3HOUK

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3houK00
3HOVC 3K7AK 4A3BC 4OINA 1TWCC 2O5JA 5IP9C 4C3HK 1ZYRA 3EQLA 4X6AC 3S1MC 1Y1VC 2PMZD 4YFNA 1SFOK 3S1RK 2CW0A 2E2IC 3S2DK 3S1QK 2NVQC 4BBSK 4A3GC 3HKZD 1TWFC 4QIWD 4A3JK 4LLGA 3S17C 3HOXK 1TWAC 5C3EK 2BE5A 3I4NC 4BXXC 1R9TK 4BY7C 4XLPA 4A3IK 5C4XC 2PPBA 4A93K 5C44K 2R92K 3HOZK 2E2JK 4G7OA 5D4DA 4A3DK 4C3JK 4OIOA 3S2HC 4A3EC 3S15K 4C2MK 1SMYA 4A3KC 2B63C 1TWHK 2Y0SD 3S1NC 1I50K 3RZDK 2A6HA 3GTJK 4MQ9A 2JA5K 3K7AC 4LK1A 3GTOK 2YU9C 5IYDK 1SFOC 3S1RC 3S1QC 4XLNA 4BBSC 5C4JK 4AYBD 4A3JC 4Q5SA 2PMZL 5FJ8K 3HOXC 5C3EC 2E2HK 1YNJA 1R9TC 4A3IC 4G7HA 3H3VL 2NVXC 4BBRC 3HKZL 4KN7A 4A3FK 4A93C 5C44C 2R92C 3HOZC 2R93K 3H0GK 3S15C 1TWGK 5M5XK 3GTLC 2JA7C 1TWHC 1I50C 2PA8L 1HQMA 3RZDC 4A3CC 2A69A 1Y1WK 2O5IA 2JA5C 3GTOC 2VUMK 5TMFA 4LK0A 4LJZA 4BY1C 5IYDC 5M5YK 1K83K 3M3YK 2JA8K 3GTPK 3HOWK 4Y7NK 2NVYK 4JK1A 3HOYK 5C4JC 3RZOK 1I6HK 2E2HC 3S14K 4MEYA 4A3LK 4AYBL 3FKIK 4A3FC 3GTGK 3S2DC 4QJVA 3PO3K 3M4OK 2R93C 4OIQA 5IP7K 4A3MK 4Y52K 3GTQK 1TWGC 4XSZA 2JA6K 3HOVK 5IP9K 4YG2A 5M3FK 4OIRA 4QIWL 4X6AK 3DXJA 4QJVB 2E2JC 2VUMC 4A3DC 5IYCK 3GTKK 3M3YC 2JA8C 1BDFA 3GTPC 4Y7NC 2NVYC 3HOWC 3HOYC 2NVTK 3GTJC 3RZOC 2WB1D 1I6HC 1WCMK 3S14C 4NOIA 3I4MK 3HOUK 4A3LC 2Y0SL 2R7ZK 5FLMK 3GTGC 3S2HK 4A3KK 3PO3C 3PO2K 4Y52C 5IP7C 4A3MC 2WAQD 2JA6C 4C3IK 2YU9K 3CQZK 3S16K 5IYBK 3H0GC 4GZYA 4OIPA 5IYCC 3H3VD 1I3QK 5M3MK 3GTMK 1XPPA 3GTKC 4XSXA 4A3BK 1TWCK 4YFXA 2NVTC 1Y1WC 1Y1VK 2A6EA 4BBRK 2NVXK 3S1MK 1WCMC 2E2IK 3I4MC 3HOUC 2NVQK 4A3GK 2R7ZC 2PA8D 1TWFK 5FLMC 1K83C 4KN4A 4YFKA 2WB1L 3S17K 1TWAK 4BXXK 3GTLK 1I6VA 2JA7K 5C4XK 3I4NK 3PO2C 4BY7K 4KMUA 5M5WK 4A3CK 5TMCA 4MEXA 1IW7A 3CQZC 3S16C 3FKIC 4ZH4A 5IYBC 4A3EK 4BY1K 1YNNA 2A68A 2WAQL 4Q4ZA 2B63K 3M4OC 3S1NK 3WODA 1I3QC 4G7ZA 3GTMC 3GTQC
chains in the Genus database with same CATH superfamily
3HOVC 1J6XA 3K7AK 3GEIA 4KC6A 5IP9C 2NVYA 1Y1VC 4YFNA 1DCPA 3S1QK 1WSRA 3HKZD 1TWFC 4A3JK 1EH1A 2BE5A 3N0CA 1R9TK 4XCHA 4M1XA 4A93K 2E2JK 3S15K 4A3KC 3OEPA 4KM9A 2A6HA 3GTJK 4MQ9A 2JA5K 3K7AC 2YU9C 1Y1WA 3S1QC 5C4JK 4A3JC 3CAGA 4Q5SA 4PABA 1R9TC 4A93C 4GT9A 4KARA 3S15C 4KATA 3FKIA 3AQOA 2PA8L 1I3QA 2JA5C 2VUMK 1O27A 5TMFA 4LK0A 4BY1C 1K83K 3M3YK 3HOWK 5C4JC 2V6UA 3ADAC 4MEYA 4A3LK 1O2BA 3A8JA 1WCMA 5IP7K 2JA6K 1G51A 1UV7A 4OIRA 3A8IA 4YG2A 4QIWL 1XZPB 3DXJA 5EGHA 2VUMC 4A3DC 3AH5A 3M3YC 2D6FC 1BDFA 3HOWC 1BJTA 5IORA 3HOUK 4A3LC 2GSUA 1O2FB 4KASA 3L4KA 1JVIA 5IP7C 2FQTA 4GTFA 2JA6C 3T01A 4BLBA 3CQZK 1WIHA 3S16K 1XZPA 3SZZA 4GZYA 4KB4A 1XPPA 1B4BA 4P5AA 1TWCK 2FQOA 4P5BA 2NVXK 2E2IK 3OPFA 3HOUC 2NVQK 2PA8D 1USMA 2WB1L 3S17K 1TWAK 2P5MA 4BY7K 5C4XK 4KMUA 4MEXA 1O24A 3CQZC 3S16C 4ZH4A 4A3EK 2A68A 3M4OC 2B63K 3WODA 3TFIA 4G7ZA 3GTQC 1ISEA 1RU0A 1TWCC 1WQFA 4X6AC 2PMZD 2E2IC 3S2DK 2NVQC 4WILA 4BBSK 4QIWD 4LLGA 3S17C 1TWAC 5C3EK 4BY7C 5C4XC 2GAHC 3HOZK 1KQ4A 5D4DA 3VA7A 3S2HC 4A3EC 3JSTA 4G0VA 2B63C 1EI6A 3GIRA 1IQ0A 3H0GA 2R93A 3RZDK 3GSIA 4KB2A 2V6SA 3FHZA 3GTKA 4BBSC 4GTEA 1WORA 4AYBD 5C3EC 3H3VL 4BBRC 2ZFZA 3HOZC 1VH2A 1EQRA 5M5XK 3GTLC 2JA7C 3RZDC 2A69A 1Y1WK 3AD9C 5JVOA 1IBAA 4LJZA 3QX3A 5M5YK 1Y1VA 3LAJA 3AD8C 4WJ4A 3HOYK 1TWFA 1I6HK 2EBBA 3AQPA 1IS1A 3FKIK 1ZVUA 3GTGK 3PO3K 4OIQA 2XCOA 3TTGA 5IOSA 1YCLA 2E2JC 1J6WA 3HXAA 2YU9A 4KMAA 1C0AA 3HOYC 3GTJC 4GFQA 1I6HC 1WCMK 1VJEA 3I4MK 4O2DA 2R7ZK 1R9TA 1F9NA 3GTGC 3PO3C 1GE9A 1WQGA 2JA5A 4OIPA 3H3VD 4G0WA 4XSXA 1O29A 4ILDA 3S1MK 1WCMC 2PHCB 3I4MC 3OREA 4A3GK 2R7ZC 4WJ3M 1K83C 4YFKA 1SFOA 4BXXK 3I4NK 1I6VA 5M5WK 4A3CK 1YNNA 2WAQL 2VUMA 3T00A 3FOEA 3S1NK 1XXBA 1JOEA 2O5JA 4OINA 4C3HK 3EQLA 1YX2A 3S1MC 3S1RK 4J3NA 4A3GC 2CFAA 1L0WA 3HOXK 4BXXC 3I4NC 1WOPA 4XLPA 2PPBA 1BGWA 4FZBA 3FOFA 5C44K 2R92K 2JA6A 4OIOA 4C2MK 1TWHK 3S1NC 3GDZA 1I50K 3Q3QA 3GTOK 4LK1A 4C3HC 1VRQC 2GSNA 5IYDK 1ZQ1C 3S1RC 3HOXC 2E2HK 3GTPA 2ZUEA 4BLAA 2NVXC 3HKZL 4LR2A 4KN7A 5C44C 2R92C 2R93K 3H0GK 1USOA 1TWGK 4C2MC 1O25A 1TWHC 1I50C 3SZYA 2O5IA 3GTQA 3GTOC 1TWCA 1XXCA 5IYDC 5HL8A 2E2IA 2JA8K 2NVYK 3N3YA 2E2HC 3S14K 2GSOA 2XCQA 3S2DC 4LOWA 4QJVA 2R93C 1J98A 3AD7C 3L4JA 4GTCA 1TWGC 1XZQB 4KM8A 3HOVK 1DCOA 5IP9K 5M3FK 5IYCK 2JA8C 2NVYC 2NVTK 3GTMA 2WB1D 3S14C 3N0BA 2Y0SL 5FLMK 4A3KK 1WOSA 1XZQA 1IL2A 3S0XA 3GTLA 2JA7A 4BKWA 2YU9K 5IYBK 3G4AA 3LAPA 1VGXA 5IYCC 1I3QK 5M3MK 4KMHA 1DCHA 4A3BK 3TFHA 4YFXA 2NVTC 1Y1WC 3V4GA 5FLMC 5L46A 1INNA 3TFJA 5CJ9A 1IE0A 3A8KA 3FKIC 5IYBC 4BY1K 1I3QC 3LPXA 4A3BC 1ZYRA 1VLOA 3GTJA 1SFOK 2CW0A 3BP3A 1B4AA 3GTGA 2RH6A 4A3IK 4G7OA 2CFAB 1O2AA 4A3DK 4C3JK 2V6TA 1WSVA 2ZUFA 1SMYA 2Y0SD 4G0UA 4RMFA 1F7VA 1SFOC 1EFWA 4XLNA 3GEEA 5IOQA 2R7ZA 1EK8A 2PMZL 5FJ8K 1K83A 1YNJA 4A3IC 4G7HA 4GTBA 4A3FK 4C3JC 2GAGC 1PJ6A 5JFEA 1HQMA 1V5VA 4A3CC 1HI9A 1AB4A 4GTLA 1JQWA 1J6VA 4GTAA 4PAAA 3GTPK 3RZOK 4Y7NK 1ZBSA 4JK1A 1ZXOA 4FM9A 3T02A 4AH6A 4AYBL 4A3FC 3NUHA 2P8TA 2Y3PA 3M4OK 5E68A 4Y52K 4A3MK 3GTQK 4XSZA 1WQHA 4X6AK 1DD5A 4DDQA 4KMDA 1WOOA 4QJVB 1O26A 3CQZA 3BUEA 3GTKK 3IPJA 3GTPC 3RZOC 4Y7NC 4LQYA 3BP8C 4NOIA 2NVXA 3S2HK 4C45A 2XCRB 3PO2K 2R92A 4KAWX 4Y52C 4A3MC 1F7UA 2WAQD 1PJ7A 5EGEA 1TWAA 4C3IK 1TWHA 1I50A 3ERED 3H0GC 3GTOA 5CHPA 5IOTA 3GTMK 3GTKC 4GTDA 2B63A 1Y1VK 2A6EA 4BBRK 2JH3A 2E2HA 5TJ3A 2KWAA 3MMLB 2RGRA 1PJ5A 1TWFK 4KN4A 3GTLK 2JA7K 3PO2C 1O28A 1XXAA 4P9SA 5TMCA 1TWGA 2W7VA 1BS2A 4C3IC 4KDDA 1X31C 1IW7A 3G4CA 4Q4ZA 3GEHA 3GTMC 1F93A
chains in the Genus database with same CATH topology
3HOVC 3K7AK 4A3BC 4OINA 1TWCC 2O5JA 5IP9C 4C3HK 1ZYRA 3EQLA 4X6AC 3S1MC 1Y1VC 2PMZD 4YFNA 1SFOK 3S1RK 2CW0A 2E2IC 3S2DK 3S1QK 2NVQC 4BBSK 4A3GC 3HKZD 1TWFC 4QIWD 4A3JK 4LLGA 3S17C 3HOXK 1TWAC 5C3EK 2BE5A 3I4NC 4BXXC 1R9TK 4BY7C 4XLPA 4A3IK 5C4XC 2PPBA 4A93K 5C44K 2R92K 3HOZK 2E2JK 4G7OA 5D4DA 4A3DK 4C3JK 4OIOA 3S2HC 4A3EC 3S15K 4C2MK 1SMYA 4A3KC 2B63C 1TWHK 2Y0SD 3S1NC 1I50K 3RZDK 2A6HA 3GTJK 4MQ9A 2JA5K 3K7AC 4LK1A 3GTOK 2YU9C 5IYDK 1SFOC 3S1RC 3S1QC 4XLNA 4BBSC 5C4JK 4AYBD 4A3JC 4Q5SA 2PMZL 5FJ8K 3HOXC 5C3EC 2E2HK 1YNJA 1R9TC 4A3IC 4G7HA 3H3VL 2NVXC 4BBRC 3HKZL 4KN7A 4A3FK 4A93C 5C44C 2R92C 3HOZC 2R93K 3H0GK 3S15C 1TWGK 5M5XK 3GTLC 2JA7C 1TWHC 1I50C 2PA8L 1HQMA 3RZDC 4A3CC 2A69A 1Y1WK 2O5IA 2JA5C 3GTOC 2VUMK 5TMFA 4LK0A 4LJZA 4BY1C 5IYDC 5M5YK 1K83K 3M3YK 2JA8K 3GTPK 3HOWK 4Y7NK 2NVYK 4JK1A 3HOYK 5C4JC 3RZOK 1I6HK 2E2HC 3S14K 4MEYA 4A3LK 4AYBL 3FKIK 4A3FC 3GTGK 3S2DC 4QJVA 3PO3K 3M4OK 2R93C 4OIQA 5IP7K 4A3MK 4Y52K 3GTQK 1TWGC 4XSZA 2JA6K 3HOVK 5IP9K 4YG2A 5M3FK 4OIRA 4QIWL 4X6AK 3DXJA 4QJVB 2E2JC 2VUMC 4A3DC 5IYCK 3GTKK 3M3YC 2JA8C 1BDFA 3GTPC 4Y7NC 2NVYC 3HOWC 3HOYC 2NVTK 3GTJC 3RZOC 2WB1D 1I6HC 1WCMK 3S14C 4NOIA 3I4MK 3HOUK 4A3LC 2Y0SL 2R7ZK 5FLMK 3GTGC 3S2HK 4A3KK 3PO3C 3PO2K 4Y52C 5IP7C 4A3MC 2WAQD 2JA6C 4C3IK 2YU9K 3CQZK 3S16K 5IYBK 3H0GC 4GZYA 4OIPA 5IYCC 3H3VD 1I3QK 5M3MK 3GTMK 1XPPA 3GTKC 4XSXA 4A3BK 1TWCK 4YFXA 2NVTC 1Y1WC 1Y1VK 2A6EA 4BBRK 2NVXK 3S1MK 1WCMC 2E2IK 3I4MC 3HOUC 2NVQK 4A3GK 2R7ZC 2PA8D 1TWFK 5FLMC 1K83C 4KN4A 4YFKA 2WB1L 3S17K 1TWAK 4BXXK 3GTLK 1I6VA 2JA7K 5C4XK 3I4NK 3PO2C 4BY7K 4KMUA 5M5WK 4A3CK 5TMCA 4MEXA 1IW7A 3CQZC 3S16C 3FKIC 4ZH4A 5IYBC 4A3EK 4BY1K 1YNNA 2A68A 2WAQL 4Q4ZA 2B63K 3M4OC 3S1NK 3WODA 1I3QC 4G7ZA 3GTMC 3GTQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV C;  3K7A K;  4A3B C;  4OIN A;  1TWC C;  2O5J A;  5IP9 C;  4C3H K;  1ZYR A;  3EQL A;  4X6A C;  3S1M C;  1Y1V C;  2PMZ D;  4YFN A;  1SFO K;  3S1R K;  2CW0 A;  2E2I C;  3S2D K;  3S1Q K;  2NVQ C;  4BBS K;  4A3G C;  3HKZ D;  1TWF C;  4QIW D;  4A3J K;  4LLG A;  3S17 C;  3HOX K;  1TWA C;  5C3E K;  2BE5 A;  3I4N C;  4BXX C;  1R9T K;  4BY7 C;  4XLP A;  4A3I K;  5C4X C;  2PPB A;  4A93 K;  5C44 K;  2R92 K;  3HOZ K;  2E2J K;  4G7O A;  5D4D A;  4A3D K;  4C3J K;  4OIO A;  3S2H C;  4A3E C;  3S15 K;  4C2M K;  1SMY A;  4A3K C;  2B63 C;  1TWH K;  2Y0S D;  3S1N C;  1I50 K;  3RZD K;  2A6H A;  3GTJ K;  4MQ9 A;  2JA5 K;  3K7A C;  4LK1 A;  3GTO K;  2YU9 C;  5IYD K;  1SFO C;  3S1R C;  3S1Q C;  4XLN A;  4BBS C;  5C4J K;  4AYB D;  4A3J C;  4Q5S A;  2PMZ L;  5FJ8 K;  3HOX C;  5C3E C;  2E2H K;  1YNJ A;  1R9T C;  4A3I C;  4G7H A;  3H3V L;  2NVX C;  4BBR C;  3HKZ L;  4KN7 A;  4A3F K;  4A93 C;  5C44 C;  2R92 C;  3HOZ C;  2R93 K;  3H0G K;  3S15 C;  1TWG K;  5M5X K;  3GTL C;  2JA7 C;  1TWH C;  1I50 C;  2PA8 L;  1HQM A;  3RZD C;  4A3C C;  2A69 A;  1Y1W K;  2O5I A;  2JA5 C;  3GTO C;  2VUM K;  5TMF A;  4LK0 A;  4LJZ A;  4BY1 C;  5IYD C;  5M5Y K;  1K83 K;  3M3Y K;  2JA8 K;  3GTP K;  3HOW K;  4Y7N K;  2NVY K;  4JK1 A;  3HOY K;  5C4J C;  3RZO K;  1I6H K;  2E2H C;  3S14 K;  4MEY A;  4A3L K;  4AYB L;  3FKI K;  4A3F C;  3GTG K;  3S2D C;  4QJV A;  3PO3 K;  3M4O K;  2R93 C;  4OIQ A;  5IP7 K;  4A3M K;  4Y52 K;  3GTQ K;  1TWG C;  4XSZ A;  2JA6 K;  3HOV K;  5IP9 K;  4YG2 A;  5M3F K;  4OIR A;  4QIW L;  4X6A K;  3DXJ A;  4QJV B;  2E2J C;  2VUM C;  4A3D C;  5IYC K;  3GTK K;  3M3Y C;  2JA8 C;  1BDF A;  3GTP C;  4Y7N C;  2NVY C;  3HOW C;  3HOY C;  2NVT K;  3GTJ C;  3RZO C;  2WB1 D;  1I6H C;  1WCM K;  3S14 C;  4NOI A;  3I4M K;  3HOU K;  4A3L C;  2Y0S L;  2R7Z K;  5FLM K;  3GTG C;  3S2H K;  4A3K K;  3PO3 C;  3PO2 K;  4Y52 C;  5IP7 C;  4A3M C;  2WAQ D;  2JA6 C;  4C3I K;  2YU9 K;  3CQZ K;  3S16 K;  5IYB K;  3H0G C;  4GZY A;  4OIP A;  5IYC C;  3H3V D;  1I3Q K;  5M3M K;  3GTM K;  1XPP A;  3GTK C;  4XSX A;  4A3B K;  1TWC K;  4YFX A;  2NVT C;  1Y1W C;  1Y1V K;  2A6E A;  4BBR K;  2NVX K;  3S1M K;  1WCM C;  2E2I K;  3I4M C;  3HOU C;  2NVQ K;  4A3G K;  2R7Z C;  2PA8 D;  1TWF K;  5FLM C;  1K83 C;  4KN4 A;  4YFK A;  2WB1 L;  3S17 K;  1TWA K;  4BXX K;  3GTL K;  1I6V A;  2JA7 K;  5C4X K;  3I4N K;  3PO2 C;  4BY7 K;  4KMU A;  5M5W K;  4A3C K;  5TMC A;  4MEX A;  1IW7 A;  3CQZ C;  3S16 C;  3FKI C;  4ZH4 A;  5IYB C;  4A3E K;  4BY1 K;  1YNN A;  2A68 A;  2WAQ L;  4Q4Z A;  2B63 K;  3M4O C;  3S1N K;  3WOD A;  1I3Q C;  4G7Z A;  3GTM C;  3GTQ C; 
#chains in the Genus database with same CATH topology
 3HOV C;  1J6X A;  3K7A K;  3GEI A;  4KC6 A;  5IP9 C;  2NVY A;  1Y1V C;  4YFN A;  1DCP A;  3S1Q K;  1WSR A;  3HKZ D;  1TWF C;  4A3J K;  1EH1 A;  2BE5 A;  3N0C A;  1R9T K;  4XCH A;  4M1X A;  4A93 K;  2E2J K;  3S15 K;  4A3K C;  3OEP A;  4KM9 A;  2A6H A;  3GTJ K;  4MQ9 A;  2JA5 K;  3K7A C;  2YU9 C;  1Y1W A;  3S1Q C;  5C4J K;  4A3J C;  3CAG A;  4Q5S A;  4PAB A;  1R9T C;  4A93 C;  4GT9 A;  4KAR A;  3S15 C;  4KAT A;  3FKI A;  3AQO A;  2PA8 L;  1I3Q A;  2JA5 C;  2VUM K;  1O27 A;  5TMF A;  4LK0 A;  4BY1 C;  1K83 K;  3M3Y K;  3HOW K;  5C4J C;  2V6U A;  3ADA C;  4MEY A;  4A3L K;  1O2B A;  3A8J A;  1WCM A;  5IP7 K;  2JA6 K;  1G51 A;  1UV7 A;  4OIR A;  3A8I A;  4YG2 A;  4QIW L;  1XZP B;  3DXJ A;  5EGH A;  2VUM C;  4A3D C;  3AH5 A;  3M3Y C;  2D6F C;  1BDF A;  3HOW C;  1BJT A;  5IOR A;  3HOU K;  4A3L C;  2GSU A;  1O2F B;  4KAS A;  3L4K A;  1JVI A;  5IP7 C;  2FQT A;  4GTF A;  2JA6 C;  3T01 A;  4BLB A;  3CQZ K;  1WIH A;  3S16 K;  1XZP A;  3SZZ A;  4GZY A;  4KB4 A;  1XPP A;  1B4B A;  4P5A A;  1TWC K;  2FQO A;  4P5B A;  2NVX K;  2E2I K;  3OPF A;  3HOU C;  2NVQ K;  2PA8 D;  1USM A;  2WB1 L;  3S17 K;  1TWA K;  2P5M A;  4BY7 K;  5C4X K;  4KMU A;  4MEX A;  1O24 A;  3CQZ C;  3S16 C;  4ZH4 A;  4A3E K;  2A68 A;  3M4O C;  2B63 K;  3WOD A;  3TFI A;  4G7Z A;  3GTQ C;  1ISE A;  1RU0 A;  1TWC C;  1WQF A;  4X6A C;  2PMZ D;  2E2I C;  3S2D K;  2NVQ C;  4WIL A;  4BBS K;  4QIW D;  4LLG A;  3S17 C;  1TWA C;  5C3E K;  4BY7 C;  5C4X C;  2GAH C;  3HOZ K;  1KQ4 A;  5D4D A;  3VA7 A;  3S2H C;  4A3E C;  3JST A;  4G0V A;  2B63 C;  1EI6 A;  3GIR A;  1IQ0 A;  3H0G A;  2R93 A;  3RZD K;  3GSI A;  4KB2 A;  2V6S A;  3FHZ A;  3GTK A;  4BBS C;  4GTE A;  1WOR A;  4AYB D;  5C3E C;  3H3V L;  4BBR C;  2ZFZ A;  3HOZ C;  1VH2 A;  1EQR A;  5M5X K;  3GTL C;  2JA7 C;  3RZD C;  2A69 A;  1Y1W K;  3AD9 C;  5JVO A;  1IBA A;  4LJZ A;  3QX3 A;  5M5Y K;  1Y1V A;  3LAJ A;  3AD8 C;  4WJ4 A;  3HOY K;  1TWF A;  1I6H K;  2EBB A;  3AQP A;  1IS1 A;  3FKI K;  1ZVU A;  3GTG K;  3PO3 K;  4OIQ A;  2XCO A;  3TTG A;  5IOS A;  1YCL A;  2E2J C;  1J6W A;  3HXA A;  2YU9 A;  4KMA A;  1C0A A;  3HOY C;  3GTJ C;  4GFQ A;  1I6H C;  1WCM K;  1VJE A;  3I4M K;  4O2D A;  2R7Z K;  1R9T A;  1F9N A;  3GTG C;  3PO3 C;  1GE9 A;  1WQG A;  2JA5 A;  4OIP A;  3H3V D;  4G0W A;  4XSX A;  1O29 A;  4ILD A;  3S1M K;  1WCM C;  2PHC B;  3I4M C;  3ORE A;  4A3G K;  2R7Z C;  4WJ3 M;  1K83 C;  4YFK A;  1SFO A;  4BXX K;  3I4N K;  1I6V A;  5M5W K;  4A3C K;  1YNN A;  2WAQ L;  2VUM A;  3T00 A;  3FOE A;  3S1N K;  1XXB A;  1JOE A;  2O5J A;  4OIN A;  4C3H K;  3EQL A;  1YX2 A;  3S1M C;  3S1R K;  4J3N A;  4A3G C;  2CFA A;  1L0W A;  3HOX K;  4BXX C;  3I4N C;  1WOP A;  4XLP A;  2PPB A;  1BGW A;  4FZB A;  3FOF A;  5C44 K;  2R92 K;  2JA6 A;  4OIO A;  4C2M K;  1TWH K;  3S1N C;  3GDZ A;  1I50 K;  3Q3Q A;  3GTO K;  4LK1 A;  4C3H C;  1VRQ C;  2GSN A;  5IYD K;  1ZQ1 C;  3S1R C;  3HOX C;  2E2H K;  3GTP A;  2ZUE A;  4BLA A;  2NVX C;  3HKZ L;  4LR2 A;  4KN7 A;  5C44 C;  2R92 C;  2R93 K;  3H0G K;  1USO A;  1TWG K;  4C2M C;  1O25 A;  1TWH C;  1I50 C;  3SZY A;  2O5I A;  3GTQ A;  3GTO C;  1TWC A;  1XXC A;  5IYD C;  5HL8 A;  2E2I A;  2JA8 K;  2NVY K;  3N3Y A;  2E2H C;  3S14 K;  2GSO A;  2XCQ A;  3S2D C;  4LOW A;  4QJV A;  2R93 C;  1J98 A;  3AD7 C;  3L4J A;  4GTC A;  1TWG C;  1XZQ B;  4KM8 A;  3HOV K;  1DCO A;  5IP9 K;  5M3F K;  5IYC K;  2JA8 C;  2NVY C;  2NVT K;  3GTM A;  2WB1 D;  3S14 C;  3N0B A;  2Y0S L;  5FLM K;  4A3K K;  1WOS A;  1XZQ A;  1IL2 A;  3S0X A;  3GTL A;  2JA7 A;  4BKW A;  2YU9 K;  5IYB K;  3G4A A;  3LAP A;  1VGX A;  5IYC C;  1I3Q K;  5M3M K;  4KMH A;  1DCH A;  4A3B K;  3TFH A;  4YFX A;  2NVT C;  1Y1W C;  3V4G A;  5FLM C;  5L46 A;  1INN A;  3TFJ A;  5CJ9 A;  1IE0 A;  3A8K A;  3FKI C;  5IYB C;  4BY1 K;  1I3Q C;  3LPX A;  4A3B C;  1ZYR A;  1VLO A;  3GTJ A;  1SFO K;  2CW0 A;  3BP3 A;  1B4A A;  3GTG A;  2RH6 A;  4A3I K;  4G7O A;  2CFA B;  1O2A A;  4A3D K;  4C3J K;  2V6T A;  1WSV A;  2ZUF A;  1SMY A;  2Y0S D;  4G0U A;  4RMF A;  1F7V A;  1SFO C;  1EFW A;  4XLN A;  3GEE A;  5IOQ A;  2R7Z A;  1EK8 A;  2PMZ L;  5FJ8 K;  1K83 A;  1YNJ A;  4A3I C;  4G7H A;  4GTB A;  4A3F K;  4C3J C;  2GAG C;  1PJ6 A;  5JFE A;  1HQM A;  1V5V A;  4A3C C;  1HI9 A;  1AB4 A;  4GTL A;  1JQW A;  1J6V A;  4GTA A;  4PAA A;  3GTP K;  3RZO K;  4Y7N K;  1ZBS A;  4JK1 A;  1ZXO A;  4FM9 A;  3T02 A;  4AH6 A;  4AYB L;  4A3F C;  3NUH A;  2P8T A;  2Y3P A;  3M4O K;  5E68 A;  4Y52 K;  4A3M K;  3GTQ K;  4XSZ A;  1WQH A;  4X6A K;  1DD5 A;  4DDQ A;  4KMD A;  1WOO A;  4QJV B;  1O26 A;  3CQZ A;  3BUE A;  3GTK K;  3IPJ A;  3GTP C;  3RZO C;  4Y7N C;  4LQY A;  3BP8 C;  4NOI A;  2NVX A;  3S2H K;  4C45 A;  2XCR B;  3PO2 K;  2R92 A;  4KAW X;  4Y52 C;  4A3M C;  1F7U A;  2WAQ D;  1PJ7 A;  5EGE A;  1TWA A;  4C3I K;  1TWH A;  1I50 A;  3ERE D;  3H0G C;  3GTO A;  5CHP A;  5IOT A;  3GTM K;  3GTK C;  4GTD A;  2B63 A;  1Y1V K;  2A6E A;  4BBR K;  2JH3 A;  2E2H A;  5TJ3 A;  2KWA A;  3MML B;  2RGR A;  1PJ5 A;  1TWF K;  4KN4 A;  3GTL K;  2JA7 K;  3PO2 C;  1O28 A;  1XXA A;  4P9S A;  5TMC A;  1TWG A;  2W7V A;  1BS2 A;  4C3I C;  4KDD A;  1X31 C;  1IW7 A;  3G4C A;  4Q4Z A;  3GEH A;  3GTM C;  1F93 A; 
#chains in the Genus database with same CATH homology
 3HOV C;  3K7A K;  4A3B C;  4OIN A;  1TWC C;  2O5J A;  5IP9 C;  4C3H K;  1ZYR A;  3EQL A;  4X6A C;  3S1M C;  1Y1V C;  2PMZ D;  4YFN A;  1SFO K;  3S1R K;  2CW0 A;  2E2I C;  3S2D K;  3S1Q K;  2NVQ C;  4BBS K;  4A3G C;  3HKZ D;  1TWF C;  4QIW D;  4A3J K;  4LLG A;  3S17 C;  3HOX K;  1TWA C;  5C3E K;  2BE5 A;  3I4N C;  4BXX C;  1R9T K;  4BY7 C;  4XLP A;  4A3I K;  5C4X C;  2PPB A;  4A93 K;  5C44 K;  2R92 K;  3HOZ K;  2E2J K;  4G7O A;  5D4D A;  4A3D K;  4C3J K;  4OIO A;  3S2H C;  4A3E C;  3S15 K;  4C2M K;  1SMY A;  4A3K C;  2B63 C;  1TWH K;  2Y0S D;  3S1N C;  1I50 K;  3RZD K;  2A6H A;  3GTJ K;  4MQ9 A;  2JA5 K;  3K7A C;  4LK1 A;  3GTO K;  2YU9 C;  5IYD K;  1SFO C;  3S1R C;  3S1Q C;  4XLN A;  4BBS C;  5C4J K;  4AYB D;  4A3J C;  4Q5S A;  2PMZ L;  5FJ8 K;  3HOX C;  5C3E C;  2E2H K;  1YNJ A;  1R9T C;  4A3I C;  4G7H A;  3H3V L;  2NVX C;  4BBR C;  3HKZ L;  4KN7 A;  4A3F K;  4A93 C;  5C44 C;  2R92 C;  3HOZ C;  2R93 K;  3H0G K;  3S15 C;  1TWG K;  5M5X K;  3GTL C;  2JA7 C;  1TWH C;  1I50 C;  2PA8 L;  1HQM A;  3RZD C;  4A3C C;  2A69 A;  1Y1W K;  2O5I A;  2JA5 C;  3GTO C;  2VUM K;  5TMF A;  4LK0 A;  4LJZ A;  4BY1 C;  5IYD C;  5M5Y K;  1K83 K;  3M3Y K;  2JA8 K;  3GTP K;  3HOW K;  4Y7N K;  2NVY K;  4JK1 A;  3HOY K;  5C4J C;  3RZO K;  1I6H K;  2E2H C;  3S14 K;  4MEY A;  4A3L K;  4AYB L;  3FKI K;  4A3F C;  3GTG K;  3S2D C;  4QJV A;  3PO3 K;  3M4O K;  2R93 C;  4OIQ A;  5IP7 K;  4A3M K;  4Y52 K;  3GTQ K;  1TWG C;  4XSZ A;  2JA6 K;  3HOV K;  5IP9 K;  4YG2 A;  5M3F K;  4OIR A;  4QIW L;  4X6A K;  3DXJ A;  4QJV B;  2E2J C;  2VUM C;  4A3D C;  5IYC K;  3GTK K;  3M3Y C;  2JA8 C;  1BDF A;  3GTP C;  4Y7N C;  2NVY C;  3HOW C;  3HOY C;  2NVT K;  3GTJ C;  3RZO C;  2WB1 D;  1I6H C;  1WCM K;  3S14 C;  4NOI A;  3I4M K;  3HOU K;  4A3L C;  2Y0S L;  2R7Z K;  5FLM K;  3GTG C;  3S2H K;  4A3K K;  3PO3 C;  3PO2 K;  4Y52 C;  5IP7 C;  4A3M C;  2WAQ D;  2JA6 C;  4C3I K;  2YU9 K;  3CQZ K;  3S16 K;  5IYB K;  3H0G C;  4GZY A;  4OIP A;  5IYC C;  3H3V D;  1I3Q K;  5M3M K;  3GTM K;  1XPP A;  3GTK C;  4XSX A;  4A3B K;  1TWC K;  4YFX A;  2NVT C;  1Y1W C;  1Y1V K;  2A6E A;  4BBR K;  2NVX K;  3S1M K;  1WCM C;  2E2I K;  3I4M C;  3HOU C;  2NVQ K;  4A3G K;  2R7Z C;  2PA8 D;  1TWF K;  5FLM C;  1K83 C;  4KN4 A;  4YFK A;  2WB1 L;  3S17 K;  1TWA K;  4BXX K;  3GTL K;  1I6V A;  2JA7 K;  5C4X K;  3I4N K;  3PO2 C;  4BY7 K;  4KMU A;  5M5W K;  4A3C K;  5TMC A;  4MEX A;  1IW7 A;  3CQZ C;  3S16 C;  3FKI C;  4ZH4 A;  5IYB C;  4A3E K;  4BY1 K;  1YNN A;  2A68 A;  2WAQ L;  4Q4Z A;  2B63 K;  3M4O C;  3S1N K;  3WOD A;  1I3Q C;  4G7Z A;  3GTM C;  3GTQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...