5IOSA

Flavin-dependent thymidylate synthase r90a variant in complex with fad and deoxyuridine monophosphate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
214
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGAYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 77
structure length 214
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iosA00
4GTDA 4P5AA 5IORA 4GTCA 5IOQA 4GTFA 3G4AA 3G4CA 4FZBA 3N3YA 5JFEA 5IOTA 3AH5A 4KASA 1O2BA 4GTBA 1O2AA 2CFAA 1O25A 1O26A 4KATA 3N0CA 3N0BA 2CFAB 1KQ4A 4GTEA 4P5BA 1O24A 4GT9A 1O28A 1O29A 4GTLA 4GTAA 5IOSA 4KARA 5CHPA 1O27A
chains in the Genus database with same CATH superfamily
1ZXOA 2KWAA 3DXJA 1XXCA 4XLPA 3L4JA 3TFIA 3VA7A 5C44C 4LQYA 4BY1C 1WCMC 4GTFA 3H0GA 5TJ3A 4FZBA 4OIOA 1K83A 1RU0A 1F9NA 1WIHA 3BP8C 3S14K 3M4OK 4C3JC 3HOYC 1KQ4A 4C2MC 3RZOK 1R9TA 5C4XC 1ZYRA 5C4JK 1I50C 2WB1D 4XCHA 3HOVC 1JOEA 4GFQA 2YU9K 4LK1A 2O5IA 5IOQA 3GTQA 3S0XA 3AD7C 4YFKA 3GEEA 2B63K 4BBSK 4G7ZA 4BXXC 5IYCK 4YFNA 2NVYC 3FOFA 2R93C 5IYDK 3BUEA 3A8JA 2E2JK 3FKIK 2PA8D 4BKWA 2NVXC 1SFOC 1IW7A 4NOIA 1Y1WA 1TWGC 4BY7K 3CQZC 5IYBK 1XZQA 3K7AK 3TFJA 3HOZK 5M3FK 1DCPA 3M3YK 3S16C 4A3EC 3CAGA 2E2IK 2V6SA 3GTJC 3GTGC 4KMUA 3N0CA 4KC6A 4X6AK 2VUMK 2JA7A 3T02A 4A3DK 1J6WA 5FLMK 1USOA 2JA6A 2GSUA 3M4OC 3HOUC 1WCMA 5IP7K 4J3NA 3T00A 4WILA 3HKZD 1BGWA 4G0UA 4KATA 1WOPA 1WQGA 3GTPK 1I6HK 2ZUFA 3AD9C 2R7ZC 4AYBL 4C3HC 2Y0SL 2B63C 1I50A 1TWHA 3H3VL 2A68A 3SZYA 2JA8C 1TWAC 3GTMK 1WQHA 1AB4A 4PAAA 4Y7NC 3OEPA 3G4CA 2JA5K 2A69A 4KASA 1O2BA 4BY7C 4MEXA 1B4BA 2CFAA 4KM8A 1TWFC 3HOZC 4QJVB 1O24A 4A3IC 2NVYA 2R93A 5C3EK 3EQLA 3S15K 4FM9A 1INNA 4A3LC 1SFOA 4LJZA 3S1QC 1TWGA 4MEYA 3T01A 3CQZA 3HOXK 2FQOA 2XCOA 2E2HC 3GTLC 4A3KC 3RZDK 3GTOC 4ZH4A 3AH5A 2A6HA 4KMAA 1IL2A 4WJ4A 3S1MC 2RGRA 4YG2A 1O2AA 4A3JK 4OIPA 4PABA 4A3FK 3GTJA 4BBRK 3GTGA 2NVTK 3PO2C 3H0GK 2P5MA 2WB1L 2Y3PA 3FHZA 3HOWK 4KMDA 1K83K 2D6FC 4KARA 4KB4A 4C45A 4YFXA 4A3MC 2R92C 3LAJA 3I4NK 1VLOA 3LPXA 1I6HC 1X31C 1J98A 2GSNA 1PJ5A 3S1RC 4KDDA 4P9SA 2PA8L 3GTQK 5TMFA 5IP9K 2NVQK 1I3QK 3OREA 2RH6A 3S2DK 4DDQA 5IOSA 2R7ZA 1EH1A 3GTKC 2O5JA 2B63A 1TWCC 1ZBSA 4KAWX 1DD5A 1TWAA 3MMLB 4QIWD 4C3IC 2P8TA 4GTCA 3S17K 1Y1WK 2BE5A 4Y52C 3WODA 1ISEA 4OIRA 2PPBA 4XSXA 2XCQA 4A93K 1TWFA 3IPJA 4OIQA 4A3CK 4GTAA 1XZPB 1VJEA 4BBRC 3S14C 3PO3K 3HKZL 2JA7K 2PMZD 2GSOA 3A8KA 2E2HA 3I4MK 5D4DA 3GTLA 3RZOC 5JFEA 5C4JC 3GTOA 4A3GK 3QX3A 1O25A 1WOOA 4LR2A 4BY1K 1WCMK 2YU9C 1XXBA 1HQMA 1SMYA 5L46A 1IE0A 1J6VA 4BBSC 2EBBA 4C3JK 5M5XK 5IYCC 3FOEA 3HOYK 1B4AA 2WAQD 1BDFA 2R92A 1HI9A 1I3QC 5C4XK 5IYDC 3SZZA 2A6EA 1WQFA 2E2JC 3FKIC 3S1NK 1TWHK 1XXAA 2FQTA 4GTBA 3HOVK 4WJ3M 2V6UA 5EGEA 5M5WK 5IYBC 3N0BA 1YNJA 1I6VA 3K7AC 1ZVUA 3M3YC 2W7VA 1EFWA 3OPFA 3GTKA 4BXXK 1VRQC 2NVXA 1TWCA 2E2IC 3L4KA 1V5VA 2NVYK 1L0WA 1C0AA 2R93K 4LOWA 5M5YK 4G7OA 4X6AC 2VUMC 1F7UA 4A3CC 1Y1VK 1VH2A 2PHCB 5E68A 1SFOK 4A3DC 1TWGK 4OINA 3CQZK 5FLMC 1O26A 5HL8A 4A3BK 4GTEA 1O28A 3S16K 1EK8A 4GTLA 5IP7C 4G0WA 1PJ6A 3Q3QA 2XCRB 3S2HK 3GTJK 3GTGK 5TMCA 4M1XA 3GIRA 1XZQB 1R9TK 3GTPC 4ILDA 3A8IA 2V6TA 3AQPA 3GEIA 3HOUK 4QJVA 3GTMC 2ZFZA 4BLAA 3GDZA 2YU9A 3ERED 1O29A 1VGXA 5M3MK 3S1NC 1GE9A 3JSTA 1TWHC 2JA5C 1USMA 4QIWL 2GAHC 5IORA 1F93A 5JVOA 2R7ZK 1I3QA 5EGHA 5C3EC 1WSRA 4C3HK 3FKIA 3S15C 3GEHA 2JA8K 1TWAK 1EI6A 3HOXC 3GSIA 4BLBA 1IBAA 4Y7NK 1XPPA 1Y1VC 1UV7A 3RZDC 2PMZL 4P5AA 4A3JC 1TWFK 2E2IA 4A3BC 4A3FC 4A3IK 5FJ8K 2NVTC 3H0GC 4XLNA 4KMHA 1F7VA 2VUMA 4Q4ZA 5CJ9A 3HOWC 4A3LK 1K83C 1YNNA 3S1QK 3S2HC 2JA6K 2JH3A 1J6XA 1WOSA 1BJTA 5C44K 2E2HK 2CFAB 4P5BA 4GZYA 3I4NC 3GTLK 1R9TC 4KN4A 4A3KK 3GTOK 2GAGC 2WAQL 2ZUEA 3S1MK 1DCHA 1YX2A 3AQOA 4GTDA 1ZQ1C 4KN7A 3PO2K 2CW0A 3GTQC 3LAPA 4C2MK 5IP9C 2NVQC 3NUHA 3G4AA 3S2DC 3GTPA 3N3YA 1BS2A 4Q5SA 4RMFA 1I50K 4A3MK 2R92K 4JK1A 4AH6A 3BP3A 3GTMA 4KB2A 1EQRA 3TTGA 4LLGA 3S17C 4G0VA 1XZPA 1WSVA 3S1RK 1Y1WC 5CHPA 1O27A 2JA5A 1IS1A 1O2FB 4AYBD 1WORA 2Y0SD 3H3VD 4A93C 4KM9A 4XSZA 1DCOA 1JQWA 3HXAA 3AD8C 3GTKK 4MQ9A 3TFHA 5IOTA 4G7HA 2NVXK 1TWCK 4O2DA 1PJ7A 1G51A 4C3IK 3PO3C 2JA7C 3ADAC 4GT9A 3I4MC 1JVIA 1YCLA 1Y1VA 4Y52K 3V4GA 1IQ0A 4A3EK 4A3GC 2JA6C 4LK0A
chains in the Genus database with same CATH topology
1ZXOA 2KWAA 1XXCA 3L4JA 1WQHA 3VA7A 1AB4A 5IORA 4LQYA 2GSOA 5JVOA 2E2HA 4GTFA 3H0GA 3OEPA 5TJ3A 1I3QA 5EGHA 3GTLA 3G4CA 4FZBA 5JFEA 3FKIA 3GTOA 4KASA 3QX3A 1O2BA 1K83A 1F9NA 1B4BA 1O25A 1WIHA 2CFAA 4C3JC 4KM8A 4LR2A 1KQ4A 1O24A 4C2MC 4BLBA 2NVYA 2R93A 1R9TA 1XXBA 4FM9A 1SFOA 1TWGA 4P5AA 4GFQA 3CQZA 3FOEA 1B4AA 2E2IA 2R92A 2XCOA 5IOQA 3GTQA 4KMHA 1WQFA 3S0XA 2VUMA 5CJ9A 1XXAA 3AH5A 4KMAA 4GTBA 2RGRA 1O2AA 2JH3A 5EGEA 1BJTA 3GTJA 3GTGA 3N0BA 2CFAB 4P5BA 3FOFA 2P5MA 3BUEA 2Y3PA 4BKWA 3FHZA 1ZVUA 4KMDA 4KARA 3OPFA 4KB4A 3GTKA 1Y1WA 2NVXA 3AQOA 4GTDA 1TWCA 3L4KA 3LAJA 3LPXA 3LAPA 3NUHA 3G4AA 3GTPA 3N3YA 2PHCB 2GSNA 4KDDA 3CAGA 1O26A 3N0CA 3GTMA 4GTEA 4KB2A 4KC6A 2JA7A 1O28A 3OREA 2RH6A 1EK8A 4GTLA 4DDQA 4G0VA 5IOSA 2R7ZA 4G0WA 1EH1A 5CHPA 3Q3QA 2B63A 1O27A 2JA5A 1IS1A 2XCRB 2JA6A 1ZBSA 2GSUA 4KAWX 1DD5A 1TWAA 4M1XA 3MMLB 4KM9A 4C3IC 4GTCA 1WCMA 4ILDA 4J3NA 1BGWA 5IOTA 1ISEA 3AQPA 4G0UA 4KATA 2ZFZA 2XCQA 4BLAA 1TWFA 2YU9A 4GT9A 1WQGA 3ERED 1O29A 4GTAA 1GE9A 1Y1VA 4C3HC 3V4GA 1I50A 1TWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTD A;  4P5A A;  5IOR A;  4GTC A;  5IOQ A;  4GTF A;  3G4A A;  3G4C A;  4FZB A;  3N3Y A;  5JFE A;  5IOT A;  3AH5 A;  4KAS A;  1O2B A;  4GTB A;  1O2A A;  2CFA A;  1O25 A;  1O26 A;  4KAT A;  3N0C A;  3N0B A;  2CFA B;  1KQ4 A;  4GTE A;  4P5B A;  1O24 A;  4GT9 A;  1O28 A;  1O29 A;  4GTL A;  4GTA A;  5IOS A;  4KAR A;  5CHP A;  1O27 A; 
#chains in the Genus database with same CATH topology
 1ZXO A;  2KWA A;  3DXJ A;  1XXC A;  4XLP A;  3L4J A;  3TFI A;  3VA7 A;  5C44 C;  4LQY A;  4BY1 C;  1WCM C;  4GTF A;  3H0G A;  5TJ3 A;  4FZB A;  4OIO A;  1K83 A;  1RU0 A;  1F9N A;  1WIH A;  3BP8 C;  3S14 K;  3M4O K;  4C3J C;  3HOY C;  1KQ4 A;  4C2M C;  3RZO K;  1R9T A;  5C4X C;  1ZYR A;  5C4J K;  1I50 C;  2WB1 D;  4XCH A;  3HOV C;  1JOE A;  4GFQ A;  2YU9 K;  4LK1 A;  2O5I A;  5IOQ A;  3GTQ A;  3S0X A;  3AD7 C;  4YFK A;  3GEE A;  2B63 K;  4BBS K;  4G7Z A;  4BXX C;  5IYC K;  4YFN A;  2NVY C;  3FOF A;  2R93 C;  5IYD K;  3BUE A;  3A8J A;  2E2J K;  3FKI K;  2PA8 D;  4BKW A;  2NVX C;  1SFO C;  1IW7 A;  4NOI A;  1Y1W A;  1TWG C;  4BY7 K;  3CQZ C;  5IYB K;  1XZQ A;  3K7A K;  3TFJ A;  3HOZ K;  5M3F K;  1DCP A;  3M3Y K;  3S16 C;  4A3E C;  3CAG A;  2E2I K;  2V6S A;  3GTJ C;  3GTG C;  4KMU A;  3N0C A;  4KC6 A;  4X6A K;  2VUM K;  2JA7 A;  3T02 A;  4A3D K;  1J6W A;  5FLM K;  1USO A;  2JA6 A;  2GSU A;  3M4O C;  3HOU C;  1WCM A;  5IP7 K;  4J3N A;  3T00 A;  4WIL A;  3HKZ D;  1BGW A;  4G0U A;  4KAT A;  1WOP A;  1WQG A;  3GTP K;  1I6H K;  2ZUF A;  3AD9 C;  2R7Z C;  4AYB L;  4C3H C;  2Y0S L;  2B63 C;  1I50 A;  1TWH A;  3H3V L;  2A68 A;  3SZY A;  2JA8 C;  1TWA C;  3GTM K;  1WQH A;  1AB4 A;  4PAA A;  4Y7N C;  3OEP A;  3G4C A;  2JA5 K;  2A69 A;  4KAS A;  1O2B A;  4BY7 C;  4MEX A;  1B4B A;  2CFA A;  4KM8 A;  1TWF C;  3HOZ C;  4QJV B;  1O24 A;  4A3I C;  2NVY A;  2R93 A;  5C3E K;  3EQL A;  3S15 K;  4FM9 A;  1INN A;  4A3L C;  1SFO A;  4LJZ A;  3S1Q C;  1TWG A;  4MEY A;  3T01 A;  3CQZ A;  3HOX K;  2FQO A;  2XCO A;  2E2H C;  3GTL C;  4A3K C;  3RZD K;  3GTO C;  4ZH4 A;  3AH5 A;  2A6H A;  4KMA A;  1IL2 A;  4WJ4 A;  3S1M C;  2RGR A;  4YG2 A;  1O2A A;  4A3J K;  4OIP A;  4PAB A;  4A3F K;  3GTJ A;  4BBR K;  3GTG A;  2NVT K;  3PO2 C;  3H0G K;  2P5M A;  2WB1 L;  2Y3P A;  3FHZ A;  3HOW K;  4KMD A;  1K83 K;  2D6F C;  4KAR A;  4KB4 A;  4C45 A;  4YFX A;  4A3M C;  2R92 C;  3LAJ A;  3I4N K;  1VLO A;  3LPX A;  1I6H C;  1X31 C;  1J98 A;  2GSN A;  1PJ5 A;  3S1R C;  4KDD A;  4P9S A;  2PA8 L;  3GTQ K;  5TMF A;  5IP9 K;  2NVQ K;  1I3Q K;  3ORE A;  2RH6 A;  3S2D K;  4DDQ A;  5IOS A;  2R7Z A;  1EH1 A;  3GTK C;  2O5J A;  2B63 A;  1TWC C;  1ZBS A;  4KAW X;  1DD5 A;  1TWA A;  3MML B;  4QIW D;  4C3I C;  2P8T A;  4GTC A;  3S17 K;  1Y1W K;  2BE5 A;  4Y52 C;  3WOD A;  1ISE A;  4OIR A;  2PPB A;  4XSX A;  2XCQ A;  4A93 K;  1TWF A;  3IPJ A;  4OIQ A;  4A3C K;  4GTA A;  1XZP B;  1VJE A;  4BBR C;  3S14 C;  3PO3 K;  3HKZ L;  2JA7 K;  2PMZ D;  2GSO A;  3A8K A;  2E2H A;  3I4M K;  5D4D A;  3GTL A;  3RZO C;  5JFE A;  5C4J C;  3GTO A;  4A3G K;  3QX3 A;  1O25 A;  1WOO A;  4LR2 A;  4BY1 K;  1WCM K;  2YU9 C;  1XXB A;  1HQM A;  1SMY A;  5L46 A;  1IE0 A;  1J6V A;  4BBS C;  2EBB A;  4C3J K;  5M5X K;  5IYC C;  3FOE A;  3HOY K;  1B4A A;  2WAQ D;  1BDF A;  2R92 A;  1HI9 A;  1I3Q C;  5C4X K;  5IYD C;  3SZZ A;  2A6E A;  1WQF A;  2E2J C;  3FKI C;  3S1N K;  1TWH K;  1XXA A;  2FQT A;  4GTB A;  3HOV K;  4WJ3 M;  2V6U A;  5EGE A;  5M5W K;  5IYB C;  3N0B A;  1YNJ A;  1I6V A;  3K7A C;  1ZVU A;  3M3Y C;  2W7V A;  1EFW A;  3OPF A;  3GTK A;  4BXX K;  1VRQ C;  2NVX A;  1TWC A;  2E2I C;  3L4K A;  1V5V A;  2NVY K;  1L0W A;  1C0A A;  2R93 K;  4LOW A;  5M5Y K;  4G7O A;  4X6A C;  2VUM C;  1F7U A;  4A3C C;  1Y1V K;  1VH2 A;  2PHC B;  5E68 A;  1SFO K;  4A3D C;  1TWG K;  4OIN A;  3CQZ K;  5FLM C;  1O26 A;  5HL8 A;  4A3B K;  4GTE A;  1O28 A;  3S16 K;  1EK8 A;  4GTL A;  5IP7 C;  4G0W A;  1PJ6 A;  3Q3Q A;  2XCR B;  3S2H K;  3GTJ K;  3GTG K;  5TMC A;  4M1X A;  3GIR A;  1XZQ B;  1R9T K;  3GTP C;  4ILD A;  3A8I A;  2V6T A;  3AQP A;  3GEI A;  3HOU K;  4QJV A;  3GTM C;  2ZFZ A;  4BLA A;  3GDZ A;  2YU9 A;  3ERE D;  1O29 A;  1VGX A;  5M3M K;  3S1N C;  1GE9 A;  3JST A;  1TWH C;  2JA5 C;  1USM A;  4QIW L;  2GAH C;  5IOR A;  1F93 A;  5JVO A;  2R7Z K;  1I3Q A;  5EGH A;  5C3E C;  1WSR A;  4C3H K;  3FKI A;  3S15 C;  3GEH A;  2JA8 K;  1TWA K;  1EI6 A;  3HOX C;  3GSI A;  4BLB A;  1IBA A;  4Y7N K;  1XPP A;  1Y1V C;  1UV7 A;  3RZD C;  2PMZ L;  4P5A A;  4A3J C;  1TWF K;  2E2I A;  4A3B C;  4A3F C;  4A3I K;  5FJ8 K;  2NVT C;  3H0G C;  4XLN A;  4KMH A;  1F7V A;  2VUM A;  4Q4Z A;  5CJ9 A;  3HOW C;  4A3L K;  1K83 C;  1YNN A;  3S1Q K;  3S2H C;  2JA6 K;  2JH3 A;  1J6X A;  1WOS A;  1BJT A;  5C44 K;  2E2H K;  2CFA B;  4P5B A;  4GZY A;  3I4N C;  3GTL K;  1R9T C;  4KN4 A;  4A3K K;  3GTO K;  2GAG C;  2WAQ L;  2ZUE A;  3S1M K;  1DCH A;  1YX2 A;  3AQO A;  4GTD A;  1ZQ1 C;  4KN7 A;  3PO2 K;  2CW0 A;  3GTQ C;  3LAP A;  4C2M K;  5IP9 C;  2NVQ C;  3NUH A;  3G4A A;  3S2D C;  3GTP A;  3N3Y A;  1BS2 A;  4Q5S A;  4RMF A;  1I50 K;  4A3M K;  2R92 K;  4JK1 A;  4AH6 A;  3BP3 A;  3GTM A;  4KB2 A;  1EQR A;  3TTG A;  4LLG A;  3S17 C;  4G0V A;  1XZP A;  1WSV A;  3S1R K;  1Y1W C;  5CHP A;  1O27 A;  2JA5 A;  1IS1 A;  1O2F B;  4AYB D;  1WOR A;  2Y0S D;  3H3V D;  4A93 C;  4KM9 A;  4XSZ A;  1DCO A;  1JQW A;  3HXA A;  3AD8 C;  3GTK K;  4MQ9 A;  3TFH A;  5IOT A;  4G7H A;  2NVX K;  1TWC K;  4O2D A;  1PJ7 A;  1G51 A;  4C3I K;  3PO3 C;  2JA7 C;  3ADA C;  4GT9 A;  3I4M C;  1JVI A;  1YCL A;  1Y1V A;  4Y52 K;  3V4G A;  1IQ0 A;  4A3E K;  4A3G C;  2JA6 C;  4LK0 A; 
#chains in the Genus database with same CATH homology
 1ZXO A;  2KWA A;  1XXC A;  3L4J A;  1WQH A;  3VA7 A;  1AB4 A;  5IOR A;  4LQY A;  2GSO A;  5JVO A;  2E2H A;  4GTF A;  3H0G A;  3OEP A;  5TJ3 A;  1I3Q A;  5EGH A;  3GTL A;  3G4C A;  4FZB A;  5JFE A;  3FKI A;  3GTO A;  4KAS A;  3QX3 A;  1O2B A;  1K83 A;  1F9N A;  1B4B A;  1O25 A;  1WIH A;  2CFA A;  4C3J C;  4KM8 A;  4LR2 A;  1KQ4 A;  1O24 A;  4C2M C;  4BLB A;  2NVY A;  2R93 A;  1R9T A;  1XXB A;  4FM9 A;  1SFO A;  1TWG A;  4P5A A;  4GFQ A;  3CQZ A;  3FOE A;  1B4A A;  2E2I A;  2R92 A;  2XCO A;  5IOQ A;  3GTQ A;  4KMH A;  1WQF A;  3S0X A;  2VUM A;  5CJ9 A;  1XXA A;  3AH5 A;  4KMA A;  4GTB A;  2RGR A;  1O2A A;  2JH3 A;  5EGE A;  1BJT A;  3GTJ A;  3GTG A;  3N0B A;  2CFA B;  4P5B A;  3FOF A;  2P5M A;  3BUE A;  2Y3P A;  4BKW A;  3FHZ A;  1ZVU A;  4KMD A;  4KAR A;  3OPF A;  4KB4 A;  3GTK A;  1Y1W A;  2NVX A;  3AQO A;  4GTD A;  1TWC A;  3L4K A;  3LAJ A;  3LPX A;  3LAP A;  3NUH A;  3G4A A;  3GTP A;  3N3Y A;  2PHC B;  2GSN A;  4KDD A;  3CAG A;  1O26 A;  3N0C A;  3GTM A;  4GTE A;  4KB2 A;  4KC6 A;  2JA7 A;  1O28 A;  3ORE A;  2RH6 A;  1EK8 A;  4GTL A;  4DDQ A;  4G0V A;  5IOS A;  2R7Z A;  4G0W A;  1EH1 A;  5CHP A;  3Q3Q A;  2B63 A;  1O27 A;  2JA5 A;  1IS1 A;  2XCR B;  2JA6 A;  1ZBS A;  2GSU A;  4KAW X;  1DD5 A;  1TWA A;  4M1X A;  3MML B;  4KM9 A;  4C3I C;  4GTC A;  1WCM A;  4ILD A;  4J3N A;  1BGW A;  5IOT A;  1ISE A;  3AQP A;  4G0U A;  4KAT A;  2ZFZ A;  2XCQ A;  4BLA A;  1TWF A;  2YU9 A;  4GT9 A;  1WQG A;  3ERE D;  1O29 A;  4GTA A;  1GE9 A;  1Y1V A;  4C3H C;  3V4G A;  1I50 A;  1TWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...