5IOSA

Flavin-dependent thymidylate synthase r90a variant in complex with fad and deoxyuridine monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
214
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGAYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 77
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iosA00
4GTCA 4P5AA 1O24A 3N0CA 4P5BA 3G4AA 4GTDA 5JFEA 4GTAA 1O28A 1O26A 3N0BA 5CHPA 5IOTA 1O29A 3N3YA 4GTEA 1O27A 4GTFA 1O2BA 5IOSA 2CFAA 1O25A 4GT9A 4KATA 4KARA 3G4CA 3AH5A 4KASA 5IOQA 1O2AA 2CFAB 4GTBA 4GTLA 4FZBA 5IORA 1KQ4A
chains in the Genus database with same CATH superfamily
2WB1L 2R93A 4A3LK 3G4AA 2R92C 4DDQA 1I6HC 3OEPA 1R9TC 1O26A 3FHZA 1Y1WA 2V6TA 5CJ9A 3H3VD 4GTFA 1BJTA 1J6XA 3GEEA 4KATA 5IP9C 1VJEA 3A8IA 2GSOA 4A3IC 1XXCA 4C2MC 1X31C 2WAQL 5JVOA 4A3CC 3S17C 5IP9K 1R9TA 2PMZL 1TWHC 3S2DC 5C44C 3GTOC 4P9SA 3LAJA 3GTKK 4C2MK 4QIWL 2FQOA 5C3EC 4MQ9A 3S17K 1AB4A 1F93A 1WSRA 2ZFZA 5C44K 3GTKA 3AQOA 4KB4A 3S1QC 1TWAC 3ERED 2WB1D 3GEIA 4A3EC 4P5BA 4M1XA 3S1NK 2PA8L 5IYCC 2B63K 3T00A 4A3KC 5IYBC 1TWHA 5M3FK 2E2IC 4ILDA 2W7VA 3H0GC 3GTOA 1ZVUA 2NVXC 3RZDK 2V6SA 3EQLA 3HOVK 1O27A 1J6VA 4A3MK 3HOYK 2PPBA 4G7ZA 2B63A 1G51A 3M3YC 4A3KK 5IYBK 4FM9A 1JOEA 2JA5C 2NVXK 3M4OK 1TWAA 4MEXA 3JSTA 1IS1A 2JA8K 2A6EA 2WAQD 1Y1VC 4A93C 3K7AC 2V6UA 2VUMC 3N0BA 5CHPA 2PMZD 3SZYA 3A8JA 4G7HA 4A3JC 3H0GA 2NVXA 1SMYA 3S1MK 4QIWD 4C3JC 4KAWX 4KM8A 3HOXK 4BKWA 1ZXOA 4O2DA 2RGRA 4BBRK 1O2AA 3GTQK 2A6HA 3GTJK 1DD5A 1I50C 4C3JK 4OIOA 3GIRA 5JFEA 4GTAA 2PA8D 2VUMA 2E2JK 1EI6A 2XCRB 2JA6K 1B4AA 3GTJA 2P8TA 4KB2A 5IOTA 5EGEA 3GSIA 5IOSA 3ADAC 2JA7C 4X6AK 1I50K 1XPPA 5M5WK 1EK8A 3FOFA 3RZOC 5TMFA 5C4JC 1Y1WK 1IL2A 1YNNA 2FQTA 5IORA 3V4GA 1TWFK 1I50A 4Q4ZA 1WQHA 1INNA 2NVQC 4WILA 3Q3QA 2ZUEA 1WCMC 4OINA 3BUEA 1SFOC 3CAGA 5C4JK 4YFXA 4MEYA 1TWFA 3GTPC 4XSZA 4GT9A 1I3QC 4KC6A 4KM9A 1ZQ1C 4YFNA 2XCQA 2R92K 1I6HK 1R9TK 1ZBSA 4BXXC 1SFOK 1YNJA 4GTLA 3AD7C 1WOSA 1JVIA 4C45A 2YU9C 4GTCA 1XXAA 1VLOA 4GTDA 3AQPA 2R92A 4GFQA 4KMHA 1SFOA 2Y3PA 5M5YK 1O2FB 4A3IK 4BY7C 2YU9K 3GTPA 2GSNA 1O25A 2ZUFA 4A3CK 2O5JA 4KARA 2JH3A 2GSUA 4WJ3M 4G0UA 4A3DC 3HOWC 1WSVA 4NOIA 1TWHK 5IYDC 3S2DK 3GTOK 3PO2C 2YU9A 3HOUC 5C3EK 1UV7A 2E2HC 3CQZC 3L4JA 3MMLB 3HOWK 4XSXA 5IYDK 5IP7C 3FOEA 4Y7NC 3LPXA 1TWGC 3AD8C 3HOUK 1TWAK 1DCOA 4KMDA 3S1QK 1USOA 2A68A 3I4NC 4QJVB 4A3EK 3S14C 2RH6A 1ISEA 5IYCK 2E2IK 4A3BC 3S15C 3S16C 3H0GK 5IP7K 1BGWA 5TJ3A 1WQGA 2E2HA 1VRQC 3I4NK 5C4XC 3S14K 1GE9A 3M3YK 1F9NA 1DCPA 2E2IA 4C3HC 3S15K 2JA5K 1F7UA 1J98A 2KWAA 1TWGA 4BBSC 1F7VA 1Y1VK 4A93K 3L4KA 3K7AK 3HOZC 1VH2A 2VUMK 1TWCC 4A3FC 3GTLC 4A3JK 1K83C 1YCLA 2R7ZC 2JA5A 5EGHA 4C3IC 4P5AA 1IE0A 4KDDA 1Y1VA 1VGXA 1IBAA 1JQWA 3BP3A 4QJVA 4AYBL 1K83K 4LK1A 5E68A 3HXAA 3WODA 5FLMC 1EH1A 3AD9C 3AH5A 4LK0A 4Y52C 1TWCA 3GTLA 3T01A 1K83A 3BP8C 2NVTC 2R93C 2EBBA 2JA7K 2BE5A 1BDFA 5L46A 3RZOK 4AH6A 2D6FC 3VA7A 4A3GC 1O29A 4GTEA 2P5MA 1O2BA 5M5XK 5TMCA 2JA7A 3TTGA 2NVQK 1WCMK 3GTGC 4GTBA 4G0VA 1XXBA 4A3GK 3DXJA 2A69A 3GTPK 4WJ4A 4G0WA 1I3QK 1XZPB 3GEHA 4PAAA 1WCMA 4JK1A 4BY1C 1PJ5A 3GTGK 3QX3A 3FKIC 3T02A 3NUHA 4BXXK 4OIRA 1L0WA 3N3YA 4ZH4A 4AYBD 2Y0SL 1WORA 3HKZL 4LOWA 1I3QA 1XZQB 1B4BA 3GTGA 2CFAB 5HL8A 4BY1K 3GTKC 3GTMC 4Q5SA 3FKIK 2XCOA 4GZYA 4BY7K 2GAGC 1EFWA 2CW0A 3FKIA 3GTMK 4LR2A 4A3DK 4BLBA 3IPJA 4KN7A 3PO2K 1EQRA 3S1NC 1WOPA 2B63C 4KMAA 3G4CA 1PJ7A 2PHCB 2E2HK 3CQZK 3OPFA 4YFKA 5FJ8K 3GTMA 3RZDC 1XZPA 3HOVC 1KQ4A 4A3MC 3S1RC 3HOYC 4Y7NK 4PABA 3GDZA 4LLGA 1TWGK 1WIHA 3CQZA 2NVYC 1DCHA 1J6WA 1WQFA 5D4DA 3M4OC 3A8KA 4J3NA 4A3BK 1XZQA 3S1RK 2JA8C 3S16K 4LJZA 2CFAA 2Y0SD 3HKZD 1HQMA 4XCHA 4KASA 5C4XK 3S2HC 3I4MC 2NVYK 4OIPA 3TFHA 3PO3C 3TFJA 4C3HK 3S1MC 1RU0A 4KMUA 1O24A 4YG2A 3HOXC 4BBSK 4BBRC 4XLNA 3GTQC 2NVYA 3S2HK 1V5VA 3H3VL 3I4MK 3GTJC 1WOOA 3HOZK 2O5IA 3PO3K 1TWCK 4A3FK 3GTLK 2R7ZK 3OREA 4C3IK 1HI9A 1BS2A 2E2JC 1I6VA 5IOQA 5M3MK 2JA6C 3SZZA 4G7OA 1ZYRA 2R7ZA 4X6AC 3N0CA 3S0XA 4LQYA 4OIQA 1O28A 1YX2A 5FLMK 4KN4A 3GTQA 1Y1WC 3TFIA 4Y52K 4BLAA 1TWFC 2NVTK 1C0AA 1PJ6A 4XLPA 2R93K 4A3LC 1USMA 2JA6A 1IQ0A 1IW7A 3LAPA 2GAHC 4RMFA 4FZBA
chains in the Genus database with same CATH topology
1BGWA 5TJ3A 2R93A 1DD5A 1WQGA 2E2HA 3G4AA 4DDQA 5JFEA 4GTAA 3OEPA 1GE9A 2VUMA 1O26A 3FHZA 1Y1WA 1F9NA 2E2IA 2XCRB 4C3HC 5CJ9A 3FKIA 1B4AA 4LR2A 3GTJA 4KB2A 5IOTA 5EGEA 4GTFA 4BLBA 5IOSA 2KWAA 1TWGA 1BJTA 4KATA 4KMAA 3G4CA 2PHCB 1EK8A 3FOFA 3OPFA 3L4KA 3GTMA 2GSOA 1XXCA 5EGHA 4C2MC 5IORA 1KQ4A 3V4GA 2JA5A 4C3IC 4P5AA 5JVOA 1I50A 4KDDA 1WQHA 3Q3QA 1WIHA 1R9TA 1Y1VA 3CQZA 3BUEA 1WQFA 3CAGA 3LAJA 4J3NA 1TWFA 2CFAA 4GT9A 4KC6A 4KM9A 2XCQA 1EH1A 1AB4A 3AH5A 4KASA 1ZBSA 1TWCA 3GTLA 4GTLA 2ZFZA 1K83A 3GTKA 3AQOA 4KB4A 4GTCA 1XXAA 3ERED 1O24A 4P5BA 4M1XA 4GTDA 3AQPA 2R92A 4GFQA 4KMHA 1TWHA 2NVYA 4ILDA 1SFOA 2Y3PA 3GTOA 1ZVUA 3VA7A 1O29A 4GTEA 1O27A 2P5MA 1O2BA 3GTPA 2GSNA 2JA7A 1O25A 3OREA 4KARA 2B63A 2JH3A 2GSUA 5IOQA 4G0UA 4FM9A 4GTBA 4G0VA 1XXBA 2YU9A 2R7ZA 1TWAA 3N0CA 1IS1A 3S0XA 4G0WA 4LQYA 3L4JA 1O28A 3N0BA 3GTQA 1WCMA 5CHPA 3H0GA 3MMLB 3QX3A 2NVXA 3NUHA 4BLAA 3FOEA 3N3YA 3LPXA 4C3JC 4KAWX 4KMDA 1I3QA 4KM8A 4BKWA 1ZXOA 2RH6A 2RGRA 1ISEA 2JA6A 1B4BA 3LAPA 1O2AA 2CFAB 3GTGA 4FZBA 2XCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTC A;  4P5A A;  1O24 A;  3N0C A;  4P5B A;  3G4A A;  4GTD A;  5JFE A;  4GTA A;  1O28 A;  1O26 A;  3N0B A;  5CHP A;  5IOT A;  1O29 A;  3N3Y A;  4GTE A;  1O27 A;  4GTF A;  1O2B A;  5IOS A;  2CFA A;  1O25 A;  4GT9 A;  4KAT A;  4KAR A;  3G4C A;  3AH5 A;  4KAS A;  5IOQ A;  1O2A A;  2CFA B;  4GTB A;  4GTL A;  4FZB A;  5IOR A;  1KQ4 A; 
#chains in the Genus database with same CATH topology
 2WB1 L;  2R93 A;  4A3L K;  3G4A A;  2R92 C;  4DDQ A;  1I6H C;  3OEP A;  1R9T C;  1O26 A;  3FHZ A;  1Y1W A;  2V6T A;  5CJ9 A;  3H3V D;  4GTF A;  1BJT A;  1J6X A;  3GEE A;  4KAT A;  5IP9 C;  1VJE A;  3A8I A;  2GSO A;  4A3I C;  1XXC A;  4C2M C;  1X31 C;  2WAQ L;  5JVO A;  4A3C C;  3S17 C;  5IP9 K;  1R9T A;  2PMZ L;  1TWH C;  3S2D C;  5C44 C;  3GTO C;  4P9S A;  3LAJ A;  3GTK K;  4C2M K;  4QIW L;  2FQO A;  5C3E C;  4MQ9 A;  3S17 K;  1AB4 A;  1F93 A;  1WSR A;  2ZFZ A;  5C44 K;  3GTK A;  3AQO A;  4KB4 A;  3S1Q C;  1TWA C;  3ERE D;  2WB1 D;  3GEI A;  4A3E C;  4P5B A;  4M1X A;  3S1N K;  2PA8 L;  5IYC C;  2B63 K;  3T00 A;  4A3K C;  5IYB C;  1TWH A;  5M3F K;  2E2I C;  4ILD A;  2W7V A;  3H0G C;  3GTO A;  1ZVU A;  2NVX C;  3RZD K;  2V6S A;  3EQL A;  3HOV K;  1O27 A;  1J6V A;  4A3M K;  3HOY K;  2PPB A;  4G7Z A;  2B63 A;  1G51 A;  3M3Y C;  4A3K K;  5IYB K;  4FM9 A;  1JOE A;  2JA5 C;  2NVX K;  3M4O K;  1TWA A;  4MEX A;  3JST A;  1IS1 A;  2JA8 K;  2A6E A;  2WAQ D;  1Y1V C;  4A93 C;  3K7A C;  2V6U A;  2VUM C;  3N0B A;  5CHP A;  2PMZ D;  3SZY A;  3A8J A;  4G7H A;  4A3J C;  3H0G A;  2NVX A;  1SMY A;  3S1M K;  4QIW D;  4C3J C;  4KAW X;  4KM8 A;  3HOX K;  4BKW A;  1ZXO A;  4O2D A;  2RGR A;  4BBR K;  1O2A A;  3GTQ K;  2A6H A;  3GTJ K;  1DD5 A;  1I50 C;  4C3J K;  4OIO A;  3GIR A;  5JFE A;  4GTA A;  2PA8 D;  2VUM A;  2E2J K;  1EI6 A;  2XCR B;  2JA6 K;  1B4A A;  3GTJ A;  2P8T A;  4KB2 A;  5IOT A;  5EGE A;  3GSI A;  5IOS A;  3ADA C;  2JA7 C;  4X6A K;  1I50 K;  1XPP A;  5M5W K;  1EK8 A;  3FOF A;  3RZO C;  5TMF A;  5C4J C;  1Y1W K;  1IL2 A;  1YNN A;  2FQT A;  5IOR A;  3V4G A;  1TWF K;  1I50 A;  4Q4Z A;  1WQH A;  1INN A;  2NVQ C;  4WIL A;  3Q3Q A;  2ZUE A;  1WCM C;  4OIN A;  3BUE A;  1SFO C;  3CAG A;  5C4J K;  4YFX A;  4MEY A;  1TWF A;  3GTP C;  4XSZ A;  4GT9 A;  1I3Q C;  4KC6 A;  4KM9 A;  1ZQ1 C;  4YFN A;  2XCQ A;  2R92 K;  1I6H K;  1R9T K;  1ZBS A;  4BXX C;  1SFO K;  1YNJ A;  4GTL A;  3AD7 C;  1WOS A;  1JVI A;  4C45 A;  2YU9 C;  4GTC A;  1XXA A;  1VLO A;  4GTD A;  3AQP A;  2R92 A;  4GFQ A;  4KMH A;  1SFO A;  2Y3P A;  5M5Y K;  1O2F B;  4A3I K;  4BY7 C;  2YU9 K;  3GTP A;  2GSN A;  1O25 A;  2ZUF A;  4A3C K;  2O5J A;  4KAR A;  2JH3 A;  2GSU A;  4WJ3 M;  4G0U A;  4A3D C;  3HOW C;  1WSV A;  4NOI A;  1TWH K;  5IYD C;  3S2D K;  3GTO K;  3PO2 C;  2YU9 A;  3HOU C;  5C3E K;  1UV7 A;  2E2H C;  3CQZ C;  3L4J A;  3MML B;  3HOW K;  4XSX A;  5IYD K;  5IP7 C;  3FOE A;  4Y7N C;  3LPX A;  1TWG C;  3AD8 C;  3HOU K;  1TWA K;  1DCO A;  4KMD A;  3S1Q K;  1USO A;  2A68 A;  3I4N C;  4QJV B;  4A3E K;  3S14 C;  2RH6 A;  1ISE A;  5IYC K;  2E2I K;  4A3B C;  3S15 C;  3S16 C;  3H0G K;  5IP7 K;  1BGW A;  5TJ3 A;  1WQG A;  2E2H A;  1VRQ C;  3I4N K;  5C4X C;  3S14 K;  1GE9 A;  3M3Y K;  1F9N A;  1DCP A;  2E2I A;  4C3H C;  3S15 K;  2JA5 K;  1F7U A;  1J98 A;  2KWA A;  1TWG A;  4BBS C;  1F7V A;  1Y1V K;  4A93 K;  3L4K A;  3K7A K;  3HOZ C;  1VH2 A;  2VUM K;  1TWC C;  4A3F C;  3GTL C;  4A3J K;  1K83 C;  1YCL A;  2R7Z C;  2JA5 A;  5EGH A;  4C3I C;  4P5A A;  1IE0 A;  4KDD A;  1Y1V A;  1VGX A;  1IBA A;  1JQW A;  3BP3 A;  4QJV A;  4AYB L;  1K83 K;  4LK1 A;  5E68 A;  3HXA A;  3WOD A;  5FLM C;  1EH1 A;  3AD9 C;  3AH5 A;  4LK0 A;  4Y52 C;  1TWC A;  3GTL A;  3T01 A;  1K83 A;  3BP8 C;  2NVT C;  2R93 C;  2EBB A;  2JA7 K;  2BE5 A;  1BDF A;  5L46 A;  3RZO K;  4AH6 A;  2D6F C;  3VA7 A;  4A3G C;  1O29 A;  4GTE A;  2P5M A;  1O2B A;  5M5X K;  5TMC A;  2JA7 A;  3TTG A;  2NVQ K;  1WCM K;  3GTG C;  4GTB A;  4G0V A;  1XXB A;  4A3G K;  3DXJ A;  2A69 A;  3GTP K;  4WJ4 A;  4G0W A;  1I3Q K;  1XZP B;  3GEH A;  4PAA A;  1WCM A;  4JK1 A;  4BY1 C;  1PJ5 A;  3GTG K;  3QX3 A;  3FKI C;  3T02 A;  3NUH A;  4BXX K;  4OIR A;  1L0W A;  3N3Y A;  4ZH4 A;  4AYB D;  2Y0S L;  1WOR A;  3HKZ L;  4LOW A;  1I3Q A;  1XZQ B;  1B4B A;  3GTG A;  2CFA B;  5HL8 A;  4BY1 K;  3GTK C;  3GTM C;  4Q5S A;  3FKI K;  2XCO A;  4GZY A;  4BY7 K;  2GAG C;  1EFW A;  2CW0 A;  3FKI A;  3GTM K;  4LR2 A;  4A3D K;  4BLB A;  3IPJ A;  4KN7 A;  3PO2 K;  1EQR A;  3S1N C;  1WOP A;  2B63 C;  4KMA A;  3G4C A;  1PJ7 A;  2PHC B;  2E2H K;  3CQZ K;  3OPF A;  4YFK A;  5FJ8 K;  3GTM A;  3RZD C;  1XZP A;  3HOV C;  1KQ4 A;  4A3M C;  3S1R C;  3HOY C;  4Y7N K;  4PAB A;  3GDZ A;  4LLG A;  1TWG K;  1WIH A;  3CQZ A;  2NVY C;  1DCH A;  1J6W A;  1WQF A;  5D4D A;  3M4O C;  3A8K A;  4J3N A;  4A3B K;  1XZQ A;  3S1R K;  2JA8 C;  3S16 K;  4LJZ A;  2CFA A;  2Y0S D;  3HKZ D;  1HQM A;  4XCH A;  4KAS A;  5C4X K;  3S2H C;  3I4M C;  2NVY K;  4OIP A;  3TFH A;  3PO3 C;  3TFJ A;  4C3H K;  3S1M C;  1RU0 A;  4KMU A;  1O24 A;  4YG2 A;  3HOX C;  4BBS K;  4BBR C;  4XLN A;  3GTQ C;  2NVY A;  3S2H K;  1V5V A;  3H3V L;  3I4M K;  3GTJ C;  1WOO A;  3HOZ K;  2O5I A;  3PO3 K;  1TWC K;  4A3F K;  3GTL K;  2R7Z K;  3ORE A;  4C3I K;  1HI9 A;  1BS2 A;  2E2J C;  1I6V A;  5IOQ A;  5M3M K;  2JA6 C;  3SZZ A;  4G7O A;  1ZYR A;  2R7Z A;  4X6A C;  3N0C A;  3S0X A;  4LQY A;  4OIQ A;  1O28 A;  1YX2 A;  5FLM K;  4KN4 A;  3GTQ A;  1Y1W C;  3TFI A;  4Y52 K;  4BLA A;  1TWF C;  2NVT K;  1C0A A;  1PJ6 A;  4XLP A;  2R93 K;  4A3L C;  1USM A;  2JA6 A;  1IQ0 A;  1IW7 A;  3LAP A;  2GAH C;  4RMF A;  4FZB A; 
#chains in the Genus database with same CATH homology
 1BGW A;  5TJ3 A;  2R93 A;  1DD5 A;  1WQG A;  2E2H A;  3G4A A;  4DDQ A;  5JFE A;  4GTA A;  3OEP A;  1GE9 A;  2VUM A;  1O26 A;  3FHZ A;  1Y1W A;  1F9N A;  2E2I A;  2XCR B;  4C3H C;  5CJ9 A;  3FKI A;  1B4A A;  4LR2 A;  3GTJ A;  4KB2 A;  5IOT A;  5EGE A;  4GTF A;  4BLB A;  5IOS A;  2KWA A;  1TWG A;  1BJT A;  4KAT A;  4KMA A;  3G4C A;  2PHC B;  1EK8 A;  3FOF A;  3OPF A;  3L4K A;  3GTM A;  2GSO A;  1XXC A;  5EGH A;  4C2M C;  5IOR A;  1KQ4 A;  3V4G A;  2JA5 A;  4C3I C;  4P5A A;  5JVO A;  1I50 A;  4KDD A;  1WQH A;  3Q3Q A;  1WIH A;  1R9T A;  1Y1V A;  3CQZ A;  3BUE A;  1WQF A;  3CAG A;  3LAJ A;  4J3N A;  1TWF A;  2CFA A;  4GT9 A;  4KC6 A;  4KM9 A;  2XCQ A;  1EH1 A;  1AB4 A;  3AH5 A;  4KAS A;  1ZBS A;  1TWC A;  3GTL A;  4GTL A;  2ZFZ A;  1K83 A;  3GTK A;  3AQO A;  4KB4 A;  4GTC A;  1XXA A;  3ERE D;  1O24 A;  4P5B A;  4M1X A;  4GTD A;  3AQP A;  2R92 A;  4GFQ A;  4KMH A;  1TWH A;  2NVY A;  4ILD A;  1SFO A;  2Y3P A;  3GTO A;  1ZVU A;  3VA7 A;  1O29 A;  4GTE A;  1O27 A;  2P5M A;  1O2B A;  3GTP A;  2GSN A;  2JA7 A;  1O25 A;  3ORE A;  4KAR A;  2B63 A;  2JH3 A;  2GSU A;  5IOQ A;  4G0U A;  4FM9 A;  4GTB A;  4G0V A;  1XXB A;  2YU9 A;  2R7Z A;  1TWA A;  3N0C A;  1IS1 A;  3S0X A;  4G0W A;  4LQY A;  3L4J A;  1O28 A;  3N0B A;  3GTQ A;  1WCM A;  5CHP A;  3H0G A;  3MML B;  3QX3 A;  2NVX A;  3NUH A;  4BLA A;  3FOE A;  3N3Y A;  3LPX A;  4C3J C;  4KAW X;  4KMD A;  1I3Q A;  4KM8 A;  4BKW A;  1ZXO A;  2RH6 A;  2RGR A;  1ISE A;  2JA6 A;  1B4B A;  3LAP A;  1O2A A;  2CFA B;  3GTG A;  4FZB A;  2XCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...