3HOUK

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 29
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3houK00
5IYCC 3PO2K 5IP7C 2E2IK 5C44K 4A3GK 5IYBC 3S2DK 4GZYA 4AYBL 3HOXC 4KN7A 3M4OC 1IW7A 3H3VL 3S17C 5C4XK 4OIQA 4QJVB 3GTOK 3H0GK 4A3FK 5IP9K 3K7AK 5FLMC 3RZDK 1TWCC 4MQ9A 5TMCA 2NVXC 3I4NC 4LJZA 2O5JA 4A3EC 1WCMC 4A93K 3S16K 3S1QC 4LK0A 4XLPA 3GTGK 2NVTC 1I6HC 4AYBD 2PMZD 4BBSC 4A3DC 1K83C 4Y52K 3HOUK 2JA5C 3GTMC 5C4JC 3S14K 4BXXK 3HOZC 4A3IC 4QIWD 3PO2C 3GTPC 4YFKA 2PPBA 5C44C 2NVQK 3RZOK 5IYDK 2E2HK 3S2HC 2WB1L 3S2DC 1TWAK 4A3MK 1I6VA 1YNNA 2VUMK 3GTJC 1Y1VK 4JK1A 2JA8K 3GTQK 3HOYK 3I4MK 3M3YK 3S15K 3PO3K 3EQLA 4G7ZA 4X6AK 4YFXA 1TWGK 3H0GC 2A6HA 2CW0A 3K7AC 5IP9C 4A3FC 2WAQD 3RZDC 5C3EK 3GTLK 3GTKC 3HOWC 3S1RC 2PA8L 1TWFC 3FKIK 3S1MK 2BE5A 4BY7C 4C2MK 3S16C 2R92C 1TWHK 1SMYA 3HKZL 3GTGC 2WB1D 1Y1WK 4NOIA 3S1NK 2Y0SL 4YFNA 3HOUC 2JA6C 4XSXA 4A3BC 1R9TK 3HOVC 1I50K 4A3KK 1HQMA 2NVYC 3CQZK 2A6EA 4Y52C 2YU9C 2NVQC 4BBRK 3H3VD 3RZOC 4Y7NK 1I3QK 2PA8D 4G7HA 4A3MC 2E2IC 2VUMC 1Y1VC 4A3GC 4A3CK 5FJ8K 5M5XK 2JA7K 3HOYC 3GTQC 5IYBK 3I4MC 2R7ZK 3M3YC 3PO3C 4LLGA 4KN4A 4OIOA 1TWGC 2A69A 2R93K 4Q5SA 5C4XC 3GTOC 3FKIC 3S17K 5FLMK 1TWHC 4BY1K 4XSZA 4ZH4A 2NVXK 3I4NK 4A3LK 1SFOK 4A93C 4A3EK 1WCMK 1ZYRA 4MEYA 4C3IK 4A3JK 1YNJA 1BDFA 5M3FK 2A68A 2NVTK 4KMUA 1I6HK 4BBSK 4A3DK 3CQZC 4BXXC 3S14C 2JA5K 2B63K 4Y7NC 4G7OA 2O5IA 3HOZK 4A3IK 1XPPA 3GTPK 4C3HK 5IYDC 4A3CC 2E2HC 2YU9K 2E2JK 2JA7C 1TWAC 4C3JK 2R7ZC 5IYCK 3S2HK 4Q4ZA 5IP7K 4OINA 2PMZL 3GTJK 3HKZD 3S15C 2JA8C 2R93C 4X6AC 5D4DA 4QIWL 2Y0SD 3GTLC 4LK1A 4OIPA 4QJVA 4YG2A 5C3EC 3HOXK 4BY1C 3M4OK 3GTKK 4A3LC 3HOWK 3S1RK 3S1MC 1SFOC 1TWFK 4BY7K 1TWCK 3WODA 1Y1WC 4A3JC 5M5WK 2R92K 5M5YK 5M3MK 4XLNA 4MEXA 3S1NC 4OIRA 3S1QK 5TMFA 1R9TC 2WAQL 2B63C 1I50C 2JA6K 4A3BK 4A3KC 3HOVK 1K83K 3DXJA 4BBRC 2NVYK 2E2JC 3GTMK 5C4JK 1I3QC
chains in the Genus database with same CATH superfamily
5IYCC 1WQFA 3AQOA 3FKIA 3T00A 3S2DK 4GZYA 1Y1WA 4AYBL 3M4OC 3SZZA 3RZDK 4MQ9A 4XCHA 2RGRA 1KQ4A 1HI9A 4A3EC 3OPFA 2XCQA 3TFIA 3S1QC 3G4AA 4LR2A 3L4JA 3HOUK 2JA5C 4BXXK 2R93A 2GAGC 4YFKA 2NVQK 5IYDK 2E2HK 3S2DC 4WJ3M 3OREA 4A3MK 3AD9C 3GTJC 1Y1VK 1WCMA 3HOYK 3CAGA 4G0WA 3NUHA 5TJ3A 4X6AK 1G51A 5JVOA 3RZDC 4GTLA 1K83A 3HOWC 2BE5A 4C2MK 3GTPA 3HKZL 1O24A 1V5VA 2Y0SL 4YFNA 3HOUC 4A3BC 3HOVC 3VA7A 3CQZK 4KMDA 2NVQC 3ERED 4A3MC 4G7HA 1ISEA 1EK8A 1Y1VC 3TFJA 4A3CK 1TWFA 3HOYC 5IYBK 2R92A 4DDQA 3LPXA 3S0XA 1XXCA 3GTOC 1F9NA 4GTFA 4A93C 1O29A 4C3IK 1EQRA 1YNJA 4GFQA 5M3FK 2NVTK 2P5MA 1F7VA 3CQZC 1XZQB 1VH2A 1XPPA 4G0UA 2GSNA 4A3CC 2E2JK 1UV7A 3HKZD 4GT9A 3S15C 5CJ9A 1EFWA 1INNA 2Y0SD 3GTLC 4O2DA 3GEHA 3S1RK 2KWAA 1XXAA 2V6UA 4BY7K 4KMAA 4C3IC 1Y1WC 2XCOA 1WSVA 2E2HA 5M5YK 1Y1VA 2ZFZA 4A3KC 1K83K 3DXJA 2JH3A 4BBRC 2NVYK 2E2JC 3GTMK 4P9SA 3PO2K 4GTEA 2E2IK 3N0BA 4GTCA 1C0AA 2GSOA 1O2AA 2FQOA 4KN7A 3S17C 5C4XK 4OIQA 4A3FK 1DCPA 5FLMC 3CQZA 5TMCA 3I4NC 4LJZA 1WCMC 1ZBSA 3GTGK 1I6HC 4BBSC 4A3DC 1K83C 1WSRA 2PHCB 5L46A 3GTMC 2D6FC 3PO2C 3GTPC 4C3HC 4C45A 3N3YA 3RZOK 4C3JC 3SZYA 1TWAK 1IQ0A 1VJEA 4KM9A 2JA8K 3EQLA 3GEIA 2CW0A 3Q3QA 4A3FC 4BLBA 1TWFC 1WOPA 4M1XA 2R92C 3GTGC 1IS1A 2WB1D 4P5BA 4PAAA 4KATA 3S1NK 1R9TK 1I50K 5IOQA 1O28A 4FZBA 3RZOC 4Y52C 2Y3PA 3H0GA 1O2BA 1XZPA 5FJ8K 1WQHA 4LLGA 2A69A 4GTBA 1VRQC 5IORA 1PJ7A 1WORA 1F7UA 2NVYA 4KDDA 4XSZA 2NVXK 3GTMA 1O27A 2E2IA 1BDFA 4GTDA 2ZUEA 3GSIA 4BXXC 1J6XA 2O5IA 3HOZK 4A3IK 5IOSA 5IYDC 1O25A 2E2HC 2YU9K 3QX3A 2CFAB 3S2HK 1TWHA 3GEEA 2PMZL 4KARA 3GTGA 4X6AC 3HOXK 4QJVA 4YG2A 3GTKK 1BJTA 2V6TA 4C2MC 4FM9A 1BS2A 1X31C 1TWAA 2V6SA 4OIRA 3GIRA 2JA6K 1ZVUA 4BKWA 2YU9C 5C4JK 4A3GK 5EGHA 5IYBC 4KASA 1B4BA 2P8TA 4KC6A 3HOXC 3IPJA 1R9TA 1DCHA 2B63A 1I50A 3H0GK 2O5JA 3S16K 4KB4A 4G0VA 2NVTC 1XZQA 3AD8C 2PMZD 5C4JC 1USMA 3S14K 1J6VA 4AH6A 1GE9A 5IOTA 2WB1L 4P5AA 1I6VA 2NVXA 4JK1A 3I4MK 3M3YK 4G7ZA 4YFXA 1TWGK 1J98A 3H0GC 2A6HA 5C3EK 2XCRB 3S1RC 3S1MK 4BY7C 3S16C 3BUEA 1TWHK 2YU9A 5EGEA 1USOA 2W7VA 1JVIA 1B4AA 1HQMA 2NVYC 4KM8A 4Y7NK 1I3QK 2PA8D 3GTKA 2E2IC 1EH1A 1XXBA 2RH6A 2JA7K 2R7ZK 3I4MC 3M3YC 4KN4A 4OIOA 1TWGC 2FQTA 1WIHA 5C4XC 2JA6A 1TWHC 4A3LK 1SFOK 4A3EK 1ZYRA 4A3JK 3N0CA 3FOEA 4ILDA 4LOWA 2JA5K 2B63K 4Y7NC 3L4KA 2JA7C 1TWAC 2R7ZC 1XZPB 4Q4ZA 5IP7K 3A8JA 3GTJK 2JA8C 1AB4A 5D4DA 1O2FB 4QIWL 4LK1A 4KB2A 4A3LC 3HOWK 3AD7C 1SFOC 1PJ6A 1TWCK 4A3JC 1ZXOA 3BP3A 5M3MK 4XLNA 4MEXA 3S1NC 5HL8A 1R9TC 2WAQL 2B63C 1I50C 1WOOA 1F93A 4A3BK 3HOVK 1TWGA 1DCOA 3FOFA 1DD5A 5IP7C 3HXAA 3MMLB 4J3NA 5C44K 1EI6A 3JSTA 1IE0A 1IW7A 3H3VL 4QJVB 3GTOK 1WOSA 5IP9K 3K7AK 1TWCC 2NVXC 2GSUA 4LQYA 1I3QA 4A93K 4LK0A 4XLPA 3AH5A 1IBAA 1O26A 2R7ZA 2JA7A 4AYBD 4Y52K 1JQWA 3HOZC 4A3IC 4QIWD 2CFAA 2PPBA 5C44C 3S2HC 1YNNA 2VUMK 1SFOA 3GDZA 1VLOA 3FHZA 3S15K 3GTQK 3PO3K 4KAWX 1YX2A 5IP9C 3K7AC 3GTLK 2WAQD 3GTKC 2PA8L 3FKIK 2JA5A 1SMYA 4PABA 1Y1WK 1BGWA 4NOIA 3A8KA 4KMHA 3TTGA 4XSXA 3GTJA 2JA6C 4A3KK 2A6EA 4BLAA 2EBBA 4BBRK 3H3VD 2VUMC 4A3GC 5M5XK 1TWCA 3G4CA 3GTQC 3PO3C 1YCLA 1PJ5A 3AQPA 5JFEA 2R93K 4Q5SA 3FKIC 1L0WA 3S17K 1JOEA 3OEPA 5FLMK 2GAHC 4BY1K 4ZH4A 4WILA 3I4NK 1RU0A 1WCMK 4MEYA 2A68A 1VGXA 4KMUA 1I6HK 4BBSK 4A3DK 3TFHA 3T02A 3S14C 4G7OA 3GTPK 4C3HK 3GTOA 2ZUFA 1ZQ1C 4C3JK 3V4GA 5IYCK 4OINA 3BP8C 2R93C 1J6WA 4GTAA 4RMFA 4OIPA 5C3EC 3LAJA 4BY1C 3M4OK 3S1MC 5CHPA 1IL2A 1TWFK 3ADAC 5E68A 3WODA 5M5WK 2R92K 2VUMA 3S1QK 5TMFA 3GTQA 3T01A 3LAPA 4WJ4A 1WQGA 3A8IA 3GTLA 1I3QC
chains in the Genus database with same CATH topology
5IYCC 3PO2K 5IP7C 2E2IK 5C44K 4A3GK 5IYBC 3S2DK 4GZYA 4AYBL 3HOXC 4KN7A 3M4OC 1IW7A 3H3VL 3S17C 5C4XK 4OIQA 4QJVB 3GTOK 3H0GK 4A3FK 5IP9K 3K7AK 5FLMC 3RZDK 1TWCC 4MQ9A 5TMCA 2NVXC 3I4NC 4LJZA 2O5JA 4A3EC 1WCMC 4A93K 3S16K 3S1QC 4LK0A 4XLPA 3GTGK 2NVTC 1I6HC 4AYBD 2PMZD 4BBSC 4A3DC 1K83C 4Y52K 3HOUK 2JA5C 3GTMC 5C4JC 3S14K 4BXXK 3HOZC 4A3IC 4QIWD 3PO2C 3GTPC 4YFKA 2PPBA 5C44C 2NVQK 3RZOK 5IYDK 2E2HK 3S2HC 2WB1L 3S2DC 1TWAK 4A3MK 1I6VA 1YNNA 2VUMK 3GTJC 1Y1VK 4JK1A 2JA8K 3GTQK 3HOYK 3I4MK 3M3YK 3S15K 3PO3K 3EQLA 4G7ZA 4X6AK 4YFXA 1TWGK 3H0GC 2A6HA 2CW0A 3K7AC 5IP9C 4A3FC 2WAQD 3RZDC 5C3EK 3GTLK 3GTKC 3HOWC 3S1RC 2PA8L 1TWFC 3FKIK 3S1MK 2BE5A 4BY7C 4C2MK 3S16C 2R92C 1TWHK 1SMYA 3HKZL 3GTGC 2WB1D 1Y1WK 4NOIA 3S1NK 2Y0SL 4YFNA 3HOUC 2JA6C 4XSXA 4A3BC 1R9TK 3HOVC 1I50K 4A3KK 1HQMA 2NVYC 3CQZK 2A6EA 4Y52C 2YU9C 2NVQC 4BBRK 3H3VD 3RZOC 4Y7NK 1I3QK 2PA8D 4G7HA 4A3MC 2E2IC 2VUMC 1Y1VC 4A3GC 4A3CK 5FJ8K 5M5XK 2JA7K 3HOYC 3GTQC 5IYBK 3I4MC 2R7ZK 3M3YC 3PO3C 4LLGA 4KN4A 4OIOA 1TWGC 2A69A 2R93K 4Q5SA 5C4XC 3GTOC 3FKIC 3S17K 5FLMK 1TWHC 4BY1K 4XSZA 4ZH4A 2NVXK 3I4NK 4A3LK 1SFOK 4A93C 4A3EK 1WCMK 1ZYRA 4MEYA 4C3IK 4A3JK 1YNJA 1BDFA 5M3FK 2A68A 2NVTK 4KMUA 1I6HK 4BBSK 4A3DK 3CQZC 4BXXC 3S14C 2JA5K 2B63K 4Y7NC 4G7OA 2O5IA 3HOZK 4A3IK 1XPPA 3GTPK 4C3HK 5IYDC 4A3CC 2E2HC 2YU9K 2E2JK 2JA7C 1TWAC 4C3JK 2R7ZC 5IYCK 3S2HK 4Q4ZA 5IP7K 4OINA 2PMZL 3GTJK 3HKZD 3S15C 2JA8C 2R93C 4X6AC 5D4DA 4QIWL 2Y0SD 3GTLC 4LK1A 4OIPA 4QJVA 4YG2A 5C3EC 3HOXK 4BY1C 3M4OK 3GTKK 4A3LC 3HOWK 3S1RK 3S1MC 1SFOC 1TWFK 4BY7K 1TWCK 3WODA 1Y1WC 4A3JC 5M5WK 2R92K 5M5YK 5M3MK 4XLNA 4MEXA 3S1NC 4OIRA 3S1QK 5TMFA 1R9TC 2WAQL 2B63C 1I50C 2JA6K 4A3BK 4A3KC 3HOVK 1K83K 3DXJA 4BBRC 2NVYK 2E2JC 3GTMK 5C4JK 1I3QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC C;  3PO2 K;  5IP7 C;  2E2I K;  5C44 K;  4A3G K;  5IYB C;  3S2D K;  4GZY A;  4AYB L;  3HOX C;  4KN7 A;  3M4O C;  1IW7 A;  3H3V L;  3S17 C;  5C4X K;  4OIQ A;  4QJV B;  3GTO K;  3H0G K;  4A3F K;  5IP9 K;  3K7A K;  5FLM C;  3RZD K;  1TWC C;  4MQ9 A;  5TMC A;  2NVX C;  3I4N C;  4LJZ A;  2O5J A;  4A3E C;  1WCM C;  4A93 K;  3S16 K;  3S1Q C;  4LK0 A;  4XLP A;  3GTG K;  2NVT C;  1I6H C;  4AYB D;  2PMZ D;  4BBS C;  4A3D C;  1K83 C;  4Y52 K;  3HOU K;  2JA5 C;  3GTM C;  5C4J C;  3S14 K;  4BXX K;  3HOZ C;  4A3I C;  4QIW D;  3PO2 C;  3GTP C;  4YFK A;  2PPB A;  5C44 C;  2NVQ K;  3RZO K;  5IYD K;  2E2H K;  3S2H C;  2WB1 L;  3S2D C;  1TWA K;  4A3M K;  1I6V A;  1YNN A;  2VUM K;  3GTJ C;  1Y1V K;  4JK1 A;  2JA8 K;  3GTQ K;  3HOY K;  3I4M K;  3M3Y K;  3S15 K;  3PO3 K;  3EQL A;  4G7Z A;  4X6A K;  4YFX A;  1TWG K;  3H0G C;  2A6H A;  2CW0 A;  3K7A C;  5IP9 C;  4A3F C;  2WAQ D;  3RZD C;  5C3E K;  3GTL K;  3GTK C;  3HOW C;  3S1R C;  2PA8 L;  1TWF C;  3FKI K;  3S1M K;  2BE5 A;  4BY7 C;  4C2M K;  3S16 C;  2R92 C;  1TWH K;  1SMY A;  3HKZ L;  3GTG C;  2WB1 D;  1Y1W K;  4NOI A;  3S1N K;  2Y0S L;  4YFN A;  3HOU C;  2JA6 C;  4XSX A;  4A3B C;  1R9T K;  3HOV C;  1I50 K;  4A3K K;  1HQM A;  2NVY C;  3CQZ K;  2A6E A;  4Y52 C;  2YU9 C;  2NVQ C;  4BBR K;  3H3V D;  3RZO C;  4Y7N K;  1I3Q K;  2PA8 D;  4G7H A;  4A3M C;  2E2I C;  2VUM C;  1Y1V C;  4A3G C;  4A3C K;  5FJ8 K;  5M5X K;  2JA7 K;  3HOY C;  3GTQ C;  5IYB K;  3I4M C;  2R7Z K;  3M3Y C;  3PO3 C;  4LLG A;  4KN4 A;  4OIO A;  1TWG C;  2A69 A;  2R93 K;  4Q5S A;  5C4X C;  3GTO C;  3FKI C;  3S17 K;  5FLM K;  1TWH C;  4BY1 K;  4XSZ A;  4ZH4 A;  2NVX K;  3I4N K;  4A3L K;  1SFO K;  4A93 C;  4A3E K;  1WCM K;  1ZYR A;  4MEY A;  4C3I K;  4A3J K;  1YNJ A;  1BDF A;  5M3F K;  2A68 A;  2NVT K;  4KMU A;  1I6H K;  4BBS K;  4A3D K;  3CQZ C;  4BXX C;  3S14 C;  2JA5 K;  2B63 K;  4Y7N C;  4G7O A;  2O5I A;  3HOZ K;  4A3I K;  1XPP A;  3GTP K;  4C3H K;  5IYD C;  4A3C C;  2E2H C;  2YU9 K;  2E2J K;  2JA7 C;  1TWA C;  4C3J K;  2R7Z C;  5IYC K;  3S2H K;  4Q4Z A;  5IP7 K;  4OIN A;  2PMZ L;  3GTJ K;  3HKZ D;  3S15 C;  2JA8 C;  2R93 C;  4X6A C;  5D4D A;  4QIW L;  2Y0S D;  3GTL C;  4LK1 A;  4OIP A;  4QJV A;  4YG2 A;  5C3E C;  3HOX K;  4BY1 C;  3M4O K;  3GTK K;  4A3L C;  3HOW K;  3S1R K;  3S1M C;  1SFO C;  1TWF K;  4BY7 K;  1TWC K;  3WOD A;  1Y1W C;  4A3J C;  5M5W K;  2R92 K;  5M5Y K;  5M3M K;  4XLN A;  4MEX A;  3S1N C;  4OIR A;  3S1Q K;  5TMF A;  1R9T C;  2WAQ L;  2B63 C;  1I50 C;  2JA6 K;  4A3B K;  4A3K C;  3HOV K;  1K83 K;  3DXJ A;  4BBR C;  2NVY K;  2E2J C;  3GTM K;  5C4J K;  1I3Q C; 
#chains in the Genus database with same CATH topology
 5IYC C;  1WQF A;  3AQO A;  3FKI A;  3T00 A;  3S2D K;  4GZY A;  1Y1W A;  4AYB L;  3M4O C;  3SZZ A;  3RZD K;  4MQ9 A;  4XCH A;  2RGR A;  1KQ4 A;  1HI9 A;  4A3E C;  3OPF A;  2XCQ A;  3TFI A;  3S1Q C;  3G4A A;  4LR2 A;  3L4J A;  3HOU K;  2JA5 C;  4BXX K;  2R93 A;  2GAG C;  4YFK A;  2NVQ K;  5IYD K;  2E2H K;  3S2D C;  4WJ3 M;  3ORE A;  4A3M K;  3AD9 C;  3GTJ C;  1Y1V K;  1WCM A;  3HOY K;  3CAG A;  4G0W A;  3NUH A;  5TJ3 A;  4X6A K;  1G51 A;  5JVO A;  3RZD C;  4GTL A;  1K83 A;  3HOW C;  2BE5 A;  4C2M K;  3GTP A;  3HKZ L;  1O24 A;  1V5V A;  2Y0S L;  4YFN A;  3HOU C;  4A3B C;  3HOV C;  3VA7 A;  3CQZ K;  4KMD A;  2NVQ C;  3ERE D;  4A3M C;  4G7H A;  1ISE A;  1EK8 A;  1Y1V C;  3TFJ A;  4A3C K;  1TWF A;  3HOY C;  5IYB K;  2R92 A;  4DDQ A;  3LPX A;  3S0X A;  1XXC A;  3GTO C;  1F9N A;  4GTF A;  4A93 C;  1O29 A;  4C3I K;  1EQR A;  1YNJ A;  4GFQ A;  5M3F K;  2NVT K;  2P5M A;  1F7V A;  3CQZ C;  1XZQ B;  1VH2 A;  1XPP A;  4G0U A;  2GSN A;  4A3C C;  2E2J K;  1UV7 A;  3HKZ D;  4GT9 A;  3S15 C;  5CJ9 A;  1EFW A;  1INN A;  2Y0S D;  3GTL C;  4O2D A;  3GEH A;  3S1R K;  2KWA A;  1XXA A;  2V6U A;  4BY7 K;  4KMA A;  4C3I C;  1Y1W C;  2XCO A;  1WSV A;  2E2H A;  5M5Y K;  1Y1V A;  2ZFZ A;  4A3K C;  1K83 K;  3DXJ A;  2JH3 A;  4BBR C;  2NVY K;  2E2J C;  3GTM K;  4P9S A;  3PO2 K;  4GTE A;  2E2I K;  3N0B A;  4GTC A;  1C0A A;  2GSO A;  1O2A A;  2FQO A;  4KN7 A;  3S17 C;  5C4X K;  4OIQ A;  4A3F K;  1DCP A;  5FLM C;  3CQZ A;  5TMC A;  3I4N C;  4LJZ A;  1WCM C;  1ZBS A;  3GTG K;  1I6H C;  4BBS C;  4A3D C;  1K83 C;  1WSR A;  2PHC B;  5L46 A;  3GTM C;  2D6F C;  3PO2 C;  3GTP C;  4C3H C;  4C45 A;  3N3Y A;  3RZO K;  4C3J C;  3SZY A;  1TWA K;  1IQ0 A;  1VJE A;  4KM9 A;  2JA8 K;  3EQL A;  3GEI A;  2CW0 A;  3Q3Q A;  4A3F C;  4BLB A;  1TWF C;  1WOP A;  4M1X A;  2R92 C;  3GTG C;  1IS1 A;  2WB1 D;  4P5B A;  4PAA A;  4KAT A;  3S1N K;  1R9T K;  1I50 K;  5IOQ A;  1O28 A;  4FZB A;  3RZO C;  4Y52 C;  2Y3P A;  3H0G A;  1O2B A;  1XZP A;  5FJ8 K;  1WQH A;  4LLG A;  2A69 A;  4GTB A;  1VRQ C;  5IOR A;  1PJ7 A;  1WOR A;  1F7U A;  2NVY A;  4KDD A;  4XSZ A;  2NVX K;  3GTM A;  1O27 A;  2E2I A;  1BDF A;  4GTD A;  2ZUE A;  3GSI A;  4BXX C;  1J6X A;  2O5I A;  3HOZ K;  4A3I K;  5IOS A;  5IYD C;  1O25 A;  2E2H C;  2YU9 K;  3QX3 A;  2CFA B;  3S2H K;  1TWH A;  3GEE A;  2PMZ L;  4KAR A;  3GTG A;  4X6A C;  3HOX K;  4QJV A;  4YG2 A;  3GTK K;  1BJT A;  2V6T A;  4C2M C;  4FM9 A;  1BS2 A;  1X31 C;  1TWA A;  2V6S A;  4OIR A;  3GIR A;  2JA6 K;  1ZVU A;  4BKW A;  2YU9 C;  5C4J K;  4A3G K;  5EGH A;  5IYB C;  4KAS A;  1B4B A;  2P8T A;  4KC6 A;  3HOX C;  3IPJ A;  1R9T A;  1DCH A;  2B63 A;  1I50 A;  3H0G K;  2O5J A;  3S16 K;  4KB4 A;  4G0V A;  2NVT C;  1XZQ A;  3AD8 C;  2PMZ D;  5C4J C;  1USM A;  3S14 K;  1J6V A;  4AH6 A;  1GE9 A;  5IOT A;  2WB1 L;  4P5A A;  1I6V A;  2NVX A;  4JK1 A;  3I4M K;  3M3Y K;  4G7Z A;  4YFX A;  1TWG K;  1J98 A;  3H0G C;  2A6H A;  5C3E K;  2XCR B;  3S1R C;  3S1M K;  4BY7 C;  3S16 C;  3BUE A;  1TWH K;  2YU9 A;  5EGE A;  1USO A;  2W7V A;  1JVI A;  1B4A A;  1HQM A;  2NVY C;  4KM8 A;  4Y7N K;  1I3Q K;  2PA8 D;  3GTK A;  2E2I C;  1EH1 A;  1XXB A;  2RH6 A;  2JA7 K;  2R7Z K;  3I4M C;  3M3Y C;  4KN4 A;  4OIO A;  1TWG C;  2FQT A;  1WIH A;  5C4X C;  2JA6 A;  1TWH C;  4A3L K;  1SFO K;  4A3E K;  1ZYR A;  4A3J K;  3N0C A;  3FOE A;  4ILD A;  4LOW A;  2JA5 K;  2B63 K;  4Y7N C;  3L4K A;  2JA7 C;  1TWA C;  2R7Z C;  1XZP B;  4Q4Z A;  5IP7 K;  3A8J A;  3GTJ K;  2JA8 C;  1AB4 A;  5D4D A;  1O2F B;  4QIW L;  4LK1 A;  4KB2 A;  4A3L C;  3HOW K;  3AD7 C;  1SFO C;  1PJ6 A;  1TWC K;  4A3J C;  1ZXO A;  3BP3 A;  5M3M K;  4XLN A;  4MEX A;  3S1N C;  5HL8 A;  1R9T C;  2WAQ L;  2B63 C;  1I50 C;  1WOO A;  1F93 A;  4A3B K;  3HOV K;  1TWG A;  1DCO A;  3FOF A;  1DD5 A;  5IP7 C;  3HXA A;  3MML B;  4J3N A;  5C44 K;  1EI6 A;  3JST A;  1IE0 A;  1IW7 A;  3H3V L;  4QJV B;  3GTO K;  1WOS A;  5IP9 K;  3K7A K;  1TWC C;  2NVX C;  2GSU A;  4LQY A;  1I3Q A;  4A93 K;  4LK0 A;  4XLP A;  3AH5 A;  1IBA A;  1O26 A;  2R7Z A;  2JA7 A;  4AYB D;  4Y52 K;  1JQW A;  3HOZ C;  4A3I C;  4QIW D;  2CFA A;  2PPB A;  5C44 C;  3S2H C;  1YNN A;  2VUM K;  1SFO A;  3GDZ A;  1VLO A;  3FHZ A;  3S15 K;  3GTQ K;  3PO3 K;  4KAW X;  1YX2 A;  5IP9 C;  3K7A C;  3GTL K;  2WAQ D;  3GTK C;  2PA8 L;  3FKI K;  2JA5 A;  1SMY A;  4PAB A;  1Y1W K;  1BGW A;  4NOI A;  3A8K A;  4KMH A;  3TTG A;  4XSX A;  3GTJ A;  2JA6 C;  4A3K K;  2A6E A;  4BLA A;  2EBB A;  4BBR K;  3H3V D;  2VUM C;  4A3G C;  5M5X K;  1TWC A;  3G4C A;  3GTQ C;  3PO3 C;  1YCL A;  1PJ5 A;  3AQP A;  5JFE A;  2R93 K;  4Q5S A;  3FKI C;  1L0W A;  3S17 K;  1JOE A;  3OEP A;  5FLM K;  2GAH C;  4BY1 K;  4ZH4 A;  4WIL A;  3I4N K;  1RU0 A;  1WCM K;  4MEY A;  2A68 A;  1VGX A;  4KMU A;  1I6H K;  4BBS K;  4A3D K;  3TFH A;  3T02 A;  3S14 C;  4G7O A;  3GTP K;  4C3H K;  3GTO A;  2ZUF A;  1ZQ1 C;  4C3J K;  3V4G A;  5IYC K;  4OIN A;  3BP8 C;  2R93 C;  1J6W A;  4GTA A;  4RMF A;  4OIP A;  5C3E C;  3LAJ A;  4BY1 C;  3M4O K;  3S1M C;  5CHP A;  1IL2 A;  1TWF K;  3ADA C;  5E68 A;  3WOD A;  5M5W K;  2R92 K;  2VUM A;  3S1Q K;  5TMF A;  3GTQ A;  3T01 A;  3LAP A;  4WJ4 A;  1WQG A;  3A8I A;  3GTL A;  1I3Q C; 
#chains in the Genus database with same CATH homology
 5IYC C;  3PO2 K;  5IP7 C;  2E2I K;  5C44 K;  4A3G K;  5IYB C;  3S2D K;  4GZY A;  4AYB L;  3HOX C;  4KN7 A;  3M4O C;  1IW7 A;  3H3V L;  3S17 C;  5C4X K;  4OIQ A;  4QJV B;  3GTO K;  3H0G K;  4A3F K;  5IP9 K;  3K7A K;  5FLM C;  3RZD K;  1TWC C;  4MQ9 A;  5TMC A;  2NVX C;  3I4N C;  4LJZ A;  2O5J A;  4A3E C;  1WCM C;  4A93 K;  3S16 K;  3S1Q C;  4LK0 A;  4XLP A;  3GTG K;  2NVT C;  1I6H C;  4AYB D;  2PMZ D;  4BBS C;  4A3D C;  1K83 C;  4Y52 K;  3HOU K;  2JA5 C;  3GTM C;  5C4J C;  3S14 K;  4BXX K;  3HOZ C;  4A3I C;  4QIW D;  3PO2 C;  3GTP C;  4YFK A;  2PPB A;  5C44 C;  2NVQ K;  3RZO K;  5IYD K;  2E2H K;  3S2H C;  2WB1 L;  3S2D C;  1TWA K;  4A3M K;  1I6V A;  1YNN A;  2VUM K;  3GTJ C;  1Y1V K;  4JK1 A;  2JA8 K;  3GTQ K;  3HOY K;  3I4M K;  3M3Y K;  3S15 K;  3PO3 K;  3EQL A;  4G7Z A;  4X6A K;  4YFX A;  1TWG K;  3H0G C;  2A6H A;  2CW0 A;  3K7A C;  5IP9 C;  4A3F C;  2WAQ D;  3RZD C;  5C3E K;  3GTL K;  3GTK C;  3HOW C;  3S1R C;  2PA8 L;  1TWF C;  3FKI K;  3S1M K;  2BE5 A;  4BY7 C;  4C2M K;  3S16 C;  2R92 C;  1TWH K;  1SMY A;  3HKZ L;  3GTG C;  2WB1 D;  1Y1W K;  4NOI A;  3S1N K;  2Y0S L;  4YFN A;  3HOU C;  2JA6 C;  4XSX A;  4A3B C;  1R9T K;  3HOV C;  1I50 K;  4A3K K;  1HQM A;  2NVY C;  3CQZ K;  2A6E A;  4Y52 C;  2YU9 C;  2NVQ C;  4BBR K;  3H3V D;  3RZO C;  4Y7N K;  1I3Q K;  2PA8 D;  4G7H A;  4A3M C;  2E2I C;  2VUM C;  1Y1V C;  4A3G C;  4A3C K;  5FJ8 K;  5M5X K;  2JA7 K;  3HOY C;  3GTQ C;  5IYB K;  3I4M C;  2R7Z K;  3M3Y C;  3PO3 C;  4LLG A;  4KN4 A;  4OIO A;  1TWG C;  2A69 A;  2R93 K;  4Q5S A;  5C4X C;  3GTO C;  3FKI C;  3S17 K;  5FLM K;  1TWH C;  4BY1 K;  4XSZ A;  4ZH4 A;  2NVX K;  3I4N K;  4A3L K;  1SFO K;  4A93 C;  4A3E K;  1WCM K;  1ZYR A;  4MEY A;  4C3I K;  4A3J K;  1YNJ A;  1BDF A;  5M3F K;  2A68 A;  2NVT K;  4KMU A;  1I6H K;  4BBS K;  4A3D K;  3CQZ C;  4BXX C;  3S14 C;  2JA5 K;  2B63 K;  4Y7N C;  4G7O A;  2O5I A;  3HOZ K;  4A3I K;  1XPP A;  3GTP K;  4C3H K;  5IYD C;  4A3C C;  2E2H C;  2YU9 K;  2E2J K;  2JA7 C;  1TWA C;  4C3J K;  2R7Z C;  5IYC K;  3S2H K;  4Q4Z A;  5IP7 K;  4OIN A;  2PMZ L;  3GTJ K;  3HKZ D;  3S15 C;  2JA8 C;  2R93 C;  4X6A C;  5D4D A;  4QIW L;  2Y0S D;  3GTL C;  4LK1 A;  4OIP A;  4QJV A;  4YG2 A;  5C3E C;  3HOX K;  4BY1 C;  3M4O K;  3GTK K;  4A3L C;  3HOW K;  3S1R K;  3S1M C;  1SFO C;  1TWF K;  4BY7 K;  1TWC K;  3WOD A;  1Y1W C;  4A3J C;  5M5W K;  2R92 K;  5M5Y K;  5M3M K;  4XLN A;  4MEX A;  3S1N C;  4OIR A;  3S1Q K;  5TMF A;  1R9T C;  2WAQ L;  2B63 C;  1I50 C;  2JA6 K;  4A3B K;  4A3K C;  3HOV K;  1K83 K;  3DXJ A;  4BBR C;  2NVY K;  2E2J C;  3GTM K;  5C4J K;  1I3Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...