4X6AK

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4x6aK00
3FKIC 1TWAK 4YFKA 3FKIK 4AYBD 1R9TC 4NOIA 5C44K 3S1QC 1R9TK 3HKZD 5FJ8K 2BE5A 3DXJA 4XLNA 4A3EK 3RZDC 3HOYK 3GTQC 5M3MK 3HOZK 3S15C 3I4NC 3GTMC 2PMZL 3GTQK 1Y1VK 2R93K 3HOXC 4XLPA 1TWCC 4XSXA 3EQLA 4C3JK 3HOXK 5M3FK 3H0GC 1BDFA 4KN7A 2NVXC 1WCMC 2A6EA 2JA6C 3H0GK 4QIWD 3RZOC 3GTGC 1TWFC 2JA6K 4QJVB 1YNJA 4A3JC 5IP9C 4OIRA 2JA8C 3I4MC 2NVQC 3S1MC 3GTLC 5C4JC 3I4MK 4BBSC 3GTLK 3HOVC 5FLMC 4A3DK 4A3IC 5IP7C 2YU9C 2VUMK 4QJVA 4Y7NK 4Q4ZA 4A3IK 2YU9K 3S14C 1IW7A 5TMFA 2WAQL 2E2HC 3S1RK 1HQMA 2B63C 4A3FC 1Y1WK 2R7ZC 4Y52K 4A3GC 1Y1WC 3S16C 2PA8D 5C4XC 3S2DC 3HOUC 2JA7C 3M4OC 5C4XK 3M3YC 3S1QK 2JA7K 1TWHC 4C3HK 4A3MC 4A3LC 3S2HC 3RZDK 4YG2A 2Y0SD 3I4NK 3S15K 2WB1D 3S2HK 3GTMK 1I3QC 1TWCK 5TMCA 4YFNA 3WODA 1XPPA 2A69A 3S17C 1K83C 4KMUA 2NVXK 1SMYA 1WCMK 4MQ9A 3RZOK 1K83K 3S17K 3GTGK 1TWFK 4LK0A 2JA8K 4A3JK 3GTKC 5IP9K 2NVQK 5IYCC 4A93C 4C2MK 4LLGA 3GTKK 5C4JK 3S1MK 4X6AC 5IYCK 4BBSK 1YNNA 4BXXC 3HOVK 5FLMK 5IP7K 2PMZD 4LJZA 4BXXK 2PPBA 3S14K 3K7AC 4XSZA 2E2HK 5C3EC 3H3VD 2B63K 2R7ZK 4A3FK 1SFOC 4A3GK 3S16K 4BBRC 3S2DK 4AYBL 3HOUK 3HOWC 3M4OK 4G7HA 4BBRK 5M5YK 3M3YK 2R92C 3GTOC 1TWHK 3HKZL 1TWGC 2A6HA 4A3MK 4A3LK 2E2JC 4BY1C 3GTJC 1I3QK 1I6VA 2O5JA 1I6HC 5IYBC 5M5WK 4G7ZA 4KN4A 4A3KC 2WAQD 1I6HK 3CQZC 2NVYC 4C3IK 4QIWL 1TWAC 4G7OA 5C44C 4A93K 3GTPC 4X6AK 3HOYC 3HOZC 4A3EC 3GTPK 4LK1A 2E2IC 4BY7C 4OIOA 2A68A 5M5XK 1Y1VC 2E2IK 4MEXA 2NVTC 3S1NC 4BY7K 2R93C 3K7AK 3S1NK 2NVTK 3PO2C 5C3EK 3PO2K 1SFOK 3H3VL 2JA5C 2PA8L 1ZYRA 4JK1A 2O5IA 4A3CC 5IYDK 3HOWK 4OIQA 2CW0A 2JA5K 4MEYA 4YFXA 2R92K 4A3CK 3GTOK 1I50C 1TWGK 4GZYA 3PO3C 4ZH4A 2Y0SL 4OIPA 1I50K 2WB1L 2E2JK 3PO3K 4A3BC 4BY1K 4A3DC 4Q5SA 3GTJK 2VUMC 4Y7NC 4A3BK 5IYDC 5D4DA 5IYBK 4A3KK 3S1RC 4OINA 3CQZK 4Y52C 2NVYK
chains in the Genus database with same CATH superfamily
2GAGC 1I50A 2RH6A 5IOTA 4AYBD 1R9TC 5C44K 3T02A 3FHZA 3CAGA 3S1QC 1KQ4A 4LOWA 5EGHA 3HOYK 3GTQC 3CQZA 5M3MK 1O2BA 2NVYA 2PMZL 3G4AA 3HOXK 1R9TA 1WCMC 1J6XA 3RZOC 1TWFC 1YNJA 4QJVB 4OIRA 1Y1VA 5IP9C 2JA8C 3GTQA 2R93A 4P5BA 4GTEA 1ZBSA 1WORA 3GTLK 5FLMC 2VUMK 4QJVA 1PJ7A 1B4AA 4Q4ZA 1INNA 2YU9K 3S14C 4M1XA 2WAQL 1HQMA 1Y1WK 1WQHA 1WSVA 2PA8D 2ZFZA 5C4XC 3HOUC 2JA7C 3M4OC 1JQWA 3BP3A 5HL8A 4C3HK 1EQRA 4A3MC 3LAPA 4A3LC 4KARA 1O29A 1DCOA 3BUEA 1K83C 3SZYA 2JA7A 1PJ6A 4MQ9A 3S17K 2RGRA 3GTGK 3ADAC 4RMFA 4A3JK 2P5MA 2NVQK 5IYCC 3S1MK 3OPFA 3GTKK 2ZUFA 3ERED 3V4GA 2EBBA 1K83A 3K7AC 2E2HK 5C3EC 2R7ZK 1L0WA 3HKZL 5JVOA 2B63A 1XXBA 3GTJC 3TTGA 4G7ZA 4KN4A 4WJ3M 1TWHA 4DDQA 4A93K 2W7VA 1O2FB 4BLBA 4LK1A 3GTPK 3AD8C 4BY7K 2E2IK 2NVTC 1ZQ1C 1J98A 1F93A 2FQTA 3PO2K 2JA5C 2O5IA 1ZYRA 4A3CC 3QX3A 4OIQA 4GZYA 2Y0SL 1I50K 3OEPA 4GT9A 3VA7A 1SFOA 4BY1K 2GSNA 5IYDC 2JA5A 5IYBK 4PAAA 2R92A 3S1RC 3CQZK 3GDZA 2NVYK 4XCHA 3AQOA 1J6WA 2FQOA 1R9TK 5L46A 3HOZK 4A3EK 3S15C 3GTMC 1TWAA 3GTQK 1Y1VK 2R93K 1RU0A 4XLPA 3NUHA 1TWCC 2JH3A 3EQLA 4LR2A 1IBAA 1BDFA 5EGEA 2NVXC 2A6EA 3GIRA 2E2IA 3I4MC 1WOSA 4C2MC 4BBSC 3HOVC 4A3IC 3N3YA 4Y7NK 4G0UA 1VGXA 1IE0A 2XCRB 2V6SA 1X31C 4Y52K 4A3GC 3SZZA 5C4XK 2JA7K 3TFHA 3RZDK 3I4NK 1DCHA 1I3QC 1XXAA 5TMCA 1WQFA 2XCQA 3WODA 1XPPA 3N0CA 1BGWA 3S0XA 4G0WA 1USMA 1SMYA 1K83K 1IL2A 5TJ3A 1WOOA 4X6AC 4LLGA 5C4JK 5IYCK 4J3NA 4BXXC 1WCMA 5IP7K 3L4JA 3G4CA 1TWFA 1XXCA 3LAJA 3GEIA 2B63K 4A3FK 3S16K 4BBRC 3S2DK 4AYBL 4BLAA 1C0AA 3M3YK 3GTOC 1TWHK 1TWGC 2E2JC 5IOSA 4GTBA 4GFQA 1I6HC 1F9NA 5M5WK 3A8IA 1DCPA 3GEHA 5C44C 3HOYC 4OIOA 5M5XK 3S1NC 4MEXA 2NVTK 3JSTA 4GTDA 5IOQA 4KMHA 2XCOA 1PJ5A 1SFOK 2PA8L 3HOWK 2JA5K 4YFXA 2R92K 4A3CK 1O24A 4Q5SA 2V6UA 2VUMC 4O2DA 3L4KA 4A3KK 5IYDK 1Y1WC 1VH2A 3FKIC 1TWAK 4YFKA 4NOIA 3GTJA 5FJ8K 3T01A 1EFWA 1JOEA 3FKIA 4C3JK 3H0GC 1ZXOA 3N0BA 1WSRA 2JA6C 4QIWD 3GTGC 4A3JC 1O2AA 1GE9A 2NVQC 3S1MC 3I4MK 5CHPA 1WOPA 4A3DK 3H0GA 4A3IK 2JA6A 5TMFA 2E2HC 2R7ZC 1VJEA 4KB2A 3S1QK 3S2HC 1ISEA 2WB1D 1O25A 3FOEA 1J6VA 2V6TA 1BS2A 1XZPB 1WCMK 3RZOK 4GTAA 1VRQC 1JVIA 1DD5A 1TWFK 3GTMA 2JA8K 5IP9K 1XZPA 1TWCA 4A93C 5JFEA 5FLMK 2NVXA 2PMZD 4BXXK 2PPBA 3S14K 3HXAA 1HI9A 3HOUK 3M4OK 4BBRK 5M5YK 1IQ0A 4A3MK 4A3LK 2A6HA 2P8TA 4BY1C 2O5JA 1O28A 5IYBC 4C3IC 2WAQD 1I6HK 3CQZC 3AH5A 2NVYC 1I3QA 4ILDA 4P5AA 3IPJA 3HOZC 4A3EC 4G0VA 3AD9C 4AH6A 1Y1VC 2GSOA 2R93C 3TFJA 3K7AK 3S1NK 5C3EK 1O27A 4JK1A 2CW0A 4KM8A 4KB4A 4MEYA 4WILA 2CFAB 3PO3C 4KM9A 4OIPA 4LQYA 1VLOA 4A3BC 2D6FC 3GTJK 4Y7NC 2Y3PA 5D4DA 2CFAA 3OREA 2GSUA 3GTOA 1TWGA 4Y52C 3A8JA 3AQPA 2PHCB 3FKIK 4KATA 3HKZD 1YX2A 2BE5A 3DXJA 4XLNA 3RZDC 3I4NC 3LPXA 3HOXC 1O26A 1ZVUA 3FOFA 4XSXA 3MMLB 5M3FK 3GEEA 4KN7A 3H0GK 4KAWX 3TFIA 2JA6K 1BJTA 3GTLC 5C4JC 4FZBA 1AB4A 5IP7C 2YU9C 1IW7A 3S1RK 3AD7C 1F7VA 2B63C 4A3FC 3S16C 3GTLA 3S2DC 4C3HC 1WQGA 2KWAA 3M3YC 2VUMA 1TWHC 2YU9A 4YG2A 2Y0SD 3S15K 4C45A 5E68A 1F7UA 1UV7A 3GTMK 3S2HK 1Y1WA 1TWCK 4YFNA 1EI6A 2A69A 4GTLA 4FM9A 3S17C 4KMUA 2NVXK 3BP8C 4LK0A 4KMAA 3GTKC 3T00A 4C2MK 4KASA 4BBSK 1YNNA 3HOVK 2ZUEA 1IS1A 1EK8A 1XZQB 4LJZA 3GTGA 1G51A 4XSZA 3H3VD 1B4BA 3GTKA 1SFOC 4A3GK 1XZQA 3HOWC 4G7HA 4PABA 3Q3QA 2R92C 1WIHA 4KMDA 2E2HA 1USOA 2R7ZA 3GSIA 4WJ4A 1I3QK 1I6VA 4A3KC 2GAHC 4C3IK 4QIWL 1TWAC 4G7OA 5CJ9A 1EH1A 3A8KA 3GTPC 5IORA 4X6AK 4BY7C 2E2IC 2A68A 4GTCA 4C3JC 3PO2C 4GTFA 3H3VL 4P9SA 3GTPA 3GTOK 1YCLA 1I50C 1TWGK 4BKWA 4ZH4A 2WB1L 2E2JK 3PO3K 4A3DC 1V5VA 4A3BK 4KDDA 4KC6A 4OINA
chains in the Genus database with same CATH topology
3FKIC 1TWAK 4YFKA 3FKIK 4AYBD 1R9TC 4NOIA 5C44K 3S1QC 1R9TK 3HKZD 5FJ8K 2BE5A 3DXJA 4XLNA 4A3EK 3RZDC 3HOYK 3GTQC 5M3MK 3HOZK 3S15C 3I4NC 3GTMC 2PMZL 3GTQK 1Y1VK 2R93K 3HOXC 4XLPA 1TWCC 4XSXA 3EQLA 4C3JK 3HOXK 5M3FK 3H0GC 1BDFA 4KN7A 2NVXC 1WCMC 2A6EA 2JA6C 3H0GK 4QIWD 3RZOC 3GTGC 1TWFC 2JA6K 4QJVB 1YNJA 4A3JC 5IP9C 4OIRA 2JA8C 3I4MC 2NVQC 3S1MC 3GTLC 5C4JC 3I4MK 4BBSC 3GTLK 3HOVC 5FLMC 4A3DK 4A3IC 5IP7C 2YU9C 2VUMK 4QJVA 4Y7NK 4Q4ZA 4A3IK 2YU9K 3S14C 1IW7A 5TMFA 2WAQL 2E2HC 3S1RK 1HQMA 2B63C 4A3FC 1Y1WK 2R7ZC 4Y52K 4A3GC 1Y1WC 3S16C 2PA8D 5C4XC 3S2DC 3HOUC 2JA7C 3M4OC 5C4XK 3M3YC 3S1QK 2JA7K 1TWHC 4C3HK 4A3MC 4A3LC 3S2HC 3RZDK 4YG2A 2Y0SD 3I4NK 3S15K 2WB1D 3S2HK 3GTMK 1I3QC 1TWCK 5TMCA 4YFNA 3WODA 1XPPA 2A69A 3S17C 1K83C 4KMUA 2NVXK 1SMYA 1WCMK 4MQ9A 3RZOK 1K83K 3S17K 3GTGK 1TWFK 4LK0A 2JA8K 4A3JK 3GTKC 5IP9K 2NVQK 5IYCC 4A93C 4C2MK 4LLGA 3GTKK 5C4JK 3S1MK 4X6AC 5IYCK 4BBSK 1YNNA 4BXXC 3HOVK 5FLMK 5IP7K 2PMZD 4LJZA 4BXXK 2PPBA 3S14K 3K7AC 4XSZA 2E2HK 5C3EC 3H3VD 2B63K 2R7ZK 4A3FK 1SFOC 4A3GK 3S16K 4BBRC 3S2DK 4AYBL 3HOUK 3HOWC 3M4OK 4G7HA 4BBRK 5M5YK 3M3YK 2R92C 3GTOC 1TWHK 3HKZL 1TWGC 2A6HA 4A3MK 4A3LK 2E2JC 4BY1C 3GTJC 1I3QK 1I6VA 2O5JA 1I6HC 5IYBC 5M5WK 4G7ZA 4KN4A 4A3KC 2WAQD 1I6HK 3CQZC 2NVYC 4C3IK 4QIWL 1TWAC 4G7OA 5C44C 4A93K 3GTPC 4X6AK 3HOYC 3HOZC 4A3EC 3GTPK 4LK1A 2E2IC 4BY7C 4OIOA 2A68A 5M5XK 1Y1VC 2E2IK 4MEXA 2NVTC 3S1NC 4BY7K 2R93C 3K7AK 3S1NK 2NVTK 3PO2C 5C3EK 3PO2K 1SFOK 3H3VL 2JA5C 2PA8L 1ZYRA 4JK1A 2O5IA 4A3CC 5IYDK 3HOWK 4OIQA 2CW0A 2JA5K 4MEYA 4YFXA 2R92K 4A3CK 3GTOK 1I50C 1TWGK 4GZYA 3PO3C 4ZH4A 2Y0SL 4OIPA 1I50K 2WB1L 2E2JK 3PO3K 4A3BC 4BY1K 4A3DC 4Q5SA 3GTJK 2VUMC 4Y7NC 4A3BK 5IYDC 5D4DA 5IYBK 4A3KK 3S1RC 4OINA 3CQZK 4Y52C 2NVYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI C;  1TWA K;  4YFK A;  3FKI K;  4AYB D;  1R9T C;  4NOI A;  5C44 K;  3S1Q C;  1R9T K;  3HKZ D;  5FJ8 K;  2BE5 A;  3DXJ A;  4XLN A;  4A3E K;  3RZD C;  3HOY K;  3GTQ C;  5M3M K;  3HOZ K;  3S15 C;  3I4N C;  3GTM C;  2PMZ L;  3GTQ K;  1Y1V K;  2R93 K;  3HOX C;  4XLP A;  1TWC C;  4XSX A;  3EQL A;  4C3J K;  3HOX K;  5M3F K;  3H0G C;  1BDF A;  4KN7 A;  2NVX C;  1WCM C;  2A6E A;  2JA6 C;  3H0G K;  4QIW D;  3RZO C;  3GTG C;  1TWF C;  2JA6 K;  4QJV B;  1YNJ A;  4A3J C;  5IP9 C;  4OIR A;  2JA8 C;  3I4M C;  2NVQ C;  3S1M C;  3GTL C;  5C4J C;  3I4M K;  4BBS C;  3GTL K;  3HOV C;  5FLM C;  4A3D K;  4A3I C;  5IP7 C;  2YU9 C;  2VUM K;  4QJV A;  4Y7N K;  4Q4Z A;  4A3I K;  2YU9 K;  3S14 C;  1IW7 A;  5TMF A;  2WAQ L;  2E2H C;  3S1R K;  1HQM A;  2B63 C;  4A3F C;  1Y1W K;  2R7Z C;  4Y52 K;  4A3G C;  1Y1W C;  3S16 C;  2PA8 D;  5C4X C;  3S2D C;  3HOU C;  2JA7 C;  3M4O C;  5C4X K;  3M3Y C;  3S1Q K;  2JA7 K;  1TWH C;  4C3H K;  4A3M C;  4A3L C;  3S2H C;  3RZD K;  4YG2 A;  2Y0S D;  3I4N K;  3S15 K;  2WB1 D;  3S2H K;  3GTM K;  1I3Q C;  1TWC K;  5TMC A;  4YFN A;  3WOD A;  1XPP A;  2A69 A;  3S17 C;  1K83 C;  4KMU A;  2NVX K;  1SMY A;  1WCM K;  4MQ9 A;  3RZO K;  1K83 K;  3S17 K;  3GTG K;  1TWF K;  4LK0 A;  2JA8 K;  4A3J K;  3GTK C;  5IP9 K;  2NVQ K;  5IYC C;  4A93 C;  4C2M K;  4LLG A;  3GTK K;  5C4J K;  3S1M K;  4X6A C;  5IYC K;  4BBS K;  1YNN A;  4BXX C;  3HOV K;  5FLM K;  5IP7 K;  2PMZ D;  4LJZ A;  4BXX K;  2PPB A;  3S14 K;  3K7A C;  4XSZ A;  2E2H K;  5C3E C;  3H3V D;  2B63 K;  2R7Z K;  4A3F K;  1SFO C;  4A3G K;  3S16 K;  4BBR C;  3S2D K;  4AYB L;  3HOU K;  3HOW C;  3M4O K;  4G7H A;  4BBR K;  5M5Y K;  3M3Y K;  2R92 C;  3GTO C;  1TWH K;  3HKZ L;  1TWG C;  2A6H A;  4A3M K;  4A3L K;  2E2J C;  4BY1 C;  3GTJ C;  1I3Q K;  1I6V A;  2O5J A;  1I6H C;  5IYB C;  5M5W K;  4G7Z A;  4KN4 A;  4A3K C;  2WAQ D;  1I6H K;  3CQZ C;  2NVY C;  4C3I K;  4QIW L;  1TWA C;  4G7O A;  5C44 C;  4A93 K;  3GTP C;  4X6A K;  3HOY C;  3HOZ C;  4A3E C;  3GTP K;  4LK1 A;  2E2I C;  4BY7 C;  4OIO A;  2A68 A;  5M5X K;  1Y1V C;  2E2I K;  4MEX A;  2NVT C;  3S1N C;  4BY7 K;  2R93 C;  3K7A K;  3S1N K;  2NVT K;  3PO2 C;  5C3E K;  3PO2 K;  1SFO K;  3H3V L;  2JA5 C;  2PA8 L;  1ZYR A;  4JK1 A;  2O5I A;  4A3C C;  5IYD K;  3HOW K;  4OIQ A;  2CW0 A;  2JA5 K;  4MEY A;  4YFX A;  2R92 K;  4A3C K;  3GTO K;  1I50 C;  1TWG K;  4GZY A;  3PO3 C;  4ZH4 A;  2Y0S L;  4OIP A;  1I50 K;  2WB1 L;  2E2J K;  3PO3 K;  4A3B C;  4BY1 K;  4A3D C;  4Q5S A;  3GTJ K;  2VUM C;  4Y7N C;  4A3B K;  5IYD C;  5D4D A;  5IYB K;  4A3K K;  3S1R C;  4OIN A;  3CQZ K;  4Y52 C;  2NVY K; 
#chains in the Genus database with same CATH topology
 2GAG C;  1I50 A;  2RH6 A;  5IOT A;  4AYB D;  1R9T C;  5C44 K;  3T02 A;  3FHZ A;  3CAG A;  3S1Q C;  1KQ4 A;  4LOW A;  5EGH A;  3HOY K;  3GTQ C;  3CQZ A;  5M3M K;  1O2B A;  2NVY A;  2PMZ L;  3G4A A;  3HOX K;  1R9T A;  1WCM C;  1J6X A;  3RZO C;  1TWF C;  1YNJ A;  4QJV B;  4OIR A;  1Y1V A;  5IP9 C;  2JA8 C;  3GTQ A;  2R93 A;  4P5B A;  4GTE A;  1ZBS A;  1WOR A;  3GTL K;  5FLM C;  2VUM K;  4QJV A;  1PJ7 A;  1B4A A;  4Q4Z A;  1INN A;  2YU9 K;  3S14 C;  4M1X A;  2WAQ L;  1HQM A;  1Y1W K;  1WQH A;  1WSV A;  2PA8 D;  2ZFZ A;  5C4X C;  3HOU C;  2JA7 C;  3M4O C;  1JQW A;  3BP3 A;  5HL8 A;  4C3H K;  1EQR A;  4A3M C;  3LAP A;  4A3L C;  4KAR A;  1O29 A;  1DCO A;  3BUE A;  1K83 C;  3SZY A;  2JA7 A;  1PJ6 A;  4MQ9 A;  3S17 K;  2RGR A;  3GTG K;  3ADA C;  4RMF A;  4A3J K;  2P5M A;  2NVQ K;  5IYC C;  3S1M K;  3OPF A;  3GTK K;  2ZUF A;  3ERE D;  3V4G A;  2EBB A;  1K83 A;  3K7A C;  2E2H K;  5C3E C;  2R7Z K;  1L0W A;  3HKZ L;  5JVO A;  2B63 A;  1XXB A;  3GTJ C;  3TTG A;  4G7Z A;  4KN4 A;  4WJ3 M;  1TWH A;  4DDQ A;  4A93 K;  2W7V A;  1O2F B;  4BLB A;  4LK1 A;  3GTP K;  3AD8 C;  4BY7 K;  2E2I K;  2NVT C;  1ZQ1 C;  1J98 A;  1F93 A;  2FQT A;  3PO2 K;  2JA5 C;  2O5I A;  1ZYR A;  4A3C C;  3QX3 A;  4OIQ A;  4GZY A;  2Y0S L;  1I50 K;  3OEP A;  4GT9 A;  3VA7 A;  1SFO A;  4BY1 K;  2GSN A;  5IYD C;  2JA5 A;  5IYB K;  4PAA A;  2R92 A;  3S1R C;  3CQZ K;  3GDZ A;  2NVY K;  4XCH A;  3AQO A;  1J6W A;  2FQO A;  1R9T K;  5L46 A;  3HOZ K;  4A3E K;  3S15 C;  3GTM C;  1TWA A;  3GTQ K;  1Y1V K;  2R93 K;  1RU0 A;  4XLP A;  3NUH A;  1TWC C;  2JH3 A;  3EQL A;  4LR2 A;  1IBA A;  1BDF A;  5EGE A;  2NVX C;  2A6E A;  3GIR A;  2E2I A;  3I4M C;  1WOS A;  4C2M C;  4BBS C;  3HOV C;  4A3I C;  3N3Y A;  4Y7N K;  4G0U A;  1VGX A;  1IE0 A;  2XCR B;  2V6S A;  1X31 C;  4Y52 K;  4A3G C;  3SZZ A;  5C4X K;  2JA7 K;  3TFH A;  3RZD K;  3I4N K;  1DCH A;  1I3Q C;  1XXA A;  5TMC A;  1WQF A;  2XCQ A;  3WOD A;  1XPP A;  3N0C A;  1BGW A;  3S0X A;  4G0W A;  1USM A;  1SMY A;  1K83 K;  1IL2 A;  5TJ3 A;  1WOO A;  4X6A C;  4LLG A;  5C4J K;  5IYC K;  4J3N A;  4BXX C;  1WCM A;  5IP7 K;  3L4J A;  3G4C A;  1TWF A;  1XXC A;  3LAJ A;  3GEI A;  2B63 K;  4A3F K;  3S16 K;  4BBR C;  3S2D K;  4AYB L;  4BLA A;  1C0A A;  3M3Y K;  3GTO C;  1TWH K;  1TWG C;  2E2J C;  5IOS A;  4GTB A;  4GFQ A;  1I6H C;  1F9N A;  5M5W K;  3A8I A;  1DCP A;  3GEH A;  5C44 C;  3HOY C;  4OIO A;  5M5X K;  3S1N C;  4MEX A;  2NVT K;  3JST A;  4GTD A;  5IOQ A;  4KMH A;  2XCO A;  1PJ5 A;  1SFO K;  2PA8 L;  3HOW K;  2JA5 K;  4YFX A;  2R92 K;  4A3C K;  1O24 A;  4Q5S A;  2V6U A;  2VUM C;  4O2D A;  3L4K A;  4A3K K;  5IYD K;  1Y1W C;  1VH2 A;  3FKI C;  1TWA K;  4YFK A;  4NOI A;  3GTJ A;  5FJ8 K;  3T01 A;  1EFW A;  1JOE A;  3FKI A;  4C3J K;  3H0G C;  1ZXO A;  3N0B A;  1WSR A;  2JA6 C;  4QIW D;  3GTG C;  4A3J C;  1O2A A;  1GE9 A;  2NVQ C;  3S1M C;  3I4M K;  5CHP A;  1WOP A;  4A3D K;  3H0G A;  4A3I K;  2JA6 A;  5TMF A;  2E2H C;  2R7Z C;  1VJE A;  4KB2 A;  3S1Q K;  3S2H C;  1ISE A;  2WB1 D;  1O25 A;  3FOE A;  1J6V A;  2V6T A;  1BS2 A;  1XZP B;  1WCM K;  3RZO K;  4GTA A;  1VRQ C;  1JVI A;  1DD5 A;  1TWF K;  3GTM A;  2JA8 K;  5IP9 K;  1XZP A;  1TWC A;  4A93 C;  5JFE A;  5FLM K;  2NVX A;  2PMZ D;  4BXX K;  2PPB A;  3S14 K;  3HXA A;  1HI9 A;  3HOU K;  3M4O K;  4BBR K;  5M5Y K;  1IQ0 A;  4A3M K;  4A3L K;  2A6H A;  2P8T A;  4BY1 C;  2O5J A;  1O28 A;  5IYB C;  4C3I C;  2WAQ D;  1I6H K;  3CQZ C;  3AH5 A;  2NVY C;  1I3Q A;  4ILD A;  4P5A A;  3IPJ A;  3HOZ C;  4A3E C;  4G0V A;  3AD9 C;  4AH6 A;  1Y1V C;  2GSO A;  2R93 C;  3TFJ A;  3K7A K;  3S1N K;  5C3E K;  1O27 A;  4JK1 A;  2CW0 A;  4KM8 A;  4KB4 A;  4MEY A;  4WIL A;  2CFA B;  3PO3 C;  4KM9 A;  4OIP A;  4LQY A;  1VLO A;  4A3B C;  2D6F C;  3GTJ K;  4Y7N C;  2Y3P A;  5D4D A;  2CFA A;  3ORE A;  2GSU A;  3GTO A;  1TWG A;  4Y52 C;  3A8J A;  3AQP A;  2PHC B;  3FKI K;  4KAT A;  3HKZ D;  1YX2 A;  2BE5 A;  3DXJ A;  4XLN A;  3RZD C;  3I4N C;  3LPX A;  3HOX C;  1O26 A;  1ZVU A;  3FOF A;  4XSX A;  3MML B;  5M3F K;  3GEE A;  4KN7 A;  3H0G K;  4KAW X;  3TFI A;  2JA6 K;  1BJT A;  3GTL C;  5C4J C;  4FZB A;  1AB4 A;  5IP7 C;  2YU9 C;  1IW7 A;  3S1R K;  3AD7 C;  1F7V A;  2B63 C;  4A3F C;  3S16 C;  3GTL A;  3S2D C;  4C3H C;  1WQG A;  2KWA A;  3M3Y C;  2VUM A;  1TWH C;  2YU9 A;  4YG2 A;  2Y0S D;  3S15 K;  4C45 A;  5E68 A;  1F7U A;  1UV7 A;  3GTM K;  3S2H K;  1Y1W A;  1TWC K;  4YFN A;  1EI6 A;  2A69 A;  4GTL A;  4FM9 A;  3S17 C;  4KMU A;  2NVX K;  3BP8 C;  4LK0 A;  4KMA A;  3GTK C;  3T00 A;  4C2M K;  4KAS A;  4BBS K;  1YNN A;  3HOV K;  2ZUE A;  1IS1 A;  1EK8 A;  1XZQ B;  4LJZ A;  3GTG A;  1G51 A;  4XSZ A;  3H3V D;  1B4B A;  3GTK A;  1SFO C;  4A3G K;  1XZQ A;  3HOW C;  4G7H A;  4PAB A;  3Q3Q A;  2R92 C;  1WIH A;  4KMD A;  2E2H A;  1USO A;  2R7Z A;  3GSI A;  4WJ4 A;  1I3Q K;  1I6V A;  4A3K C;  2GAH C;  4C3I K;  4QIW L;  1TWA C;  4G7O A;  5CJ9 A;  1EH1 A;  3A8K A;  3GTP C;  5IOR A;  4X6A K;  4BY7 C;  2E2I C;  2A68 A;  4GTC A;  4C3J C;  3PO2 C;  4GTF A;  3H3V L;  4P9S A;  3GTP A;  3GTO K;  1YCL A;  1I50 C;  1TWG K;  4BKW A;  4ZH4 A;  2WB1 L;  2E2J K;  3PO3 K;  4A3D C;  1V5V A;  4A3B K;  4KDD A;  4KC6 A;  4OIN A; 
#chains in the Genus database with same CATH homology
 3FKI C;  1TWA K;  4YFK A;  3FKI K;  4AYB D;  1R9T C;  4NOI A;  5C44 K;  3S1Q C;  1R9T K;  3HKZ D;  5FJ8 K;  2BE5 A;  3DXJ A;  4XLN A;  4A3E K;  3RZD C;  3HOY K;  3GTQ C;  5M3M K;  3HOZ K;  3S15 C;  3I4N C;  3GTM C;  2PMZ L;  3GTQ K;  1Y1V K;  2R93 K;  3HOX C;  4XLP A;  1TWC C;  4XSX A;  3EQL A;  4C3J K;  3HOX K;  5M3F K;  3H0G C;  1BDF A;  4KN7 A;  2NVX C;  1WCM C;  2A6E A;  2JA6 C;  3H0G K;  4QIW D;  3RZO C;  3GTG C;  1TWF C;  2JA6 K;  4QJV B;  1YNJ A;  4A3J C;  5IP9 C;  4OIR A;  2JA8 C;  3I4M C;  2NVQ C;  3S1M C;  3GTL C;  5C4J C;  3I4M K;  4BBS C;  3GTL K;  3HOV C;  5FLM C;  4A3D K;  4A3I C;  5IP7 C;  2YU9 C;  2VUM K;  4QJV A;  4Y7N K;  4Q4Z A;  4A3I K;  2YU9 K;  3S14 C;  1IW7 A;  5TMF A;  2WAQ L;  2E2H C;  3S1R K;  1HQM A;  2B63 C;  4A3F C;  1Y1W K;  2R7Z C;  4Y52 K;  4A3G C;  1Y1W C;  3S16 C;  2PA8 D;  5C4X C;  3S2D C;  3HOU C;  2JA7 C;  3M4O C;  5C4X K;  3M3Y C;  3S1Q K;  2JA7 K;  1TWH C;  4C3H K;  4A3M C;  4A3L C;  3S2H C;  3RZD K;  4YG2 A;  2Y0S D;  3I4N K;  3S15 K;  2WB1 D;  3S2H K;  3GTM K;  1I3Q C;  1TWC K;  5TMC A;  4YFN A;  3WOD A;  1XPP A;  2A69 A;  3S17 C;  1K83 C;  4KMU A;  2NVX K;  1SMY A;  1WCM K;  4MQ9 A;  3RZO K;  1K83 K;  3S17 K;  3GTG K;  1TWF K;  4LK0 A;  2JA8 K;  4A3J K;  3GTK C;  5IP9 K;  2NVQ K;  5IYC C;  4A93 C;  4C2M K;  4LLG A;  3GTK K;  5C4J K;  3S1M K;  4X6A C;  5IYC K;  4BBS K;  1YNN A;  4BXX C;  3HOV K;  5FLM K;  5IP7 K;  2PMZ D;  4LJZ A;  4BXX K;  2PPB A;  3S14 K;  3K7A C;  4XSZ A;  2E2H K;  5C3E C;  3H3V D;  2B63 K;  2R7Z K;  4A3F K;  1SFO C;  4A3G K;  3S16 K;  4BBR C;  3S2D K;  4AYB L;  3HOU K;  3HOW C;  3M4O K;  4G7H A;  4BBR K;  5M5Y K;  3M3Y K;  2R92 C;  3GTO C;  1TWH K;  3HKZ L;  1TWG C;  2A6H A;  4A3M K;  4A3L K;  2E2J C;  4BY1 C;  3GTJ C;  1I3Q K;  1I6V A;  2O5J A;  1I6H C;  5IYB C;  5M5W K;  4G7Z A;  4KN4 A;  4A3K C;  2WAQ D;  1I6H K;  3CQZ C;  2NVY C;  4C3I K;  4QIW L;  1TWA C;  4G7O A;  5C44 C;  4A93 K;  3GTP C;  4X6A K;  3HOY C;  3HOZ C;  4A3E C;  3GTP K;  4LK1 A;  2E2I C;  4BY7 C;  4OIO A;  2A68 A;  5M5X K;  1Y1V C;  2E2I K;  4MEX A;  2NVT C;  3S1N C;  4BY7 K;  2R93 C;  3K7A K;  3S1N K;  2NVT K;  3PO2 C;  5C3E K;  3PO2 K;  1SFO K;  3H3V L;  2JA5 C;  2PA8 L;  1ZYR A;  4JK1 A;  2O5I A;  4A3C C;  5IYD K;  3HOW K;  4OIQ A;  2CW0 A;  2JA5 K;  4MEY A;  4YFX A;  2R92 K;  4A3C K;  3GTO K;  1I50 C;  1TWG K;  4GZY A;  3PO3 C;  4ZH4 A;  2Y0S L;  4OIP A;  1I50 K;  2WB1 L;  2E2J K;  3PO3 K;  4A3B C;  4BY1 K;  4A3D C;  4Q5S A;  3GTJ K;  2VUM C;  4Y7N C;  4A3B K;  5IYD C;  5D4D A;  5IYB K;  4A3K K;  3S1R C;  4OIN A;  3CQZ K;  4Y52 C;  2NVY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...