 1K83K 2E2JC 4C3HK 3HOUK 3I4NK 1TWHC 4KN4A 2PA8L 2NVXC 3S1MK 4BXXK 5M5XK 4A3EC 4G7OA 4A3KK 3GTPC 4YFNA 2YU9K 4JK1A 3I4MC 3M4OC 4A3BK 2B63C 3GTQK 2JA8K 5IP9K 1SFOK 2NVTK 3M3YK 3S15C 1I50C 2BE5A 4A3MC 4A3CK 2WB1L 2E2HC 5C4XC 3HOXK 2JA5K 1TWFC 1I6VA 5IP7K 1XPPA 4A3JK 5D4DA 4KN7A 4OINA 2NVYC 3GTOC 3H3VL 1I6HC 4BBSC 3CQZK 3GTJC 4AYBD 3GTLC 3FKIK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6E A;  5TMC A;  5IYB C;  1I3Q K;  4QIW D;  3HOY K;  3S1R C;  1TWG K;  3K7A C;  3HOW C;  5M3M K;  2A69 A;  2E2J K;  4A93 C;  2Y0S L;  3RZO C;  2NVQ K;  2O5I A;  4A3F C;  1Y1V C;  3PO3 K;  1TWH K;  1HQM A;  1R9T C;  4LK1 A;  5C3E C;  3S2H C;  3HOV C;  2R93 C;  3GTK C;  1IW7 A;  3H0G C;  3GTG K;  3S17 K;  3GTP K;  1WCM K;  3HOZ C;  3PO2 C;  3S14 K;  3HKZ D;  4GZY A;  3M4O K;  3GTM C;  2VUM K;  2WAQ D;  4A3G C;  5FLM K;  3S15 K;  3S16 C;  2O5J A;  4XSZ A;  4BY7 K;  2PMZ D;  4ZH4 A;  1I50 K;  5C4J K;  5C44 C;  1Y1W C;  3S2D K;  2JA6 C;  5C4X K;  3S1N C;  1K83 C;  4XLP A;  4C2M K;  5M5W K;  4X6A C;  4Y7N C;  3HOU C;  3I4N C;  2A68 A;  3RZD K;  1I6H K;  2NVY K;  3S1M C;  4A3D K;  4LLG A;  4LJZ A;  3GTJ K;  4Y52 K;  5M5Y K;  4Q4Z A;  5IYD C;  3GTL K;  4Q5S A;  1SMY A;  2PA8 D;  1TWA C;  3K7A K;  2PPB A;  3HOW K;  4A93 K;  1BDF A;  4G7Z A;  3RZO K;  2NVX K;  4A3F K;  1SFO C;  2NVT C;  4BBR C;  4A3E K;  4OIQ A;  2JA7 C;  4QJV A;  4BY1 C;  3S2H K;  4XSX A;  3HOV K;  3H0G K;  4G7H A;  2R92 C;  4LK0 A;  2A6H A;  3I4M K;  3PO2 K;  5IYC C;  4XLN A;  3HOX C;  2B63 K;  4A3L C;  5IP7 C;  4A3I C;  2R7Z C;  3GTM K;  4A3G K;  1TWC C;  2WB1 D;  3S2D C;  4A3M K;  4MEX A;  2E2I C;  2E2H K;  3S1Q C;  4AYB L;  5C44 K;  1Y1W K;  3HOY C;  2JA6 K;  3S1N K;  1TWF K;  4QIW L;  3H3V D;  2NVQ C;  4X6A K;  4Y7N K;  4OIP A;  3PO3 C;  3GTO K;  4BXX C;  4BBS K;  4A3K C;  4OIO A;  1ZYR A;  4YFK A;  2CW0 A;  4NOI A;  3GTG C;  3S17 C;  5IYB K;  5TMF A;  1WCM C;  2YU9 C;  5IYD K;  4A3B C;  1YNN A;  2Y0S D;  3S14 C;  3S1R K;  3GTQ C;  4C3J K;  4OIR A;  1TWA K;  3HKZ L;  5IP9 C;  2JA8 C;  4MQ9 A;  1Y1V K;  2VUM C;  3M3Y C;  4MEY A;  5FLM C;  1R9T K;  2R93 K;  5C3E K;  4QJV B;  4BBR K;  2WAQ L;  2JA7 K;  4BY7 C;  3GTK K;  4A3C C;  4BY1 K;  5M3F K;  4YFX A;  1YNJ A;  2PMZ L;  5C4J C;  3HOZ K;  2R92 K;  2JA5 C;  3EQL A;  5IYC K;  4A3J C;  4A3L K;  3WOD A;  5FJ8 K;  4YG2 A;  3RZD C;  3CQZ C;  3S16 K;  4A3I K;  2R7Z K;  4A3D C;  4C3I K;  1TWC K;  3FKI C;  4Y52 C;  4KMU A;  1I3Q C;  3DXJ A;  2E2I K;  3S1Q K;  1TWG C;  1K83 K;  2E2J C;  4C3H K;  3HOU K;  3I4N K;  1TWH C;  4KN4 A;  2PA8 L;  2NVX C;  3S1M K;  4BXX K;  5M5X K;  4A3E C;  4G7O A;  4A3K K;  3GTP C;  4YFN A;  2YU9 K;  4JK1 A;  3I4M C;  3M4O C;  4A3B K;  2B63 C;  3GTQ K;  2JA8 K;  5IP9 K;  1SFO K;  2NVT K;  3M3Y K;  3S15 C;  1I50 C;  2BE5 A;  4A3M C;  4A3C K;  2WB1 L;  2E2H C;  5C4X C;  3HOX K;  2JA5 K;  1TWF C;  1I6V A;  5IP7 K;  1XPP A;  4A3J K;  5D4D A;  4KN7 A;  4OIN A;  2NVY C;  3GTO C;  3H3V L;  1I6H C;  4BBS C;  3CQZ K;  3GTJ C;  4AYB D;  3GTL C;  3FKI K; 
#chains in the Genus database with same CATH topology
 1TWG K;  4A93 C;  2E2J K;  4G0U A;  1B4B A;  1B4A A;  4A3F C;  2NVQ K;  4G0V A;  2O5I A;  1HQM A;  3GTJ A;  1XXC A;  5C3E C;  4FM9 A;  3GTK C;  1IW7 A;  3GTP K;  3NUH A;  1USO A;  5IOR A;  3M4O K;  1TWA A;  1WOP A;  1Y1V A;  3GTM C;  2VUM K;  4GFQ A;  2CFA B;  5FLM K;  3S15 K;  2O5J A;  4BLA A;  1RU0 A;  2P8T A;  3H0G A;  4ZH4 A;  1I50 K;  2XCQ A;  5C44 C;  2JA6 C;  4XLP A;  4Y7N C;  3ERE D;  1I6H K;  2NVY K;  1XXA A;  3T02 A;  3T01 A;  5IYD C;  1Y1W A;  1WOR A;  2GSU A;  4DDQ A;  3L4K A;  2PPB A;  3FOE A;  3RZO K;  2NVX K;  1O24 A;  4OIQ A;  4KMH A;  4LQY A;  4XLN A;  1KQ4 A;  1SFO A;  1F93 A;  2JA7 A;  1O2F B;  3GEI A;  2R92 A;  4PAA A;  3S1N K;  4PAB A;  4QIW L;  2R7Z A;  4A3K C;  2CW0 A;  3S17 C;  4GTE A;  4A3B C;  1YNN A;  2Y0S D;  3S14 C;  3SZY A;  2JA8 C;  4KAS A;  1R9T K;  1O25 A;  4BY7 C;  1XZQ B;  2CFA A;  4A3C C;  1BJT A;  3GTP A;  4YFX A;  1BS2 A;  2YU9 A;  3HOZ K;  1J98 A;  1IBA A;  2V6U A;  1WQG A;  2VUM A;  3WOD A;  3S16 K;  4A3D C;  1J6W A;  4Y52 C;  2GAG C;  1I3Q C;  2GSO A;  3DXJ A;  2E2I K;  4GTC A;  4C45 A;  1YCL A;  1GE9 A;  1IS1 A;  3QX3 A;  2NVX A;  4KAR A;  2WB1 L;  3LAP A;  1XXB A;  1YX2 A;  4P5B A;  2JA5 K;  1I6V A;  5IP7 K;  1XPP A;  4A3J K;  4OIN A;  4KN7 A;  3GTJ C;  3S2D K;  3FKI K;  5IYB C;  3BUE A;  3HOY K;  3K7A C;  3HOW C;  1EQR A;  2A69 A;  5M3M K;  1Y1V C;  3PO3 K;  1TWH K;  3V4G A;  5JVO A;  1VJE A;  3TFJ A;  3HOV C;  1XZQ A;  3H0G C;  1WCM K;  3ADA C;  3PO2 C;  3FHZ A;  3HKZ D;  1G51 A;  3CAG A;  4P5A A;  1R9T A;  2WAQ D;  4A3G C;  2ZUE A;  2PMZ D;  5C4J K;  1Y1W C;  3AD9 C;  5M5W K;  3VA7 A;  2ZFZ A;  5E68 A;  3TFH A;  3HOU C;  3I4N C;  2A68 A;  3RZD K;  3S1M C;  2ZUF A;  3N3Y A;  4LJZ A;  1EH1 A;  3GTL K;  4KAW X;  4KB2 A;  1IQ0 A;  2PA8 D;  4A93 K;  1BDF A;  4A3F K;  1SFO C;  2NVT C;  1IE0 A;  4A3E K;  2JA7 C;  2XCO A;  4BY1 C;  1DCP A;  1PJ7 A;  2R92 C;  2A6H A;  3I4M K;  5HL8 A;  3HOX C;  1V5V A;  4A3I C;  2R7Z C;  3GTM K;  4MEX A;  2E2H K;  3S1Q C;  5C44 K;  2JA5 A;  2JA6 K;  1TWF K;  2PHC B;  2NVQ C;  4Y7N K;  4OIP A;  4BXX C;  1WSR A;  1WIH A;  1TWC A;  3GTO K;  4OIO A;  4P9S A;  3AH5 A;  2YU9 C;  4WJ4 A;  5IYD K;  3S1R K;  4C3J K;  4OIR A;  4WIL A;  5IP9 C;  2VUM C;  2RGR A;  5FLM C;  1VRQ C;  2R93 K;  1XZP B;  4QJV B;  1WCM A;  5M3F K;  3GTQ A;  3ORE A;  4C3I K;  4XCH A;  1VLO A;  1K83 K;  4C3H K;  4KN4 A;  3CQZ A;  1DCO A;  2NVX C;  4KDD A;  4A3K K;  1O29 A;  4YFN A;  1TWG A;  5CJ9 A;  1ZVU A;  1JOE A;  4JK1 A;  4A3B K;  2JA8 K;  3FOF A;  1O2B A;  3GDZ A;  4M1X A;  4A3C K;  5C4X C;  3LAJ A;  2GSN A;  4C2M C;  3A8J A;  5D4D A;  2Y3P A;  1I50 A;  4AYB D;  2E2H A;  1I3Q K;  1O27 A;  1TWF A;  3SZZ A;  4BKW A;  5IOS A;  4KM8 A;  2Y0S L;  2NVY A;  3GTO A;  1R9T C;  4LK1 A;  3S2H C;  3GTG K;  3HOZ C;  4FZB A;  4GZY A;  1PJ6 A;  2EBB A;  3BP8 C;  3T00 A;  2R93 A;  3S16 C;  5EGH A;  1EI6 A;  3G4A A;  3N0B A;  4X6A C;  1VGX A;  3MML B;  2V6S A;  3GTJ K;  1C0A A;  5M5Y K;  4Q4Z A;  1K83 A;  1TWA C;  3K7A K;  3HOW K;  4KAT A;  3LPX A;  4BBR C;  3HOV K;  3H0G K;  3Q3Q A;  4LK0 A;  3PO2 K;  3GIR A;  2FQO A;  5IYC C;  2B63 K;  4A3L C;  5IP7 C;  4GTD A;  1UV7 A;  3AQO A;  4A3G K;  1TWC C;  3S2D C;  1ZQ1 C;  3AQP A;  4A3M K;  3TTG A;  3TFI A;  1Y1W K;  5IOT A;  3HOY C;  3H3V D;  3IPJ A;  2XCR B;  3PO3 C;  4O2D A;  4BBS K;  1ZYR A;  2E2I A;  5EGE A;  1WCM C;  1O28 A;  1X31 C;  4ILD A;  3GTQ C;  3HXA A;  3HKZ L;  3M3Y C;  4MEY A;  5C3E K;  3L4J A;  2WAQ L;  2JA7 K;  3GTK K;  3GTG A;  4BY1 K;  5C4J C;  1YNJ A;  2PMZ L;  4WJ3 M;  2R92 K;  3EQL A;  3GEE A;  1ZXO A;  3RZD C;  1JQW A;  3CQZ C;  4A3I K;  2R7Z K;  5JFE A;  4KMU A;  3S1Q K;  1TWG C;  1ZBS A;  2E2J C;  4J3N A;  1O2A A;  2PA8 L;  4KC6 A;  4BXX K;  1F7U A;  5M5X K;  4A3E C;  3FKI A;  4RMF A;  3GTP C;  1PJ5 A;  2YU9 K;  3GTL C;  2W7V A;  3I4M C;  2JH3 A;  3M4O C;  1TWH A;  5L46 A;  5IP9 K;  3S15 C;  1WQH A;  1HI9 A;  1I50 C;  2BE5 A;  2E2H C;  2B63 A;  1TWF C;  1L0W A;  1I6H C;  2NVY C;  3GTO C;  2A6E A;  5TMC A;  4QIW D;  3S1R C;  4C3J C;  3RZO C;  1WSV A;  3GSI A;  2R93 C;  3GTL A;  3S17 K;  4BLB A;  3S14 K;  4GT9 A;  4XSZ A;  4BY7 K;  3GTK A;  4C3I C;  1ISE A;  1AB4 A;  1EK8 A;  3S1N C;  5TJ3 A;  5C4X K;  3S0X A;  1K83 C;  1WQF A;  4C2M K;  1IL2 A;  4C3H C;  3GTM A;  3N0C A;  1USM A;  4A3D K;  4LLG A;  4Y52 K;  4KB4 A;  4Q5S A;  2JA6 A;  2V6T A;  1SMY A;  3BP3 A;  4G7Z A;  1XZP A;  4QJV A;  3S2H K;  4XSX A;  4G7H A;  1F9N A;  3GEH A;  1F7V A;  1BGW A;  2GAH C;  2WB1 D;  4KMD A;  2P5M A;  2E2I C;  4AYB L;  3AD8 C;  2FQT A;  3OPF A;  3A8K A;  4GTF A;  4X6A K;  4GTB A;  1J6X A;  1J6V A;  4YFK A;  4NOI A;  3GTG C;  5IYB K;  5TMF A;  4KM9 A;  1TWA K;  4MQ9 A;  1Y1V K;  4BBR K;  4G0W A;  4GTL A;  2JA5 C;  5IYC K;  4A3J C;  4A3L K;  5FJ8 K;  1WOO A;  3AD7 C;  4YG2 A;  5IOQ A;  1EFW A;  4KMA A;  1TWC K;  3FKI C;  3G4C A;  4GTA A;  3OEP A;  3HOU K;  3I4N K;  1JVI A;  1TWH C;  1O26 A;  3JST A;  1DD5 A;  4LOW A;  3S1M K;  4G7O A;  3A8I A;  1I3Q A;  2B63 C;  3GTQ K;  1VH2 A;  4LR2 A;  3M3Y K;  1SFO K;  2NVT K;  5CHP A;  4A3M C;  1WOS A;  1DCH A;  4AH6 A;  2D6F C;  3HOX K;  1INN A;  3H3V L;  4BBS C;  3CQZ K;  2RH6 A;  2KWA A; 
#chains in the Genus database with same CATH homology
 2A6E A;  5TMC A;  5IYB C;  1I3Q K;  4QIW D;  3HOY K;  3S1R C;  1TWG K;  3K7A C;  3HOW C;  5M3M K;  2A69 A;  2E2J K;  4A93 C;  2Y0S L;  3RZO C;  2NVQ K;  2O5I A;  4A3F C;  1Y1V C;  3PO3 K;  1TWH K;  1HQM A;  1R9T C;  4LK1 A;  5C3E C;  3S2H C;  3HOV C;  2R93 C;  3GTK C;  1IW7 A;  3H0G C;  3GTG K;  3S17 K;  3GTP K;  1WCM K;  3HOZ C;  3PO2 C;  3S14 K;  3HKZ D;  4GZY A;  3M4O K;  3GTM C;  2VUM K;  2WAQ D;  4A3G C;  5FLM K;  3S15 K;  3S16 C;  2O5J A;  4XSZ A;  4BY7 K;  2PMZ D;  4ZH4 A;  1I50 K;  5C4J K;  5C44 C;  1Y1W C;  3S2D K;  2JA6 C;  5C4X K;  3S1N C;  1K83 C;  4XLP A;  4C2M K;  5M5W K;  4X6A C;  4Y7N C;  3HOU C;  3I4N C;  2A68 A;  3RZD K;  1I6H K;  2NVY K;  3S1M C;  4A3D K;  4LLG A;  4LJZ A;  3GTJ K;  4Y52 K;  5M5Y K;  4Q4Z A;  5IYD C;  3GTL K;  4Q5S A;  1SMY A;  2PA8 D;  1TWA C;  3K7A K;  2PPB A;  3HOW K;  4A93 K;  1BDF A;  4G7Z A;  3RZO K;  2NVX K;  4A3F K;  1SFO C;  2NVT C;  4BBR C;  4A3E K;  4OIQ A;  2JA7 C;  4QJV A;  4BY1 C;  3S2H K;  4XSX A;  3HOV K;  3H0G K;  4G7H A;  2R92 C;  4LK0 A;  2A6H A;  3I4M K;  3PO2 K;  5IYC C;  4XLN A;  3HOX C;  2B63 K;  4A3L C;  5IP7 C;  4A3I C;  2R7Z C;  3GTM K;  4A3G K;  1TWC C;  2WB1 D;  3S2D C;  4A3M K;  4MEX A;  2E2I C;  2E2H K;  3S1Q C;  4AYB L;  5C44 K;  1Y1W K;  3HOY C;  2JA6 K;  3S1N K;  1TWF K;  4QIW L;  3H3V D;  2NVQ C;  4X6A K;  4Y7N K;  4OIP A;  3PO3 C;  3GTO K;  4BXX C;  4BBS K;  4A3K C;  4OIO A;  1ZYR A;  4YFK A;  2CW0 A;  4NOI A;  3GTG C;  3S17 C;  5IYB K;  5TMF A;  1WCM C;  2YU9 C;  5IYD K;  4A3B C;  1YNN A;  2Y0S D;  3S14 C;  3S1R K;  3GTQ C;  4C3J K;  4OIR A;  1TWA K;  3HKZ L;  5IP9 C;  2JA8 C;  4MQ9 A;  1Y1V K;  2VUM C;  3M3Y C;  4MEY A;  5FLM C;  1R9T K;  2R93 K;  5C3E K;  4QJV B;  4BBR K;  2WAQ L;  2JA7 K;  4BY7 C;  3GTK K;  4A3C C;  4BY1 K;  5M3F K;  4YFX A;  1YNJ A;  2PMZ L;  5C4J C;  3HOZ K;  2R92 K;  2JA5 C;  3EQL A;  5IYC K;  4A3J C;  4A3L K;  3WOD A;  5FJ8 K;  4YG2 A;  3RZD C;  3CQZ C;  3S16 K;  4A3I K;  2R7Z K;  4A3D C;  4C3I K;  1TWC K;  3FKI C;  4Y52 C;  4KMU A;  1I3Q C;  3DXJ A;  2E2I K;  3S1Q K;  1TWG C;  1K83 K;  2E2J C;  4C3H K;  3HOU K;  3I4N K;  1TWH C;  4KN4 A;  2PA8 L;  2NVX C;  3S1M K;  4BXX K;  5M5X K;  4A3E C;  4G7O A;  4A3K K;  3GTP C;  4YFN A;  2YU9 K;  4JK1 A;  3I4M C;  3M4O C;  4A3B K;  2B63 C;  3GTQ K;  2JA8 K;  5IP9 K;  1SFO K;  2NVT K;  3M3Y K;  3S15 C;  1I50 C;  2BE5 A;  4A3M C;  4A3C K;  2WB1 L;  2E2H C;  5C4X C;  3HOX K;  2JA5 K;  1TWF C;  1I6V A;  5IP7 K;  1XPP A;  4A3J K;  5D4D A;  4KN7 A;  4OIN A;  2NVY C;  3GTO C;  3H3V L;  1I6H C;  4BBS C;  3CQZ K;  3GTJ C;  4AYB D;  3GTL C;  3FKI K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...