5IOSA

Flavin-dependent thymidylate synthase r90a variant in complex with fad and deoxyuridine monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
214
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGAYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 77
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iosA00
4KARA 4P5BA 1O25A 1O24A 2CFAA 1O26A 1KQ4A 5IOSA 1O29A 1O28A 2CFAB 4GTBA 4GTCA 1O27A 4GTAA 3G4AA 3G4CA 1O2BA 4GTDA 4P5AA 4FZBA 1O2AA 4GTFA 4GTLA 5IOTA 5CHPA 5IOQA 3N0BA 3AH5A 4KASA 4KATA 5JFEA 5IORA 3N0CA 4GTEA 4GT9A 3N3YA
chains in the Genus database with same CATH superfamily
4OIRA 2R92C 4KARA 1B4AA 2Y0SL 4YFKA 4AH6A 1TWCC 1EH1A 3GTPC 4G7ZA 2R93K 1WOOA 3HXAA 4A3FK 2B63C 4A3DK 4XSXA 4AYBD 4C3IC 3GTKA 2R93C 2Y0SD 5CHPA 1F7VA 5IYCK 3Q3QA 2JA8C 1F9NA 4C3IK 1YNJA 3CQZK 3GEEA 4BKWA 2CFAA 1WSVA 5C3EK 1TWGA 4KM9A 3ADAC 1PJ5A 3SZZA 4XLPA 4G0WA 5E68A 1TWFC 3HKZL 4A3JK 5IP7C 2RGRA 3S1RC 3GTQK 1RU0A 3GTLC 4A93K 1WIHA 2BE5A 2NVYC 5TMFA 2W7VA 2NVQC 4KMHA 1I3QC 4LR2A 2VUMA 4A3JC 5FJ8K 5D4DA 3IPJA 4KMAA 3S2DC 3GTJC 3M3YC 3CAGA 2GAGC 3GTKC 3T01A 1DCHA 5FLMC 2A68A 5IP7K 4OIQA 3S14K 3GTMK 4P5AA 1J6VA 1YX2A 2E2JK 4Y7NK 1Y1VC 1TWHK 1BJTA 5FLMK 1K83C 2NVXK 1JOEA 3S1QC 1WCMK 1BGWA 2R7ZK 1Y1VK 4XSZA 1SFOA 1O26A 1WQHA 4A3GC 1O29A 2NVXC 3S1MC 1TWAA 4A3CK 3S17K 3QX3A 2P8TA 4KN7A 4GTFA 5IOTA 3PO2K 4G0VA 2FQTA 4KATA 3AQPA 1I6VA 4X6AK 1XPPA 1EFWA 1I50K 3PO2C 4A3EK 3H0GC 5IP9C 1EK8A 3GTOA 3GTLA 3S1NC 3S17C 2E2IC 1F7UA 4QJVB 3GTOC 1R9TC 2GSNA 4LQYA 4A3EC 1TWHC 4GFQA 1XXCA 1O2BA 1K83A 1USMA 4BLBA 5TJ3A 2E2IK 4BXXC 3H0GK 1VJEA 4MQ9A 2KWAA 3S15C 4KAWX 2WB1L 1TWAC 1PJ6A 1I6HK 3OPFA 3CQZC 1TWCK 5HL8A 1UV7A 2JA7A 2PPBA 2ZUFA 3GTPK 3FKIA 1I50C 4KB2A 4OINA 3BP8C 3RZDK 5JFEA 3N0BA 2YU9A 1WQGA 2E2HA 1ISEA 1I3QA 1AB4A 2WB1D 5IYBC 3PO3C 2FQOA 4J3NA 1R9TA 4YG2A 1Y1WA 1G51A 4KC6A 2NVYK 3OREA 1J6WA 3L4KA 5M5XK 4FM9A 1J98A 4A3MC 3RZDC 3GTMA 1JQWA 3G4CA 4BY7C 1IE0A 1TWGC 3TFIA 1PJ7A 3M3YK 4A3KK 1TWHA 1VLOA 2R92K 3AH5A 1F93A 3S16C 4A3MK 3JSTA 1TWFK 4BBSC 3GTJA 4KN4A 2JA5A 1IBAA 1DCOA 3S16K 4C3HC 1WSRA 1XXBA 3HOXC 3HOWK 2B63A 1YNNA 1O28A 5IP9K 4BLAA 4A3KC 4PABA 4GTCA 2VUMK 3G4AA 2JA6A 1SMYA 4GTDA 5IYCC 2ZUEA 3I4MK 4AYBL 2A6HA 3N0CA 2PMZD 4GTEA 2R93A 4Q4ZA 1I50A 1XZQA 5C3EC 2E2JC 4Y7NC 4A3LC 1USOA 3S14C 1O24A 5C44K 5C4JC 1TWGK 3GTMC 4C45A 2D6FC 1VGXA 3S15K 3GTGC 1XZQB 3OEPA 4MEYA 2R7ZC 4C2MC 3LAPA 2GAHC 1Y1WC 5JVOA 2E2IA 3CQZA 2XCQA 4GTLA 1XZPB 2NVQK 3S0XA 1INNA 4WJ3M 5IORA 3WODA 4LJZA 5TMCA 3HOXK 3HOWC 1HI9A 4KB4A 3LAJA 3T00A 3TFJA 3GTKK 4BXXK 4MEXA 3TFHA 2GSOA 3DXJA 1V5VA 3BP3A 3I4MC 2JH3A 3VA7A 3GDZA 3K7AK 4LK0A 2E2HC 4FZBA 4BBRC 4RMFA 5M5YK 5M3FK 2JA7C 3NUHA 3EQLA 1ZYRA 3A8IA 4A3GK 3AD9C 3GTGA 1ZQ1C 2P5MA 1Y1VA 1SFOK 4P5BA 1DD5A 4QIWD 4BBSK 2PA8L 4KM8A 5EGHA 4NOIA 4A3BC 5IYBK 3PO3K 1WQFA 4GTBA 5IYDC 3S2HC 3FOFA 1IQ0A 4C3JC 1IS1A 3FOEA 1ZXOA 1O2AA 4A3BK 2R7ZA 3LPXA 3V4GA 3GIRA 4DDQA 3A8KA 1WOPA 4LLGA 3RZOC 4C3JK 5C4XC 4LK1A 4ZH4A 4KMDA 1TWCA 3FKIC 1EI6A 2EBBA 3GTOK 1HQMA 3L4JA 1O25A 4ILDA 3HOUK 1VH2A 2B63K 2JA8K 3HKZD 2CFAB 4G0UA 3M4OK 1DCPA 4C3HK 4Q5SA 3HOUC 1GE9A 4PAAA 1YCLA 2NVYA 5EGEA 3HOVC 3A8JA 2A69A 5IOQA 4A3IK 4KASA 1TWAK 2XCRB 2WAQD 4XLNA 2Y3PA 5CJ9A 1I6HC 1L0WA 1K83K 3M4OC 1WCMA 3GTQC 1JVIA 1KQ4A 2V6SA 3H3VL 2GSUA 1WCMC 3GTQA 3BUEA 3H0GA 4P9SA 3RZOK 4A3LK 1O27A 2JA5K 4A3IC 3AD7C 3GTPA 2WAQL 4KMUA 3FKIK 3GTLK 1BS2A 2A6EA 1XZPA 4QIWL 4OIOA 4JK1A 4WILA 4XCHA 2VUMC 1I3QK 2PMZL 4C2MK 2O5IA 4WJ4A 3TTGA 3N3YA 2V6TA 2V6UA 3S2DK 3AQOA 1ZVUA 2JA7K 4X6AC 2O5JA 3HOZC 1C0AA 4BY7K 1SFOC 3HOYC 3GEIA 2PHCB 4A93C 1O2FB 3HOZK 4Y52C 5M3MK 1R9TK 3GSIA 3S1MK 4O2DA 1Y1WK 1VRQC 4A3CC 1TWFA 2ZFZA 3GEHA 5C44C 5C4JK 2XCOA 1IW7A 3GTJK 4Y52K 3GTGK 4M1XA 3T02A 4BBRK 5C4XK 3HOYK 1B4BA 3H3VD 2PA8D 1XXAA 5IOSA 1WOSA 2RH6A 4G7HA 3ERED 2YU9C 4QJVA 3S1RK 4YFXA 3S1NK 1X31C 1IL2A 3S2HK 5IYDK 4KDDA 3I4NC 4LOWA 2YU9K 4G7OA 2E2HK 4A3DC 4GT9A 1WORA 3HOVK 2NVXA 4OIPA 1J6XA 3K7AC 3I4NK 4BY1K 4GZYA 3AD8C 2JA6C 4YFNA 1EQRA 3FHZA 5L46A 4GTAA 4BY1C 2NVTC 1ZBSA 2CW0A 1BDFA 4A3FC 3S1QK 2JA5C 5M5WK 2R92A 2NVTK 3MMLB 3SZYA 2JA6K
chains in the Genus database with same CATH topology
4KARA 1B4AA 1EK8A 1WCMA 3GTOA 3GTLA 1O24A 1KQ4A 1EH1A 2GSUA 3GTQA 3OEPA 3BUEA 2GSNA 3H0GA 4LQYA 4C2MC 3LAPA 4GFQA 1O27A 1XXCA 1O2BA 3GTPA 5JVOA 1K83A 2E2IA 4BLBA 3CQZA 2XCQA 5TJ3A 4C3IC 4GTLA 3GTKA 5CHPA 3S0XA 5IORA 3Q3QA 2KWAA 1F9NA 3N3YA 3LAJA 4KB4A 3AQOA 1ZVUA 4KAWX 4BKWA 2CFAA 2GSOA 1TWGA 3OPFA 4KM9A 2JH3A 3VA7A 2PHCB 4G0WA 2JA7A 4FZBA 3FKIA 4KB2A 2RGRA 5JFEA 3N0BA 2YU9A 1WQGA 1TWFA 1ISEA 2ZFZA 1I3QA 2E2HA 1AB4A 2XCOA 3NUHA 1WIHA 1I50A 4KMHA 3GTGA 4LR2A 4M1XA 4J3NA 1R9TA 2P5MA 2VUMA 1Y1VA 4P5BA 1B4BA 1DD5A 1Y1WA 4KC6A 4KMAA 4KM8A 1XXAA 5IOSA 3OREA 5EGHA 2RH6A 3CAGA 1WQFA 4GTBA 3L4KA 3FOFA 3ERED 4FM9A 4C3JC 3GTMA 3G4CA 1IS1A 3FOEA 4P5AA 1ZXOA 1O2AA 2R7ZA 3LPXA 1TWHA 3V4GA 4KDDA 4DDQA 3AH5A 1BJTA 4GT9A 4KMDA 1TWCA 3GTJA 2NVXA 2JA5A 1BGWA 3L4JA 1SFOA 1O25A 4ILDA 4C3HC 1O26A 1WQHA 1XXBA 1O29A 2B63A 1O28A 2CFAB 4G0UA 4BLAA 1TWAA 3FHZA 4GTCA 4GTAA 3G4AA 3QX3A 2JA6A 1ZBSA 4GTDA 1GE9A 4GTFA 5IOTA 2NVYA 5EGEA 4G0VA 5IOQA 4KATA 4KASA 3AQPA 2R92A 3N0CA 2XCRB 4GTEA 2R93A 3MMLB 2Y3PA 5CJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAR A;  4P5B A;  1O25 A;  1O24 A;  2CFA A;  1O26 A;  1KQ4 A;  5IOS A;  1O29 A;  1O28 A;  2CFA B;  4GTB A;  4GTC A;  1O27 A;  4GTA A;  3G4A A;  3G4C A;  1O2B A;  4GTD A;  4P5A A;  4FZB A;  1O2A A;  4GTF A;  4GTL A;  5IOT A;  5CHP A;  5IOQ A;  3N0B A;  3AH5 A;  4KAS A;  4KAT A;  5JFE A;  5IOR A;  3N0C A;  4GTE A;  4GT9 A;  3N3Y A; 
#chains in the Genus database with same CATH topology
 4OIR A;  2R92 C;  4KAR A;  1B4A A;  2Y0S L;  4YFK A;  4AH6 A;  1TWC C;  1EH1 A;  3GTP C;  4G7Z A;  2R93 K;  1WOO A;  3HXA A;  4A3F K;  2B63 C;  4A3D K;  4XSX A;  4AYB D;  4C3I C;  3GTK A;  2R93 C;  2Y0S D;  5CHP A;  1F7V A;  5IYC K;  3Q3Q A;  2JA8 C;  1F9N A;  4C3I K;  1YNJ A;  3CQZ K;  3GEE A;  4BKW A;  2CFA A;  1WSV A;  5C3E K;  1TWG A;  4KM9 A;  3ADA C;  1PJ5 A;  3SZZ A;  4XLP A;  4G0W A;  5E68 A;  1TWF C;  3HKZ L;  4A3J K;  5IP7 C;  2RGR A;  3S1R C;  3GTQ K;  1RU0 A;  3GTL C;  4A93 K;  1WIH A;  2BE5 A;  2NVY C;  5TMF A;  2W7V A;  2NVQ C;  4KMH A;  1I3Q C;  4LR2 A;  2VUM A;  4A3J C;  5FJ8 K;  5D4D A;  3IPJ A;  4KMA A;  3S2D C;  3GTJ C;  3M3Y C;  3CAG A;  2GAG C;  3GTK C;  3T01 A;  1DCH A;  5FLM C;  2A68 A;  5IP7 K;  4OIQ A;  3S14 K;  3GTM K;  4P5A A;  1J6V A;  1YX2 A;  2E2J K;  4Y7N K;  1Y1V C;  1TWH K;  1BJT A;  5FLM K;  1K83 C;  2NVX K;  1JOE A;  3S1Q C;  1WCM K;  1BGW A;  2R7Z K;  1Y1V K;  4XSZ A;  1SFO A;  1O26 A;  1WQH A;  4A3G C;  1O29 A;  2NVX C;  3S1M C;  1TWA A;  4A3C K;  3S17 K;  3QX3 A;  2P8T A;  4KN7 A;  4GTF A;  5IOT A;  3PO2 K;  4G0V A;  2FQT A;  4KAT A;  3AQP A;  1I6V A;  4X6A K;  1XPP A;  1EFW A;  1I50 K;  3PO2 C;  4A3E K;  3H0G C;  5IP9 C;  1EK8 A;  3GTO A;  3GTL A;  3S1N C;  3S17 C;  2E2I C;  1F7U A;  4QJV B;  3GTO C;  1R9T C;  2GSN A;  4LQY A;  4A3E C;  1TWH C;  4GFQ A;  1XXC A;  1O2B A;  1K83 A;  1USM A;  4BLB A;  5TJ3 A;  2E2I K;  4BXX C;  3H0G K;  1VJE A;  4MQ9 A;  2KWA A;  3S15 C;  4KAW X;  2WB1 L;  1TWA C;  1PJ6 A;  1I6H K;  3OPF A;  3CQZ C;  1TWC K;  5HL8 A;  1UV7 A;  2JA7 A;  2PPB A;  2ZUF A;  3GTP K;  3FKI A;  1I50 C;  4KB2 A;  4OIN A;  3BP8 C;  3RZD K;  5JFE A;  3N0B A;  2YU9 A;  1WQG A;  2E2H A;  1ISE A;  1I3Q A;  1AB4 A;  2WB1 D;  5IYB C;  3PO3 C;  2FQO A;  4J3N A;  1R9T A;  4YG2 A;  1Y1W A;  1G51 A;  4KC6 A;  2NVY K;  3ORE A;  1J6W A;  3L4K A;  5M5X K;  4FM9 A;  1J98 A;  4A3M C;  3RZD C;  3GTM A;  1JQW A;  3G4C A;  4BY7 C;  1IE0 A;  1TWG C;  3TFI A;  1PJ7 A;  3M3Y K;  4A3K K;  1TWH A;  1VLO A;  2R92 K;  3AH5 A;  1F93 A;  3S16 C;  4A3M K;  3JST A;  1TWF K;  4BBS C;  3GTJ A;  4KN4 A;  2JA5 A;  1IBA A;  1DCO A;  3S16 K;  4C3H C;  1WSR A;  1XXB A;  3HOX C;  3HOW K;  2B63 A;  1YNN A;  1O28 A;  5IP9 K;  4BLA A;  4A3K C;  4PAB A;  4GTC A;  2VUM K;  3G4A A;  2JA6 A;  1SMY A;  4GTD A;  5IYC C;  2ZUE A;  3I4M K;  4AYB L;  2A6H A;  3N0C A;  2PMZ D;  4GTE A;  2R93 A;  4Q4Z A;  1I50 A;  1XZQ A;  5C3E C;  2E2J C;  4Y7N C;  4A3L C;  1USO A;  3S14 C;  1O24 A;  5C44 K;  5C4J C;  1TWG K;  3GTM C;  4C45 A;  2D6F C;  1VGX A;  3S15 K;  3GTG C;  1XZQ B;  3OEP A;  4MEY A;  2R7Z C;  4C2M C;  3LAP A;  2GAH C;  1Y1W C;  5JVO A;  2E2I A;  3CQZ A;  2XCQ A;  4GTL A;  1XZP B;  2NVQ K;  3S0X A;  1INN A;  4WJ3 M;  5IOR A;  3WOD A;  4LJZ A;  5TMC A;  3HOX K;  3HOW C;  1HI9 A;  4KB4 A;  3LAJ A;  3T00 A;  3TFJ A;  3GTK K;  4BXX K;  4MEX A;  3TFH A;  2GSO A;  3DXJ A;  1V5V A;  3BP3 A;  3I4M C;  2JH3 A;  3VA7 A;  3GDZ A;  3K7A K;  4LK0 A;  2E2H C;  4FZB A;  4BBR C;  4RMF A;  5M5Y K;  5M3F K;  2JA7 C;  3NUH A;  3EQL A;  1ZYR A;  3A8I A;  4A3G K;  3AD9 C;  3GTG A;  1ZQ1 C;  2P5M A;  1Y1V A;  1SFO K;  4P5B A;  1DD5 A;  4QIW D;  4BBS K;  2PA8 L;  4KM8 A;  5EGH A;  4NOI A;  4A3B C;  5IYB K;  3PO3 K;  1WQF A;  4GTB A;  5IYD C;  3S2H C;  3FOF A;  1IQ0 A;  4C3J C;  1IS1 A;  3FOE A;  1ZXO A;  1O2A A;  4A3B K;  2R7Z A;  3LPX A;  3V4G A;  3GIR A;  4DDQ A;  3A8K A;  1WOP A;  4LLG A;  3RZO C;  4C3J K;  5C4X C;  4LK1 A;  4ZH4 A;  4KMD A;  1TWC A;  3FKI C;  1EI6 A;  2EBB A;  3GTO K;  1HQM A;  3L4J A;  1O25 A;  4ILD A;  3HOU K;  1VH2 A;  2B63 K;  2JA8 K;  3HKZ D;  2CFA B;  4G0U A;  3M4O K;  1DCP A;  4C3H K;  4Q5S A;  3HOU C;  1GE9 A;  4PAA A;  1YCL A;  2NVY A;  5EGE A;  3HOV C;  3A8J A;  2A69 A;  5IOQ A;  4A3I K;  4KAS A;  1TWA K;  2XCR B;  2WAQ D;  4XLN A;  2Y3P A;  5CJ9 A;  1I6H C;  1L0W A;  1K83 K;  3M4O C;  1WCM A;  3GTQ C;  1JVI A;  1KQ4 A;  2V6S A;  3H3V L;  2GSU A;  1WCM C;  3GTQ A;  3BUE A;  3H0G A;  4P9S A;  3RZO K;  4A3L K;  1O27 A;  2JA5 K;  4A3I C;  3AD7 C;  3GTP A;  2WAQ L;  4KMU A;  3FKI K;  3GTL K;  1BS2 A;  2A6E A;  1XZP A;  4QIW L;  4OIO A;  4JK1 A;  4WIL A;  4XCH A;  2VUM C;  1I3Q K;  2PMZ L;  4C2M K;  2O5I A;  4WJ4 A;  3TTG A;  3N3Y A;  2V6T A;  2V6U A;  3S2D K;  3AQO A;  1ZVU A;  2JA7 K;  4X6A C;  2O5J A;  3HOZ C;  1C0A A;  4BY7 K;  1SFO C;  3HOY C;  3GEI A;  2PHC B;  4A93 C;  1O2F B;  3HOZ K;  4Y52 C;  5M3M K;  1R9T K;  3GSI A;  3S1M K;  4O2D A;  1Y1W K;  1VRQ C;  4A3C C;  1TWF A;  2ZFZ A;  3GEH A;  5C44 C;  5C4J K;  2XCO A;  1IW7 A;  3GTJ K;  4Y52 K;  3GTG K;  4M1X A;  3T02 A;  4BBR K;  5C4X K;  3HOY K;  1B4B A;  3H3V D;  2PA8 D;  1XXA A;  5IOS A;  1WOS A;  2RH6 A;  4G7H A;  3ERE D;  2YU9 C;  4QJV A;  3S1R K;  4YFX A;  3S1N K;  1X31 C;  1IL2 A;  3S2H K;  5IYD K;  4KDD A;  3I4N C;  4LOW A;  2YU9 K;  4G7O A;  2E2H K;  4A3D C;  4GT9 A;  1WOR A;  3HOV K;  2NVX A;  4OIP A;  1J6X A;  3K7A C;  3I4N K;  4BY1 K;  4GZY A;  3AD8 C;  2JA6 C;  4YFN A;  1EQR A;  3FHZ A;  5L46 A;  4GTA A;  4BY1 C;  2NVT C;  1ZBS A;  2CW0 A;  1BDF A;  4A3F C;  3S1Q K;  2JA5 C;  5M5W K;  2R92 A;  2NVT K;  3MML B;  3SZY A;  2JA6 K; 
#chains in the Genus database with same CATH homology
 4KAR A;  1B4A A;  1EK8 A;  1WCM A;  3GTO A;  3GTL A;  1O24 A;  1KQ4 A;  1EH1 A;  2GSU A;  3GTQ A;  3OEP A;  3BUE A;  2GSN A;  3H0G A;  4LQY A;  4C2M C;  3LAP A;  4GFQ A;  1O27 A;  1XXC A;  1O2B A;  3GTP A;  5JVO A;  1K83 A;  2E2I A;  4BLB A;  3CQZ A;  2XCQ A;  5TJ3 A;  4C3I C;  4GTL A;  3GTK A;  5CHP A;  3S0X A;  5IOR A;  3Q3Q A;  2KWA A;  1F9N A;  3N3Y A;  3LAJ A;  4KB4 A;  3AQO A;  1ZVU A;  4KAW X;  4BKW A;  2CFA A;  2GSO A;  1TWG A;  3OPF A;  4KM9 A;  2JH3 A;  3VA7 A;  2PHC B;  4G0W A;  2JA7 A;  4FZB A;  3FKI A;  4KB2 A;  2RGR A;  5JFE A;  3N0B A;  2YU9 A;  1WQG A;  1TWF A;  1ISE A;  2ZFZ A;  1I3Q A;  2E2H A;  1AB4 A;  2XCO A;  3NUH A;  1WIH A;  1I50 A;  4KMH A;  3GTG A;  4LR2 A;  4M1X A;  4J3N A;  1R9T A;  2P5M A;  2VUM A;  1Y1V A;  4P5B A;  1B4B A;  1DD5 A;  1Y1W A;  4KC6 A;  4KMA A;  4KM8 A;  1XXA A;  5IOS A;  3ORE A;  5EGH A;  2RH6 A;  3CAG A;  1WQF A;  4GTB A;  3L4K A;  3FOF A;  3ERE D;  4FM9 A;  4C3J C;  3GTM A;  3G4C A;  1IS1 A;  3FOE A;  4P5A A;  1ZXO A;  1O2A A;  2R7Z A;  3LPX A;  1TWH A;  3V4G A;  4KDD A;  4DDQ A;  3AH5 A;  1BJT A;  4GT9 A;  4KMD A;  1TWC A;  3GTJ A;  2NVX A;  2JA5 A;  1BGW A;  3L4J A;  1SFO A;  1O25 A;  4ILD A;  4C3H C;  1O26 A;  1WQH A;  1XXB A;  1O29 A;  2B63 A;  1O28 A;  2CFA B;  4G0U A;  4BLA A;  1TWA A;  3FHZ A;  4GTC A;  4GTA A;  3G4A A;  3QX3 A;  2JA6 A;  1ZBS A;  4GTD A;  1GE9 A;  4GTF A;  5IOT A;  2NVY A;  5EGE A;  4G0V A;  5IOQ A;  4KAT A;  4KAS A;  3AQP A;  2R92 A;  3N0C A;  2XCR B;  4GTE A;  2R93 A;  3MML B;  2Y3P A;  5CJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...