5IOSA

Flavin-dependent thymidylate synthase r90a variant in complex with fad and deoxyuridine monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
214
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGAYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 77
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iosA00
2CFAB 1O28A 3G4CA 1O2BA 4GTEA 5IOQA 1O25A 4GTDA 4GTAA 4KARA 4GT9A 4FZBA 4KASA 2CFAA 1O24A 3N0BA 5IORA 4P5AA 1KQ4A 1O26A 4P5BA 4GTCA 5IOSA 1O27A 4KATA 4GTFA 5JFEA 5IOTA 3G4AA 1O29A 5CHPA 3AH5A 1O2AA 4GTLA 3N0CA 3N3YA 4GTBA
chains in the Genus database with same CATH superfamily
1SFOK 5M5XK 1TWAC 3G4CA 1WCMK 4RMFA 4G0UA 2PPBA 4AYBD 1R9TC 3OEPA 4KASA 4QIWD 3TTGA 5C44C 1XZQA 4C3IC 2GSNA 4A3GK 3S1NK 4KMDA 3GTJA 1K83K 4GTCA 5M3MK 4QJVB 5IYBC 1XXAA 2A68A 3SZZA 3S17C 1Y1VK 4BY7K 1RU0A 3IPJA 2GAGC 4KM8A 3M4OC 5IYDK 3GTKA 4GTEA 1WQHA 3SZYA 1TWHK 1ZYRA 4BXXC 2EBBA 4LQYA 2Y0SD 4LK0A 3I4MK 3GTOA 4BBRC 1TWGK 3GTPA 1I50K 2PMZD 4XLNA 3GTGA 1XZPB 3JSTA 3K7AK 4Q5SA 5TJ3A 1DD5A 4AYBL 5C4JC 2YU9A 1VH2A 4QIWL 4C3HC 3S14K 4A3BK 1PJ7A 3N3YA 2YU9C 1TWFK 3HOVK 5M5WK 4LR2A 4Y7NC 3S1MC 2FQOA 2O5JA 4MQ9A 2WAQD 4NOIA 3GEIA 2VUMK 1IBAA 2V6SA 3H0GA 1JOEA 1USOA 3V4GA 4A3KK 2R92K 3GTLA 2XCQA 3HOXC 5FLMK 2WB1D 4WILA 3GTMK 3S2DC 1EH1A 3Q3QA 4FM9A 2Y0SL 1WOOA 3HOUC 1XZQB 1O25A 2PMZL 3HOYK 2RGRA 2E2IC 2R7ZK 3LAJA 3PO3C 4DDQA 3GTQC 1C0AA 4A3FC 2FQTA 4KB4A 4A3EK 1F7UA 4G7HA 1XXBA 4GFQA 3A8KA 4A93C 1IS1A 2NVTC 4OIQA 4J3NA 3GTLK 1BDFA 5EGHA 1GE9A 1SMYA 3HOZC 3FKIC 5IP7K 3S1QK 2ZUFA 2XCOA 4GTDA 1I6HC 2WB1L 3FOEA 3RZOC 4Q4ZA 2JA6C 1BS2A 1ZXOA 3M3YC 3FOFA 1DCOA 4C3JK 3H3VD 4BBSC 3CQZC 1I3QK 2E2HC 2JA7A 5M3FK 2NVYA 2E2JK 5CHPA 1O29A 4MEXA 4LK1A 2B63A 1WCMC 2NVYC 4Y52K 3HOWK 1YCLA 3AD8C 1TWAA 5IP9K 1O28A 4A3MC 5TMCA 2JA8C 3RZDK 1F7VA 2R93K 1TWCK 1R9TA 1WOPA 4A3GC 2A6EA 2JH3A 3S1NC 5EGEA 1K83C 5TMFA 1KQ4A 1Y1VC 2JA5K 1O27A 4X6AK 5IOTA 3OPFA 5IYDC 4C2MK 4GTBA 2Y3PA 3EQLA 5E68A 5IOQA 1TWHC 3QX3A 3H3VL 3AD9C 4LOWA 5CJ9A 4GT9A 3BP8C 5C3EC 1TWGC 4YFXA 1I50C 3K7AC 1L0WA 4BKWA 4M1XA 2NVXA 3DXJA 3S2HK 3S14C 2NVXC 3GDZA 4A3BC 1TWFC 3GSIA 3GTJK 3S0XA 4A3IC 1ZBSA 4KMAA 2KWAA 4OIPA 4KB2A 1J6WA 2VUMC 3S1RK 1X31C 3GTKK 2R92C 2P8TA 4A3JK 4KMHA 5FLMC 1B4AA 5IYCK 3GTMC 1VLOA 3GTOK 3A8JA 1HI9A 1WOSA 1HQMA 2V6TA 3GTGK 3GTPK 1J6VA 1YNJA 3HOYC 2R7ZC 1PJ6A 2YU9K 1B4BA 3AQPA 4AH6A 2NVQK 4KAWX 2E2IA 3HKZD 4BY1K 4A3LK 3TFHA 3PO2K 3GTQA 3L4JA 3LPXA 3GEEA 4XLPA 3OREA 3S16C 1V5VA 3BP3A 1Y1WA 4LLGA 1J6XA 1Y1WC 3H0GK 4KMUA 2V6UA 1INNA 2WAQL 4ZH4A 3S1QC 3FKIA 2CFAB 3AQOA 3TFJA 3HOUK 4OIRA 1WQFA 4G0VA 3ADAC 2E2IK 2JA6A 5C4XC 3PO3K 3GIRA 1USMA 4C3JC 4A3FK 1I3QC 1IL2A 4A3CC 3CQZA 4KM9A 2E2HA 3HKZL 4Y52C 4YFKA 1SFOA 3HOWC 3LAPA 4A93K 5IP9C 4KC6A 1SFOC 2NVTK 1WCMA 4XSXA 4C45A 1VJEA 2BE5A 1O2FB 1O2BA 1TWCC 1VRQC 2ZUEA 4A3DK 2ZFZA 3FKIK 4KARA 1AB4A 3S15K 1I6HK 1ZQ1C 1K83A 2JA5C 4P5AA 1Y1VA 4KDDA 2CW0A 1YNNA 5HL8A 4BY7C 5IOSA 3M3YK 4P9SA 3I4NK 5JFEA 2E2HK 4GZYA 1IQ0A 1ZVUA 4BLBA 2JA7K 2NVYK 1TWHA 5C4XK 2B63K 4A3MK 1JQWA 1TWAK 2JA8K 1BJTA 4OIOA 4FZBA 2CFAA 1TWGA 3I4MC 1I50A 4G7ZA 3S2HC 1R9TK 1XXCA 1UV7A 4G7OA 5C44K 1F9NA 4C3IK 1PJ5A 4PABA 2GSOA 3GTJC 3CAGA 1IE0A 1TWFA 4GTFA 3ERED 1EK8A 5FJ8K 3G4AA 3AH5A 3HOVC 3NUHA 5IYBK 3S17K 3A8IA 3S1RC 4YG2A 3GTKC 1I6VA 5M5YK 2VUMA 2PA8D 3M4OK 3BUEA 1WSVA 4A3JC 2R92A 2PHCB 2GAHC 5IYCC 4A3KC 1WSRA 5C3EK 1EFWA 4BXXK 4WJ4A 1O26A 3GTOC 3TFIA 3GTPC 3GTGC 3GTMA 4KATA 4BBRK 1VGXA 1ISEA 3VA7A 4JK1A 2NVXK 3GEHA 2NVQC 4XCHA 1WQGA 3AD7C 4BLAA 5C4JK 2R7ZA 4BY1C 4A3LC 4C3HK 3PO2C 4A3IK 1J98A 1G51A 4A3EC 1EQRA 4Y7NK 3S1MK 1DCHA 3N0BA 5IORA 2GSUA 3H0GC 5D4DA 4ILDA 3GTLC 2PA8L 1JVIA 5JVOA 4KN4A 3T00A 2P5MA 3HOXK 5IP7C 2O5IA 1WORA 4QJVA 4LJZA 5L46A 3S2DK 4XSZA 4GTAA 2D6FC 4O2DA 2XCRB 3T02A 1F93A 3L4KA 2W7VA 1I3QA 3GTQK 4PAAA 3S16K 2E2JC 4OINA 4KN7A 1Y1WK 1XPPA 2A69A 1BGWA 4A3DC 3N0CA 2R93A 4G0WA 1XZPA 1TWCA 3RZDC 1IW7A 2R93C 1DCPA 3T01A 3S15C 3MMLB 3HOZK 4WJ3M 1O24A 2JA5A 3RZOK 3FHZA 2JA6K 3I4NC 4P5BA 2RH6A 4X6AC 3HXAA 1YX2A 4A3CK 4C2MC 2JA7C 1WIHA 4YFNA 4GTLA 1O2AA 1EI6A 2A6HA 4MEYA 3CQZK 4BBSK 3WODA 2B63C
chains in the Genus database with same CATH topology
3G4CA 1B4BA 3AQPA 2VUMA 4KAWX 4G0UA 2E2IA 2XCOA 4GTDA 3BUEA 3GTQA 3L4JA 3OEPA 4KASA 3LPXA 3FOEA 2R92A 2PHCB 3OREA 4C3IC 2GSNA 1ZXOA 1Y1WA 4KMDA 3FOFA 1O26A 3GTJA 4GTCA 3GTMA 2JA7A 4KATA 1XXAA 2NVYA 1ISEA 3VA7A 5CHPA 1O29A 2B63A 4KM8A 1WQGA 4BLAA 2R7ZA 1TWAA 2CFAB 1O28A 3FKIA 3GTKA 4GTEA 3AQOA 1WQFA 1R9TA 1WQHA 4G0VA 2JH3A 2JA6A 4LQYA 3N0BA 5EGEA 5IORA 4C3JC 2GSUA 3GTOA 1KQ4A 3GTPA 3GTGA 4ILDA 3CQZA 5JVOA 1O27A 4KM9A 2E2HA 1SFOA 5TJ3A 1DD5A 3LAPA 2P5MA 5IOTA 3OPFA 4KC6A 2YU9A 1WCMA 4C3HC 3N3YA 4GTBA 2Y3PA 1O2BA 5IOQA 2ZFZA 4LR2A 3QX3A 4GTAA 4KARA 5CJ9A 1AB4A 4GT9A 2XCRB 1K83A 3L4KA 4P5AA 1I3QA 3H0GA 4BKWA 1Y1VA 4M1XA 4KDDA 3V4GA 3GTLA 2NVXA 2XCQA 5IOSA 5JFEA 1BGWA 1ZVUA 3N0CA 2R93A 3S0XA 4BLBA 4G0WA 1EH1A 3Q3QA 1ZBSA 4FM9A 4KMAA 1TWCA 2KWAA 1TWHA 4KB2A 1O25A 3MMLB 2RGRA 3LAJA 4DDQA 1BJTA 4FZBA 2CFAA 1O24A 1TWGA 1I50A 2JA5A 4KB4A 1XXCA 4KMHA 1XXBA 1B4AA 4GFQA 3FHZA 1F9NA 4P5BA 2RH6A 1IS1A 2GSOA 3CAGA 1TWFA 4GTFA 4C2MC 4J3NA 3ERED 1WIHA 1EK8A 3G4AA 5EGHA 1GE9A 3AH5A 1O2AA 4GTLA 3NUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA B;  1O28 A;  3G4C A;  1O2B A;  4GTE A;  5IOQ A;  1O25 A;  4GTD A;  4GTA A;  4KAR A;  4GT9 A;  4FZB A;  4KAS A;  2CFA A;  1O24 A;  3N0B A;  5IOR A;  4P5A A;  1KQ4 A;  1O26 A;  4P5B A;  4GTC A;  5IOS A;  1O27 A;  4KAT A;  4GTF A;  5JFE A;  5IOT A;  3G4A A;  1O29 A;  5CHP A;  3AH5 A;  1O2A A;  4GTL A;  3N0C A;  3N3Y A;  4GTB A; 
#chains in the Genus database with same CATH topology
 1SFO K;  5M5X K;  1TWA C;  3G4C A;  1WCM K;  4RMF A;  4G0U A;  2PPB A;  4AYB D;  1R9T C;  3OEP A;  4KAS A;  4QIW D;  3TTG A;  5C44 C;  1XZQ A;  4C3I C;  2GSN A;  4A3G K;  3S1N K;  4KMD A;  3GTJ A;  1K83 K;  4GTC A;  5M3M K;  4QJV B;  5IYB C;  1XXA A;  2A68 A;  3SZZ A;  3S17 C;  1Y1V K;  4BY7 K;  1RU0 A;  3IPJ A;  2GAG C;  4KM8 A;  3M4O C;  5IYD K;  3GTK A;  4GTE A;  1WQH A;  3SZY A;  1TWH K;  1ZYR A;  4BXX C;  2EBB A;  4LQY A;  2Y0S D;  4LK0 A;  3I4M K;  3GTO A;  4BBR C;  1TWG K;  3GTP A;  1I50 K;  2PMZ D;  4XLN A;  3GTG A;  1XZP B;  3JST A;  3K7A K;  4Q5S A;  5TJ3 A;  1DD5 A;  4AYB L;  5C4J C;  2YU9 A;  1VH2 A;  4QIW L;  4C3H C;  3S14 K;  4A3B K;  1PJ7 A;  3N3Y A;  2YU9 C;  1TWF K;  3HOV K;  5M5W K;  4LR2 A;  4Y7N C;  3S1M C;  2FQO A;  2O5J A;  4MQ9 A;  2WAQ D;  4NOI A;  3GEI A;  2VUM K;  1IBA A;  2V6S A;  3H0G A;  1JOE A;  1USO A;  3V4G A;  4A3K K;  2R92 K;  3GTL A;  2XCQ A;  3HOX C;  5FLM K;  2WB1 D;  4WIL A;  3GTM K;  3S2D C;  1EH1 A;  3Q3Q A;  4FM9 A;  2Y0S L;  1WOO A;  3HOU C;  1XZQ B;  1O25 A;  2PMZ L;  3HOY K;  2RGR A;  2E2I C;  2R7Z K;  3LAJ A;  3PO3 C;  4DDQ A;  3GTQ C;  1C0A A;  4A3F C;  2FQT A;  4KB4 A;  4A3E K;  1F7U A;  4G7H A;  1XXB A;  4GFQ A;  3A8K A;  4A93 C;  1IS1 A;  2NVT C;  4OIQ A;  4J3N A;  3GTL K;  1BDF A;  5EGH A;  1GE9 A;  1SMY A;  3HOZ C;  3FKI C;  5IP7 K;  3S1Q K;  2ZUF A;  2XCO A;  4GTD A;  1I6H C;  2WB1 L;  3FOE A;  3RZO C;  4Q4Z A;  2JA6 C;  1BS2 A;  1ZXO A;  3M3Y C;  3FOF A;  1DCO A;  4C3J K;  3H3V D;  4BBS C;  3CQZ C;  1I3Q K;  2E2H C;  2JA7 A;  5M3F K;  2NVY A;  2E2J K;  5CHP A;  1O29 A;  4MEX A;  4LK1 A;  2B63 A;  1WCM C;  2NVY C;  4Y52 K;  3HOW K;  1YCL A;  3AD8 C;  1TWA A;  5IP9 K;  1O28 A;  4A3M C;  5TMC A;  2JA8 C;  3RZD K;  1F7V A;  2R93 K;  1TWC K;  1R9T A;  1WOP A;  4A3G C;  2A6E A;  2JH3 A;  3S1N C;  5EGE A;  1K83 C;  5TMF A;  1KQ4 A;  1Y1V C;  2JA5 K;  1O27 A;  4X6A K;  5IOT A;  3OPF A;  5IYD C;  4C2M K;  4GTB A;  2Y3P A;  3EQL A;  5E68 A;  5IOQ A;  1TWH C;  3QX3 A;  3H3V L;  3AD9 C;  4LOW A;  5CJ9 A;  4GT9 A;  3BP8 C;  5C3E C;  1TWG C;  4YFX A;  1I50 C;  3K7A C;  1L0W A;  4BKW A;  4M1X A;  2NVX A;  3DXJ A;  3S2H K;  3S14 C;  2NVX C;  3GDZ A;  4A3B C;  1TWF C;  3GSI A;  3GTJ K;  3S0X A;  4A3I C;  1ZBS A;  4KMA A;  2KWA A;  4OIP A;  4KB2 A;  1J6W A;  2VUM C;  3S1R K;  1X31 C;  3GTK K;  2R92 C;  2P8T A;  4A3J K;  4KMH A;  5FLM C;  1B4A A;  5IYC K;  3GTM C;  1VLO A;  3GTO K;  3A8J A;  1HI9 A;  1WOS A;  1HQM A;  2V6T A;  3GTG K;  3GTP K;  1J6V A;  1YNJ A;  3HOY C;  2R7Z C;  1PJ6 A;  2YU9 K;  1B4B A;  3AQP A;  4AH6 A;  2NVQ K;  4KAW X;  2E2I A;  3HKZ D;  4BY1 K;  4A3L K;  3TFH A;  3PO2 K;  3GTQ A;  3L4J A;  3LPX A;  3GEE A;  4XLP A;  3ORE A;  3S16 C;  1V5V A;  3BP3 A;  1Y1W A;  4LLG A;  1J6X A;  1Y1W C;  3H0G K;  4KMU A;  2V6U A;  1INN A;  2WAQ L;  4ZH4 A;  3S1Q C;  3FKI A;  2CFA B;  3AQO A;  3TFJ A;  3HOU K;  4OIR A;  1WQF A;  4G0V A;  3ADA C;  2E2I K;  2JA6 A;  5C4X C;  3PO3 K;  3GIR A;  1USM A;  4C3J C;  4A3F K;  1I3Q C;  1IL2 A;  4A3C C;  3CQZ A;  4KM9 A;  2E2H A;  3HKZ L;  4Y52 C;  4YFK A;  1SFO A;  3HOW C;  3LAP A;  4A93 K;  5IP9 C;  4KC6 A;  1SFO C;  2NVT K;  1WCM A;  4XSX A;  4C45 A;  1VJE A;  2BE5 A;  1O2F B;  1O2B A;  1TWC C;  1VRQ C;  2ZUE A;  4A3D K;  2ZFZ A;  3FKI K;  4KAR A;  1AB4 A;  3S15 K;  1I6H K;  1ZQ1 C;  1K83 A;  2JA5 C;  4P5A A;  1Y1V A;  4KDD A;  2CW0 A;  1YNN A;  5HL8 A;  4BY7 C;  5IOS A;  3M3Y K;  4P9S A;  3I4N K;  5JFE A;  2E2H K;  4GZY A;  1IQ0 A;  1ZVU A;  4BLB A;  2JA7 K;  2NVY K;  1TWH A;  5C4X K;  2B63 K;  4A3M K;  1JQW A;  1TWA K;  2JA8 K;  1BJT A;  4OIO A;  4FZB A;  2CFA A;  1TWG A;  3I4M C;  1I50 A;  4G7Z A;  3S2H C;  1R9T K;  1XXC A;  1UV7 A;  4G7O A;  5C44 K;  1F9N A;  4C3I K;  1PJ5 A;  4PAB A;  2GSO A;  3GTJ C;  3CAG A;  1IE0 A;  1TWF A;  4GTF A;  3ERE D;  1EK8 A;  5FJ8 K;  3G4A A;  3AH5 A;  3HOV C;  3NUH A;  5IYB K;  3S17 K;  3A8I A;  3S1R C;  4YG2 A;  3GTK C;  1I6V A;  5M5Y K;  2VUM A;  2PA8 D;  3M4O K;  3BUE A;  1WSV A;  4A3J C;  2R92 A;  2PHC B;  2GAH C;  5IYC C;  4A3K C;  1WSR A;  5C3E K;  1EFW A;  4BXX K;  4WJ4 A;  1O26 A;  3GTO C;  3TFI A;  3GTP C;  3GTG C;  3GTM A;  4KAT A;  4BBR K;  1VGX A;  1ISE A;  3VA7 A;  4JK1 A;  2NVX K;  3GEH A;  2NVQ C;  4XCH A;  1WQG A;  3AD7 C;  4BLA A;  5C4J K;  2R7Z A;  4BY1 C;  4A3L C;  4C3H K;  3PO2 C;  4A3I K;  1J98 A;  1G51 A;  4A3E C;  1EQR A;  4Y7N K;  3S1M K;  1DCH A;  3N0B A;  5IOR A;  2GSU A;  3H0G C;  5D4D A;  4ILD A;  3GTL C;  2PA8 L;  1JVI A;  5JVO A;  4KN4 A;  3T00 A;  2P5M A;  3HOX K;  5IP7 C;  2O5I A;  1WOR A;  4QJV A;  4LJZ A;  5L46 A;  3S2D K;  4XSZ A;  4GTA A;  2D6F C;  4O2D A;  2XCR B;  3T02 A;  1F93 A;  3L4K A;  2W7V A;  1I3Q A;  3GTQ K;  4PAA A;  3S16 K;  2E2J C;  4OIN A;  4KN7 A;  1Y1W K;  1XPP A;  2A69 A;  1BGW A;  4A3D C;  3N0C A;  2R93 A;  4G0W A;  1XZP A;  1TWC A;  3RZD C;  1IW7 A;  2R93 C;  1DCP A;  3T01 A;  3S15 C;  3MML B;  3HOZ K;  4WJ3 M;  1O24 A;  2JA5 A;  3RZO K;  3FHZ A;  2JA6 K;  3I4N C;  4P5B A;  2RH6 A;  4X6A C;  3HXA A;  1YX2 A;  4A3C K;  4C2M C;  2JA7 C;  1WIH A;  4YFN A;  4GTL A;  1O2A A;  1EI6 A;  2A6H A;  4MEY A;  3CQZ K;  4BBS K;  3WOD A;  2B63 C; 
#chains in the Genus database with same CATH homology
 3G4C A;  1B4B A;  3AQP A;  2VUM A;  4KAW X;  4G0U A;  2E2I A;  2XCO A;  4GTD A;  3BUE A;  3GTQ A;  3L4J A;  3OEP A;  4KAS A;  3LPX A;  3FOE A;  2R92 A;  2PHC B;  3ORE A;  4C3I C;  2GSN A;  1ZXO A;  1Y1W A;  4KMD A;  3FOF A;  1O26 A;  3GTJ A;  4GTC A;  3GTM A;  2JA7 A;  4KAT A;  1XXA A;  2NVY A;  1ISE A;  3VA7 A;  5CHP A;  1O29 A;  2B63 A;  4KM8 A;  1WQG A;  4BLA A;  2R7Z A;  1TWA A;  2CFA B;  1O28 A;  3FKI A;  3GTK A;  4GTE A;  3AQO A;  1WQF A;  1R9T A;  1WQH A;  4G0V A;  2JH3 A;  2JA6 A;  4LQY A;  3N0B A;  5EGE A;  5IOR A;  4C3J C;  2GSU A;  3GTO A;  1KQ4 A;  3GTP A;  3GTG A;  4ILD A;  3CQZ A;  5JVO A;  1O27 A;  4KM9 A;  2E2H A;  1SFO A;  5TJ3 A;  1DD5 A;  3LAP A;  2P5M A;  5IOT A;  3OPF A;  4KC6 A;  2YU9 A;  1WCM A;  4C3H C;  3N3Y A;  4GTB A;  2Y3P A;  1O2B A;  5IOQ A;  2ZFZ A;  4LR2 A;  3QX3 A;  4GTA A;  4KAR A;  5CJ9 A;  1AB4 A;  4GT9 A;  2XCR B;  1K83 A;  3L4K A;  4P5A A;  1I3Q A;  3H0G A;  4BKW A;  1Y1V A;  4M1X A;  4KDD A;  3V4G A;  3GTL A;  2NVX A;  2XCQ A;  5IOS A;  5JFE A;  1BGW A;  1ZVU A;  3N0C A;  2R93 A;  3S0X A;  4BLB A;  4G0W A;  1EH1 A;  3Q3Q A;  1ZBS A;  4FM9 A;  4KMA A;  1TWC A;  2KWA A;  1TWH A;  4KB2 A;  1O25 A;  3MML B;  2RGR A;  3LAJ A;  4DDQ A;  1BJT A;  4FZB A;  2CFA A;  1O24 A;  1TWG A;  1I50 A;  2JA5 A;  4KB4 A;  1XXC A;  4KMH A;  1XXB A;  1B4A A;  4GFQ A;  3FHZ A;  1F9N A;  4P5B A;  2RH6 A;  1IS1 A;  2GSO A;  3CAG A;  1TWF A;  4GTF A;  4C2M C;  4J3N A;  3ERE D;  1WIH A;  1EK8 A;  3G4A A;  5EGH A;  1GE9 A;  3AH5 A;  1O2A A;  4GTL A;  3NUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...