3HOUK

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3houK00
4XLPA 2VUMC 3S1QC 5M3MK 3HOUK 2R93C 4C2MK 2B63C 2E2JK 4KMUA 5TMFA 5FLMK 3I4NC 4G7OA 1K83K 2A6HA 1Y1WC 3I4MK 1Y1VK 4A3CC 3FKIK 3RZOK 1I6VA 3HOZK 2YU9C 3PO2K 1HQMA 5M5YK 3HOYK 5C3EK 3S16K 3S14K 2NVXC 1TWFK 1SMYA 1WCMC 3H0GC 4BBSC 3S16C 4A3EK 2Y0SD 3HOUC 2PA8D 5C4JK 2E2HK 2E2JC 5C4XK 5FLMC 4XLNA 3GTPK 1K83C 2O5IA 3I4MC 1Y1VC 4KN7A 4AYBD 3FKIC 4YG2A 3S1RK 3GTGK 3GTKK 3HOZC 4NOIA 3HOYC 3PO2C 5C3EC 5C44K 3S14C 2E2IK 4LK0A 2WAQL 1TWFC 3S2DK 4G7ZA 2JA7K 2O5JA 3M4OK 4YFNA 4A3EC 4A3LK 2PMZL 4A3JK 4A93K 1TWGK 5D4DA 5C4JC 4A3DK 4C3JK 3GTMK 5C4XC 4LJZA 3HKZL 3PO3K 3GTPC 1BDFA 1TWAK 3S2HK 3S1RC 4Y7NK 3CQZK 3GTGC 4X6AK 4YFXA 4A3KK 2JA5K 3GTKC 5IP7K 3GTQK 5IP9K 5IYDK 4OIPA 5C44C 4A3BK 2E2IC 3S15K 4BY7K 3S2DC 2NVTK 2JA7C 4C3IK 4A3LC 3K7AK 4Q4ZA 4A3JC 4LLGA 1TWGC 4OIQA 4A93C 1I6HK 4A3DC 1YNNA 3GTMC 3H3VL 5TMCA 3GTJK 3M3YC 2R7ZK 4BBRK 2NVQK 3PO3C 3RZOC 5M5WK 1TWAC 4XSZA 2R92K 3S2HC 4Y52K 4Y7NC 3CQZC 2A68A 4BY1K 4A3KC 5IYDC 2JA5C 4X6AC 4QIWL 5IP7C 5IP9C 3GTQC 4MEXA 2PPBA 4A3BC 3HOWK 3S15C 4BY7C 1TWCK 2NVTC 2WAQD 2E2HC 3K7AC 4OIRA 2PMZD 1I6HC 1TWHK 3EQLA 3GTJC 1I50K 2R7ZC 4BBRC 2NVQC 3HKZD 4A3GK 2R93K 2R92C 4Y52C 5M3FK 3HOXK 3GTOK 1YNJA 4BY1C 4C3HK 4KN4A 3GTLK 1ZYRA 4JK1A 4LK1A 3HOWC 3S17K 5IYCK 3RZDK 3M4OC 1TWCC 4YFKA 4Q5SA 4OIOA 2NVYK 5M5XK 1R9TK 1TWHC 3S1NK 4BXXK 3H3VD 2WB1L 1I50C 4A3GC 4A3MK 1IW7A 2BE5A 2WB1D 3HOXC 4A3IK 3GTOC 2JA8K 3GTLC 2JA6K 1I3QK 4QIWD 3S17C 4MEYA 5IYCC 3RZDC 3S1MK 4ZH4A 1SFOK 3HOVK 2A6EA 2CW0A 2NVYC 4QJVB 4XSXA 5IYBK 3M3YK 2Y0SL 1XPPA 4A3FK 5FJ8K 2VUMK 3S1QK 2PA8L 1R9TC 2B63K 3S1NC 4BXXC 4GZYA 3WODA 4A3MC 4G7HA 4A3IC 3I4NK 4MQ9A 4AYBL 1Y1WK 4A3CK 2JA8C 2JA6C 1I3QC 2YU9K 4OINA 3S1MC 4QJVA 1SFOC 3HOVC 2NVXK 1WCMK 5IYBC 3H0GK 4BBSK 2A69A 3DXJA 4A3FC
chains in the Genus database with same CATH superfamily
4XLPA 3S1QC 3HOUK 2R93C 5IOTA 1EQRA 3GDZA 1PJ5A 2ZUEA 1J98A 3GTGA 2FQTA 4C2MC 2RGRA 1WOSA 5C4XK 4XLNA 3T01A 3I4MC 1EK8A 3GTMA 4KN7A 3FKIC 3Q3QA 4BLBA 1GE9A 1I50A 5C3EC 3GEEA 2PHCB 2WAQL 2JA5A 2JA7K 1WQFA 1DD5A 5C4JC 1KQ4A 4A3DK 5CHPA 1XZPA 3HKZL 2GSOA 1DCPA 5JFEA 4GT9A 3S2HK 4X6AK 4A3KK 1J6VA 3GTKC 3GTQK 3MMLB 3A8KA 3AQPA 3S15K 4KARA 3S2DC 1XZQA 2XCRB 4A93C 1I6HK 3H3VL 3PO3C 5M5WK 3CQZC 5IYDC 5IP9C 1VGXA 1WSRA 1TWCK 2NVTC 1WORA 2KWAA 5EGHA 1TWHK 1WQHA 1UV7A 3GTJC 4BBRC 4J3NA 4GTFA 2R92C 1ISEA 4JK1A 4YFKA 3LAJA 4OIOA 1EI6A 2NVYK 3CAGA 1F7UA 1R9TK 3S0XA 1I50C 2WB1L 2BE5A 2WB1D 4A3IK 1V5VA 4C3HC 3GTLC 3FOEA 3S17C 4KAWX 4MEYA 3OEPA 1USOA 4ZH4A 2CW0A 5IYBK 1BS2A 2XCQA 1B4BA 3TFHA 3NUHA 2V6SA 4A3MC 4G7HA 3L4KA 4A3CK 2YU9K 4P5BA 1PJ7A 4OINA 4QJVA 2NVXK 1WCMK 2GAHC 3H0GK 2A69A 3M3YC 1DCHA 5M3MK 2B63C 1IBAA 4ILDA 3T00A 1F7VA 2E2HA 1K83K 2A6HA 3RZOK 1I6VA 3PO2K 5M5YK 2CFAB 3HXAA 1TWFK 1SMYA 3GTKA 4BBSC 3S16C 3HOUC 2PA8D 3SZYA 1TWCA 2RH6A 1IE0A 3GTPK 3FHZA 2O5IA 3GEIA 3S1RK 4AYBD 4LK0A 4YFNA 1TWGK 3IPJA 4FM9A 5C4XC 4KM9A 4LR2A 2D6FC 3FOFA 4BLAA 1R9TA 3GTJA 2GSNA 2R92A 3V4GA 4BY7K 1X31C 2JA7C 4DDQA 4LLGA 1WSVA 3G4CA 4A3DC 2JH3A 3VA7A 1O29A 2NVQK 2V6TA 3S2HC 1ZQ1C 4X6AC 4A3KC 3GTQC 4KASA 2PPBA 3HOWK 3S15C 3OREA 3GTLA 2WAQD 4FZBA 4G0UA 2E2HC 4OIRA 1I6HC 1J6XA 1O24A 4GTLA 2R93K 1WCMA 3HKZD 3H0GA 3L4JA 3ERED 4RMFA 3GTOK 1YNJA 4LK1A 3T02A 3M4OC 1TWCC 3A8IA 4Q5SA 4XCHA 5M5XK 1TWHC 1F93A 3JSTA 4BXXK 1O2BA 3H3VD 1TWFA 2B63A 1IW7A 3BP8C 1BGWA 2ZFZA 4KM8A 3S1MK 3GTPA 1SFOK 3A8JA 2A6EA 2NVYC 3QX3A 4XSXA 2Y0SL 4A3FK 2VUMK 1G51A 1R9TC 4A3IC 3I4NK 4MQ9A 1Y1WK 1O28A 1JOEA 2P8TA 3SZZA 5IYBC 4WILA 1IS1A 2E2JK 1PJ6A 4KMUA 5TMFA 5FLMK 5JVOA 5TJ3A 2W7VA 3N0BA 4G7OA 4A3CC 1Y1VK 4LOWA 1XXBA 3HOZK 4M1XA 2YU9C 1HQMA 3HOYK 5IOQA 3S14K 2EBBA 1O25A 1WCMC 3OPFA 4GTAA 3H0GC 2NVXC 1ZVUA 4A3EK 1AB4A 3AD9C 4C45A 1WOOA 2JA7A 3ADAC 5EGEA 1K83C 3AH5A 5IORA 4YG2A 3GTGK 4GTEA 3PO2C 4WJ4A 5C44K 2E2IK 1TWFC 1ZXOA 2O5JA 1O2FB 3GTQA 1IL2A 2PMZL 4A3JK 4A3LK 1XZQB 4C3JK 3GTMK 3GTPC 1BDFA 1TWAK 3S1RC 4Y7NK 4YFXA 2JA5K 5IP7K 4A3BK 2ZUFA 5IOSA 1WOPA 5HL8A 4C3IK 3K7AK 4OIQA 1TWGC 1L0WA 1IQ0A 1O27A 2R7ZK 1TWHA 5E68A 4XSZA 4Y52K 4BY1K 2A68A 4QIWL 3AQOA 4BY7C 5L46A 1Y1WA 1EFWA 1VH2A 2NVYA 3EQLA 4A3GK 2NVQC 1USMA 2V6UA 4KB4A 5M3FK 3HOXK 3HOWC 5IYCK 3RZDK 3TTGA 3N0CA 3S1NK 3GTOC 1ZBSA 3TFJA 2JA8K 2JA6K 1I3QK 4G0WA 1O26A 1YCLA 3BP3A 3GIRA 3HOVK 4QJVB 2YU9A 4KATA 1XPPA 3S1QK 1F9NA 2NVXA 4BXXC 1HI9A 4GZYA 2E2IA 1XXAA 5CJ9A 1DCOA 3LPXA 1INNA 1K83A 3S1MC 1SFOC 4GTBA 1TWAA 3DXJA 4KC6A 4A3FC 2VUMC 4C2MK 3I4NC 1Y1WC 3I4MK 3FKIK 5C3EK 2R7ZA 2Y0SD 3AD8C 5C4JK 2E2HK 1EH1A 2E2JC 1TWGA 5FLMC 4AH6A 4PABA 1Y1VC 4GFQA 2FQOA 2CFAA 3GTKK 4NOIA 3HOZC 3HOYC 3S14C 2GAGC 1VLOA 3GSIA 3AD7C 4G7ZA 2Y3PA 4LQYA 3S2DK 3N3YA 3M4OK 4A3EC 4A93K 5D4DA 4LJZA 3G4AA 3PO3K 3CQZK 3GTGC 5IYDK 4O2DA 5IP9K 4OIPA 5C44C 2E2IC 4P9SA 4KMHA 2NVTK 2P5MA 4A3LC 4Q4ZA 4A3JC 2JA6A 1I3QA 1C0AA 1YNNA 4C3JC 3GTMC 1XZPB 5TMCA 1XXCA 3GTJK 4BBRK 1JQWA 3RZOC 1TWAC 2R92K 4Y7NC 4GTDA 2R93A 2JA5C 4WJ3M 2GSUA 5IP7C 4MEXA 4A3BC 3GTOA 4PAAA 4GTCA 1WQGA 4C3IC 3K7AC 1YX2A 4KB2A 2PMZD 4KDDA 1O2AA 2XCOA 1I50K 2R7ZC 4Y52C 4BY1C 4C3HK 4KN4A 3GTLK 1JVIA 1VRQC 1ZYRA 4P5AA 3S17K 3BUEA 3FKIA 1SFOA 4A3GC 2VUMA 1J6WA 4A3MK 1BJTA 3HOXC 1RU0A 4QIWD 5IYCC 3RZDC 1B4AA 4KMDA 3LAPA 3GEHA 1WIHA 3M3YK 5FJ8K 2PA8L 4BKWA 4KMAA 2B63K 3S1NC 4G0VA 3TFIA 3WODA 1VJEA 4AYBL 2JA8C 2JA6C 1I3QC 1Y1VA 3HOVC 4BBSK 3CQZA 3S16K
chains in the Genus database with same CATH topology
4XLPA 2VUMC 3S1QC 5M3MK 3HOUK 2R93C 4C2MK 2B63C 2E2JK 4KMUA 5TMFA 5FLMK 3I4NC 4G7OA 1K83K 2A6HA 1Y1WC 3I4MK 1Y1VK 4A3CC 3FKIK 3RZOK 1I6VA 3HOZK 2YU9C 3PO2K 1HQMA 5M5YK 3HOYK 5C3EK 3S16K 3S14K 2NVXC 1TWFK 1SMYA 1WCMC 3H0GC 4BBSC 3S16C 4A3EK 2Y0SD 3HOUC 2PA8D 5C4JK 2E2HK 2E2JC 5C4XK 5FLMC 4XLNA 3GTPK 1K83C 2O5IA 3I4MC 1Y1VC 4KN7A 4AYBD 3FKIC 4YG2A 3S1RK 3GTGK 3GTKK 3HOZC 4NOIA 3HOYC 3PO2C 5C3EC 5C44K 3S14C 2E2IK 4LK0A 2WAQL 1TWFC 3S2DK 4G7ZA 2JA7K 2O5JA 3M4OK 4YFNA 4A3EC 4A3LK 2PMZL 4A3JK 4A93K 1TWGK 5D4DA 5C4JC 4A3DK 4C3JK 3GTMK 5C4XC 4LJZA 3HKZL 3PO3K 3GTPC 1BDFA 1TWAK 3S2HK 3S1RC 4Y7NK 3CQZK 3GTGC 4X6AK 4YFXA 4A3KK 2JA5K 3GTKC 5IP7K 3GTQK 5IP9K 5IYDK 4OIPA 5C44C 4A3BK 2E2IC 3S15K 4BY7K 3S2DC 2NVTK 2JA7C 4C3IK 4A3LC 3K7AK 4Q4ZA 4A3JC 4LLGA 1TWGC 4OIQA 4A93C 1I6HK 4A3DC 1YNNA 3GTMC 3H3VL 5TMCA 3GTJK 3M3YC 2R7ZK 4BBRK 2NVQK 3PO3C 3RZOC 5M5WK 1TWAC 4XSZA 2R92K 3S2HC 4Y52K 4Y7NC 3CQZC 2A68A 4BY1K 4A3KC 5IYDC 2JA5C 4X6AC 4QIWL 5IP7C 5IP9C 3GTQC 4MEXA 2PPBA 4A3BC 3HOWK 3S15C 4BY7C 1TWCK 2NVTC 2WAQD 2E2HC 3K7AC 4OIRA 2PMZD 1I6HC 1TWHK 3EQLA 3GTJC 1I50K 2R7ZC 4BBRC 2NVQC 3HKZD 4A3GK 2R93K 2R92C 4Y52C 5M3FK 3HOXK 3GTOK 1YNJA 4BY1C 4C3HK 4KN4A 3GTLK 1ZYRA 4JK1A 4LK1A 3HOWC 3S17K 5IYCK 3RZDK 3M4OC 1TWCC 4YFKA 4Q5SA 4OIOA 2NVYK 5M5XK 1R9TK 1TWHC 3S1NK 4BXXK 3H3VD 2WB1L 1I50C 4A3GC 4A3MK 1IW7A 2BE5A 2WB1D 3HOXC 4A3IK 3GTOC 2JA8K 3GTLC 2JA6K 1I3QK 4QIWD 3S17C 4MEYA 5IYCC 3RZDC 3S1MK 4ZH4A 1SFOK 3HOVK 2A6EA 2CW0A 2NVYC 4QJVB 4XSXA 5IYBK 3M3YK 2Y0SL 1XPPA 4A3FK 5FJ8K 2VUMK 3S1QK 2PA8L 1R9TC 2B63K 3S1NC 4BXXC 4GZYA 3WODA 4A3MC 4G7HA 4A3IC 3I4NK 4MQ9A 4AYBL 1Y1WK 4A3CK 2JA8C 2JA6C 1I3QC 2YU9K 4OINA 3S1MC 4QJVA 1SFOC 3HOVC 2NVXK 1WCMK 5IYBC 3H0GK 4BBSK 2A69A 3DXJA 4A3FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP A;  2VUM C;  3S1Q C;  5M3M K;  3HOU K;  2R93 C;  4C2M K;  2B63 C;  2E2J K;  4KMU A;  5TMF A;  5FLM K;  3I4N C;  4G7O A;  1K83 K;  2A6H A;  1Y1W C;  3I4M K;  1Y1V K;  4A3C C;  3FKI K;  3RZO K;  1I6V A;  3HOZ K;  2YU9 C;  3PO2 K;  1HQM A;  5M5Y K;  3HOY K;  5C3E K;  3S16 K;  3S14 K;  2NVX C;  1TWF K;  1SMY A;  1WCM C;  3H0G C;  4BBS C;  3S16 C;  4A3E K;  2Y0S D;  3HOU C;  2PA8 D;  5C4J K;  2E2H K;  2E2J C;  5C4X K;  5FLM C;  4XLN A;  3GTP K;  1K83 C;  2O5I A;  3I4M C;  1Y1V C;  4KN7 A;  4AYB D;  3FKI C;  4YG2 A;  3S1R K;  3GTG K;  3GTK K;  3HOZ C;  4NOI A;  3HOY C;  3PO2 C;  5C3E C;  5C44 K;  3S14 C;  2E2I K;  4LK0 A;  2WAQ L;  1TWF C;  3S2D K;  4G7Z A;  2JA7 K;  2O5J A;  3M4O K;  4YFN A;  4A3E C;  4A3L K;  2PMZ L;  4A3J K;  4A93 K;  1TWG K;  5D4D A;  5C4J C;  4A3D K;  4C3J K;  3GTM K;  5C4X C;  4LJZ A;  3HKZ L;  3PO3 K;  3GTP C;  1BDF A;  1TWA K;  3S2H K;  3S1R C;  4Y7N K;  3CQZ K;  3GTG C;  4X6A K;  4YFX A;  4A3K K;  2JA5 K;  3GTK C;  5IP7 K;  3GTQ K;  5IP9 K;  5IYD K;  4OIP A;  5C44 C;  4A3B K;  2E2I C;  3S15 K;  4BY7 K;  3S2D C;  2NVT K;  2JA7 C;  4C3I K;  4A3L C;  3K7A K;  4Q4Z A;  4A3J C;  4LLG A;  1TWG C;  4OIQ A;  4A93 C;  1I6H K;  4A3D C;  1YNN A;  3GTM C;  3H3V L;  5TMC A;  3GTJ K;  3M3Y C;  2R7Z K;  4BBR K;  2NVQ K;  3PO3 C;  3RZO C;  5M5W K;  1TWA C;  4XSZ A;  2R92 K;  3S2H C;  4Y52 K;  4Y7N C;  3CQZ C;  2A68 A;  4BY1 K;  4A3K C;  5IYD C;  2JA5 C;  4X6A C;  4QIW L;  5IP7 C;  5IP9 C;  3GTQ C;  4MEX A;  2PPB A;  4A3B C;  3HOW K;  3S15 C;  4BY7 C;  1TWC K;  2NVT C;  2WAQ D;  2E2H C;  3K7A C;  4OIR A;  2PMZ D;  1I6H C;  1TWH K;  3EQL A;  3GTJ C;  1I50 K;  2R7Z C;  4BBR C;  2NVQ C;  3HKZ D;  4A3G K;  2R93 K;  2R92 C;  4Y52 C;  5M3F K;  3HOX K;  3GTO K;  1YNJ A;  4BY1 C;  4C3H K;  4KN4 A;  3GTL K;  1ZYR A;  4JK1 A;  4LK1 A;  3HOW C;  3S17 K;  5IYC K;  3RZD K;  3M4O C;  1TWC C;  4YFK A;  4Q5S A;  4OIO A;  2NVY K;  5M5X K;  1R9T K;  1TWH C;  3S1N K;  4BXX K;  3H3V D;  2WB1 L;  1I50 C;  4A3G C;  4A3M K;  1IW7 A;  2BE5 A;  2WB1 D;  3HOX C;  4A3I K;  3GTO C;  2JA8 K;  3GTL C;  2JA6 K;  1I3Q K;  4QIW D;  3S17 C;  4MEY A;  5IYC C;  3RZD C;  3S1M K;  4ZH4 A;  1SFO K;  3HOV K;  2A6E A;  2CW0 A;  2NVY C;  4QJV B;  4XSX A;  5IYB K;  3M3Y K;  2Y0S L;  1XPP A;  4A3F K;  5FJ8 K;  2VUM K;  3S1Q K;  2PA8 L;  1R9T C;  2B63 K;  3S1N C;  4BXX C;  4GZY A;  3WOD A;  4A3M C;  4G7H A;  4A3I C;  3I4N K;  4MQ9 A;  4AYB L;  1Y1W K;  4A3C K;  2JA8 C;  2JA6 C;  1I3Q C;  2YU9 K;  4OIN A;  3S1M C;  4QJV A;  1SFO C;  3HOV C;  2NVX K;  1WCM K;  5IYB C;  3H0G K;  4BBS K;  2A69 A;  3DXJ A;  4A3F C; 
#chains in the Genus database with same CATH topology
 4XLP A;  3S1Q C;  3HOU K;  2R93 C;  5IOT A;  1EQR A;  3GDZ A;  1PJ5 A;  2ZUE A;  1J98 A;  3GTG A;  2FQT A;  4C2M C;  2RGR A;  1WOS A;  5C4X K;  4XLN A;  3T01 A;  3I4M C;  1EK8 A;  3GTM A;  4KN7 A;  3FKI C;  3Q3Q A;  4BLB A;  1GE9 A;  1I50 A;  5C3E C;  3GEE A;  2PHC B;  2WAQ L;  2JA5 A;  2JA7 K;  1WQF A;  1DD5 A;  5C4J C;  1KQ4 A;  4A3D K;  5CHP A;  1XZP A;  3HKZ L;  2GSO A;  1DCP A;  5JFE A;  4GT9 A;  3S2H K;  4X6A K;  4A3K K;  1J6V A;  3GTK C;  3GTQ K;  3MML B;  3A8K A;  3AQP A;  3S15 K;  4KAR A;  3S2D C;  1XZQ A;  2XCR B;  4A93 C;  1I6H K;  3H3V L;  3PO3 C;  5M5W K;  3CQZ C;  5IYD C;  5IP9 C;  1VGX A;  1WSR A;  1TWC K;  2NVT C;  1WOR A;  2KWA A;  5EGH A;  1TWH K;  1WQH A;  1UV7 A;  3GTJ C;  4BBR C;  4J3N A;  4GTF A;  2R92 C;  1ISE A;  4JK1 A;  4YFK A;  3LAJ A;  4OIO A;  1EI6 A;  2NVY K;  3CAG A;  1F7U A;  1R9T K;  3S0X A;  1I50 C;  2WB1 L;  2BE5 A;  2WB1 D;  4A3I K;  1V5V A;  4C3H C;  3GTL C;  3FOE A;  3S17 C;  4KAW X;  4MEY A;  3OEP A;  1USO A;  4ZH4 A;  2CW0 A;  5IYB K;  1BS2 A;  2XCQ A;  1B4B A;  3TFH A;  3NUH A;  2V6S A;  4A3M C;  4G7H A;  3L4K A;  4A3C K;  2YU9 K;  4P5B A;  1PJ7 A;  4OIN A;  4QJV A;  2NVX K;  1WCM K;  2GAH C;  3H0G K;  2A69 A;  3M3Y C;  1DCH A;  5M3M K;  2B63 C;  1IBA A;  4ILD A;  3T00 A;  1F7V A;  2E2H A;  1K83 K;  2A6H A;  3RZO K;  1I6V A;  3PO2 K;  5M5Y K;  2CFA B;  3HXA A;  1TWF K;  1SMY A;  3GTK A;  4BBS C;  3S16 C;  3HOU C;  2PA8 D;  3SZY A;  1TWC A;  2RH6 A;  1IE0 A;  3GTP K;  3FHZ A;  2O5I A;  3GEI A;  3S1R K;  4AYB D;  4LK0 A;  4YFN A;  1TWG K;  3IPJ A;  4FM9 A;  5C4X C;  4KM9 A;  4LR2 A;  2D6F C;  3FOF A;  4BLA A;  1R9T A;  3GTJ A;  2GSN A;  2R92 A;  3V4G A;  4BY7 K;  1X31 C;  2JA7 C;  4DDQ A;  4LLG A;  1WSV A;  3G4C A;  4A3D C;  2JH3 A;  3VA7 A;  1O29 A;  2NVQ K;  2V6T A;  3S2H C;  1ZQ1 C;  4X6A C;  4A3K C;  3GTQ C;  4KAS A;  2PPB A;  3HOW K;  3S15 C;  3ORE A;  3GTL A;  2WAQ D;  4FZB A;  4G0U A;  2E2H C;  4OIR A;  1I6H C;  1J6X A;  1O24 A;  4GTL A;  2R93 K;  1WCM A;  3HKZ D;  3H0G A;  3L4J A;  3ERE D;  4RMF A;  3GTO K;  1YNJ A;  4LK1 A;  3T02 A;  3M4O C;  1TWC C;  3A8I A;  4Q5S A;  4XCH A;  5M5X K;  1TWH C;  1F93 A;  3JST A;  4BXX K;  1O2B A;  3H3V D;  1TWF A;  2B63 A;  1IW7 A;  3BP8 C;  1BGW A;  2ZFZ A;  4KM8 A;  3S1M K;  3GTP A;  1SFO K;  3A8J A;  2A6E A;  2NVY C;  3QX3 A;  4XSX A;  2Y0S L;  4A3F K;  2VUM K;  1G51 A;  1R9T C;  4A3I C;  3I4N K;  4MQ9 A;  1Y1W K;  1O28 A;  1JOE A;  2P8T A;  3SZZ A;  5IYB C;  4WIL A;  1IS1 A;  2E2J K;  1PJ6 A;  4KMU A;  5TMF A;  5FLM K;  5JVO A;  5TJ3 A;  2W7V A;  3N0B A;  4G7O A;  4A3C C;  1Y1V K;  4LOW A;  1XXB A;  3HOZ K;  4M1X A;  2YU9 C;  1HQM A;  3HOY K;  5IOQ A;  3S14 K;  2EBB A;  1O25 A;  1WCM C;  3OPF A;  4GTA A;  3H0G C;  2NVX C;  1ZVU A;  4A3E K;  1AB4 A;  3AD9 C;  4C45 A;  1WOO A;  2JA7 A;  3ADA C;  5EGE A;  1K83 C;  3AH5 A;  5IOR A;  4YG2 A;  3GTG K;  4GTE A;  3PO2 C;  4WJ4 A;  5C44 K;  2E2I K;  1TWF C;  1ZXO A;  2O5J A;  1O2F B;  3GTQ A;  1IL2 A;  2PMZ L;  4A3J K;  4A3L K;  1XZQ B;  4C3J K;  3GTM K;  3GTP C;  1BDF A;  1TWA K;  3S1R C;  4Y7N K;  4YFX A;  2JA5 K;  5IP7 K;  4A3B K;  2ZUF A;  5IOS A;  1WOP A;  5HL8 A;  4C3I K;  3K7A K;  4OIQ A;  1TWG C;  1L0W A;  1IQ0 A;  1O27 A;  2R7Z K;  1TWH A;  5E68 A;  4XSZ A;  4Y52 K;  4BY1 K;  2A68 A;  4QIW L;  3AQO A;  4BY7 C;  5L46 A;  1Y1W A;  1EFW A;  1VH2 A;  2NVY A;  3EQL A;  4A3G K;  2NVQ C;  1USM A;  2V6U A;  4KB4 A;  5M3F K;  3HOX K;  3HOW C;  5IYC K;  3RZD K;  3TTG A;  3N0C A;  3S1N K;  3GTO C;  1ZBS A;  3TFJ A;  2JA8 K;  2JA6 K;  1I3Q K;  4G0W A;  1O26 A;  1YCL A;  3BP3 A;  3GIR A;  3HOV K;  4QJV B;  2YU9 A;  4KAT A;  1XPP A;  3S1Q K;  1F9N A;  2NVX A;  4BXX C;  1HI9 A;  4GZY A;  2E2I A;  1XXA A;  5CJ9 A;  1DCO A;  3LPX A;  1INN A;  1K83 A;  3S1M C;  1SFO C;  4GTB A;  1TWA A;  3DXJ A;  4KC6 A;  4A3F C;  2VUM C;  4C2M K;  3I4N C;  1Y1W C;  3I4M K;  3FKI K;  5C3E K;  2R7Z A;  2Y0S D;  3AD8 C;  5C4J K;  2E2H K;  1EH1 A;  2E2J C;  1TWG A;  5FLM C;  4AH6 A;  4PAB A;  1Y1V C;  4GFQ A;  2FQO A;  2CFA A;  3GTK K;  4NOI A;  3HOZ C;  3HOY C;  3S14 C;  2GAG C;  1VLO A;  3GSI A;  3AD7 C;  4G7Z A;  2Y3P A;  4LQY A;  3S2D K;  3N3Y A;  3M4O K;  4A3E C;  4A93 K;  5D4D A;  4LJZ A;  3G4A A;  3PO3 K;  3CQZ K;  3GTG C;  5IYD K;  4O2D A;  5IP9 K;  4OIP A;  5C44 C;  2E2I C;  4P9S A;  4KMH A;  2NVT K;  2P5M A;  4A3L C;  4Q4Z A;  4A3J C;  2JA6 A;  1I3Q A;  1C0A A;  1YNN A;  4C3J C;  3GTM C;  1XZP B;  5TMC A;  1XXC A;  3GTJ K;  4BBR K;  1JQW A;  3RZO C;  1TWA C;  2R92 K;  4Y7N C;  4GTD A;  2R93 A;  2JA5 C;  4WJ3 M;  2GSU A;  5IP7 C;  4MEX A;  4A3B C;  3GTO A;  4PAA A;  4GTC A;  1WQG A;  4C3I C;  3K7A C;  1YX2 A;  4KB2 A;  2PMZ D;  4KDD A;  1O2A A;  2XCO A;  1I50 K;  2R7Z C;  4Y52 C;  4BY1 C;  4C3H K;  4KN4 A;  3GTL K;  1JVI A;  1VRQ C;  1ZYR A;  4P5A A;  3S17 K;  3BUE A;  3FKI A;  1SFO A;  4A3G C;  2VUM A;  1J6W A;  4A3M K;  1BJT A;  3HOX C;  1RU0 A;  4QIW D;  5IYC C;  3RZD C;  1B4A A;  4KMD A;  3LAP A;  3GEH A;  1WIH A;  3M3Y K;  5FJ8 K;  2PA8 L;  4BKW A;  4KMA A;  2B63 K;  3S1N C;  4G0V A;  3TFI A;  3WOD A;  1VJE A;  4AYB L;  2JA8 C;  2JA6 C;  1I3Q C;  1Y1V A;  3HOV C;  4BBS K;  3CQZ A;  3S16 K; 
#chains in the Genus database with same CATH homology
 4XLP A;  2VUM C;  3S1Q C;  5M3M K;  3HOU K;  2R93 C;  4C2M K;  2B63 C;  2E2J K;  4KMU A;  5TMF A;  5FLM K;  3I4N C;  4G7O A;  1K83 K;  2A6H A;  1Y1W C;  3I4M K;  1Y1V K;  4A3C C;  3FKI K;  3RZO K;  1I6V A;  3HOZ K;  2YU9 C;  3PO2 K;  1HQM A;  5M5Y K;  3HOY K;  5C3E K;  3S16 K;  3S14 K;  2NVX C;  1TWF K;  1SMY A;  1WCM C;  3H0G C;  4BBS C;  3S16 C;  4A3E K;  2Y0S D;  3HOU C;  2PA8 D;  5C4J K;  2E2H K;  2E2J C;  5C4X K;  5FLM C;  4XLN A;  3GTP K;  1K83 C;  2O5I A;  3I4M C;  1Y1V C;  4KN7 A;  4AYB D;  3FKI C;  4YG2 A;  3S1R K;  3GTG K;  3GTK K;  3HOZ C;  4NOI A;  3HOY C;  3PO2 C;  5C3E C;  5C44 K;  3S14 C;  2E2I K;  4LK0 A;  2WAQ L;  1TWF C;  3S2D K;  4G7Z A;  2JA7 K;  2O5J A;  3M4O K;  4YFN A;  4A3E C;  4A3L K;  2PMZ L;  4A3J K;  4A93 K;  1TWG K;  5D4D A;  5C4J C;  4A3D K;  4C3J K;  3GTM K;  5C4X C;  4LJZ A;  3HKZ L;  3PO3 K;  3GTP C;  1BDF A;  1TWA K;  3S2H K;  3S1R C;  4Y7N K;  3CQZ K;  3GTG C;  4X6A K;  4YFX A;  4A3K K;  2JA5 K;  3GTK C;  5IP7 K;  3GTQ K;  5IP9 K;  5IYD K;  4OIP A;  5C44 C;  4A3B K;  2E2I C;  3S15 K;  4BY7 K;  3S2D C;  2NVT K;  2JA7 C;  4C3I K;  4A3L C;  3K7A K;  4Q4Z A;  4A3J C;  4LLG A;  1TWG C;  4OIQ A;  4A93 C;  1I6H K;  4A3D C;  1YNN A;  3GTM C;  3H3V L;  5TMC A;  3GTJ K;  3M3Y C;  2R7Z K;  4BBR K;  2NVQ K;  3PO3 C;  3RZO C;  5M5W K;  1TWA C;  4XSZ A;  2R92 K;  3S2H C;  4Y52 K;  4Y7N C;  3CQZ C;  2A68 A;  4BY1 K;  4A3K C;  5IYD C;  2JA5 C;  4X6A C;  4QIW L;  5IP7 C;  5IP9 C;  3GTQ C;  4MEX A;  2PPB A;  4A3B C;  3HOW K;  3S15 C;  4BY7 C;  1TWC K;  2NVT C;  2WAQ D;  2E2H C;  3K7A C;  4OIR A;  2PMZ D;  1I6H C;  1TWH K;  3EQL A;  3GTJ C;  1I50 K;  2R7Z C;  4BBR C;  2NVQ C;  3HKZ D;  4A3G K;  2R93 K;  2R92 C;  4Y52 C;  5M3F K;  3HOX K;  3GTO K;  1YNJ A;  4BY1 C;  4C3H K;  4KN4 A;  3GTL K;  1ZYR A;  4JK1 A;  4LK1 A;  3HOW C;  3S17 K;  5IYC K;  3RZD K;  3M4O C;  1TWC C;  4YFK A;  4Q5S A;  4OIO A;  2NVY K;  5M5X K;  1R9T K;  1TWH C;  3S1N K;  4BXX K;  3H3V D;  2WB1 L;  1I50 C;  4A3G C;  4A3M K;  1IW7 A;  2BE5 A;  2WB1 D;  3HOX C;  4A3I K;  3GTO C;  2JA8 K;  3GTL C;  2JA6 K;  1I3Q K;  4QIW D;  3S17 C;  4MEY A;  5IYC C;  3RZD C;  3S1M K;  4ZH4 A;  1SFO K;  3HOV K;  2A6E A;  2CW0 A;  2NVY C;  4QJV B;  4XSX A;  5IYB K;  3M3Y K;  2Y0S L;  1XPP A;  4A3F K;  5FJ8 K;  2VUM K;  3S1Q K;  2PA8 L;  1R9T C;  2B63 K;  3S1N C;  4BXX C;  4GZY A;  3WOD A;  4A3M C;  4G7H A;  4A3I C;  3I4N K;  4MQ9 A;  4AYB L;  1Y1W K;  4A3C K;  2JA8 C;  2JA6 C;  1I3Q C;  2YU9 K;  4OIN A;  3S1M C;  4QJV A;  1SFO C;  3HOV C;  2NVX K;  1WCM K;  5IYB C;  3H0G K;  4BBS K;  2A69 A;  3DXJ A;  4A3F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...