4A3FK

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3fK00
2NVXK 2R7ZK 5FJ8K 4XLNA 2NVQK 3HOYC 4LK1A 4G7OA 2NVXC 4XSXA 3HOXC 2E2JK 5C4JC 5C3EK 3GTMC 4BY1K 2BE5A 4MEXA 3GTGK 3H3VD 3S1MK 4A3BC 3RZOK 4KN4A 3I4NC 4A3FC 3HOVC 2WAQD 3PO2K 1R9TC 4KMUA 5TMFA 4BY7K 5C44C 5C4XK 4A3MC 4BXXK 3DXJA 4A3GC 2NVTK 3S14C 3S2DC 2E2IK 2YU9K 1TWFK 5C44K 4G7HA 4BY7C 5M3FK 2E2HK 4A3DC 4LK0A 1R9TK 3PO2C 3S1QC 2WB1D 4LJZA 3H3VL 3M3YK 4A3KC 4BBRC 1I6HC 5IP7K 4A3EK 5C3EC 3GTMK 5IP7C 3GTJK 4C3HK 3S1NC 4BBRK 4A3KK 1I6HK 5IYDK 1YNNA 3HKZL 2VUMC 1I6VA 4YFXA 3S1RK 3GTLC 4OIQA 5IP9K 3HOWK 3M3YC 1Y1WC 4Q4ZA 2E2IC 3GTKK 2NVTC 2E2JC 3S14K 3M4OC 3FKIK 4MQ9A 1Y1VK 2PMZL 4YFKA 4BBSK 2JA8K 2JA7K 3S17K 2PA8D 5FLMK 4XLPA 3GTGC 3I4NK 4A3BK 2PA8L 3GTPK 4C3IK 3S16K 4QIWD 3H0GC 2WAQL 1WCMC 4Y7NC 4A3JC 4A3IC 5FLMC 4OIRA 4JK1A 2JA7C 5M5WK 4OINA 1TWAK 2NVYK 5IYBK 3PO3K 1SFOC 3S15K 3HKZD 3S2HK 4Y52C 1BDFA 3GTKC 5TMCA 1TWGC 2A68A 3PO3C 1I50C 4YG2A 5IYBC 3GTOK 1TWAC 5M3MK 5IYDC 3HOUK 3GTQK 2Y0SD 3HOZK 2R92C 3GTJC 3S1NK 4OIPA 2JA5K 1TWHK 2B63C 1WCMK 4A3JK 3CQZC 3S16C 4QIWL 3GTPC 4ZH4A 3K7AC 1SMYA 1K83K 4LLGA 3S1QK 2JA6K 4NOIA 3RZDC 2E2HC 4A3LK 2JA8C 1ZYRA 1YNJA 4A93C 4A3DK 4G7ZA 2O5JA 3K7AK 4C2MK 4GZYA 3FKIC 3M4OK 3CQZK 3S2DK 4A3GK 5C4XC 4XSZA 1IW7A 3EQLA 4KN7A 1I3QK 2Y0SL 5IP9C 4AYBL 1XPPA 5M5YK 4QJVA 5IYCC 4A3MK 3S1RC 2VUMK 3HOUC 3HOZC 4X6AK 4A3CC 3GTOC 1I50K 3S1MC 5IYCK 4Q5SA 4X6AC 4A3CK 4QJVB 1I3QC 4BY1C 4Y52K 4A3EC 3S15C 1SFOK 2CW0A 2NVYC 4AYBD 2O5IA 3HOYK 2NVQC 3RZDK 4A93K 2JA6C 4A3LC 2WB1L 2R7ZC 1HQMA 1K83C 4A3IK 2A6HA 1TWFC 3H0GK 4Y7NK 2YU9C 1TWCK 5M5XK 3I4MK 5D4DA 2R93K 1TWHC 4C3JK 4MEYA 2JA5C 2B63K 4BXXC 2R92K 2A69A 3GTQC 3S17C 2A6EA 2PPBA 2PMZD 4A3FK 3HOVK 3RZOC 1Y1VC 4BBSC 1TWGK 4YFNA 2R93C 3I4MC 1TWCC 1Y1WK 3S2HC 5C4JK 3WODA 4OIOA 3HOXK 3HOWC 3GTLK
chains in the Genus database with same CATH superfamily
2NVXK 1WOSA 3L4JA 4XLNA 1JQWA 1ZVUA 2NVQK 2V6SA 4GTEA 1VRQC 2E2JK 2PHCB 4GFQA 1EFWA 4BY1K 1I50A 2JA6A 3FHZA 4A3FC 3HOVC 1J6VA 1R9TC 1EI6A 5TMFA 3LAPA 1XXCA 1EQRA 3S2DC 2E2IK 1F93A 1XZPA 3AQPA 2CFAB 1TWFK 2E2HK 1R9TK 3S1QC 4FM9A 5IP7K 3QX3A 4A3EK 3GIRA 5C3EC 1O25A 3TFJA 4GTLA 3GTJK 4BBRK 3SZZA 1YNNA 1O24A 2VUMC 3S1RK 1J6XA 3GTKK 2NVTC 3FKIK 4KAWX 1Y1VK 4BBSK 4YFKA 2JA8K 3S17K 4P5BA 3VA7A 3S16K 1XXAA 3SZYA 1RU0A 3OEPA 1PJ6A 2JA7C 4OINA 4P9SA 1J6WA 1BGWA 3PO3K 3S15K 4KMHA 2E2HA 3OREA 3BUEA 5TMCA 3CAGA 1WOOA 3PO3C 3GTOK 2Y0SD 4C3HC 5L46A 2ZUFA 4C3JC 2B63C 1WOPA 3S16C 4QIWL 4GTBA 4ZH4A 4C2MC 4LLGA 3N3YA 2GSUA 2JA8C 4C2MK 3N0CA 1ZQ1C 4A3GK 1IW7A 1O28A 3EQLA 4C45A 4LOWA 5M5YK 2XCRB 3S1MC 3AD8C 3N0BA 1EH1A 5CJ9A 1Y1WA 4A3EC 2CW0A 2NVYC 2O5IA 1YCLA 3RZDK 2B63A 2R7ZC 1HQMA 3IPJA 5E68A 1TWHC 2ZUEA 4MEYA 2R92K 3S0XA 3GTQC 2PPBA 1B4AA 1Y1VC 3RZOC 4BBSC 2R93C 2GSNA 1TWCC 2E2JC 4KMUA 2R7ZK 1VJEA 3G4AA 4G7OA 1XXBA 4ILDA 3AH5A 4BLBA 2NVXC 2D6FC 3HOXC 3OPFA 4GT9A 5C3EK 3GEEA 4MEXA 3GTGK 3H3VD 3I4NC 1EK8A 4KN4A 3TFHA 1DCPA 2WAQD 1TWFA 4M1XA 5TJ3A 3DXJA 5IOTA 3A8KA 3S14C 3GTGA 2YU9K 5M3FK 4LJZA 1WSVA 4A3KC 1IL2A 2GAHC 3S1NC 4C3HK 3GTKA 1I6HK 1I6VA 2RGRA 3GDZA 3HOWK 4J3NA 3GTJA 4PABA 2YU9A 1O2FB 2EBBA 3GTOA 1USOA 2JA7K 5FLMK 4XLPA 3GTGC 3I4NK 4A3BK 3GEHA 3AD7C 4Y7NC 2WAQL 1WCMC 1ISEA 3L4KA 2KWAA 5FLMC 1WSRA 4KMDA 2GSOA 4JK1A 5IYBK 1SFOC 1DD5A 4LR2A 4Y52C 3GTKC 2A68A 1TWAC 3A8IA 3HOZK 2R92C 3S1NK 1TWHK 1INNA 2P8TA 3CQZC 3GTPC 3RZDC 2E2HC 2O5JA 1XZQA 3T02A 1K83A 3S2DK 1O2AA 4KN7A 1WQHA 1O29A 5IP9C 1XPPA 3Q3QA 5IYCC 3HOUC 1J98A 1B4BA 1SFOA 5IYCK 4BY1C 1IQ0A 3GEIA 5IOQA 4AYBD 3ERED 2NVQC 5JFEA 4A3IK 5HL8A 3H0GK 1BS2A 1TWCK 5M5XK 2R93K 4C3JK 4G0UA 4BXXC 4GTCA 2A69A 2VUMA 2A6EA 1YX2A 4YFNA 5EGHA 3I4MC 1HI9A 1Y1WK 5C4JK 4OIOA 5FJ8K 3HXAA 4LK1A 4XSXA 5IORA 3GTMC 2BE5A 3FOFA 4A3BC 3S1MK 2E2IA 3PO2K 1JOEA 4KARA 4BY7K 1WORA 5C44C 3BP3A 4A3GC 1I3QA 4KC6A 5C44K 1XZPB 4G7HA 4AH6A 1F7VA 4LK0A 1I6HC 3GSIA 1PJ7A 1R9TA 4KMAA 4A3KK 1V5VA 2RH6A 3HKZL 1C0AA 4YFXA 3GTLC 3M3YC 3GTMA 4KM9A 1Y1WC 3S14K 3M4OC 4GTFA 4MQ9A 1F7UA 2ZFZA 4BLAA 3NUHA 1TWGA 1IS1A 3GTQA 1AB4A 4KASA 2PA8L 3GTPK 4C3IK 2XCOA 4PAAA 4A3JC 1TWCA 5EGEA 2W7VA 4OIRA 1TWAK 1L0WA 4KB2A 1UV7A 3S2HK 4WILA 1TWHA 3FKIA 1I50C 5IYBC 1VH2A 5M3MK 5IYDC 2NVXA 3GTQK 3GTJC 1PJ5A 4A3JK 3MMLB 5CHPA 4C3IC 3K7AC 1SMYA 3S1QK 4LQYA 4A93C 2JA5A 4A3DK 1ZYRA 4GTAA 4G7ZA 3K7AK 3M4OK 4XSZA 1WIHA 1O2BA 4AYBL 2Y0SL 4A3MK 5C4XC 4BKWA 1I50K 3CQZA 4Q5SA 1O27A 4A3CK 4QJVB 3FOEA 1DCOA 4G0VA 1Y1VA 4Y52K 1TWAA 1XZQB 1USMA 4P5AA 3HOYK 2WB1L 2GAGC 1K83C 2YU9C 2B63K 1WCMA 3GTLA 2CFAA 2P5MA 2JA7A 1TWGK 3TFIA 1VLOA 1WQFA 3HOXK 3HOWC 3GTLK 3M3YK 1ZBSA 3HOYC 2XCQA 5IOSA 5C4JC 1WQGA 4KM8A 5JVOA 3RZOK 5C4XK 4A3MC 4BXXK 1KQ4A 3T00A 2NVTK 4KB4A 4BY7C 3LPXA 4A3DC 3PO2C 2WB1D 3H3VL 1IBAA 4BBRC 3LAJA 3GTPA 3GTMK 2V6TA 5IP7C 5IYDK 3G4CA 2FQOA 4OIQA 1G51A 5IP9K 2R7ZA 4Q4ZA 4DDQA 2E2IC 2Y3PA 2PMZL 3TTGA 2JH3A 2PA8D 3BP8C 1O26A 4QIWD 3H0GC 4FZBA 4G0WA 4A3IC 1VGXA 5M5WK 4O2DA 2NVYK 3AD9C 3HKZD 1BDFA 1GE9A 1TWGC 4YG2A 3HOUK 4OIPA 2JA5K 1IE0A 1WCMK 4KDDA 3AQOA 1K83K 2JA6K 4NOIA 4A3LK 2NVYA 1YNJA 4GZYA 3V4GA 3H0GA 3FKIC 1ZXOA 4RMFA 3CQZK 2R93A 3T01A 1I3QK 4A3CC 4GTDA 3S1RC 4QJVA 3HOZC 2R92A 4X6AK 3ADAC 2VUMK 3GTOC 4X6AC 1BJTA 1I3QC 1F9NA 3S15C 1SFOK 2V6UA 4A3LC 4A93K 2JA6C 4WJ3M 2A6HA 1TWFC 4Y7NK 3I4MK 5D4DA 4XCHA 2JA5C 4KATA 1DCHA 1X31C 3S17C 2FQTA 2PMZD 4A3FK 3HOVK 1JVIA 3A8JA 3S2HC 3JSTA 3WODA 4WJ4A
chains in the Genus database with same CATH topology
2NVXK 2R7ZK 5FJ8K 4XLNA 2NVQK 3HOYC 4LK1A 4G7OA 2NVXC 4XSXA 3HOXC 2E2JK 5C4JC 5C3EK 3GTMC 4BY1K 2BE5A 4MEXA 3GTGK 3H3VD 3S1MK 4A3BC 3RZOK 4KN4A 3I4NC 4A3FC 3HOVC 2WAQD 3PO2K 1R9TC 4KMUA 5TMFA 4BY7K 5C44C 5C4XK 4A3MC 4BXXK 3DXJA 4A3GC 2NVTK 3S14C 3S2DC 2E2IK 2YU9K 1TWFK 5C44K 4G7HA 4BY7C 5M3FK 2E2HK 4A3DC 4LK0A 1R9TK 3PO2C 3S1QC 2WB1D 4LJZA 3H3VL 3M3YK 4A3KC 4BBRC 1I6HC 5IP7K 4A3EK 5C3EC 3GTMK 5IP7C 3GTJK 4C3HK 3S1NC 4BBRK 4A3KK 1I6HK 5IYDK 1YNNA 3HKZL 2VUMC 1I6VA 4YFXA 3S1RK 3GTLC 4OIQA 5IP9K 3HOWK 3M3YC 1Y1WC 4Q4ZA 2E2IC 3GTKK 2NVTC 2E2JC 3S14K 3M4OC 3FKIK 4MQ9A 1Y1VK 2PMZL 4YFKA 4BBSK 2JA8K 2JA7K 3S17K 2PA8D 5FLMK 4XLPA 3GTGC 3I4NK 4A3BK 2PA8L 3GTPK 4C3IK 3S16K 4QIWD 3H0GC 2WAQL 1WCMC 4Y7NC 4A3JC 4A3IC 5FLMC 4OIRA 4JK1A 2JA7C 5M5WK 4OINA 1TWAK 2NVYK 5IYBK 3PO3K 1SFOC 3S15K 3HKZD 3S2HK 4Y52C 1BDFA 3GTKC 5TMCA 1TWGC 2A68A 3PO3C 1I50C 4YG2A 5IYBC 3GTOK 1TWAC 5M3MK 5IYDC 3HOUK 3GTQK 2Y0SD 3HOZK 2R92C 3GTJC 3S1NK 4OIPA 2JA5K 1TWHK 2B63C 1WCMK 4A3JK 3CQZC 3S16C 4QIWL 3GTPC 4ZH4A 3K7AC 1SMYA 1K83K 4LLGA 3S1QK 2JA6K 4NOIA 3RZDC 2E2HC 4A3LK 2JA8C 1ZYRA 1YNJA 4A93C 4A3DK 4G7ZA 2O5JA 3K7AK 4C2MK 4GZYA 3FKIC 3M4OK 3CQZK 3S2DK 4A3GK 5C4XC 4XSZA 1IW7A 3EQLA 4KN7A 1I3QK 2Y0SL 5IP9C 4AYBL 1XPPA 5M5YK 4QJVA 5IYCC 4A3MK 3S1RC 2VUMK 3HOUC 3HOZC 4X6AK 4A3CC 3GTOC 1I50K 3S1MC 5IYCK 4Q5SA 4X6AC 4A3CK 4QJVB 1I3QC 4BY1C 4Y52K 4A3EC 3S15C 1SFOK 2CW0A 2NVYC 4AYBD 2O5IA 3HOYK 2NVQC 3RZDK 4A93K 2JA6C 4A3LC 2WB1L 2R7ZC 1HQMA 1K83C 4A3IK 2A6HA 1TWFC 3H0GK 4Y7NK 2YU9C 1TWCK 5M5XK 3I4MK 5D4DA 2R93K 1TWHC 4C3JK 4MEYA 2JA5C 2B63K 4BXXC 2R92K 2A69A 3GTQC 3S17C 2A6EA 2PPBA 2PMZD 4A3FK 3HOVK 3RZOC 1Y1VC 4BBSC 1TWGK 4YFNA 2R93C 3I4MC 1TWCC 1Y1WK 3S2HC 5C4JK 3WODA 4OIOA 3HOXK 3HOWC 3GTLK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX K;  2R7Z K;  5FJ8 K;  4XLN A;  2NVQ K;  3HOY C;  4LK1 A;  4G7O A;  2NVX C;  4XSX A;  3HOX C;  2E2J K;  5C4J C;  5C3E K;  3GTM C;  4BY1 K;  2BE5 A;  4MEX A;  3GTG K;  3H3V D;  3S1M K;  4A3B C;  3RZO K;  4KN4 A;  3I4N C;  4A3F C;  3HOV C;  2WAQ D;  3PO2 K;  1R9T C;  4KMU A;  5TMF A;  4BY7 K;  5C44 C;  5C4X K;  4A3M C;  4BXX K;  3DXJ A;  4A3G C;  2NVT K;  3S14 C;  3S2D C;  2E2I K;  2YU9 K;  1TWF K;  5C44 K;  4G7H A;  4BY7 C;  5M3F K;  2E2H K;  4A3D C;  4LK0 A;  1R9T K;  3PO2 C;  3S1Q C;  2WB1 D;  4LJZ A;  3H3V L;  3M3Y K;  4A3K C;  4BBR C;  1I6H C;  5IP7 K;  4A3E K;  5C3E C;  3GTM K;  5IP7 C;  3GTJ K;  4C3H K;  3S1N C;  4BBR K;  4A3K K;  1I6H K;  5IYD K;  1YNN A;  3HKZ L;  2VUM C;  1I6V A;  4YFX A;  3S1R K;  3GTL C;  4OIQ A;  5IP9 K;  3HOW K;  3M3Y C;  1Y1W C;  4Q4Z A;  2E2I C;  3GTK K;  2NVT C;  2E2J C;  3S14 K;  3M4O C;  3FKI K;  4MQ9 A;  1Y1V K;  2PMZ L;  4YFK A;  4BBS K;  2JA8 K;  2JA7 K;  3S17 K;  2PA8 D;  5FLM K;  4XLP A;  3GTG C;  3I4N K;  4A3B K;  2PA8 L;  3GTP K;  4C3I K;  3S16 K;  4QIW D;  3H0G C;  2WAQ L;  1WCM C;  4Y7N C;  4A3J C;  4A3I C;  5FLM C;  4OIR A;  4JK1 A;  2JA7 C;  5M5W K;  4OIN A;  1TWA K;  2NVY K;  5IYB K;  3PO3 K;  1SFO C;  3S15 K;  3HKZ D;  3S2H K;  4Y52 C;  1BDF A;  3GTK C;  5TMC A;  1TWG C;  2A68 A;  3PO3 C;  1I50 C;  4YG2 A;  5IYB C;  3GTO K;  1TWA C;  5M3M K;  5IYD C;  3HOU K;  3GTQ K;  2Y0S D;  3HOZ K;  2R92 C;  3GTJ C;  3S1N K;  4OIP A;  2JA5 K;  1TWH K;  2B63 C;  1WCM K;  4A3J K;  3CQZ C;  3S16 C;  4QIW L;  3GTP C;  4ZH4 A;  3K7A C;  1SMY A;  1K83 K;  4LLG A;  3S1Q K;  2JA6 K;  4NOI A;  3RZD C;  2E2H C;  4A3L K;  2JA8 C;  1ZYR A;  1YNJ A;  4A93 C;  4A3D K;  4G7Z A;  2O5J A;  3K7A K;  4C2M K;  4GZY A;  3FKI C;  3M4O K;  3CQZ K;  3S2D K;  4A3G K;  5C4X C;  4XSZ A;  1IW7 A;  3EQL A;  4KN7 A;  1I3Q K;  2Y0S L;  5IP9 C;  4AYB L;  1XPP A;  5M5Y K;  4QJV A;  5IYC C;  4A3M K;  3S1R C;  2VUM K;  3HOU C;  3HOZ C;  4X6A K;  4A3C C;  3GTO C;  1I50 K;  3S1M C;  5IYC K;  4Q5S A;  4X6A C;  4A3C K;  4QJV B;  1I3Q C;  4BY1 C;  4Y52 K;  4A3E C;  3S15 C;  1SFO K;  2CW0 A;  2NVY C;  4AYB D;  2O5I A;  3HOY K;  2NVQ C;  3RZD K;  4A93 K;  2JA6 C;  4A3L C;  2WB1 L;  2R7Z C;  1HQM A;  1K83 C;  4A3I K;  2A6H A;  1TWF C;  3H0G K;  4Y7N K;  2YU9 C;  1TWC K;  5M5X K;  3I4M K;  5D4D A;  2R93 K;  1TWH C;  4C3J K;  4MEY A;  2JA5 C;  2B63 K;  4BXX C;  2R92 K;  2A69 A;  3GTQ C;  3S17 C;  2A6E A;  2PPB A;  2PMZ D;  4A3F K;  3HOV K;  3RZO C;  1Y1V C;  4BBS C;  1TWG K;  4YFN A;  2R93 C;  3I4M C;  1TWC C;  1Y1W K;  3S2H C;  5C4J K;  3WOD A;  4OIO A;  3HOX K;  3HOW C;  3GTL K; 
#chains in the Genus database with same CATH topology
 2NVX K;  1WOS A;  3L4J A;  4XLN A;  1JQW A;  1ZVU A;  2NVQ K;  2V6S A;  4GTE A;  1VRQ C;  2E2J K;  2PHC B;  4GFQ A;  1EFW A;  4BY1 K;  1I50 A;  2JA6 A;  3FHZ A;  4A3F C;  3HOV C;  1J6V A;  1R9T C;  1EI6 A;  5TMF A;  3LAP A;  1XXC A;  1EQR A;  3S2D C;  2E2I K;  1F93 A;  1XZP A;  3AQP A;  2CFA B;  1TWF K;  2E2H K;  1R9T K;  3S1Q C;  4FM9 A;  5IP7 K;  3QX3 A;  4A3E K;  3GIR A;  5C3E C;  1O25 A;  3TFJ A;  4GTL A;  3GTJ K;  4BBR K;  3SZZ A;  1YNN A;  1O24 A;  2VUM C;  3S1R K;  1J6X A;  3GTK K;  2NVT C;  3FKI K;  4KAW X;  1Y1V K;  4BBS K;  4YFK A;  2JA8 K;  3S17 K;  4P5B A;  3VA7 A;  3S16 K;  1XXA A;  3SZY A;  1RU0 A;  3OEP A;  1PJ6 A;  2JA7 C;  4OIN A;  4P9S A;  1J6W A;  1BGW A;  3PO3 K;  3S15 K;  4KMH A;  2E2H A;  3ORE A;  3BUE A;  5TMC A;  3CAG A;  1WOO A;  3PO3 C;  3GTO K;  2Y0S D;  4C3H C;  5L46 A;  2ZUF A;  4C3J C;  2B63 C;  1WOP A;  3S16 C;  4QIW L;  4GTB A;  4ZH4 A;  4C2M C;  4LLG A;  3N3Y A;  2GSU A;  2JA8 C;  4C2M K;  3N0C A;  1ZQ1 C;  4A3G K;  1IW7 A;  1O28 A;  3EQL A;  4C45 A;  4LOW A;  5M5Y K;  2XCR B;  3S1M C;  3AD8 C;  3N0B A;  1EH1 A;  5CJ9 A;  1Y1W A;  4A3E C;  2CW0 A;  2NVY C;  2O5I A;  1YCL A;  3RZD K;  2B63 A;  2R7Z C;  1HQM A;  3IPJ A;  5E68 A;  1TWH C;  2ZUE A;  4MEY A;  2R92 K;  3S0X A;  3GTQ C;  2PPB A;  1B4A A;  1Y1V C;  3RZO C;  4BBS C;  2R93 C;  2GSN A;  1TWC C;  2E2J C;  4KMU A;  2R7Z K;  1VJE A;  3G4A A;  4G7O A;  1XXB A;  4ILD A;  3AH5 A;  4BLB A;  2NVX C;  2D6F C;  3HOX C;  3OPF A;  4GT9 A;  5C3E K;  3GEE A;  4MEX A;  3GTG K;  3H3V D;  3I4N C;  1EK8 A;  4KN4 A;  3TFH A;  1DCP A;  2WAQ D;  1TWF A;  4M1X A;  5TJ3 A;  3DXJ A;  5IOT A;  3A8K A;  3S14 C;  3GTG A;  2YU9 K;  5M3F K;  4LJZ A;  1WSV A;  4A3K C;  1IL2 A;  2GAH C;  3S1N C;  4C3H K;  3GTK A;  1I6H K;  1I6V A;  2RGR A;  3GDZ A;  3HOW K;  4J3N A;  3GTJ A;  4PAB A;  2YU9 A;  1O2F B;  2EBB A;  3GTO A;  1USO A;  2JA7 K;  5FLM K;  4XLP A;  3GTG C;  3I4N K;  4A3B K;  3GEH A;  3AD7 C;  4Y7N C;  2WAQ L;  1WCM C;  1ISE A;  3L4K A;  2KWA A;  5FLM C;  1WSR A;  4KMD A;  2GSO A;  4JK1 A;  5IYB K;  1SFO C;  1DD5 A;  4LR2 A;  4Y52 C;  3GTK C;  2A68 A;  1TWA C;  3A8I A;  3HOZ K;  2R92 C;  3S1N K;  1TWH K;  1INN A;  2P8T A;  3CQZ C;  3GTP C;  3RZD C;  2E2H C;  2O5J A;  1XZQ A;  3T02 A;  1K83 A;  3S2D K;  1O2A A;  4KN7 A;  1WQH A;  1O29 A;  5IP9 C;  1XPP A;  3Q3Q A;  5IYC C;  3HOU C;  1J98 A;  1B4B A;  1SFO A;  5IYC K;  4BY1 C;  1IQ0 A;  3GEI A;  5IOQ A;  4AYB D;  3ERE D;  2NVQ C;  5JFE A;  4A3I K;  5HL8 A;  3H0G K;  1BS2 A;  1TWC K;  5M5X K;  2R93 K;  4C3J K;  4G0U A;  4BXX C;  4GTC A;  2A69 A;  2VUM A;  2A6E A;  1YX2 A;  4YFN A;  5EGH A;  3I4M C;  1HI9 A;  1Y1W K;  5C4J K;  4OIO A;  5FJ8 K;  3HXA A;  4LK1 A;  4XSX A;  5IOR A;  3GTM C;  2BE5 A;  3FOF A;  4A3B C;  3S1M K;  2E2I A;  3PO2 K;  1JOE A;  4KAR A;  4BY7 K;  1WOR A;  5C44 C;  3BP3 A;  4A3G C;  1I3Q A;  4KC6 A;  5C44 K;  1XZP B;  4G7H A;  4AH6 A;  1F7V A;  4LK0 A;  1I6H C;  3GSI A;  1PJ7 A;  1R9T A;  4KMA A;  4A3K K;  1V5V A;  2RH6 A;  3HKZ L;  1C0A A;  4YFX A;  3GTL C;  3M3Y C;  3GTM A;  4KM9 A;  1Y1W C;  3S14 K;  3M4O C;  4GTF A;  4MQ9 A;  1F7U A;  2ZFZ A;  4BLA A;  3NUH A;  1TWG A;  1IS1 A;  3GTQ A;  1AB4 A;  4KAS A;  2PA8 L;  3GTP K;  4C3I K;  2XCO A;  4PAA A;  4A3J C;  1TWC A;  5EGE A;  2W7V A;  4OIR A;  1TWA K;  1L0W A;  4KB2 A;  1UV7 A;  3S2H K;  4WIL A;  1TWH A;  3FKI A;  1I50 C;  5IYB C;  1VH2 A;  5M3M K;  5IYD C;  2NVX A;  3GTQ K;  3GTJ C;  1PJ5 A;  4A3J K;  3MML B;  5CHP A;  4C3I C;  3K7A C;  1SMY A;  3S1Q K;  4LQY A;  4A93 C;  2JA5 A;  4A3D K;  1ZYR A;  4GTA A;  4G7Z A;  3K7A K;  3M4O K;  4XSZ A;  1WIH A;  1O2B A;  4AYB L;  2Y0S L;  4A3M K;  5C4X C;  4BKW A;  1I50 K;  3CQZ A;  4Q5S A;  1O27 A;  4A3C K;  4QJV B;  3FOE A;  1DCO A;  4G0V A;  1Y1V A;  4Y52 K;  1TWA A;  1XZQ B;  1USM A;  4P5A A;  3HOY K;  2WB1 L;  2GAG C;  1K83 C;  2YU9 C;  2B63 K;  1WCM A;  3GTL A;  2CFA A;  2P5M A;  2JA7 A;  1TWG K;  3TFI A;  1VLO A;  1WQF A;  3HOX K;  3HOW C;  3GTL K;  3M3Y K;  1ZBS A;  3HOY C;  2XCQ A;  5IOS A;  5C4J C;  1WQG A;  4KM8 A;  5JVO A;  3RZO K;  5C4X K;  4A3M C;  4BXX K;  1KQ4 A;  3T00 A;  2NVT K;  4KB4 A;  4BY7 C;  3LPX A;  4A3D C;  3PO2 C;  2WB1 D;  3H3V L;  1IBA A;  4BBR C;  3LAJ A;  3GTP A;  3GTM K;  2V6T A;  5IP7 C;  5IYD K;  3G4C A;  2FQO A;  4OIQ A;  1G51 A;  5IP9 K;  2R7Z A;  4Q4Z A;  4DDQ A;  2E2I C;  2Y3P A;  2PMZ L;  3TTG A;  2JH3 A;  2PA8 D;  3BP8 C;  1O26 A;  4QIW D;  3H0G C;  4FZB A;  4G0W A;  4A3I C;  1VGX A;  5M5W K;  4O2D A;  2NVY K;  3AD9 C;  3HKZ D;  1BDF A;  1GE9 A;  1TWG C;  4YG2 A;  3HOU K;  4OIP A;  2JA5 K;  1IE0 A;  1WCM K;  4KDD A;  3AQO A;  1K83 K;  2JA6 K;  4NOI A;  4A3L K;  2NVY A;  1YNJ A;  4GZY A;  3V4G A;  3H0G A;  3FKI C;  1ZXO A;  4RMF A;  3CQZ K;  2R93 A;  3T01 A;  1I3Q K;  4A3C C;  4GTD A;  3S1R C;  4QJV A;  3HOZ C;  2R92 A;  4X6A K;  3ADA C;  2VUM K;  3GTO C;  4X6A C;  1BJT A;  1I3Q C;  1F9N A;  3S15 C;  1SFO K;  2V6U A;  4A3L C;  4A93 K;  2JA6 C;  4WJ3 M;  2A6H A;  1TWF C;  4Y7N K;  3I4M K;  5D4D A;  4XCH A;  2JA5 C;  4KAT A;  1DCH A;  1X31 C;  3S17 C;  2FQT A;  2PMZ D;  4A3F K;  3HOV K;  1JVI A;  3A8J A;  3S2H C;  3JST A;  3WOD A;  4WJ4 A; 
#chains in the Genus database with same CATH homology
 2NVX K;  2R7Z K;  5FJ8 K;  4XLN A;  2NVQ K;  3HOY C;  4LK1 A;  4G7O A;  2NVX C;  4XSX A;  3HOX C;  2E2J K;  5C4J C;  5C3E K;  3GTM C;  4BY1 K;  2BE5 A;  4MEX A;  3GTG K;  3H3V D;  3S1M K;  4A3B C;  3RZO K;  4KN4 A;  3I4N C;  4A3F C;  3HOV C;  2WAQ D;  3PO2 K;  1R9T C;  4KMU A;  5TMF A;  4BY7 K;  5C44 C;  5C4X K;  4A3M C;  4BXX K;  3DXJ A;  4A3G C;  2NVT K;  3S14 C;  3S2D C;  2E2I K;  2YU9 K;  1TWF K;  5C44 K;  4G7H A;  4BY7 C;  5M3F K;  2E2H K;  4A3D C;  4LK0 A;  1R9T K;  3PO2 C;  3S1Q C;  2WB1 D;  4LJZ A;  3H3V L;  3M3Y K;  4A3K C;  4BBR C;  1I6H C;  5IP7 K;  4A3E K;  5C3E C;  3GTM K;  5IP7 C;  3GTJ K;  4C3H K;  3S1N C;  4BBR K;  4A3K K;  1I6H K;  5IYD K;  1YNN A;  3HKZ L;  2VUM C;  1I6V A;  4YFX A;  3S1R K;  3GTL C;  4OIQ A;  5IP9 K;  3HOW K;  3M3Y C;  1Y1W C;  4Q4Z A;  2E2I C;  3GTK K;  2NVT C;  2E2J C;  3S14 K;  3M4O C;  3FKI K;  4MQ9 A;  1Y1V K;  2PMZ L;  4YFK A;  4BBS K;  2JA8 K;  2JA7 K;  3S17 K;  2PA8 D;  5FLM K;  4XLP A;  3GTG C;  3I4N K;  4A3B K;  2PA8 L;  3GTP K;  4C3I K;  3S16 K;  4QIW D;  3H0G C;  2WAQ L;  1WCM C;  4Y7N C;  4A3J C;  4A3I C;  5FLM C;  4OIR A;  4JK1 A;  2JA7 C;  5M5W K;  4OIN A;  1TWA K;  2NVY K;  5IYB K;  3PO3 K;  1SFO C;  3S15 K;  3HKZ D;  3S2H K;  4Y52 C;  1BDF A;  3GTK C;  5TMC A;  1TWG C;  2A68 A;  3PO3 C;  1I50 C;  4YG2 A;  5IYB C;  3GTO K;  1TWA C;  5M3M K;  5IYD C;  3HOU K;  3GTQ K;  2Y0S D;  3HOZ K;  2R92 C;  3GTJ C;  3S1N K;  4OIP A;  2JA5 K;  1TWH K;  2B63 C;  1WCM K;  4A3J K;  3CQZ C;  3S16 C;  4QIW L;  3GTP C;  4ZH4 A;  3K7A C;  1SMY A;  1K83 K;  4LLG A;  3S1Q K;  2JA6 K;  4NOI A;  3RZD C;  2E2H C;  4A3L K;  2JA8 C;  1ZYR A;  1YNJ A;  4A93 C;  4A3D K;  4G7Z A;  2O5J A;  3K7A K;  4C2M K;  4GZY A;  3FKI C;  3M4O K;  3CQZ K;  3S2D K;  4A3G K;  5C4X C;  4XSZ A;  1IW7 A;  3EQL A;  4KN7 A;  1I3Q K;  2Y0S L;  5IP9 C;  4AYB L;  1XPP A;  5M5Y K;  4QJV A;  5IYC C;  4A3M K;  3S1R C;  2VUM K;  3HOU C;  3HOZ C;  4X6A K;  4A3C C;  3GTO C;  1I50 K;  3S1M C;  5IYC K;  4Q5S A;  4X6A C;  4A3C K;  4QJV B;  1I3Q C;  4BY1 C;  4Y52 K;  4A3E C;  3S15 C;  1SFO K;  2CW0 A;  2NVY C;  4AYB D;  2O5I A;  3HOY K;  2NVQ C;  3RZD K;  4A93 K;  2JA6 C;  4A3L C;  2WB1 L;  2R7Z C;  1HQM A;  1K83 C;  4A3I K;  2A6H A;  1TWF C;  3H0G K;  4Y7N K;  2YU9 C;  1TWC K;  5M5X K;  3I4M K;  5D4D A;  2R93 K;  1TWH C;  4C3J K;  4MEY A;  2JA5 C;  2B63 K;  4BXX C;  2R92 K;  2A69 A;  3GTQ C;  3S17 C;  2A6E A;  2PPB A;  2PMZ D;  4A3F K;  3HOV K;  3RZO C;  1Y1V C;  4BBS C;  1TWG K;  4YFN A;  2R93 C;  3I4M C;  1TWC C;  1Y1W K;  3S2H C;  5C4J K;  3WOD A;  4OIO A;  3HOX K;  3HOW C;  3GTL K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...