3HOUK

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 29
structure length 114
sequence length 114
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3houK00
3S1RK 1K83K 2NVYC 5C44K 4A3IC 2O5JA 4MQ9A 4Y7NK 3S14C 4A93C 2PPBA 5IYBC 3HOZC 2B63C 3I4NK 5D4DA 2R93K 5M3MK 4JK1A 5IYCC 3GTPC 3PO3K 4OIRA 5IP7C 2R92K 5IYDK 2E2HK 2NVTK 1I6HC 3GTMC 4Y52C 1SFOK 2NVQC 3HOWK 1WCMK 4YFNA 2WB1D 2JA8C 4A3BK 3S2DC 4BXXK 4A3GC 2JA5C 4BBRC 1TWGK 2WAQL 3H0GC 4A3MK 4BY1C 4A3KK 4KN4A 3GTLC 3GTQK 3H3VD 3FKIK 2JA6K 5FLMK 1HQMA 1TWHK 4YG2A 2JA7K 3GTKC 4QJVB 1IW7A 3HOYC 1R9TK 1Y1VK 1ZYRA 4GZYA 4YFXA 3RZDK 4C3IK 1TWAC 2E2JK 3HKZD 4A3LK 4A3DC 3CQZC 1TWFK 1I6HK 3GTOK 1I3QK 2WB1L 5C4JK 3GTGC 3HOVC 4A3CK 4A3FC 4BBSK 2YU9C 3S1MK 4C3HK 4X6AK 5C4XK 3S1NK 3M4OC 5TMCA 3S1QK 4AYBL 4QJVA 2JA5K 3S15K 5M5WK 3HOXC 2VUMC 2E2IC 3S16K 5IP9K 4Q4ZA 4A3JC 2R7ZK 3I4MK 5FJ8K 3K7AC 4G7HA 1TWCC 4G7OA 5C3EK 3HOUC 4LK0A 4KN7A 4MEXA 3S2HC 2A6EA 3RZOC 1YNNA 4KMUA 3GTJK 4QIWD 3S17K 3M3YC 2NVYK 4LK1A 4MEYA 3HKZL 4A3IK 1Y1WC 4BY7C 2NVXC 4A3EC 3S14K 2Y0SD 4A93K 3PO2C 3S16C 1I50C 3CQZK 4YFKA 5IYBK 2B63K 3HOZK 3S1RC 1K83C 5M3FK 5IYCK 3GTPK 2CW0A 4Y7NC 5IP7K 2A6HA 3I4NC 3GTMK 1BDFA 4C3JK 2NVQK 4OIPA 2O5IA 3PO3C 2R93C 4Y52K 2R92C 4XSXA 5IYDC 3EQLA 2JA8K 4XSZA 3S2DK 4A3GK 2E2HC 4BBRK 2NVTC 4LLGA 3H0GK 5M5XK 4XLNA 1SFOC 1WCMC 2PMZD 3HOWC 4QIWL 4BY1K 3S2HK 3H3VL 3GTLK 4A3BC 4BXXC 1TWGC 4A3MC 4OIQA 2Y0SL 4XLPA 2WAQD 4A3KC 3GTKK 3WODA 3GTQC 3HOYK 3FKIC 2JA6C 5FLMC 2A68A 1TWHC 4OINA 2JA7C 4A3DK 1TWAK 2PA8D 1R9TC 3HOVK 1Y1VC 3GTGK 5C44C 4A3FK 2YU9K 2BE5A 3RZDC 4A3LC 2E2JC 3M4OK 2PMZL 1TWFC 3HOXK 3GTOC 1I3QC 2E2IK 5C4JC 2VUMK 4A3CC 1XPPA 4ZH4A 3S1MC 5M5YK 4X6AC 4NOIA 4OIOA 1YNJA 5TMFA 4A3JK 3S1QC 3S15C 3S1NC 4BBSC 5C4XC 3K7AK 1TWCK 5IP9C 4Q5SA 4AYBD 3HOUK 2R7ZC 2A69A 3I4MC 3RZOK 1I6VA 3M3YK 1SMYA 5C3EC 1Y1WK 4BY7K 2PA8L 2NVXK 3DXJA 4C2MK 4A3EK 4LJZA 3PO2K 3S17C 1I50K 3GTJC 4G7ZA
chains in the Genus database with same CATH superfamily
3S1RK 1EQRA 1V5VA 3HXAA 3GTQA 4A93C 1PJ7A 2B63C 1Y1WA 3GTPC 3PO3K 3GEIA 2R92K 1WOPA 2NVQC 3OEPA 4A3BK 4BXXK 4BBRC 4M1XA 4KC6A 3GTQK 1WCMA 3TFJA 2JA6K 2P8TA 1HQMA 4RMFA 4G0VA 1IW7A 4C45A 5IOTA 4GZYA 3G4CA 4C3IK 3RZDK 2E2JK 4A3DC 1WSRA 2NVYA 3N0BA 4GFQA 1TWHA 2WB1L 1I6HK 2CFAA 5TMCA 2VUMC 2E2IC 1IL2A 3NUHA 1XZQB 4A3JC 2GSUA 2R7ZK 4G7OA 1J6XA 4LK0A 4MEXA 3L4JA 4QIWD 2FQOA 3N0CA 2NVYK 4A3IK 1O26A 4BY7C 2NVXC 3S14K 2Y0SD 5IYBK 3HOZK 1J98A 3FOFA 3S1RC 3GTKA 2GAGC 5IP7K 4KB2A 1WOSA 1VH2A 3PO3C 3AD8C 2R92C 3CQZA 3EQLA 3S2DK 4XSZA 2B63A 1INNA 4LLGA 5M5XK 3ERED 4BLAA 3VA7A 4BY1K 4A3BC 4BXXC 4OIQA 1WOOA 4XLPA 3GTKK 1JOEA 3N3YA 1WIHA 3GTQC 2JA6C 5CHPA 4KMAA 1J6WA 3GTGK 1BS2A 3AD9C 3RZDC 4C3IC 2E2JC 1B4BA 2FQTA 1IBAA 1YCLA 5TMFA 2R93A 1ZXOA 3K7AK 4Q5SA 1DD5A 1C0AA 2R7ZC 2A69A 3RZOK 2VUMA 2E2IA 3M3YK 4C2MK 4LQYA 1TWGA 4LJZA 2NVYC 5C44K 4A3IC 1USMA 4Y7NK 1F7UA 3S14C 2PPBA 5IYBC 3HOZC 2R93K 5M3MK 2NVXA 5IP7C 5IYDK 1R9TA 3HOWK 4YFNA 3CAGA 1EK8A 2WB1D 4GTCA 3S2DC 2RGRA 3GTOA 1TWGK 1X31C 4A3MK 3SZYA 4KM9A 1JQWA 4BKWA 1O29A 4GTLA 4BY1C 2CFAB 4YG2A 5CJ9A 1DCPA 3GTKC 2ZUEA 1R9TK 4FZBA 4A3LK 3GTJA 5EGEA 3CQZC 2JA6A 3GTOK 1I3QK 3GTGC 4BLBA 1DCOA 4X6AK 2JA5K 4QJVA 3S15K 5IP9K 4GTBA 1F93A 4Q4ZA 3GTMA 3ADAC 3K7AC 1O27A 5C3EK 4LOWA 4KN7A 1EFWA 3H0GA 3RZOC 3GTJK 3A8JA 3M3YC 3IPJA 5JVOA 4C2MC 2R7ZA 3T01A 4GTDA 1EI6A 4YFKA 1WORA 2GSOA 1O2FB 4Y7NC 2A6HA 4GTAA 2R93C 3GTMK 4C3JK 2O5IA 1WQFA 1IE0A 4A3GK 5IYDC 3TFIA 3H0GK 4KDDA 3HOWC 3S2HK 1TWGC 4KMHA 4A3MC 1BJTA 1TWCA 3GSIA 4OINA 4PABA 1R9TC 2XCQA 3TTGA 2P5MA 1F7VA 4A3FK 4P5AA 2BE5A 1O24A 4A3LC 3M4OK 1WSVA 1DCHA 3GTOC 1I3QC 4KASA 1EH1A 4ZH4A 5M5YK 4X6AC 1YNJA 3S15C 2V6UA 3GTGA 1TWCK 5IP9C 4AYBD 1ZQ1C 2D6FC 1SFOA 1I6VA 1SMYA 5C3EC 5IOQA 3DXJA 1KQ4A 4A3EK 3S16K 1I50K 3GTJC 3T00A 5E68A 2O5JA 4GT9A 2PHCB 3T02A 4KMDA 3I4NK 4JK1A 4OIRA 3S0XA 1I6HC 3MMLB 3GTMC 1GE9A 4C3JC 1SFOK 4A3GC 1TWFA 4PAAA 3H0GC 3TFHA 2V6SA 4KN4A 4A3KK 4GTEA 3FKIK 3OPFA 5FLMK 1WQHA 3A8IA 1XXAA 4QJVB 1Y1VK 1ZYRA 3GDZA 4YFXA 1TWFK 1VGXA 5C4JK 2ZFZA 4A3FC 3S1MK 4C3HK 5C4XK 3M4OC 1BGWA 3S1QK 4AYBL 4BBSK 2KWAA 1I3QA 5FJ8K 2EBBA 1TWCC 5HL8A 3FOEA 2JA5A 4KMUA 1WQGA 4LK1A 3HKZL 4FM9A 3GTLA 4A3EC 3S16C 1I50C 3AQOA 5M3FK 1J6VA 5IYCK 4G0WA 1VJEA 1IS1A 1AB4A 3I4NC 3GEEA 4Y52K 4G0UA 1TWAA 2JA8K 5TJ3A 3FHZA 4P5BA 1SFOC 1JVIA 2YU9A 1HI9A 1B4AA 3GTLK 4P9SA 2WAQD 4A3KC 3WODA 1YX2A 3OREA 3HOYK 3FKIC 5FLMC 2A68A 1UV7A 1G51A 2XCOA 3G4AA 1TWAK 4KB4A 1O28A 3BP8C 5EGHA 2GAHC 3HOVK 1Y1VC 5C44C 2YU9K 2PMZL 1K83A 1TWFC 3HOXK 5C4JC 3Q3QA 1L0WA 3S1MC 4C3HC 5C4XC 3S1QC 4BBSC 4DDQA 3AD7C 4WILA 3HOUK 2E2HA 1ISEA 1RU0A 1Y1WK 2PA8L 2V6TA 3PO2K 2GSNA 1K83K 3JSTA 4MQ9A 2JA7A 5D4DA 1PJ5A 5IYCC 3AQPA 1I50A 2E2HK 2NVTK 4Y52C 1WCMK 2JA8C 1VRQC 2JA5C 2WAQL 2JH3A 3GTLC 1VLOA 1ZVUA 1O2BA 2RH6A 5L46A 3H3VD 2JA7K 4WJ3M 3A8KA 1TWHK 3HOYC 3GEHA 1TWAC 3HKZD 3FKIA 3BP3A 3HOVC 4A3CK 3LAJA 4XCHA 4J3NA 2YU9C 3S1NK 4KARA 3LPXA 1Y1VA 5M5WK 3HOXC 3GTPA 4AH6A 5IORA 2W7VA 4KATA 3BUEA 3I4MK 4G7HA 3HOUC 2Y3PA 3S2HC 2A6EA 3S17K 1YNNA 4KM8A 4MEYA 2XCRB 1Y1WC 3V4GA 1XZQA 4A93K 3SZZA 3PO2C 3CQZK 1XXBA 2B63K 1K83C 3GTPK 2CW0A 4ILDA 1BDFA 1XZPB 2NVQK 4OIPA 1F9NA 3GIRA 4XSXA 2E2HC 4BBRK 2NVTC 4XLNA 1IQ0A 1WCMC 2PMZD 4QIWL 2ZUFA 3H3VL 2Y0SL 4LR2A 3LAPA 3AH5A 4O2DA 2JA7C 1TWHC 4A3DK 2PA8D 1XXCA 3L4KA 4WJ4A 2VUMK 2E2IK 4A3CC 1XPPA 4NOIA 4OIOA 3S1NC 1ZBSA 4A3JK 1PJ6A 5IOSA 5JFEA 1USOA 3QX3A 2R92A 1O25A 4KAWX 3I4MC 1XZPA 1O2AA 4BY7K 2NVXK 3S17C 4GTFA 4G7ZA
chains in the Genus database with same CATH topology
3S1RK 1K83K 2NVYC 5C44K 4A3IC 2O5JA 4MQ9A 4Y7NK 3S14C 4A93C 2PPBA 5IYBC 3HOZC 2B63C 3I4NK 5D4DA 2R93K 5M3MK 4JK1A 5IYCC 3GTPC 3PO3K 4OIRA 5IP7C 2R92K 5IYDK 2E2HK 2NVTK 1I6HC 3GTMC 4Y52C 1SFOK 2NVQC 3HOWK 1WCMK 4YFNA 2WB1D 2JA8C 4A3BK 3S2DC 4BXXK 4A3GC 2JA5C 4BBRC 1TWGK 2WAQL 3H0GC 4A3MK 4BY1C 4A3KK 4KN4A 3GTLC 3GTQK 3H3VD 3FKIK 2JA6K 5FLMK 1HQMA 1TWHK 4YG2A 2JA7K 3GTKC 4QJVB 1IW7A 3HOYC 1R9TK 1Y1VK 1ZYRA 4GZYA 4YFXA 3RZDK 4C3IK 1TWAC 2E2JK 3HKZD 4A3LK 4A3DC 3CQZC 1TWFK 1I6HK 3GTOK 1I3QK 2WB1L 5C4JK 3GTGC 3HOVC 4A3CK 4A3FC 4BBSK 2YU9C 3S1MK 4C3HK 4X6AK 5C4XK 3S1NK 3M4OC 5TMCA 3S1QK 4AYBL 4QJVA 2JA5K 3S15K 5M5WK 3HOXC 2VUMC 2E2IC 3S16K 5IP9K 4Q4ZA 4A3JC 2R7ZK 3I4MK 5FJ8K 3K7AC 4G7HA 1TWCC 4G7OA 5C3EK 3HOUC 4LK0A 4KN7A 4MEXA 3S2HC 2A6EA 3RZOC 1YNNA 4KMUA 3GTJK 4QIWD 3S17K 3M3YC 2NVYK 4LK1A 4MEYA 3HKZL 4A3IK 1Y1WC 4BY7C 2NVXC 4A3EC 3S14K 2Y0SD 4A93K 3PO2C 3S16C 1I50C 3CQZK 4YFKA 5IYBK 2B63K 3HOZK 3S1RC 1K83C 5M3FK 5IYCK 3GTPK 2CW0A 4Y7NC 5IP7K 2A6HA 3I4NC 3GTMK 1BDFA 4C3JK 2NVQK 4OIPA 2O5IA 3PO3C 2R93C 4Y52K 2R92C 4XSXA 5IYDC 3EQLA 2JA8K 4XSZA 3S2DK 4A3GK 2E2HC 4BBRK 2NVTC 4LLGA 3H0GK 5M5XK 4XLNA 1SFOC 1WCMC 2PMZD 3HOWC 4QIWL 4BY1K 3S2HK 3H3VL 3GTLK 4A3BC 4BXXC 1TWGC 4A3MC 4OIQA 2Y0SL 4XLPA 2WAQD 4A3KC 3GTKK 3WODA 3GTQC 3HOYK 3FKIC 2JA6C 5FLMC 2A68A 1TWHC 4OINA 2JA7C 4A3DK 1TWAK 2PA8D 1R9TC 3HOVK 1Y1VC 3GTGK 5C44C 4A3FK 2YU9K 2BE5A 3RZDC 4A3LC 2E2JC 3M4OK 2PMZL 1TWFC 3HOXK 3GTOC 1I3QC 2E2IK 5C4JC 2VUMK 4A3CC 1XPPA 4ZH4A 3S1MC 5M5YK 4X6AC 4NOIA 4OIOA 1YNJA 5TMFA 4A3JK 3S1QC 3S15C 3S1NC 4BBSC 5C4XC 3K7AK 1TWCK 5IP9C 4Q5SA 4AYBD 3HOUK 2R7ZC 2A69A 3I4MC 3RZOK 1I6VA 3M3YK 1SMYA 5C3EC 1Y1WK 4BY7K 2PA8L 2NVXK 3DXJA 4C2MK 4A3EK 4LJZA 3PO2K 3S17C 1I50K 3GTJC 4G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R K;  1K83 K;  2NVY C;  5C44 K;  4A3I C;  2O5J A;  4MQ9 A;  4Y7N K;  3S14 C;  4A93 C;  2PPB A;  5IYB C;  3HOZ C;  2B63 C;  3I4N K;  5D4D A;  2R93 K;  5M3M K;  4JK1 A;  5IYC C;  3GTP C;  3PO3 K;  4OIR A;  5IP7 C;  2R92 K;  5IYD K;  2E2H K;  2NVT K;  1I6H C;  3GTM C;  4Y52 C;  1SFO K;  2NVQ C;  3HOW K;  1WCM K;  4YFN A;  2WB1 D;  2JA8 C;  4A3B K;  3S2D C;  4BXX K;  4A3G C;  2JA5 C;  4BBR C;  1TWG K;  2WAQ L;  3H0G C;  4A3M K;  4BY1 C;  4A3K K;  4KN4 A;  3GTL C;  3GTQ K;  3H3V D;  3FKI K;  2JA6 K;  5FLM K;  1HQM A;  1TWH K;  4YG2 A;  2JA7 K;  3GTK C;  4QJV B;  1IW7 A;  3HOY C;  1R9T K;  1Y1V K;  1ZYR A;  4GZY A;  4YFX A;  3RZD K;  4C3I K;  1TWA C;  2E2J K;  3HKZ D;  4A3L K;  4A3D C;  3CQZ C;  1TWF K;  1I6H K;  3GTO K;  1I3Q K;  2WB1 L;  5C4J K;  3GTG C;  3HOV C;  4A3C K;  4A3F C;  4BBS K;  2YU9 C;  3S1M K;  4C3H K;  4X6A K;  5C4X K;  3S1N K;  3M4O C;  5TMC A;  3S1Q K;  4AYB L;  4QJV A;  2JA5 K;  3S15 K;  5M5W K;  3HOX C;  2VUM C;  2E2I C;  3S16 K;  5IP9 K;  4Q4Z A;  4A3J C;  2R7Z K;  3I4M K;  5FJ8 K;  3K7A C;  4G7H A;  1TWC C;  4G7O A;  5C3E K;  3HOU C;  4LK0 A;  4KN7 A;  4MEX A;  3S2H C;  2A6E A;  3RZO C;  1YNN A;  4KMU A;  3GTJ K;  4QIW D;  3S17 K;  3M3Y C;  2NVY K;  4LK1 A;  4MEY A;  3HKZ L;  4A3I K;  1Y1W C;  4BY7 C;  2NVX C;  4A3E C;  3S14 K;  2Y0S D;  4A93 K;  3PO2 C;  3S16 C;  1I50 C;  3CQZ K;  4YFK A;  5IYB K;  2B63 K;  3HOZ K;  3S1R C;  1K83 C;  5M3F K;  5IYC K;  3GTP K;  2CW0 A;  4Y7N C;  5IP7 K;  2A6H A;  3I4N C;  3GTM K;  1BDF A;  4C3J K;  2NVQ K;  4OIP A;  2O5I A;  3PO3 C;  2R93 C;  4Y52 K;  2R92 C;  4XSX A;  5IYD C;  3EQL A;  2JA8 K;  4XSZ A;  3S2D K;  4A3G K;  2E2H C;  4BBR K;  2NVT C;  4LLG A;  3H0G K;  5M5X K;  4XLN A;  1SFO C;  1WCM C;  2PMZ D;  3HOW C;  4QIW L;  4BY1 K;  3S2H K;  3H3V L;  3GTL K;  4A3B C;  4BXX C;  1TWG C;  4A3M C;  4OIQ A;  2Y0S L;  4XLP A;  2WAQ D;  4A3K C;  3GTK K;  3WOD A;  3GTQ C;  3HOY K;  3FKI C;  2JA6 C;  5FLM C;  2A68 A;  1TWH C;  4OIN A;  2JA7 C;  4A3D K;  1TWA K;  2PA8 D;  1R9T C;  3HOV K;  1Y1V C;  3GTG K;  5C44 C;  4A3F K;  2YU9 K;  2BE5 A;  3RZD C;  4A3L C;  2E2J C;  3M4O K;  2PMZ L;  1TWF C;  3HOX K;  3GTO C;  1I3Q C;  2E2I K;  5C4J C;  2VUM K;  4A3C C;  1XPP A;  4ZH4 A;  3S1M C;  5M5Y K;  4X6A C;  4NOI A;  4OIO A;  1YNJ A;  5TMF A;  4A3J K;  3S1Q C;  3S15 C;  3S1N C;  4BBS C;  5C4X C;  3K7A K;  1TWC K;  5IP9 C;  4Q5S A;  4AYB D;  3HOU K;  2R7Z C;  2A69 A;  3I4M C;  3RZO K;  1I6V A;  3M3Y K;  1SMY A;  5C3E C;  1Y1W K;  4BY7 K;  2PA8 L;  2NVX K;  3DXJ A;  4C2M K;  4A3E K;  4LJZ A;  3PO2 K;  3S17 C;  1I50 K;  3GTJ C;  4G7Z A; 
#chains in the Genus database with same CATH topology
 3S1R K;  1EQR A;  1V5V A;  3HXA A;  3GTQ A;  4A93 C;  1PJ7 A;  2B63 C;  1Y1W A;  3GTP C;  3PO3 K;  3GEI A;  2R92 K;  1WOP A;  2NVQ C;  3OEP A;  4A3B K;  4BXX K;  4BBR C;  4M1X A;  4KC6 A;  3GTQ K;  1WCM A;  3TFJ A;  2JA6 K;  2P8T A;  1HQM A;  4RMF A;  4G0V A;  1IW7 A;  4C45 A;  5IOT A;  4GZY A;  3G4C A;  4C3I K;  3RZD K;  2E2J K;  4A3D C;  1WSR A;  2NVY A;  3N0B A;  4GFQ A;  1TWH A;  2WB1 L;  1I6H K;  2CFA A;  5TMC A;  2VUM C;  2E2I C;  1IL2 A;  3NUH A;  1XZQ B;  4A3J C;  2GSU A;  2R7Z K;  4G7O A;  1J6X A;  4LK0 A;  4MEX A;  3L4J A;  4QIW D;  2FQO A;  3N0C A;  2NVY K;  4A3I K;  1O26 A;  4BY7 C;  2NVX C;  3S14 K;  2Y0S D;  5IYB K;  3HOZ K;  1J98 A;  3FOF A;  3S1R C;  3GTK A;  2GAG C;  5IP7 K;  4KB2 A;  1WOS A;  1VH2 A;  3PO3 C;  3AD8 C;  2R92 C;  3CQZ A;  3EQL A;  3S2D K;  4XSZ A;  2B63 A;  1INN A;  4LLG A;  5M5X K;  3ERE D;  4BLA A;  3VA7 A;  4BY1 K;  4A3B C;  4BXX C;  4OIQ A;  1WOO A;  4XLP A;  3GTK K;  1JOE A;  3N3Y A;  1WIH A;  3GTQ C;  2JA6 C;  5CHP A;  4KMA A;  1J6W A;  3GTG K;  1BS2 A;  3AD9 C;  3RZD C;  4C3I C;  2E2J C;  1B4B A;  2FQT A;  1IBA A;  1YCL A;  5TMF A;  2R93 A;  1ZXO A;  3K7A K;  4Q5S A;  1DD5 A;  1C0A A;  2R7Z C;  2A69 A;  3RZO K;  2VUM A;  2E2I A;  3M3Y K;  4C2M K;  4LQY A;  1TWG A;  4LJZ A;  2NVY C;  5C44 K;  4A3I C;  1USM A;  4Y7N K;  1F7U A;  3S14 C;  2PPB A;  5IYB C;  3HOZ C;  2R93 K;  5M3M K;  2NVX A;  5IP7 C;  5IYD K;  1R9T A;  3HOW K;  4YFN A;  3CAG A;  1EK8 A;  2WB1 D;  4GTC A;  3S2D C;  2RGR A;  3GTO A;  1TWG K;  1X31 C;  4A3M K;  3SZY A;  4KM9 A;  1JQW A;  4BKW A;  1O29 A;  4GTL A;  4BY1 C;  2CFA B;  4YG2 A;  5CJ9 A;  1DCP A;  3GTK C;  2ZUE A;  1R9T K;  4FZB A;  4A3L K;  3GTJ A;  5EGE A;  3CQZ C;  2JA6 A;  3GTO K;  1I3Q K;  3GTG C;  4BLB A;  1DCO A;  4X6A K;  2JA5 K;  4QJV A;  3S15 K;  5IP9 K;  4GTB A;  1F93 A;  4Q4Z A;  3GTM A;  3ADA C;  3K7A C;  1O27 A;  5C3E K;  4LOW A;  4KN7 A;  1EFW A;  3H0G A;  3RZO C;  3GTJ K;  3A8J A;  3M3Y C;  3IPJ A;  5JVO A;  4C2M C;  2R7Z A;  3T01 A;  4GTD A;  1EI6 A;  4YFK A;  1WOR A;  2GSO A;  1O2F B;  4Y7N C;  2A6H A;  4GTA A;  2R93 C;  3GTM K;  4C3J K;  2O5I A;  1WQF A;  1IE0 A;  4A3G K;  5IYD C;  3TFI A;  3H0G K;  4KDD A;  3HOW C;  3S2H K;  1TWG C;  4KMH A;  4A3M C;  1BJT A;  1TWC A;  3GSI A;  4OIN A;  4PAB A;  1R9T C;  2XCQ A;  3TTG A;  2P5M A;  1F7V A;  4A3F K;  4P5A A;  2BE5 A;  1O24 A;  4A3L C;  3M4O K;  1WSV A;  1DCH A;  3GTO C;  1I3Q C;  4KAS A;  1EH1 A;  4ZH4 A;  5M5Y K;  4X6A C;  1YNJ A;  3S15 C;  2V6U A;  3GTG A;  1TWC K;  5IP9 C;  4AYB D;  1ZQ1 C;  2D6F C;  1SFO A;  1I6V A;  1SMY A;  5C3E C;  5IOQ A;  3DXJ A;  1KQ4 A;  4A3E K;  3S16 K;  1I50 K;  3GTJ C;  3T00 A;  5E68 A;  2O5J A;  4GT9 A;  2PHC B;  3T02 A;  4KMD A;  3I4N K;  4JK1 A;  4OIR A;  3S0X A;  1I6H C;  3MML B;  3GTM C;  1GE9 A;  4C3J C;  1SFO K;  4A3G C;  1TWF A;  4PAA A;  3H0G C;  3TFH A;  2V6S A;  4KN4 A;  4A3K K;  4GTE A;  3FKI K;  3OPF A;  5FLM K;  1WQH A;  3A8I A;  1XXA A;  4QJV B;  1Y1V K;  1ZYR A;  3GDZ A;  4YFX A;  1TWF K;  1VGX A;  5C4J K;  2ZFZ A;  4A3F C;  3S1M K;  4C3H K;  5C4X K;  3M4O C;  1BGW A;  3S1Q K;  4AYB L;  4BBS K;  2KWA A;  1I3Q A;  5FJ8 K;  2EBB A;  1TWC C;  5HL8 A;  3FOE A;  2JA5 A;  4KMU A;  1WQG A;  4LK1 A;  3HKZ L;  4FM9 A;  3GTL A;  4A3E C;  3S16 C;  1I50 C;  3AQO A;  5M3F K;  1J6V A;  5IYC K;  4G0W A;  1VJE A;  1IS1 A;  1AB4 A;  3I4N C;  3GEE A;  4Y52 K;  4G0U A;  1TWA A;  2JA8 K;  5TJ3 A;  3FHZ A;  4P5B A;  1SFO C;  1JVI A;  2YU9 A;  1HI9 A;  1B4A A;  3GTL K;  4P9S A;  2WAQ D;  4A3K C;  3WOD A;  1YX2 A;  3ORE A;  3HOY K;  3FKI C;  5FLM C;  2A68 A;  1UV7 A;  1G51 A;  2XCO A;  3G4A A;  1TWA K;  4KB4 A;  1O28 A;  3BP8 C;  5EGH A;  2GAH C;  3HOV K;  1Y1V C;  5C44 C;  2YU9 K;  2PMZ L;  1K83 A;  1TWF C;  3HOX K;  5C4J C;  3Q3Q A;  1L0W A;  3S1M C;  4C3H C;  5C4X C;  3S1Q C;  4BBS C;  4DDQ A;  3AD7 C;  4WIL A;  3HOU K;  2E2H A;  1ISE A;  1RU0 A;  1Y1W K;  2PA8 L;  2V6T A;  3PO2 K;  2GSN A;  1K83 K;  3JST A;  4MQ9 A;  2JA7 A;  5D4D A;  1PJ5 A;  5IYC C;  3AQP A;  1I50 A;  2E2H K;  2NVT K;  4Y52 C;  1WCM K;  2JA8 C;  1VRQ C;  2JA5 C;  2WAQ L;  2JH3 A;  3GTL C;  1VLO A;  1ZVU A;  1O2B A;  2RH6 A;  5L46 A;  3H3V D;  2JA7 K;  4WJ3 M;  3A8K A;  1TWH K;  3HOY C;  3GEH A;  1TWA C;  3HKZ D;  3FKI A;  3BP3 A;  3HOV C;  4A3C K;  3LAJ A;  4XCH A;  4J3N A;  2YU9 C;  3S1N K;  4KAR A;  3LPX A;  1Y1V A;  5M5W K;  3HOX C;  3GTP A;  4AH6 A;  5IOR A;  2W7V A;  4KAT A;  3BUE A;  3I4M K;  4G7H A;  3HOU C;  2Y3P A;  3S2H C;  2A6E A;  3S17 K;  1YNN A;  4KM8 A;  4MEY A;  2XCR B;  1Y1W C;  3V4G A;  1XZQ A;  4A93 K;  3SZZ A;  3PO2 C;  3CQZ K;  1XXB A;  2B63 K;  1K83 C;  3GTP K;  2CW0 A;  4ILD A;  1BDF A;  1XZP B;  2NVQ K;  4OIP A;  1F9N A;  3GIR A;  4XSX A;  2E2H C;  4BBR K;  2NVT C;  4XLN A;  1IQ0 A;  1WCM C;  2PMZ D;  4QIW L;  2ZUF A;  3H3V L;  2Y0S L;  4LR2 A;  3LAP A;  3AH5 A;  4O2D A;  2JA7 C;  1TWH C;  4A3D K;  2PA8 D;  1XXC A;  3L4K A;  4WJ4 A;  2VUM K;  2E2I K;  4A3C C;  1XPP A;  4NOI A;  4OIO A;  3S1N C;  1ZBS A;  4A3J K;  1PJ6 A;  5IOS A;  5JFE A;  1USO A;  3QX3 A;  2R92 A;  1O25 A;  4KAW X;  3I4M C;  1XZP A;  1O2A A;  4BY7 K;  2NVX K;  3S17 C;  4GTF A;  4G7Z A; 
#chains in the Genus database with same CATH homology
 3S1R K;  1K83 K;  2NVY C;  5C44 K;  4A3I C;  2O5J A;  4MQ9 A;  4Y7N K;  3S14 C;  4A93 C;  2PPB A;  5IYB C;  3HOZ C;  2B63 C;  3I4N K;  5D4D A;  2R93 K;  5M3M K;  4JK1 A;  5IYC C;  3GTP C;  3PO3 K;  4OIR A;  5IP7 C;  2R92 K;  5IYD K;  2E2H K;  2NVT K;  1I6H C;  3GTM C;  4Y52 C;  1SFO K;  2NVQ C;  3HOW K;  1WCM K;  4YFN A;  2WB1 D;  2JA8 C;  4A3B K;  3S2D C;  4BXX K;  4A3G C;  2JA5 C;  4BBR C;  1TWG K;  2WAQ L;  3H0G C;  4A3M K;  4BY1 C;  4A3K K;  4KN4 A;  3GTL C;  3GTQ K;  3H3V D;  3FKI K;  2JA6 K;  5FLM K;  1HQM A;  1TWH K;  4YG2 A;  2JA7 K;  3GTK C;  4QJV B;  1IW7 A;  3HOY C;  1R9T K;  1Y1V K;  1ZYR A;  4GZY A;  4YFX A;  3RZD K;  4C3I K;  1TWA C;  2E2J K;  3HKZ D;  4A3L K;  4A3D C;  3CQZ C;  1TWF K;  1I6H K;  3GTO K;  1I3Q K;  2WB1 L;  5C4J K;  3GTG C;  3HOV C;  4A3C K;  4A3F C;  4BBS K;  2YU9 C;  3S1M K;  4C3H K;  4X6A K;  5C4X K;  3S1N K;  3M4O C;  5TMC A;  3S1Q K;  4AYB L;  4QJV A;  2JA5 K;  3S15 K;  5M5W K;  3HOX C;  2VUM C;  2E2I C;  3S16 K;  5IP9 K;  4Q4Z A;  4A3J C;  2R7Z K;  3I4M K;  5FJ8 K;  3K7A C;  4G7H A;  1TWC C;  4G7O A;  5C3E K;  3HOU C;  4LK0 A;  4KN7 A;  4MEX A;  3S2H C;  2A6E A;  3RZO C;  1YNN A;  4KMU A;  3GTJ K;  4QIW D;  3S17 K;  3M3Y C;  2NVY K;  4LK1 A;  4MEY A;  3HKZ L;  4A3I K;  1Y1W C;  4BY7 C;  2NVX C;  4A3E C;  3S14 K;  2Y0S D;  4A93 K;  3PO2 C;  3S16 C;  1I50 C;  3CQZ K;  4YFK A;  5IYB K;  2B63 K;  3HOZ K;  3S1R C;  1K83 C;  5M3F K;  5IYC K;  3GTP K;  2CW0 A;  4Y7N C;  5IP7 K;  2A6H A;  3I4N C;  3GTM K;  1BDF A;  4C3J K;  2NVQ K;  4OIP A;  2O5I A;  3PO3 C;  2R93 C;  4Y52 K;  2R92 C;  4XSX A;  5IYD C;  3EQL A;  2JA8 K;  4XSZ A;  3S2D K;  4A3G K;  2E2H C;  4BBR K;  2NVT C;  4LLG A;  3H0G K;  5M5X K;  4XLN A;  1SFO C;  1WCM C;  2PMZ D;  3HOW C;  4QIW L;  4BY1 K;  3S2H K;  3H3V L;  3GTL K;  4A3B C;  4BXX C;  1TWG C;  4A3M C;  4OIQ A;  2Y0S L;  4XLP A;  2WAQ D;  4A3K C;  3GTK K;  3WOD A;  3GTQ C;  3HOY K;  3FKI C;  2JA6 C;  5FLM C;  2A68 A;  1TWH C;  4OIN A;  2JA7 C;  4A3D K;  1TWA K;  2PA8 D;  1R9T C;  3HOV K;  1Y1V C;  3GTG K;  5C44 C;  4A3F K;  2YU9 K;  2BE5 A;  3RZD C;  4A3L C;  2E2J C;  3M4O K;  2PMZ L;  1TWF C;  3HOX K;  3GTO C;  1I3Q C;  2E2I K;  5C4J C;  2VUM K;  4A3C C;  1XPP A;  4ZH4 A;  3S1M C;  5M5Y K;  4X6A C;  4NOI A;  4OIO A;  1YNJ A;  5TMF A;  4A3J K;  3S1Q C;  3S15 C;  3S1N C;  4BBS C;  5C4X C;  3K7A K;  1TWC K;  5IP9 C;  4Q5S A;  4AYB D;  3HOU K;  2R7Z C;  2A69 A;  3I4M C;  3RZO K;  1I6V A;  3M3Y K;  1SMY A;  5C3E C;  1Y1W K;  4BY7 K;  2PA8 L;  2NVX K;  3DXJ A;  4C2M K;  4A3E K;  4LJZ A;  3PO2 K;  3S17 C;  1I50 K;  3GTJ C;  4G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...