4A3FK

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3fK00
3RZDC 3I4MK 4BBRK 3WODA 3S1NC 3HOYK 3GTOC 3S14K 4A93C 3K7AC 4A3GC 2NVTC 1TWFK 4YFKA 5FJ8K 2NVQK 3HOUC 1IW7A 3HOVK 4LK1A 3H0GC 4LK0A 1BDFA 5M5XK 1SMYA 1ZYRA 2WAQL 3S1RC 4MEXA 3H3VL 3S17C 4OIQA 2R92C 3GTMC 1SFOK 4X6AK 3HOZC 2WB1L 5IP7C 4XLPA 3GTJC 3S16C 1TWCK 1Y1WK 2JA8C 4BBRC 4QIWL 3HOXK 5M5WK 3HOYC 4BY7C 1TWHC 4G7ZA 4BY1K 1WCMK 4G7HA 2YU9K 3RZOK 4BXXK 2E2JK 5C44K 2R7ZK 5C4XK 4YG2A 5M3MK 4OIOA 3S15K 4Y7NK 2VUMC 4MQ9A 5C3EK 3S1MK 4A3FK 3HOXC 1TWAK 3FKIK 3GTPK 1Y1VC 4A3IK 2O5JA 3HKZD 4LLGA 4AYBD 3S2HK 4A3CK 2PMZL 4XSZA 2Y0SD 4A3EK 3GTLK 2YU9C 3GTQC 2R93K 5IYCC 1R9TK 1I50K 5IYBC 3M3YK 3S1QC 2JA5K 1TWGK 4Q4ZA 2BE5A 3I4MC 2E2HK 3S14C 2NVXK 3CQZK 1TWAC 1TWFC 3S2HC 4A3JK 2NVQC 4A3CC 2A6EA 3HOVC 4A3EC 3GTLC 2R93C 4ZH4A 2A69A 4AYBL 1I6VA 1SFOC 4X6AC 2JA6K 1K83K 1TWCC 4KN4A 2E2IK 4A3LK 3S2DK 1Y1WC 2NVYK 1I3QK 2E2HC 3GTGK 5FLMK 2B63K 3M4OK 4A3MK 2NVXC 5TMCA 2JA7K 2O5IA 4YFNA 3HOWK 4A3JC 4BY1C 1WCMC 5IYDK 4XLNA 3RZOC 2E2JC 4BXXC 4G7OA 5C44C 4XSXA 2R7ZC 4MEYA 3GTOK 4QJVA 4OINA 5C4XC 3S15C 1I6HK 3H3VD 4C3HK 2JA6C 5M3FK 2NVTK 5C4JK 4Y7NC 1K83C 4C3JK 5C3EC 4A3LC 2WB1D 3H0GK 3S1MC 2NVYC 1I3QC 4A3FC 3S1RK 5TMFA 3S17K 1YNJA 3FKIC 2R92K 4A3IC 3GTPC 4QIWD 3PO3K 3I4NK 3HOZK 4A3BK 5IYDC 3GTJK 3S16K 4YFXA 1R9TC 1I50C 4JK1A 2JA8K 1YNNA 5D4DA 3HKZL 3M3YC 2PA8D 4QJVB 2Y0SL 1I6HC 2PPBA 4BY7K 5IP9K 4Y52K 2JA5C 1TWHK 1TWGC 5C4JC 1XPPA 4A3KK 3GTKK 3PO2K 4A3DK 3CQZC 1HQMA 4A3BC 3PO3C 4BBSK 3I4NC 5M5YK 2A6HA 4C2MK 2VUMK 3EQLA 3RZDK 2PMZD 3S1NK 4OIPA 4A93K 1Y1VK 2WAQD 3K7AK 5IP9C 4Y52C 3HOUK 3DXJA 4GZYA 4A3GK 4KN7A 2CW0A 2E2IC 3S2DC 3GTQK 4Q5SA 2PA8L 5IYCK 4A3KC 3GTGC 5IYBK 5FLMC 2B63C 3GTKC 3PO2C 4A3MC 3M4OC 3GTMK 3S1QK 4C3IK 2JA7C 4A3DC 4KMUA 4OIRA 4BBSC 3HOWC 2A68A 5IP7K 4NOIA 4LJZA
chains in the Genus database with same CATH superfamily
3ADAC 1F7VA 4KMHA 3HOYK 3GTOC 3S1NC 3H0GA 3K7AC 4C3HC 4PABA 4A3GC 1WORA 3HOUC 4PAAA 1IW7A 4C3JC 4LK0A 1ZYRA 3H3VL 2WAQL 3S17C 3GTMC 4X6AK 2WB1L 5IP7C 3GTJC 1O27A 2JA8C 1AB4A 1TWHA 5M5WK 3G4AA 2EBBA 4GTCA 1EK8A 1J6VA 1VLOA 1WCMK 2R7ZK 2RH6A 1O25A 4C2MC 4A3FK 3HOXC 2KWAA 3FKIK 3GTPK 1EH1A 4LLGA 4AYBD 1DCHA 4KDDA 4XSZA 3GTMA 5IYBC 5E68A 4P5AA 1J98A 2BE5A 3I4MC 1O29A 2E2HK 3S14C 2V6SA 1JQWA 4A3CC 3GEEA 2V6UA 3OREA 1SFOA 4AYBL 1I6VA 1TWCA 5CJ9A 2JA6K 1K83K 1ZBSA 1Y1WC 1L0WA 3GTGK 1XXAA 2B63K 2NVXC 1J6XA 2GSOA 2O5IA 2JA7K 3IPJA 4XLNA 4BXXC 5C44C 4XSXA 3GTOK 5C4XC 1WSRA 2D6FC 4C3HK 5C4JK 4C3JK 3S1MC 1I3QC 5JVOA 4LOWA 5TMFA 3S17K 4A3BK 4KMDA 1I50A 3GTJK 4YFXA 1F9NA 1R9TC 2JA8K 3GSIA 4JK1A 1YNNA 5D4DA 2JA5A 4C45A 2Y0SL 5CHPA 1I6HC 1WQFA 4Y52K 3N0CA 1TWGC 2NVXA 1XXCA 3CQZA 2V6TA 3MMLB 3GTKK 3T00A 1GE9A 5EGEA 3AD7C 4C2MK 3L4KA 4M1XA 3EQLA 2PMZD 1JVIA 4OIPA 4A93K 1I3QA 2W7VA 4GZYA 2P5MA 3BUEA 2E2IC 5JFEA 3A8JA 4A3KC 5IYBK 3PO2C 3M4OC 4BBSC 3AD8C 5HL8A 4NOIA 3I4MK 4BBRK 3WODA 3S14K 4YFKA 3H0GC 5M5XK 3S1RC 1WOPA 4OIQA 4GT9A 1Y1WK 1USOA 1KQ4A 2ZUFA 2RGRA 4BY7C 1TWHC 4G7ZA 4G7HA 2YU9K 4BXXK 1O2BA 5C44K 3V4GA 5C4XK 1J6WA 4KMAA 4MQ9A 1Y1VA 3S1MK 1TWAK 1VH2A 3GTQA 3HKZD 3S2HK 3LAJA 4A3EK 3GTLK 3CAGA 1R9TK 3S1QC 3AQOA 3LAPA 1B4BA 1TWGK 1WOSA 4KATA 1TWFA 1VJEA 3SZYA 1F7UA 2NVQC 3VA7A 2R93C 4ZH4A 3QX3A 2A69A 4BLBA 4KM8A 1SFOC 2CFAB 3OEPA 1TWCC 3A8KA 2E2IK 4A3LK 1RU0A 2NVYK 1O2FB 3M4OK 3N0BA 4KB2A 1XXBA 4YFNA 4A3JC 3T01A 4G7OA 2E2JC 1ZVUA 1F93A 3FHZA 3S15C 1ISEA 1DCPA 3H0GK 3S1RK 1YNJA 2R93A 4QIWD 3PO3K 5IYDC 2ZUEA 1I50C 1WQHA 3M3YC 3HXAA 4BY7K 2JA5C 1TWHK 1XPPA 1HI9A 4FM9A 4A3DK 3CQZC 1HQMA 3I4NC 4LR2A 3S1NK 1O28A 1XZPB 3K7AK 4A3GK 5IP9C 3HOUK 3DXJA 4KN7A 1ZXOA 5FLMC 3S1QK 4J3NA 3GTMK 5IP7K 4LJZA 4WJ3M 3RZDC 3GIRA 2NVTC 5FJ8K 2NVQK 2R92A 1SMYA 4MEXA 1IQ0A 1SFOK 5IOSA 3HOZC 4XLPA 4KC6A 1TWCK 4DDQA 3HOXK 3HOYC 2PHCB 2E2JK 5L46A 1YX2A 2VUMA 4YG2A 5M3MK 3S15K 1X31C 1EI6A 4LQYA 4BLAA 1BS2A 1O2AA 3T02A 4RMFA 5TJ3A 2O5JA 1Y1VC 1USMA 3AD9C 4A3CK 2PMZL 3GTQC 5IYCC 1I50K 3M3YK 2XCQA 2CFAA 4C3IC 2JA5K 1BGWA 4P5BA 2NVXK 3CQZK 3Q3QA 1TWFC 2A6EA 3GDZA 3HOVC 4GTAA 4KASA 1I3QK 2E2HC 3S0XA 3BP3A 5FLMK 3BP8C 1WCMA 5TMCA 5IOQA 2R7ZA 4BY1C 2FQOA 3RZOC 4MEYA 4WILA 1I6HK 3H3VD 2JA6C 2NVTK 1EQRA 4Y7NC 1K83C 3NUHA 3FKIA 2WB1D 5C3EC 3GTPA 1V5VA 1DCOA 4A3IC 1IS1A 2ZFZA 3HOZK 1INNA 3TFHA 3N3YA 3TTGA 4WJ4A 3HKZL 1XZPA 4QJVB 1WSVA 5EGHA 2E2HA 5C4JC 1G51A 4XCHA 4A3KK 3PO2K 4FZBA 3GEIA 4A3BC 4BBSK 2A6HA 3G4CA 1VGXA 2JA6A 4GTEA 1K83A 1ZQ1C 1Y1VK 1O24A 4Y52C 3GTGA 1JOEA 2B63A 1PJ5A 2CW0A 3S2DC 3GTQK 4Q5SA 5IYCK 2XCOA 3AQPA 2JA7A 3GTKC 2P8TA 4A3MC 4C3IK 4KMUA 4OIRA 3HOWC 2A68A 3GTOA 5IORA 1XZQB 1WIHA 4A93C 3FOFA 1TWFK 3HOVK 4LK1A 1BDFA 3GTJA 4KB4A 2R92C 1IBAA 3S16C 4GTDA 4BBRC 4QIWL 3ERED 1VRQC 4GTFA 4KARA 3GTKA 4BY1K 3RZOK 4OIOA 4O2DA 1B4AA 4Y7NK 2VUMC 3SZZA 5C3EK 2FQTA 2GAHC 4A3IK 4G0WA 1DD5A 1BJTA 4GFQA 2Y0SD 2R93K 2YU9C 2Y3PA 2XCRB 2GAGC 3LPXA 4Q4ZA 4G0VA 4KM9A 3JSTA 1TWAC 3S2HC 4A3JK 4A3EC 3GTLC 1WQGA 1C0AA 4AH6A 4X6AC 1Y1WA 1UV7A 3L4JA 4KN4A 3S2DK 3FOEA 3TFIA 1YCLA 4A3MK 2YU9A 2GSUA 4BKWA 4P9SA 3HOWK 5IYDK 1WCMC 2JH3A 2R7ZC 4GTBA 4QJVA 4OINA 1WOOA 1PJ6A 5M3FK 5IOTA 1TWAA 4A3LC 2GSNA 2NVYC 4A3FC 3GEHA 3GTLA 3FKIC 2R92K 3GTPC 1IE0A 1R9TA 3I4NK 3TFJA 3AH5A 3S16K 1TWGA 2PA8D 4GTLA 4KAWX 2PPBA 5IP9K 1IL2A 3PO3C 5M5YK 1XZQA 2VUMK 3RZDK 4G0UA 4ILDA 2E2IA 2WAQD 3A8IA 2NVYA 2PA8L 3OPFA 3GTGC 2B63C 4A3DC 2JA7C 1PJ7A 1O26A 1EFWA
chains in the Genus database with same CATH topology
3RZDC 3I4MK 4BBRK 3WODA 3S1NC 3HOYK 3GTOC 3S14K 4A93C 3K7AC 4A3GC 2NVTC 1TWFK 4YFKA 5FJ8K 2NVQK 3HOUC 1IW7A 3HOVK 4LK1A 3H0GC 4LK0A 1BDFA 5M5XK 1SMYA 1ZYRA 2WAQL 3S1RC 4MEXA 3H3VL 3S17C 4OIQA 2R92C 3GTMC 1SFOK 4X6AK 3HOZC 2WB1L 5IP7C 4XLPA 3GTJC 3S16C 1TWCK 1Y1WK 2JA8C 4BBRC 4QIWL 3HOXK 5M5WK 3HOYC 4BY7C 1TWHC 4G7ZA 4BY1K 1WCMK 4G7HA 2YU9K 3RZOK 4BXXK 2E2JK 5C44K 2R7ZK 5C4XK 4YG2A 5M3MK 4OIOA 3S15K 4Y7NK 2VUMC 4MQ9A 5C3EK 3S1MK 4A3FK 3HOXC 1TWAK 3FKIK 3GTPK 1Y1VC 4A3IK 2O5JA 3HKZD 4LLGA 4AYBD 3S2HK 4A3CK 2PMZL 4XSZA 2Y0SD 4A3EK 3GTLK 2YU9C 3GTQC 2R93K 5IYCC 1R9TK 1I50K 5IYBC 3M3YK 3S1QC 2JA5K 1TWGK 4Q4ZA 2BE5A 3I4MC 2E2HK 3S14C 2NVXK 3CQZK 1TWAC 1TWFC 3S2HC 4A3JK 2NVQC 4A3CC 2A6EA 3HOVC 4A3EC 3GTLC 2R93C 4ZH4A 2A69A 4AYBL 1I6VA 1SFOC 4X6AC 2JA6K 1K83K 1TWCC 4KN4A 2E2IK 4A3LK 3S2DK 1Y1WC 2NVYK 1I3QK 2E2HC 3GTGK 5FLMK 2B63K 3M4OK 4A3MK 2NVXC 5TMCA 2JA7K 2O5IA 4YFNA 3HOWK 4A3JC 4BY1C 1WCMC 5IYDK 4XLNA 3RZOC 2E2JC 4BXXC 4G7OA 5C44C 4XSXA 2R7ZC 4MEYA 3GTOK 4QJVA 4OINA 5C4XC 3S15C 1I6HK 3H3VD 4C3HK 2JA6C 5M3FK 2NVTK 5C4JK 4Y7NC 1K83C 4C3JK 5C3EC 4A3LC 2WB1D 3H0GK 3S1MC 2NVYC 1I3QC 4A3FC 3S1RK 5TMFA 3S17K 1YNJA 3FKIC 2R92K 4A3IC 3GTPC 4QIWD 3PO3K 3I4NK 3HOZK 4A3BK 5IYDC 3GTJK 3S16K 4YFXA 1R9TC 1I50C 4JK1A 2JA8K 1YNNA 5D4DA 3HKZL 3M3YC 2PA8D 4QJVB 2Y0SL 1I6HC 2PPBA 4BY7K 5IP9K 4Y52K 2JA5C 1TWHK 1TWGC 5C4JC 1XPPA 4A3KK 3GTKK 3PO2K 4A3DK 3CQZC 1HQMA 4A3BC 3PO3C 4BBSK 3I4NC 5M5YK 2A6HA 4C2MK 2VUMK 3EQLA 3RZDK 2PMZD 3S1NK 4OIPA 4A93K 1Y1VK 2WAQD 3K7AK 5IP9C 4Y52C 3HOUK 3DXJA 4GZYA 4A3GK 4KN7A 2CW0A 2E2IC 3S2DC 3GTQK 4Q5SA 2PA8L 5IYCK 4A3KC 3GTGC 5IYBK 5FLMC 2B63C 3GTKC 3PO2C 4A3MC 3M4OC 3GTMK 3S1QK 4C3IK 2JA7C 4A3DC 4KMUA 4OIRA 4BBSC 3HOWC 2A68A 5IP7K 4NOIA 4LJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD C;  3I4M K;  4BBR K;  3WOD A;  3S1N C;  3HOY K;  3GTO C;  3S14 K;  4A93 C;  3K7A C;  4A3G C;  2NVT C;  1TWF K;  4YFK A;  5FJ8 K;  2NVQ K;  3HOU C;  1IW7 A;  3HOV K;  4LK1 A;  3H0G C;  4LK0 A;  1BDF A;  5M5X K;  1SMY A;  1ZYR A;  2WAQ L;  3S1R C;  4MEX A;  3H3V L;  3S17 C;  4OIQ A;  2R92 C;  3GTM C;  1SFO K;  4X6A K;  3HOZ C;  2WB1 L;  5IP7 C;  4XLP A;  3GTJ C;  3S16 C;  1TWC K;  1Y1W K;  2JA8 C;  4BBR C;  4QIW L;  3HOX K;  5M5W K;  3HOY C;  4BY7 C;  1TWH C;  4G7Z A;  4BY1 K;  1WCM K;  4G7H A;  2YU9 K;  3RZO K;  4BXX K;  2E2J K;  5C44 K;  2R7Z K;  5C4X K;  4YG2 A;  5M3M K;  4OIO A;  3S15 K;  4Y7N K;  2VUM C;  4MQ9 A;  5C3E K;  3S1M K;  4A3F K;  3HOX C;  1TWA K;  3FKI K;  3GTP K;  1Y1V C;  4A3I K;  2O5J A;  3HKZ D;  4LLG A;  4AYB D;  3S2H K;  4A3C K;  2PMZ L;  4XSZ A;  2Y0S D;  4A3E K;  3GTL K;  2YU9 C;  3GTQ C;  2R93 K;  5IYC C;  1R9T K;  1I50 K;  5IYB C;  3M3Y K;  3S1Q C;  2JA5 K;  1TWG K;  4Q4Z A;  2BE5 A;  3I4M C;  2E2H K;  3S14 C;  2NVX K;  3CQZ K;  1TWA C;  1TWF C;  3S2H C;  4A3J K;  2NVQ C;  4A3C C;  2A6E A;  3HOV C;  4A3E C;  3GTL C;  2R93 C;  4ZH4 A;  2A69 A;  4AYB L;  1I6V A;  1SFO C;  4X6A C;  2JA6 K;  1K83 K;  1TWC C;  4KN4 A;  2E2I K;  4A3L K;  3S2D K;  1Y1W C;  2NVY K;  1I3Q K;  2E2H C;  3GTG K;  5FLM K;  2B63 K;  3M4O K;  4A3M K;  2NVX C;  5TMC A;  2JA7 K;  2O5I A;  4YFN A;  3HOW K;  4A3J C;  4BY1 C;  1WCM C;  5IYD K;  4XLN A;  3RZO C;  2E2J C;  4BXX C;  4G7O A;  5C44 C;  4XSX A;  2R7Z C;  4MEY A;  3GTO K;  4QJV A;  4OIN A;  5C4X C;  3S15 C;  1I6H K;  3H3V D;  4C3H K;  2JA6 C;  5M3F K;  2NVT K;  5C4J K;  4Y7N C;  1K83 C;  4C3J K;  5C3E C;  4A3L C;  2WB1 D;  3H0G K;  3S1M C;  2NVY C;  1I3Q C;  4A3F C;  3S1R K;  5TMF A;  3S17 K;  1YNJ A;  3FKI C;  2R92 K;  4A3I C;  3GTP C;  4QIW D;  3PO3 K;  3I4N K;  3HOZ K;  4A3B K;  5IYD C;  3GTJ K;  3S16 K;  4YFX A;  1R9T C;  1I50 C;  4JK1 A;  2JA8 K;  1YNN A;  5D4D A;  3HKZ L;  3M3Y C;  2PA8 D;  4QJV B;  2Y0S L;  1I6H C;  2PPB A;  4BY7 K;  5IP9 K;  4Y52 K;  2JA5 C;  1TWH K;  1TWG C;  5C4J C;  1XPP A;  4A3K K;  3GTK K;  3PO2 K;  4A3D K;  3CQZ C;  1HQM A;  4A3B C;  3PO3 C;  4BBS K;  3I4N C;  5M5Y K;  2A6H A;  4C2M K;  2VUM K;  3EQL A;  3RZD K;  2PMZ D;  3S1N K;  4OIP A;  4A93 K;  1Y1V K;  2WAQ D;  3K7A K;  5IP9 C;  4Y52 C;  3HOU K;  3DXJ A;  4GZY A;  4A3G K;  4KN7 A;  2CW0 A;  2E2I C;  3S2D C;  3GTQ K;  4Q5S A;  2PA8 L;  5IYC K;  4A3K C;  3GTG C;  5IYB K;  5FLM C;  2B63 C;  3GTK C;  3PO2 C;  4A3M C;  3M4O C;  3GTM K;  3S1Q K;  4C3I K;  2JA7 C;  4A3D C;  4KMU A;  4OIR A;  4BBS C;  3HOW C;  2A68 A;  5IP7 K;  4NOI A;  4LJZ A; 
#chains in the Genus database with same CATH topology
 3ADA C;  1F7V A;  4KMH A;  3HOY K;  3GTO C;  3S1N C;  3H0G A;  3K7A C;  4C3H C;  4PAB A;  4A3G C;  1WOR A;  3HOU C;  4PAA A;  1IW7 A;  4C3J C;  4LK0 A;  1ZYR A;  3H3V L;  2WAQ L;  3S17 C;  3GTM C;  4X6A K;  2WB1 L;  5IP7 C;  3GTJ C;  1O27 A;  2JA8 C;  1AB4 A;  1TWH A;  5M5W K;  3G4A A;  2EBB A;  4GTC A;  1EK8 A;  1J6V A;  1VLO A;  1WCM K;  2R7Z K;  2RH6 A;  1O25 A;  4C2M C;  4A3F K;  3HOX C;  2KWA A;  3FKI K;  3GTP K;  1EH1 A;  4LLG A;  4AYB D;  1DCH A;  4KDD A;  4XSZ A;  3GTM A;  5IYB C;  5E68 A;  4P5A A;  1J98 A;  2BE5 A;  3I4M C;  1O29 A;  2E2H K;  3S14 C;  2V6S A;  1JQW A;  4A3C C;  3GEE A;  2V6U A;  3ORE A;  1SFO A;  4AYB L;  1I6V A;  1TWC A;  5CJ9 A;  2JA6 K;  1K83 K;  1ZBS A;  1Y1W C;  1L0W A;  3GTG K;  1XXA A;  2B63 K;  2NVX C;  1J6X A;  2GSO A;  2O5I A;  2JA7 K;  3IPJ A;  4XLN A;  4BXX C;  5C44 C;  4XSX A;  3GTO K;  5C4X C;  1WSR A;  2D6F C;  4C3H K;  5C4J K;  4C3J K;  3S1M C;  1I3Q C;  5JVO A;  4LOW A;  5TMF A;  3S17 K;  4A3B K;  4KMD A;  1I50 A;  3GTJ K;  4YFX A;  1F9N A;  1R9T C;  2JA8 K;  3GSI A;  4JK1 A;  1YNN A;  5D4D A;  2JA5 A;  4C45 A;  2Y0S L;  5CHP A;  1I6H C;  1WQF A;  4Y52 K;  3N0C A;  1TWG C;  2NVX A;  1XXC A;  3CQZ A;  2V6T A;  3MML B;  3GTK K;  3T00 A;  1GE9 A;  5EGE A;  3AD7 C;  4C2M K;  3L4K A;  4M1X A;  3EQL A;  2PMZ D;  1JVI A;  4OIP A;  4A93 K;  1I3Q A;  2W7V A;  4GZY A;  2P5M A;  3BUE A;  2E2I C;  5JFE A;  3A8J A;  4A3K C;  5IYB K;  3PO2 C;  3M4O C;  4BBS C;  3AD8 C;  5HL8 A;  4NOI A;  3I4M K;  4BBR K;  3WOD A;  3S14 K;  4YFK A;  3H0G C;  5M5X K;  3S1R C;  1WOP A;  4OIQ A;  4GT9 A;  1Y1W K;  1USO A;  1KQ4 A;  2ZUF A;  2RGR A;  4BY7 C;  1TWH C;  4G7Z A;  4G7H A;  2YU9 K;  4BXX K;  1O2B A;  5C44 K;  3V4G A;  5C4X K;  1J6W A;  4KMA A;  4MQ9 A;  1Y1V A;  3S1M K;  1TWA K;  1VH2 A;  3GTQ A;  3HKZ D;  3S2H K;  3LAJ A;  4A3E K;  3GTL K;  3CAG A;  1R9T K;  3S1Q C;  3AQO A;  3LAP A;  1B4B A;  1TWG K;  1WOS A;  4KAT A;  1TWF A;  1VJE A;  3SZY A;  1F7U A;  2NVQ C;  3VA7 A;  2R93 C;  4ZH4 A;  3QX3 A;  2A69 A;  4BLB A;  4KM8 A;  1SFO C;  2CFA B;  3OEP A;  1TWC C;  3A8K A;  2E2I K;  4A3L K;  1RU0 A;  2NVY K;  1O2F B;  3M4O K;  3N0B A;  4KB2 A;  1XXB A;  4YFN A;  4A3J C;  3T01 A;  4G7O A;  2E2J C;  1ZVU A;  1F93 A;  3FHZ A;  3S15 C;  1ISE A;  1DCP A;  3H0G K;  3S1R K;  1YNJ A;  2R93 A;  4QIW D;  3PO3 K;  5IYD C;  2ZUE A;  1I50 C;  1WQH A;  3M3Y C;  3HXA A;  4BY7 K;  2JA5 C;  1TWH K;  1XPP A;  1HI9 A;  4FM9 A;  4A3D K;  3CQZ C;  1HQM A;  3I4N C;  4LR2 A;  3S1N K;  1O28 A;  1XZP B;  3K7A K;  4A3G K;  5IP9 C;  3HOU K;  3DXJ A;  4KN7 A;  1ZXO A;  5FLM C;  3S1Q K;  4J3N A;  3GTM K;  5IP7 K;  4LJZ A;  4WJ3 M;  3RZD C;  3GIR A;  2NVT C;  5FJ8 K;  2NVQ K;  2R92 A;  1SMY A;  4MEX A;  1IQ0 A;  1SFO K;  5IOS A;  3HOZ C;  4XLP A;  4KC6 A;  1TWC K;  4DDQ A;  3HOX K;  3HOY C;  2PHC B;  2E2J K;  5L46 A;  1YX2 A;  2VUM A;  4YG2 A;  5M3M K;  3S15 K;  1X31 C;  1EI6 A;  4LQY A;  4BLA A;  1BS2 A;  1O2A A;  3T02 A;  4RMF A;  5TJ3 A;  2O5J A;  1Y1V C;  1USM A;  3AD9 C;  4A3C K;  2PMZ L;  3GTQ C;  5IYC C;  1I50 K;  3M3Y K;  2XCQ A;  2CFA A;  4C3I C;  2JA5 K;  1BGW A;  4P5B A;  2NVX K;  3CQZ K;  3Q3Q A;  1TWF C;  2A6E A;  3GDZ A;  3HOV C;  4GTA A;  4KAS A;  1I3Q K;  2E2H C;  3S0X A;  3BP3 A;  5FLM K;  3BP8 C;  1WCM A;  5TMC A;  5IOQ A;  2R7Z A;  4BY1 C;  2FQO A;  3RZO C;  4MEY A;  4WIL A;  1I6H K;  3H3V D;  2JA6 C;  2NVT K;  1EQR A;  4Y7N C;  1K83 C;  3NUH A;  3FKI A;  2WB1 D;  5C3E C;  3GTP A;  1V5V A;  1DCO A;  4A3I C;  1IS1 A;  2ZFZ A;  3HOZ K;  1INN A;  3TFH A;  3N3Y A;  3TTG A;  4WJ4 A;  3HKZ L;  1XZP A;  4QJV B;  1WSV A;  5EGH A;  2E2H A;  5C4J C;  1G51 A;  4XCH A;  4A3K K;  3PO2 K;  4FZB A;  3GEI A;  4A3B C;  4BBS K;  2A6H A;  3G4C A;  1VGX A;  2JA6 A;  4GTE A;  1K83 A;  1ZQ1 C;  1Y1V K;  1O24 A;  4Y52 C;  3GTG A;  1JOE A;  2B63 A;  1PJ5 A;  2CW0 A;  3S2D C;  3GTQ K;  4Q5S A;  5IYC K;  2XCO A;  3AQP A;  2JA7 A;  3GTK C;  2P8T A;  4A3M C;  4C3I K;  4KMU A;  4OIR A;  3HOW C;  2A68 A;  3GTO A;  5IOR A;  1XZQ B;  1WIH A;  4A93 C;  3FOF A;  1TWF K;  3HOV K;  4LK1 A;  1BDF A;  3GTJ A;  4KB4 A;  2R92 C;  1IBA A;  3S16 C;  4GTD A;  4BBR C;  4QIW L;  3ERE D;  1VRQ C;  4GTF A;  4KAR A;  3GTK A;  4BY1 K;  3RZO K;  4OIO A;  4O2D A;  1B4A A;  4Y7N K;  2VUM C;  3SZZ A;  5C3E K;  2FQT A;  2GAH C;  4A3I K;  4G0W A;  1DD5 A;  1BJT A;  4GFQ A;  2Y0S D;  2R93 K;  2YU9 C;  2Y3P A;  2XCR B;  2GAG C;  3LPX A;  4Q4Z A;  4G0V A;  4KM9 A;  3JST A;  1TWA C;  3S2H C;  4A3J K;  4A3E C;  3GTL C;  1WQG A;  1C0A A;  4AH6 A;  4X6A C;  1Y1W A;  1UV7 A;  3L4J A;  4KN4 A;  3S2D K;  3FOE A;  3TFI A;  1YCL A;  4A3M K;  2YU9 A;  2GSU A;  4BKW A;  4P9S A;  3HOW K;  5IYD K;  1WCM C;  2JH3 A;  2R7Z C;  4GTB A;  4QJV A;  4OIN A;  1WOO A;  1PJ6 A;  5M3F K;  5IOT A;  1TWA A;  4A3L C;  2GSN A;  2NVY C;  4A3F C;  3GEH A;  3GTL A;  3FKI C;  2R92 K;  3GTP C;  1IE0 A;  1R9T A;  3I4N K;  3TFJ A;  3AH5 A;  3S16 K;  1TWG A;  2PA8 D;  4GTL A;  4KAW X;  2PPB A;  5IP9 K;  1IL2 A;  3PO3 C;  5M5Y K;  1XZQ A;  2VUM K;  3RZD K;  4G0U A;  4ILD A;  2E2I A;  2WAQ D;  3A8I A;  2NVY A;  2PA8 L;  3OPF A;  3GTG C;  2B63 C;  4A3D C;  2JA7 C;  1PJ7 A;  1O26 A;  1EFW A; 
#chains in the Genus database with same CATH homology
 3RZD C;  3I4M K;  4BBR K;  3WOD A;  3S1N C;  3HOY K;  3GTO C;  3S14 K;  4A93 C;  3K7A C;  4A3G C;  2NVT C;  1TWF K;  4YFK A;  5FJ8 K;  2NVQ K;  3HOU C;  1IW7 A;  3HOV K;  4LK1 A;  3H0G C;  4LK0 A;  1BDF A;  5M5X K;  1SMY A;  1ZYR A;  2WAQ L;  3S1R C;  4MEX A;  3H3V L;  3S17 C;  4OIQ A;  2R92 C;  3GTM C;  1SFO K;  4X6A K;  3HOZ C;  2WB1 L;  5IP7 C;  4XLP A;  3GTJ C;  3S16 C;  1TWC K;  1Y1W K;  2JA8 C;  4BBR C;  4QIW L;  3HOX K;  5M5W K;  3HOY C;  4BY7 C;  1TWH C;  4G7Z A;  4BY1 K;  1WCM K;  4G7H A;  2YU9 K;  3RZO K;  4BXX K;  2E2J K;  5C44 K;  2R7Z K;  5C4X K;  4YG2 A;  5M3M K;  4OIO A;  3S15 K;  4Y7N K;  2VUM C;  4MQ9 A;  5C3E K;  3S1M K;  4A3F K;  3HOX C;  1TWA K;  3FKI K;  3GTP K;  1Y1V C;  4A3I K;  2O5J A;  3HKZ D;  4LLG A;  4AYB D;  3S2H K;  4A3C K;  2PMZ L;  4XSZ A;  2Y0S D;  4A3E K;  3GTL K;  2YU9 C;  3GTQ C;  2R93 K;  5IYC C;  1R9T K;  1I50 K;  5IYB C;  3M3Y K;  3S1Q C;  2JA5 K;  1TWG K;  4Q4Z A;  2BE5 A;  3I4M C;  2E2H K;  3S14 C;  2NVX K;  3CQZ K;  1TWA C;  1TWF C;  3S2H C;  4A3J K;  2NVQ C;  4A3C C;  2A6E A;  3HOV C;  4A3E C;  3GTL C;  2R93 C;  4ZH4 A;  2A69 A;  4AYB L;  1I6V A;  1SFO C;  4X6A C;  2JA6 K;  1K83 K;  1TWC C;  4KN4 A;  2E2I K;  4A3L K;  3S2D K;  1Y1W C;  2NVY K;  1I3Q K;  2E2H C;  3GTG K;  5FLM K;  2B63 K;  3M4O K;  4A3M K;  2NVX C;  5TMC A;  2JA7 K;  2O5I A;  4YFN A;  3HOW K;  4A3J C;  4BY1 C;  1WCM C;  5IYD K;  4XLN A;  3RZO C;  2E2J C;  4BXX C;  4G7O A;  5C44 C;  4XSX A;  2R7Z C;  4MEY A;  3GTO K;  4QJV A;  4OIN A;  5C4X C;  3S15 C;  1I6H K;  3H3V D;  4C3H K;  2JA6 C;  5M3F K;  2NVT K;  5C4J K;  4Y7N C;  1K83 C;  4C3J K;  5C3E C;  4A3L C;  2WB1 D;  3H0G K;  3S1M C;  2NVY C;  1I3Q C;  4A3F C;  3S1R K;  5TMF A;  3S17 K;  1YNJ A;  3FKI C;  2R92 K;  4A3I C;  3GTP C;  4QIW D;  3PO3 K;  3I4N K;  3HOZ K;  4A3B K;  5IYD C;  3GTJ K;  3S16 K;  4YFX A;  1R9T C;  1I50 C;  4JK1 A;  2JA8 K;  1YNN A;  5D4D A;  3HKZ L;  3M3Y C;  2PA8 D;  4QJV B;  2Y0S L;  1I6H C;  2PPB A;  4BY7 K;  5IP9 K;  4Y52 K;  2JA5 C;  1TWH K;  1TWG C;  5C4J C;  1XPP A;  4A3K K;  3GTK K;  3PO2 K;  4A3D K;  3CQZ C;  1HQM A;  4A3B C;  3PO3 C;  4BBS K;  3I4N C;  5M5Y K;  2A6H A;  4C2M K;  2VUM K;  3EQL A;  3RZD K;  2PMZ D;  3S1N K;  4OIP A;  4A93 K;  1Y1V K;  2WAQ D;  3K7A K;  5IP9 C;  4Y52 C;  3HOU K;  3DXJ A;  4GZY A;  4A3G K;  4KN7 A;  2CW0 A;  2E2I C;  3S2D C;  3GTQ K;  4Q5S A;  2PA8 L;  5IYC K;  4A3K C;  3GTG C;  5IYB K;  5FLM C;  2B63 C;  3GTK C;  3PO2 C;  4A3M C;  3M4O C;  3GTM K;  3S1Q K;  4C3I K;  2JA7 C;  4A3D C;  4KMU A;  4OIR A;  4BBS C;  3HOW C;  2A68 A;  5IP7 K;  4NOI A;  4LJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...