4A3FK

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3fK00
2NVXK 1TWAC 1I3QC 4Y52K 5D4DA 4MEXA 5C4XC 2NVXC 1TWHK 4Y52C 5C4JK 2WAQL 4BBSK 4BY7K 2R92K 3H0GK 3FKIK 4LK1A 2A6HA 1TWHC 5C4JC 4BBSC 4JK1A 2O5IA 4BY7C 2R92C 4A3CK 4LK0A 3H0GC 3FKIC 3K7AK 3WODA 5M5WK 4OIQA 2CW0A 3HOZK 4A93K 3S2HC 4A3CC 3GTMK 2WB1D 3K7AC 1YNJA 3HOZC 4A93C 4C2MK 4XSXA 3HKZL 2JA7K 2VUMK 3S2DK 3GTMC 3M3YK 4C3HK 2JA7C 2YU9K 2VUMC 3S2DC 2B63C 2YU9C 3GTGK 3M4OK 4OINA 4OIPA 5IYCC 2PA8L 5M5XK 5M3FK 2A6EA 4YFKA 3GTGC 1I6VA 3M4OC 3S14K 2A69A 1I50K 1TWGK 3S14C 4MQ9A 3HOUK 3GTJK 5M3MK 1I50C 1TWGC 2PMZD 3PO3K 2R7ZC 5FJ8K 3HKZD 3GTJC 3HOUC 2JA6K 3PO3C 5IP7K 4QJVB 3S2HK 4A3GK 2PPBA 2JA6C 1YNNA 5IP7C 3H3VL 4YFNA 1HQMA 3S15K 4ZH4A 2Y0SL 3GTOK 4Q5SA 4A3GC 5FLMK 3S15C 4QJVA 4QIWD 2PA8D 3GTOC 2B63K 4BBRK 5FLMC 5IYBC 4A3EK 4G7OA 5IYCK 4BBRC 2JA8K 4Q4ZA 4XSZA 4A3EC 4AYBL 2NVTK 3GTQK 2JA8C 2WAQD 4A3JK 1WCMK 3GTQC 2NVTC 3GTKK 4A3FK 5IYDK 3CQZK 3HOXC 4A3JC 1WCMC 3GTKC 4A3MK 4A3FC 1Y1WK 2R7ZK 5IP9K 5IYDC 3H3VD 3CQZC 2Y0SD 3I4NK 4LJZA 4G7ZA 2A68A 4A3MC 3RZDK 1Y1WC 5IP9C 5C44K 4OIRA 4G7HA 3S1QC 3I4NC 3RZDC 4C3JK 5C44C 3S16K 4C3IK 1TWCK 4KN4A 1I6HK 3S16C 2JA5K 1TWCC 4AYBD 5IYBK 1I6HC 2WB1L 4KN7A 3HOVK 4A3LK 2JA5C 4XLPA 2E2IK 5TMCA 4YFXA 3I4MK 1BDFA 1K83K 4KMUA 4BY1K 3HOVC 4A3LC 2R93C 1SMYA 2E2IC 3I4MC 1K83C 1Y1VK 3S1RK 1R9TK 4BY1C 4X6AK 3EQLA 3HOXK 3S1RC 1Y1VC 1R9TC 3GTPK 1SFOK 2NVQK 4A3BK 4X6AC 4Y7NK 2NVYK 4A3KK 3GTPC 1SFOC 2NVQC 4A3BC 3S1QK 3HOYK 4Y7NC 2NVYC 4LLGA 4XLNA 4A3KC 2E2HK 4A3IK 3S1MK 2E2JK 3HOYC 3PO2K 2PMZL 5C3EK 2E2HC 3S1NK 4A3IC 3S1MC 2E2JC 2O5JA 3RZOK 1TWFK 3PO2C 5C3EC 5M5YK 4A3DK 3DXJA 3S1NC 4GZYA 5TMFA 3RZOC 1TWFC 2BE5A 1XPPA 3M3YC 1ZYRA 4A3DC 3HOWK 4YG2A 4BXXK 3GTLK 1IW7A 4OIOA 2R93K 3S17K 3HOWC 4QIWL 4BXXC 4MEYA 1TWAK 1I3QK 4NOIA 3GTLC 3S17C 5C4XK
chains in the Genus database with same CATH superfamily
2CFAA 1I3QC 2JH3A 5D4DA 2YU9A 4MEXA 1F93A 5C4JK 3OPFA 3OREA 4LK1A 4P5AA 1TWHC 3BP3A 4JK1A 4BY7C 5TJ3A 5L46A 3VA7A 1AB4A 3S2HC 3GTMC 2JA7C 2VUMC 3LAPA 1EH1A 1USMA 1O24A 1WSVA 4OIPA 2PA8L 5CJ9A 3GTGC 1I6VA 4GTLA 4P9SA 3S14K 4MQ9A 1R9TA 5FJ8K 3HKZD 1BJTA 3PO3C 3G4CA 5IP7K 3CQZA 2NVYA 3H3VL 2GSUA 1HQMA 1HI9A 3AD9C 2B63K 4BBRK 3S0XA 4A3EK 1IE0A 5IYCK 1VLOA 2JA5A 3T00A 3GTQC 1WOSA 4A3MK 4LJZA 4G7ZA 2A68A 3RZDK 3GTPA 5C44C 3L4KA 3H0GA 1I6HK 4C3IC 2W7VA 1JVIA 2E2IK 3I4MK 1TWFA 2XCOA 3GIRA 1WSRA 1Y1VK 3CAGA 1WQFA 2ZFZA 1O27A 5IOTA 3S1RC 1R9TC 4A3KK 4A3BC 4Y7NC 2NVYC 1O25A 3N3YA 5E68A 2GSNA 4XLNA 4PABA 3GTJA 3S1MC 1TWHA 2O5JA 3PO2C 1O29A 5M5YK 3RZOC 4A3DC 4KM8A 4KATA 2R93K 4KC6A 5EGEA 3GTLC 4NOIA 3T02A 2JA7A 1DCPA 5C4XK 2NVXK 1O2FB 5CHPA 4Y52K 4XCHA 1VJEA 4WJ4A 4BBSK 3GTGA 2R92K 3FKIK 4OIQA 3H0GC 3WODA 3HOZK 4A93K 4A3CC 2WB1D 3K7AC 4G0WA 1YNJA 3GEEA 5IORA 3S2DK 3Q3QA 4C2MC 2YU9K 2B63C 4C3HC 2CFAB 1TWCA 1BS2A 1IS1A 5IYCC 4YFKA 3M4OC 2A69A 1I50K 1TWGK 3SZZA 3HOUK 3GTQA 3GTJC 2GSOA 2JA6K 4QJVB 4A3GK 2PPBA 1L0WA 3GTOK 3IPJA 3S15C 4GTDA 4QJVA 5FLMC 5EGHA 4GFQA 2JA8K 4XSZA 3FOFA 2WAQD 1F7VA 4PAAA 4A3JK 2NVTC 3CQZK 1B4AA 1WCMC 3GTKC 1TWAA 2R7ZK 4A3FC 3BUEA 1Y1WK 5IYDC 1GE9A 2EBBA 2Y0SD 5IP9C 2KWAA 3I4NC 4C3JK 4KN4A 1WOPA 3TTGA 1KQ4A 3S16C 2D6FC 2JA5K 1TWCC 4AYBD 5IYBK 2WB1L 4KN7A 4AH6A 4A3LK 4XLPA 5TMCA 4YFXA 4KMUA 3HOVC 2R93C 1SMYA 4KAWX 1K83C 4GT9A 2V6TA 4BY1C 4G0UA 3GTPK 3A8JA 1SFOK 3GTLA 3GSIA 4G0VA 4X6AC 3GEIA 1ZVUA 2NVQC 1ZXOA 3MMLB 4LQYA 4KMHA 4KARA 3ERED 3HOYC 5C3EK 2E2HC 4A3IC 4O2DA 3AD8C 2E2JC 1TWFK 1WOOA 3DXJA 3S1NC 1ZYRA 4KMAA 4LOWA 3HOWK 4BXXK 4RMFA 3HXAA 3S17K 1XXAA 2Y3PA 5HL8A 1I3QK 2B63A 4GTBA 1TWAC 1IL2A 3AH5A 1TWHK 2PHCB 2V6SA 2WAQL 1J6XA 4KMDA 4BY7K 4KDDA 5C4JC 2O5IA 5JVOA 5M5WK 3TFIA 3GTMK 2JA7K 4XSXA 3HKZL 2VUMK 1O28A 4M1XA 1EK8A 1ISEA 4WJ3M 1XZQA 3AD7C 4GTAA 3GTGK 3ADAC 4OINA 3AQOA 2A6EA 1UV7A 1XZPA 2E2IA 3S14C 4KB4A 1RU0A 4FZBA 3PO3K 3TFHA 2ZUFA 2R7ZC 3LAJA 1WCMA 3GTKA 5IP7C 4C3JC 2RGRA 4QIWD 2PA8D 1ZQ1C 5IYBC 4BBRC 4A3EC 1PJ6A 3GTQK 4GTFA 1VGXA 3N0CA 2R93A 3A8KA 3SZYA 1K83A 3H3VD 3FOEA 2NVXA 4A3MC 5C44K 4G7HA 3RZDC 4C3IK 1EI6A 1G51A 1YX2A 1I6HC 2E2HA 1JQWA 3TFJA 1WQHA 2GAGC 2E2IC 4KM9A 3I4MC 3S1RK 1R9TK 1VRQC 3EQLA 3HOXK 1Y1VC 4GTCA 4A3BK 4Y7NK 2NVYK 3S1QK 4A3KC 4LLGA 3S1MK 1TWGA 1I50A 3PO2K 2FQTA 1INNA 3GEHA 3RZOK 4A3DK 3GDZA 2FQOA 1DD5A 5TMFA 2JA6A 1XPPA 4YG2A 3GTLK 1IW7A 1DCOA 1PJ5A 4KB2A 4KASA 4QIWL 2XCRB 3GTOA 4P5BA 3JSTA 4C45A 1EQRA 1VH2A 5IOQA 3LPXA 1XXBA 5C4XC 2NVXC 4Y52C 4DDQA 3FHZA 3H0GK 2A6HA 4BBSC 2R92C 4A3CK 4LK0A 3K7AK 3FKIC 1WORA 2CW0A 1J6WA 1IQ0A 4GTEA 2GAHC 2R7ZA 1Y1WA 3HOZC 4A93C 4C2MK 3M3YK 4C3HK 3S2DC 1V5VA 1O2AA 2YU9C 1C0AA 3M4OK 3NUHA 5M3FK 3AQPA 5M5XK 1J98A 1IBAA 3QX3A 3GTJK 5M3MK 1I50C 1TWGC 2PMZD 1ZBSA 3HOUC 3S2HK 4J3NA 1SFOA 3OEPA 1PJ7A 1YNNA 2JA6C 3S15K 5JFEA 4YFNA 4Q5SA 4A3GC 4ZH4A 1XZQB 2Y0SL 5FLMK 3BP8C 4ILDA 4LR2A 1USOA 3G4AA 3GTOC 1X31C 4G7OA 4BLAA 3V4GA 1XZPB 4Q4ZA 1B4BA 2P8TA 4AYBL 2NVTK 2JA8C 1WCMK 3GTKK 5IOSA 4A3FK 2V6UA 1BGWA 5IYDK 3HOXC 4A3JC 1I3QA 5IP9K 1F7UA 3CQZC 3I4NK 1Y1VA 3L4JA 1Y1WC 3S1QC 3T01A 4OIRA 1YCLA 3S16K 2RH6A 1TWCK 1WQGA 3N0BA 3HOVK 2JA5C 3GTMA 1BDFA 1K83K 1DCHA 4BY1K 2VUMA 4A3LC 2ZUEA 1O26A 4BLBA 4X6AK 2P5MA 1J6VA 1XXCA 2NVQK 2XCQA 3GTPC 1SFOC 4BKWA 1EFWA 3HOYK 1F9NA 1O2BA 2E2HK 4A3IK 2E2JK 4FM9A 2PMZL 4WILA 3S1NK 5C3EC 2R92A 3A8IA 3FKIA 4GZYA 1TWFC 2BE5A 3M3YC 1JOEA 4OIOA 3HOWC 4BXXC 4MEYA 1TWAK 3S17C 1WIHA
chains in the Genus database with same CATH topology
2NVXK 1TWAC 1I3QC 4Y52K 5D4DA 4MEXA 5C4XC 2NVXC 1TWHK 4Y52C 5C4JK 2WAQL 4BBSK 4BY7K 2R92K 3H0GK 3FKIK 4LK1A 2A6HA 1TWHC 5C4JC 4BBSC 4JK1A 2O5IA 4BY7C 2R92C 4A3CK 4LK0A 3H0GC 3FKIC 3K7AK 3WODA 5M5WK 4OIQA 2CW0A 3HOZK 4A93K 3S2HC 4A3CC 3GTMK 2WB1D 3K7AC 1YNJA 3HOZC 4A93C 4C2MK 4XSXA 3HKZL 2JA7K 2VUMK 3S2DK 3GTMC 3M3YK 4C3HK 2JA7C 2YU9K 2VUMC 3S2DC 2B63C 2YU9C 3GTGK 3M4OK 4OINA 4OIPA 5IYCC 2PA8L 5M5XK 5M3FK 2A6EA 4YFKA 3GTGC 1I6VA 3M4OC 3S14K 2A69A 1I50K 1TWGK 3S14C 4MQ9A 3HOUK 3GTJK 5M3MK 1I50C 1TWGC 2PMZD 3PO3K 2R7ZC 5FJ8K 3HKZD 3GTJC 3HOUC 2JA6K 3PO3C 5IP7K 4QJVB 3S2HK 4A3GK 2PPBA 2JA6C 1YNNA 5IP7C 3H3VL 4YFNA 1HQMA 3S15K 4ZH4A 2Y0SL 3GTOK 4Q5SA 4A3GC 5FLMK 3S15C 4QJVA 4QIWD 2PA8D 3GTOC 2B63K 4BBRK 5FLMC 5IYBC 4A3EK 4G7OA 5IYCK 4BBRC 2JA8K 4Q4ZA 4XSZA 4A3EC 4AYBL 2NVTK 3GTQK 2JA8C 2WAQD 4A3JK 1WCMK 3GTQC 2NVTC 3GTKK 4A3FK 5IYDK 3CQZK 3HOXC 4A3JC 1WCMC 3GTKC 4A3MK 4A3FC 1Y1WK 2R7ZK 5IP9K 5IYDC 3H3VD 3CQZC 2Y0SD 3I4NK 4LJZA 4G7ZA 2A68A 4A3MC 3RZDK 1Y1WC 5IP9C 5C44K 4OIRA 4G7HA 3S1QC 3I4NC 3RZDC 4C3JK 5C44C 3S16K 4C3IK 1TWCK 4KN4A 1I6HK 3S16C 2JA5K 1TWCC 4AYBD 5IYBK 1I6HC 2WB1L 4KN7A 3HOVK 4A3LK 2JA5C 4XLPA 2E2IK 5TMCA 4YFXA 3I4MK 1BDFA 1K83K 4KMUA 4BY1K 3HOVC 4A3LC 2R93C 1SMYA 2E2IC 3I4MC 1K83C 1Y1VK 3S1RK 1R9TK 4BY1C 4X6AK 3EQLA 3HOXK 3S1RC 1Y1VC 1R9TC 3GTPK 1SFOK 2NVQK 4A3BK 4X6AC 4Y7NK 2NVYK 4A3KK 3GTPC 1SFOC 2NVQC 4A3BC 3S1QK 3HOYK 4Y7NC 2NVYC 4LLGA 4XLNA 4A3KC 2E2HK 4A3IK 3S1MK 2E2JK 3HOYC 3PO2K 2PMZL 5C3EK 2E2HC 3S1NK 4A3IC 3S1MC 2E2JC 2O5JA 3RZOK 1TWFK 3PO2C 5C3EC 5M5YK 4A3DK 3DXJA 3S1NC 4GZYA 5TMFA 3RZOC 1TWFC 2BE5A 1XPPA 3M3YC 1ZYRA 4A3DC 3HOWK 4YG2A 4BXXK 3GTLK 1IW7A 4OIOA 2R93K 3S17K 3HOWC 4QIWL 4BXXC 4MEYA 1TWAK 1I3QK 4NOIA 3GTLC 3S17C 5C4XK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX K;  1TWA C;  1I3Q C;  4Y52 K;  5D4D A;  4MEX A;  5C4X C;  2NVX C;  1TWH K;  4Y52 C;  5C4J K;  2WAQ L;  4BBS K;  4BY7 K;  2R92 K;  3H0G K;  3FKI K;  4LK1 A;  2A6H A;  1TWH C;  5C4J C;  4BBS C;  4JK1 A;  2O5I A;  4BY7 C;  2R92 C;  4A3C K;  4LK0 A;  3H0G C;  3FKI C;  3K7A K;  3WOD A;  5M5W K;  4OIQ A;  2CW0 A;  3HOZ K;  4A93 K;  3S2H C;  4A3C C;  3GTM K;  2WB1 D;  3K7A C;  1YNJ A;  3HOZ C;  4A93 C;  4C2M K;  4XSX A;  3HKZ L;  2JA7 K;  2VUM K;  3S2D K;  3GTM C;  3M3Y K;  4C3H K;  2JA7 C;  2YU9 K;  2VUM C;  3S2D C;  2B63 C;  2YU9 C;  3GTG K;  3M4O K;  4OIN A;  4OIP A;  5IYC C;  2PA8 L;  5M5X K;  5M3F K;  2A6E A;  4YFK A;  3GTG C;  1I6V A;  3M4O C;  3S14 K;  2A69 A;  1I50 K;  1TWG K;  3S14 C;  4MQ9 A;  3HOU K;  3GTJ K;  5M3M K;  1I50 C;  1TWG C;  2PMZ D;  3PO3 K;  2R7Z C;  5FJ8 K;  3HKZ D;  3GTJ C;  3HOU C;  2JA6 K;  3PO3 C;  5IP7 K;  4QJV B;  3S2H K;  4A3G K;  2PPB A;  2JA6 C;  1YNN A;  5IP7 C;  3H3V L;  4YFN A;  1HQM A;  3S15 K;  4ZH4 A;  2Y0S L;  3GTO K;  4Q5S A;  4A3G C;  5FLM K;  3S15 C;  4QJV A;  4QIW D;  2PA8 D;  3GTO C;  2B63 K;  4BBR K;  5FLM C;  5IYB C;  4A3E K;  4G7O A;  5IYC K;  4BBR C;  2JA8 K;  4Q4Z A;  4XSZ A;  4A3E C;  4AYB L;  2NVT K;  3GTQ K;  2JA8 C;  2WAQ D;  4A3J K;  1WCM K;  3GTQ C;  2NVT C;  3GTK K;  4A3F K;  5IYD K;  3CQZ K;  3HOX C;  4A3J C;  1WCM C;  3GTK C;  4A3M K;  4A3F C;  1Y1W K;  2R7Z K;  5IP9 K;  5IYD C;  3H3V D;  3CQZ C;  2Y0S D;  3I4N K;  4LJZ A;  4G7Z A;  2A68 A;  4A3M C;  3RZD K;  1Y1W C;  5IP9 C;  5C44 K;  4OIR A;  4G7H A;  3S1Q C;  3I4N C;  3RZD C;  4C3J K;  5C44 C;  3S16 K;  4C3I K;  1TWC K;  4KN4 A;  1I6H K;  3S16 C;  2JA5 K;  1TWC C;  4AYB D;  5IYB K;  1I6H C;  2WB1 L;  4KN7 A;  3HOV K;  4A3L K;  2JA5 C;  4XLP A;  2E2I K;  5TMC A;  4YFX A;  3I4M K;  1BDF A;  1K83 K;  4KMU A;  4BY1 K;  3HOV C;  4A3L C;  2R93 C;  1SMY A;  2E2I C;  3I4M C;  1K83 C;  1Y1V K;  3S1R K;  1R9T K;  4BY1 C;  4X6A K;  3EQL A;  3HOX K;  3S1R C;  1Y1V C;  1R9T C;  3GTP K;  1SFO K;  2NVQ K;  4A3B K;  4X6A C;  4Y7N K;  2NVY K;  4A3K K;  3GTP C;  1SFO C;  2NVQ C;  4A3B C;  3S1Q K;  3HOY K;  4Y7N C;  2NVY C;  4LLG A;  4XLN A;  4A3K C;  2E2H K;  4A3I K;  3S1M K;  2E2J K;  3HOY C;  3PO2 K;  2PMZ L;  5C3E K;  2E2H C;  3S1N K;  4A3I C;  3S1M C;  2E2J C;  2O5J A;  3RZO K;  1TWF K;  3PO2 C;  5C3E C;  5M5Y K;  4A3D K;  3DXJ A;  3S1N C;  4GZY A;  5TMF A;  3RZO C;  1TWF C;  2BE5 A;  1XPP A;  3M3Y C;  1ZYR A;  4A3D C;  3HOW K;  4YG2 A;  4BXX K;  3GTL K;  1IW7 A;  4OIO A;  2R93 K;  3S17 K;  3HOW C;  4QIW L;  4BXX C;  4MEY A;  1TWA K;  1I3Q K;  4NOI A;  3GTL C;  3S17 C;  5C4X K; 
#chains in the Genus database with same CATH topology
 2CFA A;  1I3Q C;  2JH3 A;  5D4D A;  2YU9 A;  4MEX A;  1F93 A;  5C4J K;  3OPF A;  3ORE A;  4LK1 A;  4P5A A;  1TWH C;  3BP3 A;  4JK1 A;  4BY7 C;  5TJ3 A;  5L46 A;  3VA7 A;  1AB4 A;  3S2H C;  3GTM C;  2JA7 C;  2VUM C;  3LAP A;  1EH1 A;  1USM A;  1O24 A;  1WSV A;  4OIP A;  2PA8 L;  5CJ9 A;  3GTG C;  1I6V A;  4GTL A;  4P9S A;  3S14 K;  4MQ9 A;  1R9T A;  5FJ8 K;  3HKZ D;  1BJT A;  3PO3 C;  3G4C A;  5IP7 K;  3CQZ A;  2NVY A;  3H3V L;  2GSU A;  1HQM A;  1HI9 A;  3AD9 C;  2B63 K;  4BBR K;  3S0X A;  4A3E K;  1IE0 A;  5IYC K;  1VLO A;  2JA5 A;  3T00 A;  3GTQ C;  1WOS A;  4A3M K;  4LJZ A;  4G7Z A;  2A68 A;  3RZD K;  3GTP A;  5C44 C;  3L4K A;  3H0G A;  1I6H K;  4C3I C;  2W7V A;  1JVI A;  2E2I K;  3I4M K;  1TWF A;  2XCO A;  3GIR A;  1WSR A;  1Y1V K;  3CAG A;  1WQF A;  2ZFZ A;  1O27 A;  5IOT A;  3S1R C;  1R9T C;  4A3K K;  4A3B C;  4Y7N C;  2NVY C;  1O25 A;  3N3Y A;  5E68 A;  2GSN A;  4XLN A;  4PAB A;  3GTJ A;  3S1M C;  1TWH A;  2O5J A;  3PO2 C;  1O29 A;  5M5Y K;  3RZO C;  4A3D C;  4KM8 A;  4KAT A;  2R93 K;  4KC6 A;  5EGE A;  3GTL C;  4NOI A;  3T02 A;  2JA7 A;  1DCP A;  5C4X K;  2NVX K;  1O2F B;  5CHP A;  4Y52 K;  4XCH A;  1VJE A;  4WJ4 A;  4BBS K;  3GTG A;  2R92 K;  3FKI K;  4OIQ A;  3H0G C;  3WOD A;  3HOZ K;  4A93 K;  4A3C C;  2WB1 D;  3K7A C;  4G0W A;  1YNJ A;  3GEE A;  5IOR A;  3S2D K;  3Q3Q A;  4C2M C;  2YU9 K;  2B63 C;  4C3H C;  2CFA B;  1TWC A;  1BS2 A;  1IS1 A;  5IYC C;  4YFK A;  3M4O C;  2A69 A;  1I50 K;  1TWG K;  3SZZ A;  3HOU K;  3GTQ A;  3GTJ C;  2GSO A;  2JA6 K;  4QJV B;  4A3G K;  2PPB A;  1L0W A;  3GTO K;  3IPJ A;  3S15 C;  4GTD A;  4QJV A;  5FLM C;  5EGH A;  4GFQ A;  2JA8 K;  4XSZ A;  3FOF A;  2WAQ D;  1F7V A;  4PAA A;  4A3J K;  2NVT C;  3CQZ K;  1B4A A;  1WCM C;  3GTK C;  1TWA A;  2R7Z K;  4A3F C;  3BUE A;  1Y1W K;  5IYD C;  1GE9 A;  2EBB A;  2Y0S D;  5IP9 C;  2KWA A;  3I4N C;  4C3J K;  4KN4 A;  1WOP A;  3TTG A;  1KQ4 A;  3S16 C;  2D6F C;  2JA5 K;  1TWC C;  4AYB D;  5IYB K;  2WB1 L;  4KN7 A;  4AH6 A;  4A3L K;  4XLP A;  5TMC A;  4YFX A;  4KMU A;  3HOV C;  2R93 C;  1SMY A;  4KAW X;  1K83 C;  4GT9 A;  2V6T A;  4BY1 C;  4G0U A;  3GTP K;  3A8J A;  1SFO K;  3GTL A;  3GSI A;  4G0V A;  4X6A C;  3GEI A;  1ZVU A;  2NVQ C;  1ZXO A;  3MML B;  4LQY A;  4KMH A;  4KAR A;  3ERE D;  3HOY C;  5C3E K;  2E2H C;  4A3I C;  4O2D A;  3AD8 C;  2E2J C;  1TWF K;  1WOO A;  3DXJ A;  3S1N C;  1ZYR A;  4KMA A;  4LOW A;  3HOW K;  4BXX K;  4RMF A;  3HXA A;  3S17 K;  1XXA A;  2Y3P A;  5HL8 A;  1I3Q K;  2B63 A;  4GTB A;  1TWA C;  1IL2 A;  3AH5 A;  1TWH K;  2PHC B;  2V6S A;  2WAQ L;  1J6X A;  4KMD A;  4BY7 K;  4KDD A;  5C4J C;  2O5I A;  5JVO A;  5M5W K;  3TFI A;  3GTM K;  2JA7 K;  4XSX A;  3HKZ L;  2VUM K;  1O28 A;  4M1X A;  1EK8 A;  1ISE A;  4WJ3 M;  1XZQ A;  3AD7 C;  4GTA A;  3GTG K;  3ADA C;  4OIN A;  3AQO A;  2A6E A;  1UV7 A;  1XZP A;  2E2I A;  3S14 C;  4KB4 A;  1RU0 A;  4FZB A;  3PO3 K;  3TFH A;  2ZUF A;  2R7Z C;  3LAJ A;  1WCM A;  3GTK A;  5IP7 C;  4C3J C;  2RGR A;  4QIW D;  2PA8 D;  1ZQ1 C;  5IYB C;  4BBR C;  4A3E C;  1PJ6 A;  3GTQ K;  4GTF A;  1VGX A;  3N0C A;  2R93 A;  3A8K A;  3SZY A;  1K83 A;  3H3V D;  3FOE A;  2NVX A;  4A3M C;  5C44 K;  4G7H A;  3RZD C;  4C3I K;  1EI6 A;  1G51 A;  1YX2 A;  1I6H C;  2E2H A;  1JQW A;  3TFJ A;  1WQH A;  2GAG C;  2E2I C;  4KM9 A;  3I4M C;  3S1R K;  1R9T K;  1VRQ C;  3EQL A;  3HOX K;  1Y1V C;  4GTC A;  4A3B K;  4Y7N K;  2NVY K;  3S1Q K;  4A3K C;  4LLG A;  3S1M K;  1TWG A;  1I50 A;  3PO2 K;  2FQT A;  1INN A;  3GEH A;  3RZO K;  4A3D K;  3GDZ A;  2FQO A;  1DD5 A;  5TMF A;  2JA6 A;  1XPP A;  4YG2 A;  3GTL K;  1IW7 A;  1DCO A;  1PJ5 A;  4KB2 A;  4KAS A;  4QIW L;  2XCR B;  3GTO A;  4P5B A;  3JST A;  4C45 A;  1EQR A;  1VH2 A;  5IOQ A;  3LPX A;  1XXB A;  5C4X C;  2NVX C;  4Y52 C;  4DDQ A;  3FHZ A;  3H0G K;  2A6H A;  4BBS C;  2R92 C;  4A3C K;  4LK0 A;  3K7A K;  3FKI C;  1WOR A;  2CW0 A;  1J6W A;  1IQ0 A;  4GTE A;  2GAH C;  2R7Z A;  1Y1W A;  3HOZ C;  4A93 C;  4C2M K;  3M3Y K;  4C3H K;  3S2D C;  1V5V A;  1O2A A;  2YU9 C;  1C0A A;  3M4O K;  3NUH A;  5M3F K;  3AQP A;  5M5X K;  1J98 A;  1IBA A;  3QX3 A;  3GTJ K;  5M3M K;  1I50 C;  1TWG C;  2PMZ D;  1ZBS A;  3HOU C;  3S2H K;  4J3N A;  1SFO A;  3OEP A;  1PJ7 A;  1YNN A;  2JA6 C;  3S15 K;  5JFE A;  4YFN A;  4Q5S A;  4A3G C;  4ZH4 A;  1XZQ B;  2Y0S L;  5FLM K;  3BP8 C;  4ILD A;  4LR2 A;  1USO A;  3G4A A;  3GTO C;  1X31 C;  4G7O A;  4BLA A;  3V4G A;  1XZP B;  4Q4Z A;  1B4B A;  2P8T A;  4AYB L;  2NVT K;  2JA8 C;  1WCM K;  3GTK K;  5IOS A;  4A3F K;  2V6U A;  1BGW A;  5IYD K;  3HOX C;  4A3J C;  1I3Q A;  5IP9 K;  1F7U A;  3CQZ C;  3I4N K;  1Y1V A;  3L4J A;  1Y1W C;  3S1Q C;  3T01 A;  4OIR A;  1YCL A;  3S16 K;  2RH6 A;  1TWC K;  1WQG A;  3N0B A;  3HOV K;  2JA5 C;  3GTM A;  1BDF A;  1K83 K;  1DCH A;  4BY1 K;  2VUM A;  4A3L C;  2ZUE A;  1O26 A;  4BLB A;  4X6A K;  2P5M A;  1J6V A;  1XXC A;  2NVQ K;  2XCQ A;  3GTP C;  1SFO C;  4BKW A;  1EFW A;  3HOY K;  1F9N A;  1O2B A;  2E2H K;  4A3I K;  2E2J K;  4FM9 A;  2PMZ L;  4WIL A;  3S1N K;  5C3E C;  2R92 A;  3A8I A;  3FKI A;  4GZY A;  1TWF C;  2BE5 A;  3M3Y C;  1JOE A;  4OIO A;  3HOW C;  4BXX C;  4MEY A;  1TWA K;  3S17 C;  1WIH A; 
#chains in the Genus database with same CATH homology
 2NVX K;  1TWA C;  1I3Q C;  4Y52 K;  5D4D A;  4MEX A;  5C4X C;  2NVX C;  1TWH K;  4Y52 C;  5C4J K;  2WAQ L;  4BBS K;  4BY7 K;  2R92 K;  3H0G K;  3FKI K;  4LK1 A;  2A6H A;  1TWH C;  5C4J C;  4BBS C;  4JK1 A;  2O5I A;  4BY7 C;  2R92 C;  4A3C K;  4LK0 A;  3H0G C;  3FKI C;  3K7A K;  3WOD A;  5M5W K;  4OIQ A;  2CW0 A;  3HOZ K;  4A93 K;  3S2H C;  4A3C C;  3GTM K;  2WB1 D;  3K7A C;  1YNJ A;  3HOZ C;  4A93 C;  4C2M K;  4XSX A;  3HKZ L;  2JA7 K;  2VUM K;  3S2D K;  3GTM C;  3M3Y K;  4C3H K;  2JA7 C;  2YU9 K;  2VUM C;  3S2D C;  2B63 C;  2YU9 C;  3GTG K;  3M4O K;  4OIN A;  4OIP A;  5IYC C;  2PA8 L;  5M5X K;  5M3F K;  2A6E A;  4YFK A;  3GTG C;  1I6V A;  3M4O C;  3S14 K;  2A69 A;  1I50 K;  1TWG K;  3S14 C;  4MQ9 A;  3HOU K;  3GTJ K;  5M3M K;  1I50 C;  1TWG C;  2PMZ D;  3PO3 K;  2R7Z C;  5FJ8 K;  3HKZ D;  3GTJ C;  3HOU C;  2JA6 K;  3PO3 C;  5IP7 K;  4QJV B;  3S2H K;  4A3G K;  2PPB A;  2JA6 C;  1YNN A;  5IP7 C;  3H3V L;  4YFN A;  1HQM A;  3S15 K;  4ZH4 A;  2Y0S L;  3GTO K;  4Q5S A;  4A3G C;  5FLM K;  3S15 C;  4QJV A;  4QIW D;  2PA8 D;  3GTO C;  2B63 K;  4BBR K;  5FLM C;  5IYB C;  4A3E K;  4G7O A;  5IYC K;  4BBR C;  2JA8 K;  4Q4Z A;  4XSZ A;  4A3E C;  4AYB L;  2NVT K;  3GTQ K;  2JA8 C;  2WAQ D;  4A3J K;  1WCM K;  3GTQ C;  2NVT C;  3GTK K;  4A3F K;  5IYD K;  3CQZ K;  3HOX C;  4A3J C;  1WCM C;  3GTK C;  4A3M K;  4A3F C;  1Y1W K;  2R7Z K;  5IP9 K;  5IYD C;  3H3V D;  3CQZ C;  2Y0S D;  3I4N K;  4LJZ A;  4G7Z A;  2A68 A;  4A3M C;  3RZD K;  1Y1W C;  5IP9 C;  5C44 K;  4OIR A;  4G7H A;  3S1Q C;  3I4N C;  3RZD C;  4C3J K;  5C44 C;  3S16 K;  4C3I K;  1TWC K;  4KN4 A;  1I6H K;  3S16 C;  2JA5 K;  1TWC C;  4AYB D;  5IYB K;  1I6H C;  2WB1 L;  4KN7 A;  3HOV K;  4A3L K;  2JA5 C;  4XLP A;  2E2I K;  5TMC A;  4YFX A;  3I4M K;  1BDF A;  1K83 K;  4KMU A;  4BY1 K;  3HOV C;  4A3L C;  2R93 C;  1SMY A;  2E2I C;  3I4M C;  1K83 C;  1Y1V K;  3S1R K;  1R9T K;  4BY1 C;  4X6A K;  3EQL A;  3HOX K;  3S1R C;  1Y1V C;  1R9T C;  3GTP K;  1SFO K;  2NVQ K;  4A3B K;  4X6A C;  4Y7N K;  2NVY K;  4A3K K;  3GTP C;  1SFO C;  2NVQ C;  4A3B C;  3S1Q K;  3HOY K;  4Y7N C;  2NVY C;  4LLG A;  4XLN A;  4A3K C;  2E2H K;  4A3I K;  3S1M K;  2E2J K;  3HOY C;  3PO2 K;  2PMZ L;  5C3E K;  2E2H C;  3S1N K;  4A3I C;  3S1M C;  2E2J C;  2O5J A;  3RZO K;  1TWF K;  3PO2 C;  5C3E C;  5M5Y K;  4A3D K;  3DXJ A;  3S1N C;  4GZY A;  5TMF A;  3RZO C;  1TWF C;  2BE5 A;  1XPP A;  3M3Y C;  1ZYR A;  4A3D C;  3HOW K;  4YG2 A;  4BXX K;  3GTL K;  1IW7 A;  4OIO A;  2R93 K;  3S17 K;  3HOW C;  4QIW L;  4BXX C;  4MEY A;  1TWA K;  1I3Q K;  4NOI A;  3GTL C;  3S17 C;  5C4X K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...