4X6AK

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4x6aK00
3HOUC 1IW7A 3S1NC 1TWGC 3FKIC 4BY1K 5TMCA 4BXXK 3H3VL 4A3CC 4QIWD 3DXJA 4G7HA 2NVQK 3WODA 1I3QC 2PPBA 4A3LC 2BE5A 3HOXK 1TWCK 3HOVC 4BBSK 1WCMK 4A3GC 3RZOK 3S15C 2PA8L 4BBRC 3S1MK 3S1RC 5C4XC 4GZYA 5C44K 4Y52C 2NVXK 3S14K 4JK1A 3S2DK 4A3JC 1K83K 4A3MC 5IYBK 2JA5K 5IP7C 2O5JA 4LJZA 2NVTC 3S17C 5M3MK 2WB1L 3PO3C 1TWFC 3CQZK 2E2HC 5C4JC 2JA6K 4G7OA 5IYCK 3HOYK 5IYDK 1TWAK 4A3EC 1BDFA 1R9TC 4BY7C 3GTLK 1I50C 2R7ZK 3HKZD 2VUMK 3RZDC 4Q5SA 2A6EA 2Y0SD 3GTJC 1HQMA 1TWHK 2CW0A 5C3EK 1SMYA 2B63C 2R92C 3GTMC 3HOZK 2JA7K 3S16K 1Y1VK 3GTOK 3HOWK 1SFOC 4AYBD 4C3IK 5IP9K 3HOUK 2NVYK 3I4MC 4NOIA 4C3HK 4QJVA 5C4XK 3PO2C 2E2JC 3GTKK 4A3LK 4XSXA 4A3KC 3EQLA 4QIWL 3H0GK 4BY1C 4LK1A 4BXXC 4C3JK 4A3IC 3S1QK 4YFKA 1TWCC 1YNJA 4MQ9A 1WCMC 4XLPA 2JA8K 5M5WK 3I4NK 2E2IK 3GTPK 3M3YK 4X6AK 2YU9K 2R93C 5M3FK 3S14C 3PO3K 1K83C 4A3BK 4A93K 5IYBC 4Y7NK 2JA5C 4A3DK 1Y1WC 4A3EK 3GTQK 1I6HC 2PMZD 4BY7K 4C2MK 3CQZC 5FJ8K 3S2HK 2WAQD 4LK0A 3M4OK 4ZH4A 4A3FK 5IYCC 2JA6C 5IYDC 3HOYC 1TWAC 3GTGC 3HKZL 5FLMC 3GTLC 4OIOA 3S1NK 1TWGK 3FKIK 2B63K 1I6VA 2Y0SL 4YFXA 3K7AC 4A3CK 1XPPA 1I3QK 4Q4ZA 4KN7A 3H3VD 3HOVK 4A3GK 3S15K 5TMFA 4BBRK 3I4MK 3S1RK 2NVQC 3HOZC 4Y52K 2JA7C 3PO2K 2PA8D 4A3JK 4AYBL 1Y1VC 3HOXC 4A3MK 4MEXA 3GTOC 4BBSC 5IP7K 3RZOC 3S1MC 2A69A 5IP9C 2NVYC 5C44C 2NVXC 2NVTK 3S17K 3S16C 3S2DC 4MEYA 1TWFK 4YFNA 3GTKC 2E2HK 4OINA 4A3IK 4XSZA 5C4JK 2WB1D 4YG2A 3H0GC 1R9TK 1I50K 4G7ZA 4OIPA 2R93K 4OIRA 3S1QC 4KMUA 3RZDK 3M3YC 4XLNA 3I4NC 2JA8C 4X6AC 1Y1WK 3GTJK 4QJVB 2E2IC 2YU9C 2O5IA 3GTPC 1I6HK 2R92K 4LLGA 2R7ZC 2VUMC 3GTMK 4A3BC 4A93C 4Y7NC 2PMZL 5D4DA 4A3DC 1ZYRA 1TWHC 2A6HA 2WAQL 5C3EC 3GTGK 1SFOK 3GTQC 5M5XK 5FLMK 1YNNA 4OIQA 3S2HC 3M4OC 5M5YK 3K7AK 4A3FC 2E2JK 4KN4A 4A3KK 3HOWC 2A68A
chains in the Genus database with same CATH superfamily
4C3IC 2XCRB 3FKIC 4BY1K 3H3VL 4PAAA 4QIWD 5EGHA 3TFIA 2NVQK 4A3CC 4KDDA 2PPBA 2BE5A 1WORA 4GTDA 3HOXK 4BBSK 1WCMK 4A3GC 3FHZA 2P8TA 3GSIA 3H0GA 1WSVA 5IYBK 2O5JA 1F7UA 3OEPA 3AQOA 1EH1A 5IYDK 1TWFA 1V5VA 3VA7A 4LOWA 2R7ZK 2VUMK 1R9TA 2A6EA 1HQMA 5C3EK 1SMYA 3GEHA 2B63C 1IL2A 3GTMC 5E68A 2JA7K 1IE0A 3FKIA 4C3IK 3I4MC 5C4XK 3T01A 2XCOA 5JFEA 2E2JC 3GTKK 3EQLA 2GAHC 4ILDA 4KASA 3I4NK 2JA8K 1INNA 2FQOA 2R93C 3S14C 4G0VA 1K83C 3AD7C 1B4BA 2JA5C 1AB4A 2P5MA 1WOOA 1YX2A 4GTLA 1I6HC 2PMZD 3CQZC 3FOFA 4G0WA 5IYCC 1ZBSA 3HOYC 1XZPA 1F7VA 1TWAA 4M1XA 2B63K 3GIRA 2Y0SL 3GTLA 1I3QK 4Q4ZA 2Y3PA 4KMDA 4BBRK 3I4MK 3S1RK 2ZUEA 3S1MC 2A69A 2NVYC 2E2HK 4XSZA 3GEEA 2NVXA 1I50K 1EK8A 1USMA 4OIPA 2R93K 4KMUA 4C45A 2YU9C 1I6HK 1F9NA 4LLGA 3N0CA 4A3BC 3GTPA 4BLAA 4WILA 5D4DA 4A3DC 1TWHC 2WAQL 1IS1A 3MMLB 3Q3QA 1YNNA 3A8IA 4A3KK 3HOWC 1ZXOA 3S1NC 1IBAA 4BXXK 1C0AA 3DXJA 3WODA 4A3LC 1G51A 3V4GA 5IOSA 1TWCK 3N3YA 3HOVC 3S15C 4KC6A 3S1MK 3A8KA 4Y52C 4JK1A 1JQWA 5IP7C 1XZPB 4LJZA 3BP3A 2NVTC 5M3MK 1TWFC 2JA6K 1VH2A 1EI6A 1WOSA 1XXAA 1R9TC 4KAWX 4GTFA 5EGEA 5L46A 3TFJA 3SZYA 1J98A 1TWHK 4FZBA 3HOZK 3S16K 1Y1VK 3GTOK 3HOWK 4QJVA 1SFOA 4GTAA 4A3LK 1J6XA 3IPJA 4XSXA 1WQGA 3H0GK 3S0XA 4GTBA 4LK1A 3FOEA 5IORA 3S1QK 4YFKA 4MQ9A 3M3YK 4X6AK 2E2IK 1O29A 5HL8A 4AH6A 3AQPA 1WCMA 4Y7NK 1O26A 3GTQK 3GEIA 4C2MK 3S2HK 1Y1WA 4LK0A 4A3FK 1DCPA 1TWAC 1RU0A 3HKZL 3GTLC 2EBBA 3FKIK 3GTGA 1J6WA 4YFXA 4A3CK 3H3VD 4A3GK 1O2FB 3T00A 5TMFA 1XZQA 5CHPA 1VGXA 4AYBL 4MEXA 3QX3A 3RZOC 3AD8C 5IP9C 3G4CA 5C44C 2NVXC 3S2DC 4MEYA 4YFNA 1O2AA 4OINA 4KM8A 2V6UA 3GTKA 4G7ZA 3TTGA 4GT9A 3GTPC 4QJVB 2GAGC 2W7VA 3GTMK 3GDZA 4A93C 1WQFA 2FQTA 2CFAA 2A6HA 1XXBA 1VRQC 3M4OC 1PJ5A 2E2JK 4KN4A 5CJ9A 3LAJA 1TWGC 3ERED 4G7HA 3LAPA 2ZFZA 1VJEA 3RZOK 2PA8L 4C3JC 4GZYA 5C44K 2NVXK 3S2DK 1O2BA 3S14K 4KB2A 1K83K 4A3JC 4A3MC 2JA5K 3ADAC 3S17C 2WB1L 3PO3C 3CQZK 5C4JC 4G7OA 5IYCK 3HOYK 3CAGA 4A3EC 2GSNA 2E2HA 1XZQB 4KARA 2JH3A 1ZVUA 1YCLA 1I50A 3RZDC 4Q5SA 4GFQA 2Y0SD 5JVOA 3GTJC 3A8JA 2R92C 1EQRA 1TWGA 1SFOC 2NVYK 2GSOA 1ISEA 4KMAA 4QIWL 4WJ3M 4BY1C 4C3JK 1O27A 3T02A 1WCMC 4O2DA 5M5WK 2YU9K 1TWCA 4P5AA 3PO3K 4A3BK 5IYBC 4A3DK 1Y1WC 4A3EK 4GTEA 5FJ8K 2WAQD 3GTJA 1O24A 4ZH4A 5IYDC 1HI9A 1X31C 3GTGC 2R92A 4OIOA 3S1NK 4KN7A 4KB4A 3HOVK 3S15K 3NUHA 4Y52K 2JA7C 5IP7K 1ZQ1C 1GE9A 1Y1VA 2NVTK 5C4XC 3GTOA 1WQHA 1TWFK 3GTKC 2RGRA 1L0WA 4LQYA 3SZZA 1R9TK 2XCQA 1UV7A 4XLNA 3I4NC 3G4AA 2JA8C 2V6SA 1Y1WK 2ZUFA 1BS2A 2E2IA 2PMZL 1WOPA 2R7ZA 1ZYRA 3GTGK 2VUMA 1F93A 1DCHA 5IOTA 1XXCA 4RMFA 2GSUA 3GTQA 2A68A 2JA7A 3HOUC 1IW7A 1IQ0A 4C3HC 5TMCA 1I3QC 3BUEA 2V6TA 1JVIA 4BBRC 4P9SA 3S1RC 1VLOA 3L4JA 4GTCA 3JSTA 2E2HC 1TWAK 2D6FC 4KM9A 1BDFA 4BY7C 3GTLK 1I50C 4P5BA 4WJ4A 3HKZD 4DDQA 4J3NA 1PJ7A 2CW0A 1DD5A 3HXAA 1WSRA 4KATA 4KMHA 2B63A 3GTMA 3AH5A 1I3QA 4AYBD 3HOUK 5IP9K 4NOIA 4C3HK 3PO2C 2PHCB 4A3KC 1KQ4A 1O28A 4BXXC 4A3IC 4PABA 1TWCC 1YNJA 4XLPA 3GTPK 1BGWA 5M3FK 1J6VA 1O25A 1BJTA 4A93K 2R93A 1K83A 4BY7K 3L4KA 1DCOA 2JA5A 3M4OK 2JA6C 1B4AA 3CQZA 3OPFA 5FLMC 1TWGK 5IOQA 1I6VA 3K7AC 1XPPA 4G0UA 2RH6A 4LR2A 2KWAA 2NVQC 4FM9A 3HOZC 3S16C 2CFAB 2PA8D 4A3JK 3HOXC 1Y1VC 4A3MK 3PO2K 3GTOC 4BBSC 4BLBA 3S17K 3AD9C 1JOEA 3LPXA 1WIHA 3TFHA 4A3IK 5C4JK 2NVYA 2WB1D 4YG2A 3H0GC 4XCHA 3BP8C 5TJ3A 4BKWA 4OIRA 3S1QC 3RZDK 3M3YC 4X6AC 2E2IC 3GTJK 2JA6A 2O5IA 2R92K 2R7ZC 2VUMC 3OREA 3N0BA 4Y7NC 2YU9A 1PJ6A 5C3EC 3GTQC 1SFOK 5M5XK 5FLMK 4C2MC 4OIQA 3S2HC 1TWHA 1USOA 5M5YK 3K7AK 4A3FC 1EFWA
chains in the Genus database with same CATH topology
3HOUC 1IW7A 3S1NC 1TWGC 3FKIC 4BY1K 5TMCA 4BXXK 3H3VL 4A3CC 4QIWD 3DXJA 4G7HA 2NVQK 3WODA 1I3QC 2PPBA 4A3LC 2BE5A 3HOXK 1TWCK 3HOVC 4BBSK 1WCMK 4A3GC 3RZOK 3S15C 2PA8L 4BBRC 3S1MK 3S1RC 5C4XC 4GZYA 5C44K 4Y52C 2NVXK 3S14K 4JK1A 3S2DK 4A3JC 1K83K 4A3MC 5IYBK 2JA5K 5IP7C 2O5JA 4LJZA 2NVTC 3S17C 5M3MK 2WB1L 3PO3C 1TWFC 3CQZK 2E2HC 5C4JC 2JA6K 4G7OA 5IYCK 3HOYK 5IYDK 1TWAK 4A3EC 1BDFA 1R9TC 4BY7C 3GTLK 1I50C 2R7ZK 3HKZD 2VUMK 3RZDC 4Q5SA 2A6EA 2Y0SD 3GTJC 1HQMA 1TWHK 2CW0A 5C3EK 1SMYA 2B63C 2R92C 3GTMC 3HOZK 2JA7K 3S16K 1Y1VK 3GTOK 3HOWK 1SFOC 4AYBD 4C3IK 5IP9K 3HOUK 2NVYK 3I4MC 4NOIA 4C3HK 4QJVA 5C4XK 3PO2C 2E2JC 3GTKK 4A3LK 4XSXA 4A3KC 3EQLA 4QIWL 3H0GK 4BY1C 4LK1A 4BXXC 4C3JK 4A3IC 3S1QK 4YFKA 1TWCC 1YNJA 4MQ9A 1WCMC 4XLPA 2JA8K 5M5WK 3I4NK 2E2IK 3GTPK 3M3YK 4X6AK 2YU9K 2R93C 5M3FK 3S14C 3PO3K 1K83C 4A3BK 4A93K 5IYBC 4Y7NK 2JA5C 4A3DK 1Y1WC 4A3EK 3GTQK 1I6HC 2PMZD 4BY7K 4C2MK 3CQZC 5FJ8K 3S2HK 2WAQD 4LK0A 3M4OK 4ZH4A 4A3FK 5IYCC 2JA6C 5IYDC 3HOYC 1TWAC 3GTGC 3HKZL 5FLMC 3GTLC 4OIOA 3S1NK 1TWGK 3FKIK 2B63K 1I6VA 2Y0SL 4YFXA 3K7AC 4A3CK 1XPPA 1I3QK 4Q4ZA 4KN7A 3H3VD 3HOVK 4A3GK 3S15K 5TMFA 4BBRK 3I4MK 3S1RK 2NVQC 3HOZC 4Y52K 2JA7C 3PO2K 2PA8D 4A3JK 4AYBL 1Y1VC 3HOXC 4A3MK 4MEXA 3GTOC 4BBSC 5IP7K 3RZOC 3S1MC 2A69A 5IP9C 2NVYC 5C44C 2NVXC 2NVTK 3S17K 3S16C 3S2DC 4MEYA 1TWFK 4YFNA 3GTKC 2E2HK 4OINA 4A3IK 4XSZA 5C4JK 2WB1D 4YG2A 3H0GC 1R9TK 1I50K 4G7ZA 4OIPA 2R93K 4OIRA 3S1QC 4KMUA 3RZDK 3M3YC 4XLNA 3I4NC 2JA8C 4X6AC 1Y1WK 3GTJK 4QJVB 2E2IC 2YU9C 2O5IA 3GTPC 1I6HK 2R92K 4LLGA 2R7ZC 2VUMC 3GTMK 4A3BC 4A93C 4Y7NC 2PMZL 5D4DA 4A3DC 1ZYRA 1TWHC 2A6HA 2WAQL 5C3EC 3GTGK 1SFOK 3GTQC 5M5XK 5FLMK 1YNNA 4OIQA 3S2HC 3M4OC 5M5YK 3K7AK 4A3FC 2E2JK 4KN4A 4A3KK 3HOWC 2A68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU C;  1IW7 A;  3S1N C;  1TWG C;  3FKI C;  4BY1 K;  5TMC A;  4BXX K;  3H3V L;  4A3C C;  4QIW D;  3DXJ A;  4G7H A;  2NVQ K;  3WOD A;  1I3Q C;  2PPB A;  4A3L C;  2BE5 A;  3HOX K;  1TWC K;  3HOV C;  4BBS K;  1WCM K;  4A3G C;  3RZO K;  3S15 C;  2PA8 L;  4BBR C;  3S1M K;  3S1R C;  5C4X C;  4GZY A;  5C44 K;  4Y52 C;  2NVX K;  3S14 K;  4JK1 A;  3S2D K;  4A3J C;  1K83 K;  4A3M C;  5IYB K;  2JA5 K;  5IP7 C;  2O5J A;  4LJZ A;  2NVT C;  3S17 C;  5M3M K;  2WB1 L;  3PO3 C;  1TWF C;  3CQZ K;  2E2H C;  5C4J C;  2JA6 K;  4G7O A;  5IYC K;  3HOY K;  5IYD K;  1TWA K;  4A3E C;  1BDF A;  1R9T C;  4BY7 C;  3GTL K;  1I50 C;  2R7Z K;  3HKZ D;  2VUM K;  3RZD C;  4Q5S A;  2A6E A;  2Y0S D;  3GTJ C;  1HQM A;  1TWH K;  2CW0 A;  5C3E K;  1SMY A;  2B63 C;  2R92 C;  3GTM C;  3HOZ K;  2JA7 K;  3S16 K;  1Y1V K;  3GTO K;  3HOW K;  1SFO C;  4AYB D;  4C3I K;  5IP9 K;  3HOU K;  2NVY K;  3I4M C;  4NOI A;  4C3H K;  4QJV A;  5C4X K;  3PO2 C;  2E2J C;  3GTK K;  4A3L K;  4XSX A;  4A3K C;  3EQL A;  4QIW L;  3H0G K;  4BY1 C;  4LK1 A;  4BXX C;  4C3J K;  4A3I C;  3S1Q K;  4YFK A;  1TWC C;  1YNJ A;  4MQ9 A;  1WCM C;  4XLP A;  2JA8 K;  5M5W K;  3I4N K;  2E2I K;  3GTP K;  3M3Y K;  4X6A K;  2YU9 K;  2R93 C;  5M3F K;  3S14 C;  3PO3 K;  1K83 C;  4A3B K;  4A93 K;  5IYB C;  4Y7N K;  2JA5 C;  4A3D K;  1Y1W C;  4A3E K;  3GTQ K;  1I6H C;  2PMZ D;  4BY7 K;  4C2M K;  3CQZ C;  5FJ8 K;  3S2H K;  2WAQ D;  4LK0 A;  3M4O K;  4ZH4 A;  4A3F K;  5IYC C;  2JA6 C;  5IYD C;  3HOY C;  1TWA C;  3GTG C;  3HKZ L;  5FLM C;  3GTL C;  4OIO A;  3S1N K;  1TWG K;  3FKI K;  2B63 K;  1I6V A;  2Y0S L;  4YFX A;  3K7A C;  4A3C K;  1XPP A;  1I3Q K;  4Q4Z A;  4KN7 A;  3H3V D;  3HOV K;  4A3G K;  3S15 K;  5TMF A;  4BBR K;  3I4M K;  3S1R K;  2NVQ C;  3HOZ C;  4Y52 K;  2JA7 C;  3PO2 K;  2PA8 D;  4A3J K;  4AYB L;  1Y1V C;  3HOX C;  4A3M K;  4MEX A;  3GTO C;  4BBS C;  5IP7 K;  3RZO C;  3S1M C;  2A69 A;  5IP9 C;  2NVY C;  5C44 C;  2NVX C;  2NVT K;  3S17 K;  3S16 C;  3S2D C;  4MEY A;  1TWF K;  4YFN A;  3GTK C;  2E2H K;  4OIN A;  4A3I K;  4XSZ A;  5C4J K;  2WB1 D;  4YG2 A;  3H0G C;  1R9T K;  1I50 K;  4G7Z A;  4OIP A;  2R93 K;  4OIR A;  3S1Q C;  4KMU A;  3RZD K;  3M3Y C;  4XLN A;  3I4N C;  2JA8 C;  4X6A C;  1Y1W K;  3GTJ K;  4QJV B;  2E2I C;  2YU9 C;  2O5I A;  3GTP C;  1I6H K;  2R92 K;  4LLG A;  2R7Z C;  2VUM C;  3GTM K;  4A3B C;  4A93 C;  4Y7N C;  2PMZ L;  5D4D A;  4A3D C;  1ZYR A;  1TWH C;  2A6H A;  2WAQ L;  5C3E C;  3GTG K;  1SFO K;  3GTQ C;  5M5X K;  5FLM K;  1YNN A;  4OIQ A;  3S2H C;  3M4O C;  5M5Y K;  3K7A K;  4A3F C;  2E2J K;  4KN4 A;  4A3K K;  3HOW C;  2A68 A; 
#chains in the Genus database with same CATH topology
 4C3I C;  2XCR B;  3FKI C;  4BY1 K;  3H3V L;  4PAA A;  4QIW D;  5EGH A;  3TFI A;  2NVQ K;  4A3C C;  4KDD A;  2PPB A;  2BE5 A;  1WOR A;  4GTD A;  3HOX K;  4BBS K;  1WCM K;  4A3G C;  3FHZ A;  2P8T A;  3GSI A;  3H0G A;  1WSV A;  5IYB K;  2O5J A;  1F7U A;  3OEP A;  3AQO A;  1EH1 A;  5IYD K;  1TWF A;  1V5V A;  3VA7 A;  4LOW A;  2R7Z K;  2VUM K;  1R9T A;  2A6E A;  1HQM A;  5C3E K;  1SMY A;  3GEH A;  2B63 C;  1IL2 A;  3GTM C;  5E68 A;  2JA7 K;  1IE0 A;  3FKI A;  4C3I K;  3I4M C;  5C4X K;  3T01 A;  2XCO A;  5JFE A;  2E2J C;  3GTK K;  3EQL A;  2GAH C;  4ILD A;  4KAS A;  3I4N K;  2JA8 K;  1INN A;  2FQO A;  2R93 C;  3S14 C;  4G0V A;  1K83 C;  3AD7 C;  1B4B A;  2JA5 C;  1AB4 A;  2P5M A;  1WOO A;  1YX2 A;  4GTL A;  1I6H C;  2PMZ D;  3CQZ C;  3FOF A;  4G0W A;  5IYC C;  1ZBS A;  3HOY C;  1XZP A;  1F7V A;  1TWA A;  4M1X A;  2B63 K;  3GIR A;  2Y0S L;  3GTL A;  1I3Q K;  4Q4Z A;  2Y3P A;  4KMD A;  4BBR K;  3I4M K;  3S1R K;  2ZUE A;  3S1M C;  2A69 A;  2NVY C;  2E2H K;  4XSZ A;  3GEE A;  2NVX A;  1I50 K;  1EK8 A;  1USM A;  4OIP A;  2R93 K;  4KMU A;  4C45 A;  2YU9 C;  1I6H K;  1F9N A;  4LLG A;  3N0C A;  4A3B C;  3GTP A;  4BLA A;  4WIL A;  5D4D A;  4A3D C;  1TWH C;  2WAQ L;  1IS1 A;  3MML B;  3Q3Q A;  1YNN A;  3A8I A;  4A3K K;  3HOW C;  1ZXO A;  3S1N C;  1IBA A;  4BXX K;  1C0A A;  3DXJ A;  3WOD A;  4A3L C;  1G51 A;  3V4G A;  5IOS A;  1TWC K;  3N3Y A;  3HOV C;  3S15 C;  4KC6 A;  3S1M K;  3A8K A;  4Y52 C;  4JK1 A;  1JQW A;  5IP7 C;  1XZP B;  4LJZ A;  3BP3 A;  2NVT C;  5M3M K;  1TWF C;  2JA6 K;  1VH2 A;  1EI6 A;  1WOS A;  1XXA A;  1R9T C;  4KAW X;  4GTF A;  5EGE A;  5L46 A;  3TFJ A;  3SZY A;  1J98 A;  1TWH K;  4FZB A;  3HOZ K;  3S16 K;  1Y1V K;  3GTO K;  3HOW K;  4QJV A;  1SFO A;  4GTA A;  4A3L K;  1J6X A;  3IPJ A;  4XSX A;  1WQG A;  3H0G K;  3S0X A;  4GTB A;  4LK1 A;  3FOE A;  5IOR A;  3S1Q K;  4YFK A;  4MQ9 A;  3M3Y K;  4X6A K;  2E2I K;  1O29 A;  5HL8 A;  4AH6 A;  3AQP A;  1WCM A;  4Y7N K;  1O26 A;  3GTQ K;  3GEI A;  4C2M K;  3S2H K;  1Y1W A;  4LK0 A;  4A3F K;  1DCP A;  1TWA C;  1RU0 A;  3HKZ L;  3GTL C;  2EBB A;  3FKI K;  3GTG A;  1J6W A;  4YFX A;  4A3C K;  3H3V D;  4A3G K;  1O2F B;  3T00 A;  5TMF A;  1XZQ A;  5CHP A;  1VGX A;  4AYB L;  4MEX A;  3QX3 A;  3RZO C;  3AD8 C;  5IP9 C;  3G4C A;  5C44 C;  2NVX C;  3S2D C;  4MEY A;  4YFN A;  1O2A A;  4OIN A;  4KM8 A;  2V6U A;  3GTK A;  4G7Z A;  3TTG A;  4GT9 A;  3GTP C;  4QJV B;  2GAG C;  2W7V A;  3GTM K;  3GDZ A;  4A93 C;  1WQF A;  2FQT A;  2CFA A;  2A6H A;  1XXB A;  1VRQ C;  3M4O C;  1PJ5 A;  2E2J K;  4KN4 A;  5CJ9 A;  3LAJ A;  1TWG C;  3ERE D;  4G7H A;  3LAP A;  2ZFZ A;  1VJE A;  3RZO K;  2PA8 L;  4C3J C;  4GZY A;  5C44 K;  2NVX K;  3S2D K;  1O2B A;  3S14 K;  4KB2 A;  1K83 K;  4A3J C;  4A3M C;  2JA5 K;  3ADA C;  3S17 C;  2WB1 L;  3PO3 C;  3CQZ K;  5C4J C;  4G7O A;  5IYC K;  3HOY K;  3CAG A;  4A3E C;  2GSN A;  2E2H A;  1XZQ B;  4KAR A;  2JH3 A;  1ZVU A;  1YCL A;  1I50 A;  3RZD C;  4Q5S A;  4GFQ A;  2Y0S D;  5JVO A;  3GTJ C;  3A8J A;  2R92 C;  1EQR A;  1TWG A;  1SFO C;  2NVY K;  2GSO A;  1ISE A;  4KMA A;  4QIW L;  4WJ3 M;  4BY1 C;  4C3J K;  1O27 A;  3T02 A;  1WCM C;  4O2D A;  5M5W K;  2YU9 K;  1TWC A;  4P5A A;  3PO3 K;  4A3B K;  5IYB C;  4A3D K;  1Y1W C;  4A3E K;  4GTE A;  5FJ8 K;  2WAQ D;  3GTJ A;  1O24 A;  4ZH4 A;  5IYD C;  1HI9 A;  1X31 C;  3GTG C;  2R92 A;  4OIO A;  3S1N K;  4KN7 A;  4KB4 A;  3HOV K;  3S15 K;  3NUH A;  4Y52 K;  2JA7 C;  5IP7 K;  1ZQ1 C;  1GE9 A;  1Y1V A;  2NVT K;  5C4X C;  3GTO A;  1WQH A;  1TWF K;  3GTK C;  2RGR A;  1L0W A;  4LQY A;  3SZZ A;  1R9T K;  2XCQ A;  1UV7 A;  4XLN A;  3I4N C;  3G4A A;  2JA8 C;  2V6S A;  1Y1W K;  2ZUF A;  1BS2 A;  2E2I A;  2PMZ L;  1WOP A;  2R7Z A;  1ZYR A;  3GTG K;  2VUM A;  1F93 A;  1DCH A;  5IOT A;  1XXC A;  4RMF A;  2GSU A;  3GTQ A;  2A68 A;  2JA7 A;  3HOU C;  1IW7 A;  1IQ0 A;  4C3H C;  5TMC A;  1I3Q C;  3BUE A;  2V6T A;  1JVI A;  4BBR C;  4P9S A;  3S1R C;  1VLO A;  3L4J A;  4GTC A;  3JST A;  2E2H C;  1TWA K;  2D6F C;  4KM9 A;  1BDF A;  4BY7 C;  3GTL K;  1I50 C;  4P5B A;  4WJ4 A;  3HKZ D;  4DDQ A;  4J3N A;  1PJ7 A;  2CW0 A;  1DD5 A;  3HXA A;  1WSR A;  4KAT A;  4KMH A;  2B63 A;  3GTM A;  3AH5 A;  1I3Q A;  4AYB D;  3HOU K;  5IP9 K;  4NOI A;  4C3H K;  3PO2 C;  2PHC B;  4A3K C;  1KQ4 A;  1O28 A;  4BXX C;  4A3I C;  4PAB A;  1TWC C;  1YNJ A;  4XLP A;  3GTP K;  1BGW A;  5M3F K;  1J6V A;  1O25 A;  1BJT A;  4A93 K;  2R93 A;  1K83 A;  4BY7 K;  3L4K A;  1DCO A;  2JA5 A;  3M4O K;  2JA6 C;  1B4A A;  3CQZ A;  3OPF A;  5FLM C;  1TWG K;  5IOQ A;  1I6V A;  3K7A C;  1XPP A;  4G0U A;  2RH6 A;  4LR2 A;  2KWA A;  2NVQ C;  4FM9 A;  3HOZ C;  3S16 C;  2CFA B;  2PA8 D;  4A3J K;  3HOX C;  1Y1V C;  4A3M K;  3PO2 K;  3GTO C;  4BBS C;  4BLB A;  3S17 K;  3AD9 C;  1JOE A;  3LPX A;  1WIH A;  3TFH A;  4A3I K;  5C4J K;  2NVY A;  2WB1 D;  4YG2 A;  3H0G C;  4XCH A;  3BP8 C;  5TJ3 A;  4BKW A;  4OIR A;  3S1Q C;  3RZD K;  3M3Y C;  4X6A C;  2E2I C;  3GTJ K;  2JA6 A;  2O5I A;  2R92 K;  2R7Z C;  2VUM C;  3ORE A;  3N0B A;  4Y7N C;  2YU9 A;  1PJ6 A;  5C3E C;  3GTQ C;  1SFO K;  5M5X K;  5FLM K;  4C2M C;  4OIQ A;  3S2H C;  1TWH A;  1USO A;  5M5Y K;  3K7A K;  4A3F C;  1EFW A; 
#chains in the Genus database with same CATH homology
 3HOU C;  1IW7 A;  3S1N C;  1TWG C;  3FKI C;  4BY1 K;  5TMC A;  4BXX K;  3H3V L;  4A3C C;  4QIW D;  3DXJ A;  4G7H A;  2NVQ K;  3WOD A;  1I3Q C;  2PPB A;  4A3L C;  2BE5 A;  3HOX K;  1TWC K;  3HOV C;  4BBS K;  1WCM K;  4A3G C;  3RZO K;  3S15 C;  2PA8 L;  4BBR C;  3S1M K;  3S1R C;  5C4X C;  4GZY A;  5C44 K;  4Y52 C;  2NVX K;  3S14 K;  4JK1 A;  3S2D K;  4A3J C;  1K83 K;  4A3M C;  5IYB K;  2JA5 K;  5IP7 C;  2O5J A;  4LJZ A;  2NVT C;  3S17 C;  5M3M K;  2WB1 L;  3PO3 C;  1TWF C;  3CQZ K;  2E2H C;  5C4J C;  2JA6 K;  4G7O A;  5IYC K;  3HOY K;  5IYD K;  1TWA K;  4A3E C;  1BDF A;  1R9T C;  4BY7 C;  3GTL K;  1I50 C;  2R7Z K;  3HKZ D;  2VUM K;  3RZD C;  4Q5S A;  2A6E A;  2Y0S D;  3GTJ C;  1HQM A;  1TWH K;  2CW0 A;  5C3E K;  1SMY A;  2B63 C;  2R92 C;  3GTM C;  3HOZ K;  2JA7 K;  3S16 K;  1Y1V K;  3GTO K;  3HOW K;  1SFO C;  4AYB D;  4C3I K;  5IP9 K;  3HOU K;  2NVY K;  3I4M C;  4NOI A;  4C3H K;  4QJV A;  5C4X K;  3PO2 C;  2E2J C;  3GTK K;  4A3L K;  4XSX A;  4A3K C;  3EQL A;  4QIW L;  3H0G K;  4BY1 C;  4LK1 A;  4BXX C;  4C3J K;  4A3I C;  3S1Q K;  4YFK A;  1TWC C;  1YNJ A;  4MQ9 A;  1WCM C;  4XLP A;  2JA8 K;  5M5W K;  3I4N K;  2E2I K;  3GTP K;  3M3Y K;  4X6A K;  2YU9 K;  2R93 C;  5M3F K;  3S14 C;  3PO3 K;  1K83 C;  4A3B K;  4A93 K;  5IYB C;  4Y7N K;  2JA5 C;  4A3D K;  1Y1W C;  4A3E K;  3GTQ K;  1I6H C;  2PMZ D;  4BY7 K;  4C2M K;  3CQZ C;  5FJ8 K;  3S2H K;  2WAQ D;  4LK0 A;  3M4O K;  4ZH4 A;  4A3F K;  5IYC C;  2JA6 C;  5IYD C;  3HOY C;  1TWA C;  3GTG C;  3HKZ L;  5FLM C;  3GTL C;  4OIO A;  3S1N K;  1TWG K;  3FKI K;  2B63 K;  1I6V A;  2Y0S L;  4YFX A;  3K7A C;  4A3C K;  1XPP A;  1I3Q K;  4Q4Z A;  4KN7 A;  3H3V D;  3HOV K;  4A3G K;  3S15 K;  5TMF A;  4BBR K;  3I4M K;  3S1R K;  2NVQ C;  3HOZ C;  4Y52 K;  2JA7 C;  3PO2 K;  2PA8 D;  4A3J K;  4AYB L;  1Y1V C;  3HOX C;  4A3M K;  4MEX A;  3GTO C;  4BBS C;  5IP7 K;  3RZO C;  3S1M C;  2A69 A;  5IP9 C;  2NVY C;  5C44 C;  2NVX C;  2NVT K;  3S17 K;  3S16 C;  3S2D C;  4MEY A;  1TWF K;  4YFN A;  3GTK C;  2E2H K;  4OIN A;  4A3I K;  4XSZ A;  5C4J K;  2WB1 D;  4YG2 A;  3H0G C;  1R9T K;  1I50 K;  4G7Z A;  4OIP A;  2R93 K;  4OIR A;  3S1Q C;  4KMU A;  3RZD K;  3M3Y C;  4XLN A;  3I4N C;  2JA8 C;  4X6A C;  1Y1W K;  3GTJ K;  4QJV B;  2E2I C;  2YU9 C;  2O5I A;  3GTP C;  1I6H K;  2R92 K;  4LLG A;  2R7Z C;  2VUM C;  3GTM K;  4A3B C;  4A93 C;  4Y7N C;  2PMZ L;  5D4D A;  4A3D C;  1ZYR A;  1TWH C;  2A6H A;  2WAQ L;  5C3E C;  3GTG K;  1SFO K;  3GTQ C;  5M5X K;  5FLM K;  1YNN A;  4OIQ A;  3S2H C;  3M4O C;  5M5Y K;  3K7A K;  4A3F C;  2E2J K;  4KN4 A;  4A3K K;  3HOW C;  2A68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...