4X6AK

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4x6aK00
1K83C 2E2IK 2E2JK 4A3BC 3S14C 4A3FC 4YFKA 2JA6K 4A93K 4QIWD 1TWCK 4MQ9A 1WCMK 4OIOA 4G7HA 4A3EK 3S2DK 4A3IK 4A3GC 3HOYC 2NVYC 2PMZL 4YFNA 2PMZD 5M5WK 3K7AK 4A3EC 2NVQK 4OIPA 4C3HK 4KN7A 2R92K 5TMFA 3K7AC 3GTPK 3FKIC 4XSZA 3GTJK 2O5JA 4G7ZA 2YU9C 3GTLC 3EQLA 2E2HC 3I4MC 2Y0SL 5C4JC 3M4OC 1Y1WC 4G7OA 5M3MK 4MEYA 1YNJA 2E2HK 5IYBC 3HOYK 4OIQA 4A3JC 4A3LK 3M3YK 2Y0SD 4YG2A 4Q4ZA 2JA8K 4A3JK 2NVXK 3GTKC 4OINA 2R93K 2B63K 3GTGC 2JA8C 3HOWK 4A3CC 3S1RK 4BY1K 2PPBA 4C2MK 4LJZA 5TMCA 4A3KK 4JK1A 2VUMK 3M3YC 2NVTK 3S16K 2R7ZK 3CQZK 1IW7A 4AYBL 5M3FK 4BY7K 1TWFK 4ZH4A 2NVXC 3GTKK 4BXXC 5C44K 4BBSK 2B63C 5FLMC 4BBRC 1I6VA 3PO2K 4BY1C 4QJVA 2A69A 3RZDK 4X6AC 1TWHC 2PA8L 4QJVB 2WB1D 2A68A 1I3QK 3H3VL 1TWHK 1I50C 3S14K 3S17K 3S1MK 1R9TK 4A93C 4GZYA 3CQZC 5IP7K 3HKZD 1I6HK 4Y52C 3S17C 1TWFC 4LLGA 2JA5K 5IYDK 5IP7C 1ZYRA 5C3EK 4MEXA 4XLNA 3S1MC 5M5XK 4BBRK 3DXJA 3H0GC 2JA7K 3HOZC 4A3IC 1TWCC 1TWAK 1I50K 2NVQC 4KN4A 1Y1WK 3FKIK 3HOXC 3RZOC 2PA8D 5IYBK 2WAQD 4Q5SA 4A3GK 1SMYA 3S2DC 1BDFA 3HOXK 3RZOK 3S15K 3H0GK 2JA7C 3HOZK 2YU9K 3S2HK 2WAQL 3M4OK 3S1QC 2O5IA 3S15C 4Y52K 4AYBD 2WB1L 4Y7NK 2A6EA 3S2HC 5C4JK 3GTPC 3S1RC 5IP9C 3S1QK 4A3DC 5FJ8K 4A3LC 3GTJC 4LK1A 1SFOK 3GTQC 3GTMK 3GTLK 2R93C 3HOVC 5IP9K 1YNNA 5IYCK 3PO3K 3I4MK 3GTMC 4OIRA 3GTQK 3HOVK 4YFXA 5M5YK 4KMUA 3HOUC 4A3CK 5C44C 5D4DA 4BBSC 2BE5A 4A3KC 4XSXA 3HKZL 4Y7NC 3S1NK 3HOUK 4C3JK 2R7ZC 5C4XK 2CW0A 3H3VD 4A3DK 1XPPA 4C3IK 2VUMC 2A6HA 1HQMA 3WODA 1SFOC 3GTGK 3GTOK 3HOWC 1TWGC 3S16C 5IYCC 3PO3C 4BY7C 1Y1VC 4A3MK 4BXXK 3PO2C 1TWGK 4LK0A 2E2JC 4A3BK 5FLMK 4A3FK 1Y1VK 4A3MC 2NVTC 5IYDC 2JA5C 5C3EC 4X6AK 2NVYK 3S1NC 3I4NK 1R9TC 5C4XC 1I3QC 2R92C 3GTOC 3I4NC 4NOIA 1K83K 2E2IC 1TWAC 4QIWL 4XLPA 3RZDC 2JA6C 1I6HC 1WCMC
chains in the Genus database with same CATH superfamily
4A3BC 3G4CA 3S14C 4GTCA 1EFWA 4A93K 3S1MC 4G7HA 4MQ9A 4PABA 2ZUFA 1I6HC 3AQPA 2NVQK 4OIPA 4KN7A 2R92K 4WJ4A 4XSZA 4G7ZA 1B4BA 1DCOA 4DDQA 1EK8A 1X31C 2Y0SL 3NUHA 1Y1WC 4MEYA 2E2HK 4OIQA 1DD5A 1WQHA 1O25A 2FQTA 3L4KA 4C2MK 3N0BA 5L46A 4JK1A 5IOTA 2VUMK 1AB4A 4G0WA 3S16K 2R7ZK 4BLAA 1O24A 4ZH4A 4BXXC 2P5MA 5FLMC 1I6VA 1C0AA 2A69A 4X6AC 4QJVB 2XCRB 2A68A 3BP3A 3CQZC 2JA6A 4Y52C 3S17C 1TWFC 5IYDK 2PHCB 1ZYRA 3DXJA 1TWCC 1TWAK 3AD7C 1WQFA 1IL2A 1Y1WK 5CJ9A 2PA8D 3TTGA 3S15K 3HOXK 1WORA 2JA7C 3HOZK 2NVXA 2WAQL 3M4OK 2R92A 2O5IA 2R7ZA 1HI9A 4Y7NK 5C4JK 3GTPC 3S1RC 5IP9C 4GTAA 2P8TA 3I4MK 4OIRA 3HOVK 4YFXA 1O26A 1J6VA 1TWFA 3GEHA 5IOQA 3A8KA 2R7ZC 2CW0A 2VUMC 3WODA 1ZVUA 3HOWC 1TWCA 5IYCC 4A3MK 3G4AA 1VLOA 1Y1VK 1I50A 4WJ3M 3SZZA 1VH2A 3AD8C 4C3HC 1USMA 3GTOC 3I4NC 1F93A 4KC6A 4NOIA 2FQOA 2Y3PA 2W7VA 1K83C 4WILA 4KMDA 1ZBSA 1VJEA 4QIWD 3FKIA 4OIOA 2XCQA 3ERED 4A3IK 4GTEA 2PMZL 4YFNA 3HOYC 1ZXOA 3K7AK 5M5WK 3GTKA 1ISEA 4G0UA 4GTDA 5TMFA 3N0CA 3FKIC 2O5JA 1TWAA 3GTLC 2YU9C 3EQLA 4C45A 1K83A 3M4OC 2ZFZA 5M3MK 1YNJA 4LOWA 4KB2A 4A3JC 2R93A 4YG2A 2V6SA 4LR2A 2JA8K 4A3JK 2NVXK 3GTKC 2R93K 2V6UA 3ADAC 2B63K 3GTGC 1I3QA 2JA8C 3HOWK 2PPBA 1O27A 4LJZA 5TMCA 5JFEA 4P5AA 4AH6A 4AYBL 5M3FK 1TWFK 1IQ0A 2NVXC 3GTKK 2RH6A 4BBRC 3PO2K 3RZDK 1TWHC 2PA8L 1YCLA 2RGRA 3S14K 1R9TK 2GSNA 3HKZD 5IP7K 1GE9A 4LLGA 1WOSA 3TFIA 5IP7C 4MEXA 4BBRK 2CFAB 4BLBA 3H0GC 5EGHA 4A3IC 2KWAA 4PAAA 4KASA 1I50K 2CFAA 4KN4A 3RZOC 1XZPB 4A3GK 1G51A 1SMYA 4P9SA 3LAJA 3H0GK 3S2HK 2YU9K 1XXAA 3FOFA 2WB1L 3GTMA 1VGXA 3S2HC 4J3NA 4A3DC 3N3YA 3GTQC 3GTMK 1O2AA 2R93C 3HOVC 5IP9K 5IYCK 1ZQ1C 1O2BA 4BBSC 3TFJA 1R9TA 1B4AA 4Y7NC 3BUEA 4C2MC 5C4XK 4O2DA 3H3VD 3GTOK 1HQMA 1TWGC 4KM9A 1O2FB 3PO2C 3T02A 2B63A 4A3FK 3VA7A 2NVTC 2JA5C 3S1NC 3I4NK 5E68A 1I3QC 2R92C 2E2IC 1JOEA 4XLPA 2JA6C 1J6WA 4A3FC 1XXBA 2JA6K 4A3GC 1TWCK 3GEIA 3S2DK 2NVYC 2PMZD 2GAHC 2XCOA 3IPJA 1BS2A 4FZBA 3AQOA 3K7AC 2GSOA 3GDZA 4KB4A 3GTPK 4GTLA 3GTOA 4FM9A 1RU0A 3OPFA 3I4MC 3A8JA 3V4GA 5IORA 4G7OA 3GTQA 2Y0SD 2JA5A 3AD9C 1O28A 4C3IC 1F7VA 4A3CC 3S1RK 3BP8C 2GAGC 4KMHA 1BGWA 2JH3A 4A3KK 3M3YC 2NVTK 3CQZK 5TJ3A 5C44K 1EQRA 1WSRA 5CHPA 3GTPA 4ILDA 4BY1C 3AH5A 1J98A 4KDDA 2WB1D 1I3QK 1TWHK 1I50C 3S1MK 4A93C 1I6HK 1TWHA 2JA5K 1XXCA 4KARA 5C3EK 4XLNA 2EBBA 2JA7K 3HOZC 3T00A 3GTJA 5HL8A 3H0GA 3FKIK 4Q5SA 3CQZA 1BJTA 3GEEA 1EH1A 3RZOK 3S1QC 4AYBD 2E2IA 2A6EA 3SZYA 1USOA 3S1QK 5FJ8K 1DCHA 1WCMA 3GTJC 4LK1A 4G0VA 3CAGA 3GTLK 1WOOA 1YNNA 3PO3K 5EGEA 1DCPA 1V5VA 3T01A 3HXAA 3HOUC 5C44C 1XZQA 4XSXA 4C3JK 3FHZA 1XPPA 4C3IK 2A6HA 2YU9A 3S16C 3QX3A 1F9NA 4BY7C 1YX2A 3LAPA 4LK0A 4A3BK 5FLMK 4RMFA 4X6AK 2NVYK 1L0WA 3MMLB 1R9TC 5C4XC 3TFHA 1TWAC 3RZDC 4M1XA 3A8IA 2E2HA 1WCMC 2E2IK 2E2JK 1WOPA 4YFKA 4A3EK 1WCMK 1UV7A 1IBAA 4A3EC 1JQWA 1J6XA 4C3HK 4KM8A 2GSUA 1EI6A 3GTJK 2VUMA 2E2HC 5C4JC 2JA7A 1INNA 3HOYK 1JVIA 5IYBC 4A3LK 3M3YK 1PJ6A 2NVYA 4Q4ZA 3LPXA 4OINA 3FOEA 1IE0A 1KQ4A 4BY1K 2V6TA 4C3JC 4BKWA 1IW7A 1Y1VA 4BY7K 1XZPA 4BBSK 2B63C 4QJVA 1IS1A 5IOSA 3H3VL 3S17K 4GZYA 4Y52K 2D6FC 5M5XK 1TWGA 3GTGA 2NVQC 4P5BA 3HOXC 5IYBK 2WAQD 4GTBA 1O29A 1VRQC 3S2DC 1BDFA 1XZQB 1Y1WA 3OREA 3S15C 3GTLA 2ZUEA 4GFQA 4A3LC 1SFOK 1PJ5A 3L4JA 4KMAA 3GTMC 3GTQK 4GT9A 3OEPA 1F7UA 5M5YK 4KMUA 4A3CK 3Q3QA 5D4DA 2BE5A 4A3KC 3HKZL 3S1NK 3HOUK 4XCHA 4LQYA 4A3DK 3GTGK 1SFOC 1PJ7A 4KAWX 3PO3C 5JVOA 3S0XA 1Y1VC 3JSTA 4BXXK 1TWGK 2E2JC 4GTFA 4A3MC 1WSVA 5IYDC 4KATA 5C3EC 3GSIA 1WIHA 1WQGA 1K83K 3GIRA 4QIWL 1SFOA
chains in the Genus database with same CATH topology
1K83C 2E2IK 2E2JK 4A3BC 3S14C 4A3FC 4YFKA 2JA6K 4A93K 4QIWD 1TWCK 4MQ9A 1WCMK 4OIOA 4G7HA 4A3EK 3S2DK 4A3IK 4A3GC 3HOYC 2NVYC 2PMZL 4YFNA 2PMZD 5M5WK 3K7AK 4A3EC 2NVQK 4OIPA 4C3HK 4KN7A 2R92K 5TMFA 3K7AC 3GTPK 3FKIC 4XSZA 3GTJK 2O5JA 4G7ZA 2YU9C 3GTLC 3EQLA 2E2HC 3I4MC 2Y0SL 5C4JC 3M4OC 1Y1WC 4G7OA 5M3MK 4MEYA 1YNJA 2E2HK 5IYBC 3HOYK 4OIQA 4A3JC 4A3LK 3M3YK 2Y0SD 4YG2A 4Q4ZA 2JA8K 4A3JK 2NVXK 3GTKC 4OINA 2R93K 2B63K 3GTGC 2JA8C 3HOWK 4A3CC 3S1RK 4BY1K 2PPBA 4C2MK 4LJZA 5TMCA 4A3KK 4JK1A 2VUMK 3M3YC 2NVTK 3S16K 2R7ZK 3CQZK 1IW7A 4AYBL 5M3FK 4BY7K 1TWFK 4ZH4A 2NVXC 3GTKK 4BXXC 5C44K 4BBSK 2B63C 5FLMC 4BBRC 1I6VA 3PO2K 4BY1C 4QJVA 2A69A 3RZDK 4X6AC 1TWHC 2PA8L 4QJVB 2WB1D 2A68A 1I3QK 3H3VL 1TWHK 1I50C 3S14K 3S17K 3S1MK 1R9TK 4A93C 4GZYA 3CQZC 5IP7K 3HKZD 1I6HK 4Y52C 3S17C 1TWFC 4LLGA 2JA5K 5IYDK 5IP7C 1ZYRA 5C3EK 4MEXA 4XLNA 3S1MC 5M5XK 4BBRK 3DXJA 3H0GC 2JA7K 3HOZC 4A3IC 1TWCC 1TWAK 1I50K 2NVQC 4KN4A 1Y1WK 3FKIK 3HOXC 3RZOC 2PA8D 5IYBK 2WAQD 4Q5SA 4A3GK 1SMYA 3S2DC 1BDFA 3HOXK 3RZOK 3S15K 3H0GK 2JA7C 3HOZK 2YU9K 3S2HK 2WAQL 3M4OK 3S1QC 2O5IA 3S15C 4Y52K 4AYBD 2WB1L 4Y7NK 2A6EA 3S2HC 5C4JK 3GTPC 3S1RC 5IP9C 3S1QK 4A3DC 5FJ8K 4A3LC 3GTJC 4LK1A 1SFOK 3GTQC 3GTMK 3GTLK 2R93C 3HOVC 5IP9K 1YNNA 5IYCK 3PO3K 3I4MK 3GTMC 4OIRA 3GTQK 3HOVK 4YFXA 5M5YK 4KMUA 3HOUC 4A3CK 5C44C 5D4DA 4BBSC 2BE5A 4A3KC 4XSXA 3HKZL 4Y7NC 3S1NK 3HOUK 4C3JK 2R7ZC 5C4XK 2CW0A 3H3VD 4A3DK 1XPPA 4C3IK 2VUMC 2A6HA 1HQMA 3WODA 1SFOC 3GTGK 3GTOK 3HOWC 1TWGC 3S16C 5IYCC 3PO3C 4BY7C 1Y1VC 4A3MK 4BXXK 3PO2C 1TWGK 4LK0A 2E2JC 4A3BK 5FLMK 4A3FK 1Y1VK 4A3MC 2NVTC 5IYDC 2JA5C 5C3EC 4X6AK 2NVYK 3S1NC 3I4NK 1R9TC 5C4XC 1I3QC 2R92C 3GTOC 3I4NC 4NOIA 1K83K 2E2IC 1TWAC 4QIWL 4XLPA 3RZDC 2JA6C 1I6HC 1WCMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 C;  2E2I K;  2E2J K;  4A3B C;  3S14 C;  4A3F C;  4YFK A;  2JA6 K;  4A93 K;  4QIW D;  1TWC K;  4MQ9 A;  1WCM K;  4OIO A;  4G7H A;  4A3E K;  3S2D K;  4A3I K;  4A3G C;  3HOY C;  2NVY C;  2PMZ L;  4YFN A;  2PMZ D;  5M5W K;  3K7A K;  4A3E C;  2NVQ K;  4OIP A;  4C3H K;  4KN7 A;  2R92 K;  5TMF A;  3K7A C;  3GTP K;  3FKI C;  4XSZ A;  3GTJ K;  2O5J A;  4G7Z A;  2YU9 C;  3GTL C;  3EQL A;  2E2H C;  3I4M C;  2Y0S L;  5C4J C;  3M4O C;  1Y1W C;  4G7O A;  5M3M K;  4MEY A;  1YNJ A;  2E2H K;  5IYB C;  3HOY K;  4OIQ A;  4A3J C;  4A3L K;  3M3Y K;  2Y0S D;  4YG2 A;  4Q4Z A;  2JA8 K;  4A3J K;  2NVX K;  3GTK C;  4OIN A;  2R93 K;  2B63 K;  3GTG C;  2JA8 C;  3HOW K;  4A3C C;  3S1R K;  4BY1 K;  2PPB A;  4C2M K;  4LJZ A;  5TMC A;  4A3K K;  4JK1 A;  2VUM K;  3M3Y C;  2NVT K;  3S16 K;  2R7Z K;  3CQZ K;  1IW7 A;  4AYB L;  5M3F K;  4BY7 K;  1TWF K;  4ZH4 A;  2NVX C;  3GTK K;  4BXX C;  5C44 K;  4BBS K;  2B63 C;  5FLM C;  4BBR C;  1I6V A;  3PO2 K;  4BY1 C;  4QJV A;  2A69 A;  3RZD K;  4X6A C;  1TWH C;  2PA8 L;  4QJV B;  2WB1 D;  2A68 A;  1I3Q K;  3H3V L;  1TWH K;  1I50 C;  3S14 K;  3S17 K;  3S1M K;  1R9T K;  4A93 C;  4GZY A;  3CQZ C;  5IP7 K;  3HKZ D;  1I6H K;  4Y52 C;  3S17 C;  1TWF C;  4LLG A;  2JA5 K;  5IYD K;  5IP7 C;  1ZYR A;  5C3E K;  4MEX A;  4XLN A;  3S1M C;  5M5X K;  4BBR K;  3DXJ A;  3H0G C;  2JA7 K;  3HOZ C;  4A3I C;  1TWC C;  1TWA K;  1I50 K;  2NVQ C;  4KN4 A;  1Y1W K;  3FKI K;  3HOX C;  3RZO C;  2PA8 D;  5IYB K;  2WAQ D;  4Q5S A;  4A3G K;  1SMY A;  3S2D C;  1BDF A;  3HOX K;  3RZO K;  3S15 K;  3H0G K;  2JA7 C;  3HOZ K;  2YU9 K;  3S2H K;  2WAQ L;  3M4O K;  3S1Q C;  2O5I A;  3S15 C;  4Y52 K;  4AYB D;  2WB1 L;  4Y7N K;  2A6E A;  3S2H C;  5C4J K;  3GTP C;  3S1R C;  5IP9 C;  3S1Q K;  4A3D C;  5FJ8 K;  4A3L C;  3GTJ C;  4LK1 A;  1SFO K;  3GTQ C;  3GTM K;  3GTL K;  2R93 C;  3HOV C;  5IP9 K;  1YNN A;  5IYC K;  3PO3 K;  3I4M K;  3GTM C;  4OIR A;  3GTQ K;  3HOV K;  4YFX A;  5M5Y K;  4KMU A;  3HOU C;  4A3C K;  5C44 C;  5D4D A;  4BBS C;  2BE5 A;  4A3K C;  4XSX A;  3HKZ L;  4Y7N C;  3S1N K;  3HOU K;  4C3J K;  2R7Z C;  5C4X K;  2CW0 A;  3H3V D;  4A3D K;  1XPP A;  4C3I K;  2VUM C;  2A6H A;  1HQM A;  3WOD A;  1SFO C;  3GTG K;  3GTO K;  3HOW C;  1TWG C;  3S16 C;  5IYC C;  3PO3 C;  4BY7 C;  1Y1V C;  4A3M K;  4BXX K;  3PO2 C;  1TWG K;  4LK0 A;  2E2J C;  4A3B K;  5FLM K;  4A3F K;  1Y1V K;  4A3M C;  2NVT C;  5IYD C;  2JA5 C;  5C3E C;  4X6A K;  2NVY K;  3S1N C;  3I4N K;  1R9T C;  5C4X C;  1I3Q C;  2R92 C;  3GTO C;  3I4N C;  4NOI A;  1K83 K;  2E2I C;  1TWA C;  4QIW L;  4XLP A;  3RZD C;  2JA6 C;  1I6H C;  1WCM C; 
#chains in the Genus database with same CATH topology
 4A3B C;  3G4C A;  3S14 C;  4GTC A;  1EFW A;  4A93 K;  3S1M C;  4G7H A;  4MQ9 A;  4PAB A;  2ZUF A;  1I6H C;  3AQP A;  2NVQ K;  4OIP A;  4KN7 A;  2R92 K;  4WJ4 A;  4XSZ A;  4G7Z A;  1B4B A;  1DCO A;  4DDQ A;  1EK8 A;  1X31 C;  2Y0S L;  3NUH A;  1Y1W C;  4MEY A;  2E2H K;  4OIQ A;  1DD5 A;  1WQH A;  1O25 A;  2FQT A;  3L4K A;  4C2M K;  3N0B A;  5L46 A;  4JK1 A;  5IOT A;  2VUM K;  1AB4 A;  4G0W A;  3S16 K;  2R7Z K;  4BLA A;  1O24 A;  4ZH4 A;  4BXX C;  2P5M A;  5FLM C;  1I6V A;  1C0A A;  2A69 A;  4X6A C;  4QJV B;  2XCR B;  2A68 A;  3BP3 A;  3CQZ C;  2JA6 A;  4Y52 C;  3S17 C;  1TWF C;  5IYD K;  2PHC B;  1ZYR A;  3DXJ A;  1TWC C;  1TWA K;  3AD7 C;  1WQF A;  1IL2 A;  1Y1W K;  5CJ9 A;  2PA8 D;  3TTG A;  3S15 K;  3HOX K;  1WOR A;  2JA7 C;  3HOZ K;  2NVX A;  2WAQ L;  3M4O K;  2R92 A;  2O5I A;  2R7Z A;  1HI9 A;  4Y7N K;  5C4J K;  3GTP C;  3S1R C;  5IP9 C;  4GTA A;  2P8T A;  3I4M K;  4OIR A;  3HOV K;  4YFX A;  1O26 A;  1J6V A;  1TWF A;  3GEH A;  5IOQ A;  3A8K A;  2R7Z C;  2CW0 A;  2VUM C;  3WOD A;  1ZVU A;  3HOW C;  1TWC A;  5IYC C;  4A3M K;  3G4A A;  1VLO A;  1Y1V K;  1I50 A;  4WJ3 M;  3SZZ A;  1VH2 A;  3AD8 C;  4C3H C;  1USM A;  3GTO C;  3I4N C;  1F93 A;  4KC6 A;  4NOI A;  2FQO A;  2Y3P A;  2W7V A;  1K83 C;  4WIL A;  4KMD A;  1ZBS A;  1VJE A;  4QIW D;  3FKI A;  4OIO A;  2XCQ A;  3ERE D;  4A3I K;  4GTE A;  2PMZ L;  4YFN A;  3HOY C;  1ZXO A;  3K7A K;  5M5W K;  3GTK A;  1ISE A;  4G0U A;  4GTD A;  5TMF A;  3N0C A;  3FKI C;  2O5J A;  1TWA A;  3GTL C;  2YU9 C;  3EQL A;  4C45 A;  1K83 A;  3M4O C;  2ZFZ A;  5M3M K;  1YNJ A;  4LOW A;  4KB2 A;  4A3J C;  2R93 A;  4YG2 A;  2V6S A;  4LR2 A;  2JA8 K;  4A3J K;  2NVX K;  3GTK C;  2R93 K;  2V6U A;  3ADA C;  2B63 K;  3GTG C;  1I3Q A;  2JA8 C;  3HOW K;  2PPB A;  1O27 A;  4LJZ A;  5TMC A;  5JFE A;  4P5A A;  4AH6 A;  4AYB L;  5M3F K;  1TWF K;  1IQ0 A;  2NVX C;  3GTK K;  2RH6 A;  4BBR C;  3PO2 K;  3RZD K;  1TWH C;  2PA8 L;  1YCL A;  2RGR A;  3S14 K;  1R9T K;  2GSN A;  3HKZ D;  5IP7 K;  1GE9 A;  4LLG A;  1WOS A;  3TFI A;  5IP7 C;  4MEX A;  4BBR K;  2CFA B;  4BLB A;  3H0G C;  5EGH A;  4A3I C;  2KWA A;  4PAA A;  4KAS A;  1I50 K;  2CFA A;  4KN4 A;  3RZO C;  1XZP B;  4A3G K;  1G51 A;  1SMY A;  4P9S A;  3LAJ A;  3H0G K;  3S2H K;  2YU9 K;  1XXA A;  3FOF A;  2WB1 L;  3GTM A;  1VGX A;  3S2H C;  4J3N A;  4A3D C;  3N3Y A;  3GTQ C;  3GTM K;  1O2A A;  2R93 C;  3HOV C;  5IP9 K;  5IYC K;  1ZQ1 C;  1O2B A;  4BBS C;  3TFJ A;  1R9T A;  1B4A A;  4Y7N C;  3BUE A;  4C2M C;  5C4X K;  4O2D A;  3H3V D;  3GTO K;  1HQM A;  1TWG C;  4KM9 A;  1O2F B;  3PO2 C;  3T02 A;  2B63 A;  4A3F K;  3VA7 A;  2NVT C;  2JA5 C;  3S1N C;  3I4N K;  5E68 A;  1I3Q C;  2R92 C;  2E2I C;  1JOE A;  4XLP A;  2JA6 C;  1J6W A;  4A3F C;  1XXB A;  2JA6 K;  4A3G C;  1TWC K;  3GEI A;  3S2D K;  2NVY C;  2PMZ D;  2GAH C;  2XCO A;  3IPJ A;  1BS2 A;  4FZB A;  3AQO A;  3K7A C;  2GSO A;  3GDZ A;  4KB4 A;  3GTP K;  4GTL A;  3GTO A;  4FM9 A;  1RU0 A;  3OPF A;  3I4M C;  3A8J A;  3V4G A;  5IOR A;  4G7O A;  3GTQ A;  2Y0S D;  2JA5 A;  3AD9 C;  1O28 A;  4C3I C;  1F7V A;  4A3C C;  3S1R K;  3BP8 C;  2GAG C;  4KMH A;  1BGW A;  2JH3 A;  4A3K K;  3M3Y C;  2NVT K;  3CQZ K;  5TJ3 A;  5C44 K;  1EQR A;  1WSR A;  5CHP A;  3GTP A;  4ILD A;  4BY1 C;  3AH5 A;  1J98 A;  4KDD A;  2WB1 D;  1I3Q K;  1TWH K;  1I50 C;  3S1M K;  4A93 C;  1I6H K;  1TWH A;  2JA5 K;  1XXC A;  4KAR A;  5C3E K;  4XLN A;  2EBB A;  2JA7 K;  3HOZ C;  3T00 A;  3GTJ A;  5HL8 A;  3H0G A;  3FKI K;  4Q5S A;  3CQZ A;  1BJT A;  3GEE A;  1EH1 A;  3RZO K;  3S1Q C;  4AYB D;  2E2I A;  2A6E A;  3SZY A;  1USO A;  3S1Q K;  5FJ8 K;  1DCH A;  1WCM A;  3GTJ C;  4LK1 A;  4G0V A;  3CAG A;  3GTL K;  1WOO A;  1YNN A;  3PO3 K;  5EGE A;  1DCP A;  1V5V A;  3T01 A;  3HXA A;  3HOU C;  5C44 C;  1XZQ A;  4XSX A;  4C3J K;  3FHZ A;  1XPP A;  4C3I K;  2A6H A;  2YU9 A;  3S16 C;  3QX3 A;  1F9N A;  4BY7 C;  1YX2 A;  3LAP A;  4LK0 A;  4A3B K;  5FLM K;  4RMF A;  4X6A K;  2NVY K;  1L0W A;  3MML B;  1R9T C;  5C4X C;  3TFH A;  1TWA C;  3RZD C;  4M1X A;  3A8I A;  2E2H A;  1WCM C;  2E2I K;  2E2J K;  1WOP A;  4YFK A;  4A3E K;  1WCM K;  1UV7 A;  1IBA A;  4A3E C;  1JQW A;  1J6X A;  4C3H K;  4KM8 A;  2GSU A;  1EI6 A;  3GTJ K;  2VUM A;  2E2H C;  5C4J C;  2JA7 A;  1INN A;  3HOY K;  1JVI A;  5IYB C;  4A3L K;  3M3Y K;  1PJ6 A;  2NVY A;  4Q4Z A;  3LPX A;  4OIN A;  3FOE A;  1IE0 A;  1KQ4 A;  4BY1 K;  2V6T A;  4C3J C;  4BKW A;  1IW7 A;  1Y1V A;  4BY7 K;  1XZP A;  4BBS K;  2B63 C;  4QJV A;  1IS1 A;  5IOS A;  3H3V L;  3S17 K;  4GZY A;  4Y52 K;  2D6F C;  5M5X K;  1TWG A;  3GTG A;  2NVQ C;  4P5B A;  3HOX C;  5IYB K;  2WAQ D;  4GTB A;  1O29 A;  1VRQ C;  3S2D C;  1BDF A;  1XZQ B;  1Y1W A;  3ORE A;  3S15 C;  3GTL A;  2ZUE A;  4GFQ A;  4A3L C;  1SFO K;  1PJ5 A;  3L4J A;  4KMA A;  3GTM C;  3GTQ K;  4GT9 A;  3OEP A;  1F7U A;  5M5Y K;  4KMU A;  4A3C K;  3Q3Q A;  5D4D A;  2BE5 A;  4A3K C;  3HKZ L;  3S1N K;  3HOU K;  4XCH A;  4LQY A;  4A3D K;  3GTG K;  1SFO C;  1PJ7 A;  4KAW X;  3PO3 C;  5JVO A;  3S0X A;  1Y1V C;  3JST A;  4BXX K;  1TWG K;  2E2J C;  4GTF A;  4A3M C;  1WSV A;  5IYD C;  4KAT A;  5C3E C;  3GSI A;  1WIH A;  1WQG A;  1K83 K;  3GIR A;  4QIW L;  1SFO A; 
#chains in the Genus database with same CATH homology
 1K83 C;  2E2I K;  2E2J K;  4A3B C;  3S14 C;  4A3F C;  4YFK A;  2JA6 K;  4A93 K;  4QIW D;  1TWC K;  4MQ9 A;  1WCM K;  4OIO A;  4G7H A;  4A3E K;  3S2D K;  4A3I K;  4A3G C;  3HOY C;  2NVY C;  2PMZ L;  4YFN A;  2PMZ D;  5M5W K;  3K7A K;  4A3E C;  2NVQ K;  4OIP A;  4C3H K;  4KN7 A;  2R92 K;  5TMF A;  3K7A C;  3GTP K;  3FKI C;  4XSZ A;  3GTJ K;  2O5J A;  4G7Z A;  2YU9 C;  3GTL C;  3EQL A;  2E2H C;  3I4M C;  2Y0S L;  5C4J C;  3M4O C;  1Y1W C;  4G7O A;  5M3M K;  4MEY A;  1YNJ A;  2E2H K;  5IYB C;  3HOY K;  4OIQ A;  4A3J C;  4A3L K;  3M3Y K;  2Y0S D;  4YG2 A;  4Q4Z A;  2JA8 K;  4A3J K;  2NVX K;  3GTK C;  4OIN A;  2R93 K;  2B63 K;  3GTG C;  2JA8 C;  3HOW K;  4A3C C;  3S1R K;  4BY1 K;  2PPB A;  4C2M K;  4LJZ A;  5TMC A;  4A3K K;  4JK1 A;  2VUM K;  3M3Y C;  2NVT K;  3S16 K;  2R7Z K;  3CQZ K;  1IW7 A;  4AYB L;  5M3F K;  4BY7 K;  1TWF K;  4ZH4 A;  2NVX C;  3GTK K;  4BXX C;  5C44 K;  4BBS K;  2B63 C;  5FLM C;  4BBR C;  1I6V A;  3PO2 K;  4BY1 C;  4QJV A;  2A69 A;  3RZD K;  4X6A C;  1TWH C;  2PA8 L;  4QJV B;  2WB1 D;  2A68 A;  1I3Q K;  3H3V L;  1TWH K;  1I50 C;  3S14 K;  3S17 K;  3S1M K;  1R9T K;  4A93 C;  4GZY A;  3CQZ C;  5IP7 K;  3HKZ D;  1I6H K;  4Y52 C;  3S17 C;  1TWF C;  4LLG A;  2JA5 K;  5IYD K;  5IP7 C;  1ZYR A;  5C3E K;  4MEX A;  4XLN A;  3S1M C;  5M5X K;  4BBR K;  3DXJ A;  3H0G C;  2JA7 K;  3HOZ C;  4A3I C;  1TWC C;  1TWA K;  1I50 K;  2NVQ C;  4KN4 A;  1Y1W K;  3FKI K;  3HOX C;  3RZO C;  2PA8 D;  5IYB K;  2WAQ D;  4Q5S A;  4A3G K;  1SMY A;  3S2D C;  1BDF A;  3HOX K;  3RZO K;  3S15 K;  3H0G K;  2JA7 C;  3HOZ K;  2YU9 K;  3S2H K;  2WAQ L;  3M4O K;  3S1Q C;  2O5I A;  3S15 C;  4Y52 K;  4AYB D;  2WB1 L;  4Y7N K;  2A6E A;  3S2H C;  5C4J K;  3GTP C;  3S1R C;  5IP9 C;  3S1Q K;  4A3D C;  5FJ8 K;  4A3L C;  3GTJ C;  4LK1 A;  1SFO K;  3GTQ C;  3GTM K;  3GTL K;  2R93 C;  3HOV C;  5IP9 K;  1YNN A;  5IYC K;  3PO3 K;  3I4M K;  3GTM C;  4OIR A;  3GTQ K;  3HOV K;  4YFX A;  5M5Y K;  4KMU A;  3HOU C;  4A3C K;  5C44 C;  5D4D A;  4BBS C;  2BE5 A;  4A3K C;  4XSX A;  3HKZ L;  4Y7N C;  3S1N K;  3HOU K;  4C3J K;  2R7Z C;  5C4X K;  2CW0 A;  3H3V D;  4A3D K;  1XPP A;  4C3I K;  2VUM C;  2A6H A;  1HQM A;  3WOD A;  1SFO C;  3GTG K;  3GTO K;  3HOW C;  1TWG C;  3S16 C;  5IYC C;  3PO3 C;  4BY7 C;  1Y1V C;  4A3M K;  4BXX K;  3PO2 C;  1TWG K;  4LK0 A;  2E2J C;  4A3B K;  5FLM K;  4A3F K;  1Y1V K;  4A3M C;  2NVT C;  5IYD C;  2JA5 C;  5C3E C;  4X6A K;  2NVY K;  3S1N C;  3I4N K;  1R9T C;  5C4X C;  1I3Q C;  2R92 C;  3GTO C;  3I4N C;  4NOI A;  1K83 K;  2E2I C;  1TWA C;  4QIW L;  4XLP A;  3RZD C;  2JA6 C;  1I6H C;  1WCM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...