5IOSA

Flavin-dependent thymidylate synthase r90a variant in complex with fad and deoxyuridine monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
214
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGAYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
total genus 77
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iosA00
4KATA 1O28A 1O26A 4GTBA 1O25A 4P5BA 5IOQA 2CFAB 3N0CA 1O2BA 4GTEA 4KASA 4P5AA 1O2AA 5IORA 4GTAA 3N0BA 4GTFA 5IOTA 4GTLA 3G4AA 4GT9A 5IOSA 3AH5A 4KARA 4GTCA 1KQ4A 4FZBA 5CHPA 5JFEA 2CFAA 3G4CA 3N3YA 1O24A 1O29A 4GTDA 1O27A
chains in the Genus database with same CATH superfamily
2Y0SL 3GTPC 4BBRK 3H0GK 3GTLC 4GTAA 1Y1WK 1EQRA 4C3IC 1WCMK 1K83C 2Y3PA 2E2HC 2NVYA 3GTPA 4A3GC 1IE0A 2CFAA 4A3LK 3L4JA 1JOEA 3AD7C 2YU9A 3ADAC 3HKZD 3V4GA 2GAGC 4GTBA 3S16K 4X6AK 2E2HA 1VH2A 1YNNA 1XZQA 1INNA 2O5JA 4GTFA 5IOTA 1I3QC 1PJ5A 4KAWX 5IYDC 4P9SA 2XCQA 3SZYA 3AH5A 3HOZC 1I6VA 3M3YC 3HOWK 4BXXK 5EGEA 1JVIA 1R9TC 5JVOA 3GTGK 2R92C 1VRQC 3GTQK 4LLGA 1EH1A 3S15K 2JA7K 3GTLK 4A93K 1WIHA 4KM9A 3T02A 3TFJA 5C44C 4C3IK 4BY7K 3NUHA 4KASA 3WODA 1K83K 3BP3A 4M1XA 1XXAA 4C2MK 1DCOA 3GTMA 2R92A 4LR2A 2ZFZA 2V6TA 4NOIA 2PPBA 1WOSA 4KN4A 2WB1L 5IP7C 1TWAC 3S14C 1V5VA 3S2HC 4GFQA 1I3QK 4Q4ZA 5IYDK 3OEPA 2D6FC 3HOVK 3T01A 3GTOC 3HOZK 1ZQ1C 3M3YK 2VUMA 4BBRC 3S17C 1TWAA 3MMLB 1HI9A 1R9TK 1IQ0A 1AB4A 1WCMC 3LPXA 4BKWA 2EBBA 3DXJA 3FKIC 4Y7NK 3CAGA 4A3BK 3H0GA 1XZPA 3H3VL 4A3LC 1F7UA 4ILDA 3L4KA 4A3DK 2WAQL 1WCMA 5HL8A 1WOPA 4X6AC 4LQYA 3HOYK 4BY1C 3BUEA 1EI6A 4WILA 3FKIA 2R7ZC 5E68A 4OIQA 2V6UA 5IP7K 2JA8C 4O2DA 3S14K 2A6EA 2B63K 3G4CA 3S2HK 5IP9C 4BXXC 3A8IA 4OIPA 2FQOA 3GTOK 5M5YK 5IOQA 2JA6C 1ZVUA 2V6SA 3GTGC 3GTQC 3S15C 2JA7C 3S17K 2XCOA 1Y1VC 4A93C 4QJVA 4PAAA 4LOWA 3G4AA 4BY7C 1BGWA 4A3JC 5C4JC 2WB1D 3RZOC 4G7OA 4C2MC 3FKIK 3GTGA 3GTQA 4WJ3M 2JA7A 3GTLA 4A3CC 4KATA 3A8KA 3GEEA 4XSZA 3PO2C 3M4OC 3BP8C 3N0CA 1K83A 4GTEA 4QIWD 4BY1K 2E2JC 3I4MK 1B4BA 2R7ZK 1PJ6A 4G0UA 2JA8K 4C3JK 5IOSA 3HOVC 3S1MK 5IP9K 4AYBD 3EQLA 2PHCB 1JQWA 3H3VD 4XCHA 2JA6K 4C3HK 4KDDA 1I3QA 1Y1VK 1IBAA 4AH6A 4Q5SA 4Y7NC 2W7VA 4A3JK 5C4JK 1DCHA 4A3BC 2GAHC 5C3EC 3RZOK 4YFNA 1R9TA 2NVTC 2PA8L 2PMZL 4A3DC 4GT9A 1I50K 4JK1A 1VJEA 1F93A 4A3CK 3HOYC 4DDQA 2Y0SD 4KMUA 4RMFA 3PO2K 3N3YA 3M4OK 3SZZA 2B63C 2E2IK 3TTGA 2E2JK 4A3FK 2JA5K 3AD9C 2CFAB 1TWGK 2BE5A 5CJ9A 5IYCK 1O2AA 1WSVA 1XXCA 1I6HC 2P8TA 1SMYA 1WQHA 3IPJA 1XZQB 3HOXK 2B63A 3GDZA 5TMFA 1IW7A 1TWHK 4OIOA 3S2DC 2NVXK 3VA7A 2ZUEA 3GTJK 2NVQC 3GTOA 4G0WA 4XLPA 1C0AA 1O2FB 2GSOA 3S1QK 1L0WA 3ERED 5C3EK 1TWFK 2P5MA 2NVTK 1IL2A 4P5AA 1WQGA 3PO3K 1G51A 3TFHA 1BDFA 1DD5A 4GTLA 3GTKK 1EFWA 1X31C 3CQZK 3S1NC 3I4MC 1USOA 1J6XA 2A6HA 4A3IC 4C3JC 4FZBA 5JFEA 4WJ4A 1IS1A 1O24A 2O5IA 3FOFA 1XPPA 3S1MC 2R93K 2GSNA 2ZUFA 5C4XK 5FLMC 4G7HA 3OREA 5M3FK 1I6HK 2PMZD 2R7ZA 4C3HC 3TFIA 3N0BA 3K7AC 4LJZA 4GZYA 3S2DK 1YNJA 4KC6A 3AD8C 4LK1A 4XLNA 4KMHA 1WSRA 2NVQK 1I50C 4YFXA 2JA6A 1YX2A 4G7ZA 1DCPA 1VLOA 2A68A 1Y1VA 2NVYC 1O26A 3GSIA 1VGXA 1O2BA 2YU9C 3GEHA 1XXBA 4A3EK 2E2IC 2RGRA 3S1NK 1I50A 4MQ9A 4A3FC 2JA5C 4A3MK 5IYBK 1XZPB 5D4DA 3RZDC 1BS2A 1TWGC 5IYCC 4A3IK 1SFOK 4FM9A 3S1RC 3T00A 1RU0A 4KARA 1ISEA 1KQ4A 5CHPA 5FLMK 1WOOA 3HOXC 1TWHC 2E2IA 2JA5A 3GIRA 2WAQD 4LK0A 1TWGA 3HOUK 2NVXC 3GTJC 5L46A 3K7AK 5IORA 2RH6A 4KM8A 1USMA 3LAJA 3S1QC 4J3NA 1TWFC 1TWHA 3GEIA 1GE9A 4XSXA 5M5WK 3PO3C 1J98A 3A8JA 3Q3QA 2GSUA 4ZH4A 3OPFA 3GTKC 4QJVB 2NVXA 1ZBSA 3GTJA 4OINA 3CQZC 2NVYK 3GTMC 4BBSC 3GTPK 2A69A 2YU9K 1TWFA 1O28A 2JH3A 4G0VA 1O25A 2R93C 3RZDK 4A3KC 2E2HK 1TWCC 5C4XC 3S1RK 3GTKA 2FQTA 3CQZA 1J6WA 4A3GK 3AQOA 3I4NC 4YFKA 4C45A 4YG2A 4BLAA 2VUMC 1UV7A 1WORA 5M3MK 5TMCA 2R93A 4BLBA 2XCRB 1EK8A 1TWCA 4Y52C 4GTDA 4MEXA 1J6VA 5M5XK 4P5BA 5TJ3A 4KMDA 3HKZL 3H0GC 4QIWL 3JSTA 4OIRA 4A3EC 1HQMA 1ZXOA 1F9NA 5FJ8K 1Y1WC 2R92K 3GTMK 4BBSK 4A3MC 4GTCA 5IYBC 1F7VA 1SFOC 4PABA 1WQFA 5C44K 1BJTA 1O29A 2CW0A 4AYBL 4A3KK 1TWCK 4KB4A 2PA8D 1Y1WA 1YCLA 1ZYRA 3AQPA 3S16C 3HOUC 3LAPA 1SFOA 1B4AA 3HXAA 3FOEA 3I4NK 4KN7A 4MEYA 2VUMK 2KWAA 4KB2A 1TWAK 3QX3A 4Y52K 3S0XA 3FHZA 1PJ7A 3HOWC 1O27A 5EGHA 4KMAA
chains in the Genus database with same CATH topology
3CAGA 1TWGA 3H0GA 2CFAB 5CJ9A 4ILDA 3L4KA 5IORA 1O2AA 2RH6A 4GTAA 4KM8A 3LAJA 1XXCA 1WCMA 4J3NA 4C3IC 4LQYA 1WQHA 1TWHA 1GE9A 3BUEA 2Y3PA 3FKIA 2B63A 3Q3QA 2GSUA 2NVYA 3OPFA 3GTPA 2NVXA 1ZBSA 3GTJA 2CFAA 3G4CA 3L4JA 3VA7A 2YU9A 3GTOA 4G0WA 3V4GA 1TWFA 1O28A 2GSOA 2JH3A 4GTBA 1O25A 4G0VA 5IOQA 2E2HA 1ZVUA 3ERED 2P5MA 2JA5A 4P5AA 1WQGA 2XCOA 3GTKA 4GTFA 5IOTA 3CQZA 1DD5A 4KAWX 4GTLA 3G4AA 2XCQA 1BGWA 3AH5A 3AQOA 5EGEA 4BLAA 4C2MC 4C3JC 3GTGA 4FZBA 2R93A 3GTQA 5JFEA 5JVOA 4BLBA 2XCRB 1EK8A 1TWCA 2JA7A 1IS1A 1O24A 3FOFA 3GTLA 4GTDA 1EH1A 2GSNA 4KATA 3OREA 1WIHA 4KM9A 4P5BA 5TJ3A 4KMDA 3N0CA 1K83A 2R7ZA 3NUHA 4GTEA 4KASA 4C3HC 3N0BA 1B4BA 4M1XA 1XXAA 4G0UA 3GTMA 2R92A 5IOSA 4KC6A 1ZXOA 4LR2A 1F9NA 2ZFZA 4KMHA 4GTCA 2PHCB 2JA6A 1WQFA 1BJTA 1O29A 1Y1VA 4KDDA 1I3QA 1O26A 4GFQA 4KB4A 1O2BA 1Y1WA 3OEPA 1XXBA 3AQPA 2RGRA 3LAPA 1SFOA 1I50A 1B4AA 2VUMA 3FOEA 1R9TA 4GT9A 4FM9A 1TWAA 3MMLB 2KWAA 4KB2A 4KARA 3QX3A 1AB4A 4DDQA 1ISEA 1KQ4A 5CHPA 3S0XA 3LPXA 3N3YA 3FHZA 4BKWA 2E2IA 1O27A 5EGHA 4KMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAT A;  1O28 A;  1O26 A;  4GTB A;  1O25 A;  4P5B A;  5IOQ A;  2CFA B;  3N0C A;  1O2B A;  4GTE A;  4KAS A;  4P5A A;  1O2A A;  5IOR A;  4GTA A;  3N0B A;  4GTF A;  5IOT A;  4GTL A;  3G4A A;  4GT9 A;  5IOS A;  3AH5 A;  4KAR A;  4GTC A;  1KQ4 A;  4FZB A;  5CHP A;  5JFE A;  2CFA A;  3G4C A;  3N3Y A;  1O24 A;  1O29 A;  4GTD A;  1O27 A; 
#chains in the Genus database with same CATH topology
 2Y0S L;  3GTP C;  4BBR K;  3H0G K;  3GTL C;  4GTA A;  1Y1W K;  1EQR A;  4C3I C;  1WCM K;  1K83 C;  2Y3P A;  2E2H C;  2NVY A;  3GTP A;  4A3G C;  1IE0 A;  2CFA A;  4A3L K;  3L4J A;  1JOE A;  3AD7 C;  2YU9 A;  3ADA C;  3HKZ D;  3V4G A;  2GAG C;  4GTB A;  3S16 K;  4X6A K;  2E2H A;  1VH2 A;  1YNN A;  1XZQ A;  1INN A;  2O5J A;  4GTF A;  5IOT A;  1I3Q C;  1PJ5 A;  4KAW X;  5IYD C;  4P9S A;  2XCQ A;  3SZY A;  3AH5 A;  3HOZ C;  1I6V A;  3M3Y C;  3HOW K;  4BXX K;  5EGE A;  1JVI A;  1R9T C;  5JVO A;  3GTG K;  2R92 C;  1VRQ C;  3GTQ K;  4LLG A;  1EH1 A;  3S15 K;  2JA7 K;  3GTL K;  4A93 K;  1WIH A;  4KM9 A;  3T02 A;  3TFJ A;  5C44 C;  4C3I K;  4BY7 K;  3NUH A;  4KAS A;  3WOD A;  1K83 K;  3BP3 A;  4M1X A;  1XXA A;  4C2M K;  1DCO A;  3GTM A;  2R92 A;  4LR2 A;  2ZFZ A;  2V6T A;  4NOI A;  2PPB A;  1WOS A;  4KN4 A;  2WB1 L;  5IP7 C;  1TWA C;  3S14 C;  1V5V A;  3S2H C;  4GFQ A;  1I3Q K;  4Q4Z A;  5IYD K;  3OEP A;  2D6F C;  3HOV K;  3T01 A;  3GTO C;  3HOZ K;  1ZQ1 C;  3M3Y K;  2VUM A;  4BBR C;  3S17 C;  1TWA A;  3MML B;  1HI9 A;  1R9T K;  1IQ0 A;  1AB4 A;  1WCM C;  3LPX A;  4BKW A;  2EBB A;  3DXJ A;  3FKI C;  4Y7N K;  3CAG A;  4A3B K;  3H0G A;  1XZP A;  3H3V L;  4A3L C;  1F7U A;  4ILD A;  3L4K A;  4A3D K;  2WAQ L;  1WCM A;  5HL8 A;  1WOP A;  4X6A C;  4LQY A;  3HOY K;  4BY1 C;  3BUE A;  1EI6 A;  4WIL A;  3FKI A;  2R7Z C;  5E68 A;  4OIQ A;  2V6U A;  5IP7 K;  2JA8 C;  4O2D A;  3S14 K;  2A6E A;  2B63 K;  3G4C A;  3S2H K;  5IP9 C;  4BXX C;  3A8I A;  4OIP A;  2FQO A;  3GTO K;  5M5Y K;  5IOQ A;  2JA6 C;  1ZVU A;  2V6S A;  3GTG C;  3GTQ C;  3S15 C;  2JA7 C;  3S17 K;  2XCO A;  1Y1V C;  4A93 C;  4QJV A;  4PAA A;  4LOW A;  3G4A A;  4BY7 C;  1BGW A;  4A3J C;  5C4J C;  2WB1 D;  3RZO C;  4G7O A;  4C2M C;  3FKI K;  3GTG A;  3GTQ A;  4WJ3 M;  2JA7 A;  3GTL A;  4A3C C;  4KAT A;  3A8K A;  3GEE A;  4XSZ A;  3PO2 C;  3M4O C;  3BP8 C;  3N0C A;  1K83 A;  4GTE A;  4QIW D;  4BY1 K;  2E2J C;  3I4M K;  1B4B A;  2R7Z K;  1PJ6 A;  4G0U A;  2JA8 K;  4C3J K;  5IOS A;  3HOV C;  3S1M K;  5IP9 K;  4AYB D;  3EQL A;  2PHC B;  1JQW A;  3H3V D;  4XCH A;  2JA6 K;  4C3H K;  4KDD A;  1I3Q A;  1Y1V K;  1IBA A;  4AH6 A;  4Q5S A;  4Y7N C;  2W7V A;  4A3J K;  5C4J K;  1DCH A;  4A3B C;  2GAH C;  5C3E C;  3RZO K;  4YFN A;  1R9T A;  2NVT C;  2PA8 L;  2PMZ L;  4A3D C;  4GT9 A;  1I50 K;  4JK1 A;  1VJE A;  1F93 A;  4A3C K;  3HOY C;  4DDQ A;  2Y0S D;  4KMU A;  4RMF A;  3PO2 K;  3N3Y A;  3M4O K;  3SZZ A;  2B63 C;  2E2I K;  3TTG A;  2E2J K;  4A3F K;  2JA5 K;  3AD9 C;  2CFA B;  1TWG K;  2BE5 A;  5CJ9 A;  5IYC K;  1O2A A;  1WSV A;  1XXC A;  1I6H C;  2P8T A;  1SMY A;  1WQH A;  3IPJ A;  1XZQ B;  3HOX K;  2B63 A;  3GDZ A;  5TMF A;  1IW7 A;  1TWH K;  4OIO A;  3S2D C;  2NVX K;  3VA7 A;  2ZUE A;  3GTJ K;  2NVQ C;  3GTO A;  4G0W A;  4XLP A;  1C0A A;  1O2F B;  2GSO A;  3S1Q K;  1L0W A;  3ERE D;  5C3E K;  1TWF K;  2P5M A;  2NVT K;  1IL2 A;  4P5A A;  1WQG A;  3PO3 K;  1G51 A;  3TFH A;  1BDF A;  1DD5 A;  4GTL A;  3GTK K;  1EFW A;  1X31 C;  3CQZ K;  3S1N C;  3I4M C;  1USO A;  1J6X A;  2A6H A;  4A3I C;  4C3J C;  4FZB A;  5JFE A;  4WJ4 A;  1IS1 A;  1O24 A;  2O5I A;  3FOF A;  1XPP A;  3S1M C;  2R93 K;  2GSN A;  2ZUF A;  5C4X K;  5FLM C;  4G7H A;  3ORE A;  5M3F K;  1I6H K;  2PMZ D;  2R7Z A;  4C3H C;  3TFI A;  3N0B A;  3K7A C;  4LJZ A;  4GZY A;  3S2D K;  1YNJ A;  4KC6 A;  3AD8 C;  4LK1 A;  4XLN A;  4KMH A;  1WSR A;  2NVQ K;  1I50 C;  4YFX A;  2JA6 A;  1YX2 A;  4G7Z A;  1DCP A;  1VLO A;  2A68 A;  1Y1V A;  2NVY C;  1O26 A;  3GSI A;  1VGX A;  1O2B A;  2YU9 C;  3GEH A;  1XXB A;  4A3E K;  2E2I C;  2RGR A;  3S1N K;  1I50 A;  4MQ9 A;  4A3F C;  2JA5 C;  4A3M K;  5IYB K;  1XZP B;  5D4D A;  3RZD C;  1BS2 A;  1TWG C;  5IYC C;  4A3I K;  1SFO K;  4FM9 A;  3S1R C;  3T00 A;  1RU0 A;  4KAR A;  1ISE A;  1KQ4 A;  5CHP A;  5FLM K;  1WOO A;  3HOX C;  1TWH C;  2E2I A;  2JA5 A;  3GIR A;  2WAQ D;  4LK0 A;  1TWG A;  3HOU K;  2NVX C;  3GTJ C;  5L46 A;  3K7A K;  5IOR A;  2RH6 A;  4KM8 A;  1USM A;  3LAJ A;  3S1Q C;  4J3N A;  1TWF C;  1TWH A;  3GEI A;  1GE9 A;  4XSX A;  5M5W K;  3PO3 C;  1J98 A;  3A8J A;  3Q3Q A;  2GSU A;  4ZH4 A;  3OPF A;  3GTK C;  4QJV B;  2NVX A;  1ZBS A;  3GTJ A;  4OIN A;  3CQZ C;  2NVY K;  3GTM C;  4BBS C;  3GTP K;  2A69 A;  2YU9 K;  1TWF A;  1O28 A;  2JH3 A;  4G0V A;  1O25 A;  2R93 C;  3RZD K;  4A3K C;  2E2H K;  1TWC C;  5C4X C;  3S1R K;  3GTK A;  2FQT A;  3CQZ A;  1J6W A;  4A3G K;  3AQO A;  3I4N C;  4YFK A;  4C45 A;  4YG2 A;  4BLA A;  2VUM C;  1UV7 A;  1WOR A;  5M3M K;  5TMC A;  2R93 A;  4BLB A;  2XCR B;  1EK8 A;  1TWC A;  4Y52 C;  4GTD A;  4MEX A;  1J6V A;  5M5X K;  4P5B A;  5TJ3 A;  4KMD A;  3HKZ L;  3H0G C;  4QIW L;  3JST A;  4OIR A;  4A3E C;  1HQM A;  1ZXO A;  1F9N A;  5FJ8 K;  1Y1W C;  2R92 K;  3GTM K;  4BBS K;  4A3M C;  4GTC A;  5IYB C;  1F7V A;  1SFO C;  4PAB A;  1WQF A;  5C44 K;  1BJT A;  1O29 A;  2CW0 A;  4AYB L;  4A3K K;  1TWC K;  4KB4 A;  2PA8 D;  1Y1W A;  1YCL A;  1ZYR A;  3AQP A;  3S16 C;  3HOU C;  3LAP A;  1SFO A;  1B4A A;  3HXA A;  3FOE A;  3I4N K;  4KN7 A;  4MEY A;  2VUM K;  2KWA A;  4KB2 A;  1TWA K;  3QX3 A;  4Y52 K;  3S0X A;  3FHZ A;  1PJ7 A;  3HOW C;  1O27 A;  5EGH A;  4KMA A; 
#chains in the Genus database with same CATH homology
 3CAG A;  1TWG A;  3H0G A;  2CFA B;  5CJ9 A;  4ILD A;  3L4K A;  5IOR A;  1O2A A;  2RH6 A;  4GTA A;  4KM8 A;  3LAJ A;  1XXC A;  1WCM A;  4J3N A;  4C3I C;  4LQY A;  1WQH A;  1TWH A;  1GE9 A;  3BUE A;  2Y3P A;  3FKI A;  2B63 A;  3Q3Q A;  2GSU A;  2NVY A;  3OPF A;  3GTP A;  2NVX A;  1ZBS A;  3GTJ A;  2CFA A;  3G4C A;  3L4J A;  3VA7 A;  2YU9 A;  3GTO A;  4G0W A;  3V4G A;  1TWF A;  1O28 A;  2GSO A;  2JH3 A;  4GTB A;  1O25 A;  4G0V A;  5IOQ A;  2E2H A;  1ZVU A;  3ERE D;  2P5M A;  2JA5 A;  4P5A A;  1WQG A;  2XCO A;  3GTK A;  4GTF A;  5IOT A;  3CQZ A;  1DD5 A;  4KAW X;  4GTL A;  3G4A A;  2XCQ A;  1BGW A;  3AH5 A;  3AQO A;  5EGE A;  4BLA A;  4C2M C;  4C3J C;  3GTG A;  4FZB A;  2R93 A;  3GTQ A;  5JFE A;  5JVO A;  4BLB A;  2XCR B;  1EK8 A;  1TWC A;  2JA7 A;  1IS1 A;  1O24 A;  3FOF A;  3GTL A;  4GTD A;  1EH1 A;  2GSN A;  4KAT A;  3ORE A;  1WIH A;  4KM9 A;  4P5B A;  5TJ3 A;  4KMD A;  3N0C A;  1K83 A;  2R7Z A;  3NUH A;  4GTE A;  4KAS A;  4C3H C;  3N0B A;  1B4B A;  4M1X A;  1XXA A;  4G0U A;  3GTM A;  2R92 A;  5IOS A;  4KC6 A;  1ZXO A;  4LR2 A;  1F9N A;  2ZFZ A;  4KMH A;  4GTC A;  2PHC B;  2JA6 A;  1WQF A;  1BJT A;  1O29 A;  1Y1V A;  4KDD A;  1I3Q A;  1O26 A;  4GFQ A;  4KB4 A;  1O2B A;  1Y1W A;  3OEP A;  1XXB A;  3AQP A;  2RGR A;  3LAP A;  1SFO A;  1I50 A;  1B4A A;  2VUM A;  3FOE A;  1R9T A;  4GT9 A;  4FM9 A;  1TWA A;  3MML B;  2KWA A;  4KB2 A;  4KAR A;  3QX3 A;  1AB4 A;  4DDQ A;  1ISE A;  1KQ4 A;  5CHP A;  3S0X A;  3LPX A;  3N3Y A;  3FHZ A;  4BKW A;  2E2I A;  1O27 A;  5EGH A;  4KMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...