4X6AK

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4x6aK00
3M3YK 2Y0SL 4OIQA 1TWFC 4Y52C 4BBSC 4X6AC 4YG2A 2NVTC 3HOUK 4Y7NK 1K83C 4XSZA 4OIRA 3GTKK 4A93C 3HOXC 4QIWL 2JA6K 1TWCK 4A3MC 3M3YC 1WCMK 1I6VA 5FLMC 4YFNA 1SFOK 1I3QC 3H3VD 4A3FC 4A3GC 2NVXK 2NVTK 3PO3K 2A69A 2B63C 2JA7K 3GTQC 2E2IC 3S1QC 2A6HA 2BE5A 2YU9C 4A3CK 2NVQK 2O5IA 3S14C 4OIOA 2JA8K 4ZH4A 2WB1D 3HOWC 3HOZC 4KN4A 4A3JK 2JA7C 3GTQK 5C44K 3S1RC 5M5YK 3HKZL 4NOIA 3GTJC 3H3VL 3HOYK 3S1MC 3S1NC 5M3FK 4LLGA 2NVYK 2E2HC 2PMZD 2JA5C 4A3BC 2R92K 5D4DA 3HOVK 4G7OA 4JK1A 2E2JK 5C4JK 4BXXC 4QIWD 5IYDC 5C4XC 3CQZK 1TWGC 3GTPK 3S17C 2PMZL 4Q4ZA 5C3EK 4A3EC 3PO2C 4X6AK 3H0GK 1IW7A 4XLNA 2NVXC 2A68A 4AYBL 3HOWK 3HKZD 3S2DC 1Y1VC 3S2HC 2A6EA 4A3CC 4A3LC 1R9TC 2R7ZK 3I4MK 2E2JC 5IYCC 5FLMK 3DXJA 3M4OK 5IP9C 4BY1K 5IYBK 1I50C 4A3KK 2B63K 2JA8C 3S15C 4AYBD 2JA6C 2WAQL 3RZDC 2PA8L 3S16K 2YU9K 4Q5SA 4A3FK 1Y1VK 3S2HK 4BBRC 4LJZA 3S1RK 1I6HK 1I3QK 1YNJA 1TWAC 3I4NC 4BY7K 4A3GK 2O5JA 4XSXA 5IYCK 2R93K 2VUMK 5C4XK 4MQ9A 3FKIK 1I50K 4A3IC 4A3KC 4C3IK 5M5WK 1Y1WC 2E2HK 5IP7K 2JA5K 3I4NK 4A3BK 5C3EC 4A3EK 2R92C 3PO2K 4BY7C 4BBSK 3S17K 3K7AC 3GTMC 2PA8D 3GTJK 3HOYC 3GTOK 1K83K 3GTKC 3S1NK 3RZOK 3FKIC 3EQLA 4KN7A 4C2MK 1XPPA 5C44C 1Y1WK 2CW0A 1TWFK 2PPBA 4Y52K 3M4OC 5IP9K 1ZYRA 4BY1C 2R93C 4QJVA 1TWHK 3I4MC 4A3IK 4BXXK 4XLPA 3S2DK 3RZOC 3HOVC 4OINA 1HQMA 3HOUC 4GZYA 1I6HC 3PO3C 3H0GC 4BBRK 5TMCA 2WAQD 3CQZC 5FJ8K 3GTPC 3HOZK 3GTGC 4C3JK 1R9TK 2VUMC 4LK1A 2NVQC 3GTLK 3S14K 1WCMC 2Y0SD 5IYBC 1TWAK 3S15K 4A3DC 4A3LK 4QJVB 5TMFA 2E2IK 2NVYC 1BDFA 1YNNA 4YFKA 1TWCC 4A3MK 2R7ZC 3GTGK 3GTOC 5M5XK 3S1MK 3K7AK 3GTMK 4Y7NC 4MEYA 4G7HA 4A93K 4LK0A 5C4JC 2WB1L 3RZDK 4C3HK 5IP7C 4A3JC 4MEXA 3S16C 4A3DK 4OIPA 4G7ZA 1TWGK 4KMUA 3GTLC 5M3MK 3WODA 3HOXK 5IYDK 1SFOC 4YFXA 1TWHC 3S1QK 1SMYA
chains in the Genus database with same CATH superfamily
1TWFC 4PAAA 1F7VA 2E2HA 4X6AC 3GDZA 1WQHA 4P5BA 4Y7NK 4OIRA 4XSZA 4A93C 1WCMA 1IL2A 1DCPA 1JOEA 1WCMK 3T02A 3NUHA 4G0VA 4LOWA 3PO3K 3GTQC 2BE5A 3QX3A 1J6WA 2YU9C 2GAHC 4ZH4A 2Y3PA 4KN4A 2JA7C 5C44K 3GEHA 3HKZL 3H3VL 3S0XA 5M3FK 2NVYK 3BUEA 2PMZD 5IOTA 3HOVK 4JK1A 1UV7A 3CQZK 1O2AA 2PMZL 4A3EC 3PO2C 2NVXC 4AYBL 3S2HC 3GTJA 5IYCC 1USOA 2KWAA 2B63K 2JA8C 2JA6C 3RZDC 2PA8L 2B63A 3JSTA 4BBRC 3TFJA 4LJZA 1I3QK 4P5AA 1WQFA 4XSXA 5IYCK 2R93K 5C4XK 4MQ9A 1I50K 4A3KC 1Y1WC 1V5VA 5C3EC 3K7AC 3GTMC 3GTJK 1GE9A 3S1NK 3RZOK 3FKIC 1AB4A 3GTOA 4Y52K 2PPBA 2JH3A 3M4OC 4LQYA 5IP9K 4QJVA 5JFEA 3I4MC 4BXXK 4XLPA 3RZOC 2RH6A 1BS2A 4KB2A 4GTDA 2CFAA 2XCOA 5TMCA 4KMDA 4WJ4A 1I50A 3GTGC 4C3JK 3AQOA 3GTKA 3GIRA 4KMAA 2E2IA 2Y0SD 3S15K 5TMFA 1B4AA 3GTOC 4GTLA 3AD9C 3RZDK 5IP7C 4A3JC 2FQTA 4OIPA 1JVIA 1IBAA 1SFOC 4YFXA 1O25A 1TWHC 1XZPB 3M3YK 3N0BA 1BJTA 4OIQA 1F7UA 2NVTC 4KMHA 3L4KA 3HOXC 4G0WA 2CFAB 5E68A 1WOOA 5L46A 1XXAA 1Y1VA 1VH2A 1VJEA 4A3FC 4A3GC 1F93A 1XZQB 2A69A 2JA7K 3FOEA 2A6HA 3G4AA 2NVQK 2O5IA 1USMA 1WOPA 3HOWC 4PABA 3GTQK 5M5YK 2JA6A 3S1NC 1B4BA 2JA5C 4A3BC 3TFIA 5D4DA 4AH6A 5C4XC 3LAPA 2V6TA 4Q4ZA 4X6AK 1IW7A 3IPJA 4KATA 5EGHA 2A68A 3HOWK 3OPFA 1J6XA 2A6EA 3GTQA 1ZXOA 3DXJA 5FLMK 5TJ3A 4BY1K 3S15C 3M4OK 4Q5SA 1DCOA 1VGXA 4A3FK 3S2HK 1DD5A 1J98A 2GSOA 1I6HK 1IQ0A 4RMFA 4BY7K 4O2DA 1BGWA 4A3GK 4GTAA 1EI6A 1F9NA 5CHPA 3FKIK 5M5WK 2W7VA 2VUMA 2E2HK 3GTLA 4BY7C 3HOYC 2FQOA 3BP3A 4KB4A 3AD8C 1XPPA 4KAWX 2CW0A 1X31C 4BY1C 2NVYA 1EK8A 1TWHK 3N0CA 3FOFA 1WIHA 3OREA 4FZBA 1HI9A 1O26A 4WJ3M 3CQZC 3AD7C 3HOZK 1DCHA 4GTEA 2VUMC 3S14K 3GTLK 4A3DC 4A3LK 4QJVB 2NVYC 1BDFA 4YFKA 1TWAA 3GTGK 1Y1WA 3SZZA 4Y7NC 4MEYA 4A93K 3S16C 2WB1L 4MEXA 3TFHA 1I3QA 4XCHA 3HOXK 2R93A 2GSUA 4Y52C 3TTGA 3HOUK 2XCRB 5HL8A 3LPXA 4A3MC 3M3YC 5FLMC 2ZUEA 1SFOK 1I3QC 3ERED 3H3VD 5IOQA 1O2BA 2NVTK 1TWGA 3GEEA 2B63C 5EGEA 2E2IC 1WSRA 2V6SA 4OIOA 2JA8K 1L0WA 4A3JK 1K83A 3AQPA 3S1RC 4NOIA 1WOSA 3HOYK 3VA7A 4DDQA 2R92A 4KASA 2E2HC 1SFOA 2R92K 2E2JK 4C3IC 5C4JK 4BXXC 1INNA 3GSIA 1TWGC 5C3EK 4G0UA 3HKZD 1KQ4A 4KARA 4A3LC 3T01A 1R9TC 3I4MK 5IP9C 4KM8A 4LR2A 1I50C 4A3KK 3GTGA 5IOSA 2WAQL 2YU9K 1Y1VK 3CAGA 1YNJA 2P5MA 2XCQA 4C3JC 2JA7A 3CQZA 1EQRA 4A3IC 3HXAA 2JA5K 5IP7K 3I4NK 4A3BK 4A3EK 3PO2K 2PA8D 3GTOK 4GTFA 1TWFA 1XXBA 4KN7A 3EQLA 3T00A 4C2MK 1TWFK 1ZYRA 4M1XA 3LAJA 3S2DK 3A8KA 1WORA 2NVXA 3HOVC 2D6FC 4OINA 1HQMA 1IE0A 4ILDA 3AH5A 3G4CA 4GZYA 1I6HC 1O27A 3GEIA 2WAQD 1RU0A 5FJ8K 3GTPC 4LK1A 2GSNA 4WILA 5IYBC 4GTCA 3L4JA 2E2IK 2R7ZC 1PJ6A 1EH1A 1TWCC 1JQWA 5M5XK 2YU9A 3K7AK 3GTMK 4G7HA 2EBBA 4C3HK 3GTMA 3A8JA 5M3MK 1ZBSA 5IYDK 2P8TA 1C0AA 3S1QK 1SMYA 2Y0SL 4BBSC 3A8IA 2JA5A 4YG2A 1K83C 3GTKK 1TWCA 1ZQ1C 4QIWL 1O29A 4KDDA 2JA6K 1TWCK 1I6VA 4BLBA 4YFNA 3V4GA 4GT9A 3MMLB 2NVXK 1PJ7A 1YCLA 3S1QC 2GAGC 3N3YA 4A3CK 3S14C 1WQGA 2WB1D 3HOZC 4C3HC 1YX2A 1XZPA 3GTJC 3S1MC 1VRQC 2V6UA 4LLGA 4C45A 4G7OA 4KM9A 4QIWD 5IYDC 2ZFZA 3GTPK 3S17C 3FKIA 3OEPA 1O28A 3H0GK 4XLNA 1XXCA 1XZQA 3S2DC 1O2FB 1Y1VC 4A3CC 2R7ZK 2E2JC 2RGRA 5IYBK 4AYBD 3S16K 3SZYA 4J3NA 5IORA 5CJ9A 3S1RK 1TWAC 3I4NC 4BLAA 3BP8C 2O5JA 3GTPA 2VUMK 4C2MC 1O24A 3Q3QA 4C3IK 1R9TA 1WSVA 3ADAC 4GFQA 2R92C 4BBSK 3S17K 5JVOA 1K83K 3GTKC 1VLOA 2R7ZA 5C44C 1Y1WK 1TWHA 2R93C 3FHZA 2PHCB 4A3IK 1G51A 3HOUC 4GTBA 3PO3C 3H0GC 4BBRK 1R9TK 4P9SA 2NVQC 1WCMC 1TWAK 1YNNA 4A3MK 3S1MK 4LK0A 5C4JC 1ISEA 1J6VA 4A3DK 2ZUFA 4G7ZA 1TWGK 4KMUA 3GTLC 1ZVUA 3WODA 1PJ5A 4BKWA 1IS1A 1EFWA 3H0GA 4FM9A 4KC6A
chains in the Genus database with same CATH topology
3M3YK 2Y0SL 4OIQA 1TWFC 4Y52C 4BBSC 4X6AC 4YG2A 2NVTC 3HOUK 4Y7NK 1K83C 4XSZA 4OIRA 3GTKK 4A93C 3HOXC 4QIWL 2JA6K 1TWCK 4A3MC 3M3YC 1WCMK 1I6VA 5FLMC 4YFNA 1SFOK 1I3QC 3H3VD 4A3FC 4A3GC 2NVXK 2NVTK 3PO3K 2A69A 2B63C 2JA7K 3GTQC 2E2IC 3S1QC 2A6HA 2BE5A 2YU9C 4A3CK 2NVQK 2O5IA 3S14C 4OIOA 2JA8K 4ZH4A 2WB1D 3HOWC 3HOZC 4KN4A 4A3JK 2JA7C 3GTQK 5C44K 3S1RC 5M5YK 3HKZL 4NOIA 3GTJC 3H3VL 3HOYK 3S1MC 3S1NC 5M3FK 4LLGA 2NVYK 2E2HC 2PMZD 2JA5C 4A3BC 2R92K 5D4DA 3HOVK 4G7OA 4JK1A 2E2JK 5C4JK 4BXXC 4QIWD 5IYDC 5C4XC 3CQZK 1TWGC 3GTPK 3S17C 2PMZL 4Q4ZA 5C3EK 4A3EC 3PO2C 4X6AK 3H0GK 1IW7A 4XLNA 2NVXC 2A68A 4AYBL 3HOWK 3HKZD 3S2DC 1Y1VC 3S2HC 2A6EA 4A3CC 4A3LC 1R9TC 2R7ZK 3I4MK 2E2JC 5IYCC 5FLMK 3DXJA 3M4OK 5IP9C 4BY1K 5IYBK 1I50C 4A3KK 2B63K 2JA8C 3S15C 4AYBD 2JA6C 2WAQL 3RZDC 2PA8L 3S16K 2YU9K 4Q5SA 4A3FK 1Y1VK 3S2HK 4BBRC 4LJZA 3S1RK 1I6HK 1I3QK 1YNJA 1TWAC 3I4NC 4BY7K 4A3GK 2O5JA 4XSXA 5IYCK 2R93K 2VUMK 5C4XK 4MQ9A 3FKIK 1I50K 4A3IC 4A3KC 4C3IK 5M5WK 1Y1WC 2E2HK 5IP7K 2JA5K 3I4NK 4A3BK 5C3EC 4A3EK 2R92C 3PO2K 4BY7C 4BBSK 3S17K 3K7AC 3GTMC 2PA8D 3GTJK 3HOYC 3GTOK 1K83K 3GTKC 3S1NK 3RZOK 3FKIC 3EQLA 4KN7A 4C2MK 1XPPA 5C44C 1Y1WK 2CW0A 1TWFK 2PPBA 4Y52K 3M4OC 5IP9K 1ZYRA 4BY1C 2R93C 4QJVA 1TWHK 3I4MC 4A3IK 4BXXK 4XLPA 3S2DK 3RZOC 3HOVC 4OINA 1HQMA 3HOUC 4GZYA 1I6HC 3PO3C 3H0GC 4BBRK 5TMCA 2WAQD 3CQZC 5FJ8K 3GTPC 3HOZK 3GTGC 4C3JK 1R9TK 2VUMC 4LK1A 2NVQC 3GTLK 3S14K 1WCMC 2Y0SD 5IYBC 1TWAK 3S15K 4A3DC 4A3LK 4QJVB 5TMFA 2E2IK 2NVYC 1BDFA 1YNNA 4YFKA 1TWCC 4A3MK 2R7ZC 3GTGK 3GTOC 5M5XK 3S1MK 3K7AK 3GTMK 4Y7NC 4MEYA 4G7HA 4A93K 4LK0A 5C4JC 2WB1L 3RZDK 4C3HK 5IP7C 4A3JC 4MEXA 3S16C 4A3DK 4OIPA 4G7ZA 1TWGK 4KMUA 3GTLC 5M3MK 3WODA 3HOXK 5IYDK 1SFOC 4YFXA 1TWHC 3S1QK 1SMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y K;  2Y0S L;  4OIQ A;  1TWF C;  4Y52 C;  4BBS C;  4X6A C;  4YG2 A;  2NVT C;  3HOU K;  4Y7N K;  1K83 C;  4XSZ A;  4OIR A;  3GTK K;  4A93 C;  3HOX C;  4QIW L;  2JA6 K;  1TWC K;  4A3M C;  3M3Y C;  1WCM K;  1I6V A;  5FLM C;  4YFN A;  1SFO K;  1I3Q C;  3H3V D;  4A3F C;  4A3G C;  2NVX K;  2NVT K;  3PO3 K;  2A69 A;  2B63 C;  2JA7 K;  3GTQ C;  2E2I C;  3S1Q C;  2A6H A;  2BE5 A;  2YU9 C;  4A3C K;  2NVQ K;  2O5I A;  3S14 C;  4OIO A;  2JA8 K;  4ZH4 A;  2WB1 D;  3HOW C;  3HOZ C;  4KN4 A;  4A3J K;  2JA7 C;  3GTQ K;  5C44 K;  3S1R C;  5M5Y K;  3HKZ L;  4NOI A;  3GTJ C;  3H3V L;  3HOY K;  3S1M C;  3S1N C;  5M3F K;  4LLG A;  2NVY K;  2E2H C;  2PMZ D;  2JA5 C;  4A3B C;  2R92 K;  5D4D A;  3HOV K;  4G7O A;  4JK1 A;  2E2J K;  5C4J K;  4BXX C;  4QIW D;  5IYD C;  5C4X C;  3CQZ K;  1TWG C;  3GTP K;  3S17 C;  2PMZ L;  4Q4Z A;  5C3E K;  4A3E C;  3PO2 C;  4X6A K;  3H0G K;  1IW7 A;  4XLN A;  2NVX C;  2A68 A;  4AYB L;  3HOW K;  3HKZ D;  3S2D C;  1Y1V C;  3S2H C;  2A6E A;  4A3C C;  4A3L C;  1R9T C;  2R7Z K;  3I4M K;  2E2J C;  5IYC C;  5FLM K;  3DXJ A;  3M4O K;  5IP9 C;  4BY1 K;  5IYB K;  1I50 C;  4A3K K;  2B63 K;  2JA8 C;  3S15 C;  4AYB D;  2JA6 C;  2WAQ L;  3RZD C;  2PA8 L;  3S16 K;  2YU9 K;  4Q5S A;  4A3F K;  1Y1V K;  3S2H K;  4BBR C;  4LJZ A;  3S1R K;  1I6H K;  1I3Q K;  1YNJ A;  1TWA C;  3I4N C;  4BY7 K;  4A3G K;  2O5J A;  4XSX A;  5IYC K;  2R93 K;  2VUM K;  5C4X K;  4MQ9 A;  3FKI K;  1I50 K;  4A3I C;  4A3K C;  4C3I K;  5M5W K;  1Y1W C;  2E2H K;  5IP7 K;  2JA5 K;  3I4N K;  4A3B K;  5C3E C;  4A3E K;  2R92 C;  3PO2 K;  4BY7 C;  4BBS K;  3S17 K;  3K7A C;  3GTM C;  2PA8 D;  3GTJ K;  3HOY C;  3GTO K;  1K83 K;  3GTK C;  3S1N K;  3RZO K;  3FKI C;  3EQL A;  4KN7 A;  4C2M K;  1XPP A;  5C44 C;  1Y1W K;  2CW0 A;  1TWF K;  2PPB A;  4Y52 K;  3M4O C;  5IP9 K;  1ZYR A;  4BY1 C;  2R93 C;  4QJV A;  1TWH K;  3I4M C;  4A3I K;  4BXX K;  4XLP A;  3S2D K;  3RZO C;  3HOV C;  4OIN A;  1HQM A;  3HOU C;  4GZY A;  1I6H C;  3PO3 C;  3H0G C;  4BBR K;  5TMC A;  2WAQ D;  3CQZ C;  5FJ8 K;  3GTP C;  3HOZ K;  3GTG C;  4C3J K;  1R9T K;  2VUM C;  4LK1 A;  2NVQ C;  3GTL K;  3S14 K;  1WCM C;  2Y0S D;  5IYB C;  1TWA K;  3S15 K;  4A3D C;  4A3L K;  4QJV B;  5TMF A;  2E2I K;  2NVY C;  1BDF A;  1YNN A;  4YFK A;  1TWC C;  4A3M K;  2R7Z C;  3GTG K;  3GTO C;  5M5X K;  3S1M K;  3K7A K;  3GTM K;  4Y7N C;  4MEY A;  4G7H A;  4A93 K;  4LK0 A;  5C4J C;  2WB1 L;  3RZD K;  4C3H K;  5IP7 C;  4A3J C;  4MEX A;  3S16 C;  4A3D K;  4OIP A;  4G7Z A;  1TWG K;  4KMU A;  3GTL C;  5M3M K;  3WOD A;  3HOX K;  5IYD K;  1SFO C;  4YFX A;  1TWH C;  3S1Q K;  1SMY A; 
#chains in the Genus database with same CATH topology
 1TWF C;  4PAA A;  1F7V A;  2E2H A;  4X6A C;  3GDZ A;  1WQH A;  4P5B A;  4Y7N K;  4OIR A;  4XSZ A;  4A93 C;  1WCM A;  1IL2 A;  1DCP A;  1JOE A;  1WCM K;  3T02 A;  3NUH A;  4G0V A;  4LOW A;  3PO3 K;  3GTQ C;  2BE5 A;  3QX3 A;  1J6W A;  2YU9 C;  2GAH C;  4ZH4 A;  2Y3P A;  4KN4 A;  2JA7 C;  5C44 K;  3GEH A;  3HKZ L;  3H3V L;  3S0X A;  5M3F K;  2NVY K;  3BUE A;  2PMZ D;  5IOT A;  3HOV K;  4JK1 A;  1UV7 A;  3CQZ K;  1O2A A;  2PMZ L;  4A3E C;  3PO2 C;  2NVX C;  4AYB L;  3S2H C;  3GTJ A;  5IYC C;  1USO A;  2KWA A;  2B63 K;  2JA8 C;  2JA6 C;  3RZD C;  2PA8 L;  2B63 A;  3JST A;  4BBR C;  3TFJ A;  4LJZ A;  1I3Q K;  4P5A A;  1WQF A;  4XSX A;  5IYC K;  2R93 K;  5C4X K;  4MQ9 A;  1I50 K;  4A3K C;  1Y1W C;  1V5V A;  5C3E C;  3K7A C;  3GTM C;  3GTJ K;  1GE9 A;  3S1N K;  3RZO K;  3FKI C;  1AB4 A;  3GTO A;  4Y52 K;  2PPB A;  2JH3 A;  3M4O C;  4LQY A;  5IP9 K;  4QJV A;  5JFE A;  3I4M C;  4BXX K;  4XLP A;  3RZO C;  2RH6 A;  1BS2 A;  4KB2 A;  4GTD A;  2CFA A;  2XCO A;  5TMC A;  4KMD A;  4WJ4 A;  1I50 A;  3GTG C;  4C3J K;  3AQO A;  3GTK A;  3GIR A;  4KMA A;  2E2I A;  2Y0S D;  3S15 K;  5TMF A;  1B4A A;  3GTO C;  4GTL A;  3AD9 C;  3RZD K;  5IP7 C;  4A3J C;  2FQT A;  4OIP A;  1JVI A;  1IBA A;  1SFO C;  4YFX A;  1O25 A;  1TWH C;  1XZP B;  3M3Y K;  3N0B A;  1BJT A;  4OIQ A;  1F7U A;  2NVT C;  4KMH A;  3L4K A;  3HOX C;  4G0W A;  2CFA B;  5E68 A;  1WOO A;  5L46 A;  1XXA A;  1Y1V A;  1VH2 A;  1VJE A;  4A3F C;  4A3G C;  1F93 A;  1XZQ B;  2A69 A;  2JA7 K;  3FOE A;  2A6H A;  3G4A A;  2NVQ K;  2O5I A;  1USM A;  1WOP A;  3HOW C;  4PAB A;  3GTQ K;  5M5Y K;  2JA6 A;  3S1N C;  1B4B A;  2JA5 C;  4A3B C;  3TFI A;  5D4D A;  4AH6 A;  5C4X C;  3LAP A;  2V6T A;  4Q4Z A;  4X6A K;  1IW7 A;  3IPJ A;  4KAT A;  5EGH A;  2A68 A;  3HOW K;  3OPF A;  1J6X A;  2A6E A;  3GTQ A;  1ZXO A;  3DXJ A;  5FLM K;  5TJ3 A;  4BY1 K;  3S15 C;  3M4O K;  4Q5S A;  1DCO A;  1VGX A;  4A3F K;  3S2H K;  1DD5 A;  1J98 A;  2GSO A;  1I6H K;  1IQ0 A;  4RMF A;  4BY7 K;  4O2D A;  1BGW A;  4A3G K;  4GTA A;  1EI6 A;  1F9N A;  5CHP A;  3FKI K;  5M5W K;  2W7V A;  2VUM A;  2E2H K;  3GTL A;  4BY7 C;  3HOY C;  2FQO A;  3BP3 A;  4KB4 A;  3AD8 C;  1XPP A;  4KAW X;  2CW0 A;  1X31 C;  4BY1 C;  2NVY A;  1EK8 A;  1TWH K;  3N0C A;  3FOF A;  1WIH A;  3ORE A;  4FZB A;  1HI9 A;  1O26 A;  4WJ3 M;  3CQZ C;  3AD7 C;  3HOZ K;  1DCH A;  4GTE A;  2VUM C;  3S14 K;  3GTL K;  4A3D C;  4A3L K;  4QJV B;  2NVY C;  1BDF A;  4YFK A;  1TWA A;  3GTG K;  1Y1W A;  3SZZ A;  4Y7N C;  4MEY A;  4A93 K;  3S16 C;  2WB1 L;  4MEX A;  3TFH A;  1I3Q A;  4XCH A;  3HOX K;  2R93 A;  2GSU A;  4Y52 C;  3TTG A;  3HOU K;  2XCR B;  5HL8 A;  3LPX A;  4A3M C;  3M3Y C;  5FLM C;  2ZUE A;  1SFO K;  1I3Q C;  3ERE D;  3H3V D;  5IOQ A;  1O2B A;  2NVT K;  1TWG A;  3GEE A;  2B63 C;  5EGE A;  2E2I C;  1WSR A;  2V6S A;  4OIO A;  2JA8 K;  1L0W A;  4A3J K;  1K83 A;  3AQP A;  3S1R C;  4NOI A;  1WOS A;  3HOY K;  3VA7 A;  4DDQ A;  2R92 A;  4KAS A;  2E2H C;  1SFO A;  2R92 K;  2E2J K;  4C3I C;  5C4J K;  4BXX C;  1INN A;  3GSI A;  1TWG C;  5C3E K;  4G0U A;  3HKZ D;  1KQ4 A;  4KAR A;  4A3L C;  3T01 A;  1R9T C;  3I4M K;  5IP9 C;  4KM8 A;  4LR2 A;  1I50 C;  4A3K K;  3GTG A;  5IOS A;  2WAQ L;  2YU9 K;  1Y1V K;  3CAG A;  1YNJ A;  2P5M A;  2XCQ A;  4C3J C;  2JA7 A;  3CQZ A;  1EQR A;  4A3I C;  3HXA A;  2JA5 K;  5IP7 K;  3I4N K;  4A3B K;  4A3E K;  3PO2 K;  2PA8 D;  3GTO K;  4GTF A;  1TWF A;  1XXB A;  4KN7 A;  3EQL A;  3T00 A;  4C2M K;  1TWF K;  1ZYR A;  4M1X A;  3LAJ A;  3S2D K;  3A8K A;  1WOR A;  2NVX A;  3HOV C;  2D6F C;  4OIN A;  1HQM A;  1IE0 A;  4ILD A;  3AH5 A;  3G4C A;  4GZY A;  1I6H C;  1O27 A;  3GEI A;  2WAQ D;  1RU0 A;  5FJ8 K;  3GTP C;  4LK1 A;  2GSN A;  4WIL A;  5IYB C;  4GTC A;  3L4J A;  2E2I K;  2R7Z C;  1PJ6 A;  1EH1 A;  1TWC C;  1JQW A;  5M5X K;  2YU9 A;  3K7A K;  3GTM K;  4G7H A;  2EBB A;  4C3H K;  3GTM A;  3A8J A;  5M3M K;  1ZBS A;  5IYD K;  2P8T A;  1C0A A;  3S1Q K;  1SMY A;  2Y0S L;  4BBS C;  3A8I A;  2JA5 A;  4YG2 A;  1K83 C;  3GTK K;  1TWC A;  1ZQ1 C;  4QIW L;  1O29 A;  4KDD A;  2JA6 K;  1TWC K;  1I6V A;  4BLB A;  4YFN A;  3V4G A;  4GT9 A;  3MML B;  2NVX K;  1PJ7 A;  1YCL A;  3S1Q C;  2GAG C;  3N3Y A;  4A3C K;  3S14 C;  1WQG A;  2WB1 D;  3HOZ C;  4C3H C;  1YX2 A;  1XZP A;  3GTJ C;  3S1M C;  1VRQ C;  2V6U A;  4LLG A;  4C45 A;  4G7O A;  4KM9 A;  4QIW D;  5IYD C;  2ZFZ A;  3GTP K;  3S17 C;  3FKI A;  3OEP A;  1O28 A;  3H0G K;  4XLN A;  1XXC A;  1XZQ A;  3S2D C;  1O2F B;  1Y1V C;  4A3C C;  2R7Z K;  2E2J C;  2RGR A;  5IYB K;  4AYB D;  3S16 K;  3SZY A;  4J3N A;  5IOR A;  5CJ9 A;  3S1R K;  1TWA C;  3I4N C;  4BLA A;  3BP8 C;  2O5J A;  3GTP A;  2VUM K;  4C2M C;  1O24 A;  3Q3Q A;  4C3I K;  1R9T A;  1WSV A;  3ADA C;  4GFQ A;  2R92 C;  4BBS K;  3S17 K;  5JVO A;  1K83 K;  3GTK C;  1VLO A;  2R7Z A;  5C44 C;  1Y1W K;  1TWH A;  2R93 C;  3FHZ A;  2PHC B;  4A3I K;  1G51 A;  3HOU C;  4GTB A;  3PO3 C;  3H0G C;  4BBR K;  1R9T K;  4P9S A;  2NVQ C;  1WCM C;  1TWA K;  1YNN A;  4A3M K;  3S1M K;  4LK0 A;  5C4J C;  1ISE A;  1J6V A;  4A3D K;  2ZUF A;  4G7Z A;  1TWG K;  4KMU A;  3GTL C;  1ZVU A;  3WOD A;  1PJ5 A;  4BKW A;  1IS1 A;  1EFW A;  3H0G A;  4FM9 A;  4KC6 A; 
#chains in the Genus database with same CATH homology
 3M3Y K;  2Y0S L;  4OIQ A;  1TWF C;  4Y52 C;  4BBS C;  4X6A C;  4YG2 A;  2NVT C;  3HOU K;  4Y7N K;  1K83 C;  4XSZ A;  4OIR A;  3GTK K;  4A93 C;  3HOX C;  4QIW L;  2JA6 K;  1TWC K;  4A3M C;  3M3Y C;  1WCM K;  1I6V A;  5FLM C;  4YFN A;  1SFO K;  1I3Q C;  3H3V D;  4A3F C;  4A3G C;  2NVX K;  2NVT K;  3PO3 K;  2A69 A;  2B63 C;  2JA7 K;  3GTQ C;  2E2I C;  3S1Q C;  2A6H A;  2BE5 A;  2YU9 C;  4A3C K;  2NVQ K;  2O5I A;  3S14 C;  4OIO A;  2JA8 K;  4ZH4 A;  2WB1 D;  3HOW C;  3HOZ C;  4KN4 A;  4A3J K;  2JA7 C;  3GTQ K;  5C44 K;  3S1R C;  5M5Y K;  3HKZ L;  4NOI A;  3GTJ C;  3H3V L;  3HOY K;  3S1M C;  3S1N C;  5M3F K;  4LLG A;  2NVY K;  2E2H C;  2PMZ D;  2JA5 C;  4A3B C;  2R92 K;  5D4D A;  3HOV K;  4G7O A;  4JK1 A;  2E2J K;  5C4J K;  4BXX C;  4QIW D;  5IYD C;  5C4X C;  3CQZ K;  1TWG C;  3GTP K;  3S17 C;  2PMZ L;  4Q4Z A;  5C3E K;  4A3E C;  3PO2 C;  4X6A K;  3H0G K;  1IW7 A;  4XLN A;  2NVX C;  2A68 A;  4AYB L;  3HOW K;  3HKZ D;  3S2D C;  1Y1V C;  3S2H C;  2A6E A;  4A3C C;  4A3L C;  1R9T C;  2R7Z K;  3I4M K;  2E2J C;  5IYC C;  5FLM K;  3DXJ A;  3M4O K;  5IP9 C;  4BY1 K;  5IYB K;  1I50 C;  4A3K K;  2B63 K;  2JA8 C;  3S15 C;  4AYB D;  2JA6 C;  2WAQ L;  3RZD C;  2PA8 L;  3S16 K;  2YU9 K;  4Q5S A;  4A3F K;  1Y1V K;  3S2H K;  4BBR C;  4LJZ A;  3S1R K;  1I6H K;  1I3Q K;  1YNJ A;  1TWA C;  3I4N C;  4BY7 K;  4A3G K;  2O5J A;  4XSX A;  5IYC K;  2R93 K;  2VUM K;  5C4X K;  4MQ9 A;  3FKI K;  1I50 K;  4A3I C;  4A3K C;  4C3I K;  5M5W K;  1Y1W C;  2E2H K;  5IP7 K;  2JA5 K;  3I4N K;  4A3B K;  5C3E C;  4A3E K;  2R92 C;  3PO2 K;  4BY7 C;  4BBS K;  3S17 K;  3K7A C;  3GTM C;  2PA8 D;  3GTJ K;  3HOY C;  3GTO K;  1K83 K;  3GTK C;  3S1N K;  3RZO K;  3FKI C;  3EQL A;  4KN7 A;  4C2M K;  1XPP A;  5C44 C;  1Y1W K;  2CW0 A;  1TWF K;  2PPB A;  4Y52 K;  3M4O C;  5IP9 K;  1ZYR A;  4BY1 C;  2R93 C;  4QJV A;  1TWH K;  3I4M C;  4A3I K;  4BXX K;  4XLP A;  3S2D K;  3RZO C;  3HOV C;  4OIN A;  1HQM A;  3HOU C;  4GZY A;  1I6H C;  3PO3 C;  3H0G C;  4BBR K;  5TMC A;  2WAQ D;  3CQZ C;  5FJ8 K;  3GTP C;  3HOZ K;  3GTG C;  4C3J K;  1R9T K;  2VUM C;  4LK1 A;  2NVQ C;  3GTL K;  3S14 K;  1WCM C;  2Y0S D;  5IYB C;  1TWA K;  3S15 K;  4A3D C;  4A3L K;  4QJV B;  5TMF A;  2E2I K;  2NVY C;  1BDF A;  1YNN A;  4YFK A;  1TWC C;  4A3M K;  2R7Z C;  3GTG K;  3GTO C;  5M5X K;  3S1M K;  3K7A K;  3GTM K;  4Y7N C;  4MEY A;  4G7H A;  4A93 K;  4LK0 A;  5C4J C;  2WB1 L;  3RZD K;  4C3H K;  5IP7 C;  4A3J C;  4MEX A;  3S16 C;  4A3D K;  4OIP A;  4G7Z A;  1TWG K;  4KMU A;  3GTL C;  5M3M K;  3WOD A;  3HOX K;  5IYD K;  1SFO C;  4YFX A;  1TWH C;  3S1Q K;  1SMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...