4A3FK

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid and soaked with ampcpp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3fK00
5TMCA 4A3KC 5C3EK 2E2IK 3GTKC 3S16K 4A3LC 2WAQD 1I6VA 3RZDK 3M3YK 1WCMC 4OIQA 1R9TK 3GTLK 4BY1K 5IYDC 4A3MC 1TWGK 3WODA 3FKIK 2R93C 4OIRA 3PO2C 5IP7C 4A3EC 4BBSK 3CQZC 4A3GK 5IP9C 3S1NC 5C3EC 4QJVB 2E2IC 3S16C 2NVQK 2NVQC 3GTJK 3GTQK 3M3YC 5M3MK 4A3KK 3S1RC 3GTKK 4A3LK 4QIWD 4Q5SA 4A3IK 2NVXC 2A6HA 2YU9C 1Y1WC 1WCMK 3H0GC 1TWCK 4MQ9A 5IYDK 4A3MK 4QIWL 3HOWC 5IP7K 4A3EK 3CQZK 4YFNA 5IYCC 5IP9K 3S1NK 1YNJA 3EQLA 3S2DK 3GTOK 4A3IC 2O5JA 2CW0A 2PPBA 5M5XK 4G7HA 1TWCC 3S1RK 1HQMA 2Y0SD 3S2DC 3HOXC 3HKZD 2NVXK 3HOZC 2YU9K 2WAQL 4LJZA 3H0GK 4YG2A 1Y1WK 4C2MK 4A3FC 3GTPC 3S1MK 3H3VD 4GZYA 4LK1A 3PO3C 3I4MC 2Y0SL 3GTOC 4MEXA 3HKZL 3K7AK 5FLMK 4OIOA 4XSZA 3HOWK 4A3DC 4C3IK 5IYCK 3H3VL 2VUMC 3HOVC 2A6EA 2JA6C 1K83C 2A69A 1SFOC 4ZH4A 4Y52K 4KN4A 2PMZD 3S1MC 4A3CC 4BBRK 3HOXK 1I50C 1TWHC 3HOZK 3K7AC 5FLMC 4KN7A 4A3FK 3GTPK 4MEYA 4BXXC 2PMZL 3PO3K 3I4MK 4C3HK 1SMYA 2B63K 3S14C 4G7OA 3GTQC 4A93C 2NVYC 2R92C 4A3DK 2BE5A 5IYBC 4Y52C 2O5IA 4JK1A 2VUMK 3S2HC 3HOVK 4BBRC 2JA6K 1K83K 1I3QC 1SFOK 4BY7C 3S15C 4A3CK 4A3JC 3HOYC 1I50K 1TWHK 4A3BC 2B63C 1Y1VK 4Q4ZA 5C4JC 4AYBD 2E2HC 2E2JC 5M3FK 1TWAC 1BDFA 2JA7C 2R7ZC 3RZOC 4X6AC 4Y7NC 4XLNA 3S14K 2NVTK 3HOUK 4A93K 2NVYK 2R92K 2R93K 4AYBL 4C3JK 1IW7A 5IYBK 3S1QC 2WB1D 5TMFA 3S2HK 4YFXA 1ZYRA 4NOIA 5M5YK 2JA8C 1YNNA 3GTGK 3GTMC 1Y1VC 3S17C 1I3QK 2JA5C 5C4XC 2PA8D 5C44C 4BY7K 3S15K 4OINA 2WB1L 4KMUA 4QJVA 4A3JK 3HOYK 3I4NK 4A3BK 5FJ8K 1TWFC 2E2JK 2NVTC 5C4JK 2JA7K 1XPPA 2E2HK 3HOUC 1TWAK 3M4OK 4BXXK 4XLPA 2PA8L 4G7ZA 2R7ZK 3RZOK 1I6HK 4X6AK 5M5WK 4Y7NK 3DXJA 4LK0A 3GTGC 3RZDC 3S1QK 1R9TC 3GTLC 4BY1C 3I4NC 4LLGA 2JA8K 3GTMK 1TWGC 5C4XK 3S17K 2JA5K 3FKIC 3M4OC 5C44K 4BBSC 1I6HC 4XSXA 4A3GC 5D4DA 1TWFK 2A68A 4OIPA 4YFKA 3PO2K 3GTJC
chains in the Genus database with same CATH superfamily
4FZBA 2E2IA 1O26A 5JFEA 1R9TK 3GTLK 2ZUEA 1F7VA 3PO2C 1JOEA 5C3EC 4GTCA 1ZBSA 3M3YC 1WOOA 5M3MK 3GTJA 4A3KK 3S1RC 3GTKA 4A3IK 2V6SA 2A6HA 2YU9C 1Y1WC 1TWCK 1WCMA 2ZFZA 4A3EK 5IOSA 3CQZK 5IP9K 3EQLA 4GTFA 4KMHA 3GTOA 2O5JA 2CW0A 5M5XK 4G7HA 3BP3A 1HQMA 3AH5A 2NVXK 3QX3A 1F9NA 1J6WA 3H0GA 4KMDA 4C2MK 4A3FC 3S1MK 3S2DC 3I4MC 4C3HC 4MEXA 4A3DC 4C3IK 3CAGA 4P9SA 3HOVC 2JA6C 3S0XA 1SFOC 4KB2A 4KN4A 3TFJA 3HOXK 3HOZK 1EK8A 5FLMC 4C45A 3GTPK 4KASA 1G51A 3PO3K 1SMYA 3LAJA 2R92C 5IOTA 4Y52C 4JK1A 2FQOA 4FM9A 1I3QC 1K83A 1I50K 2B63C 2XCOA 1TWAC 1XZQA 4X6AC 4XLNA 3S14K 4PAAA 3HOUK 3IPJA 1IW7A 2NVYA 1J6VA 4LR2A 5TMFA 5IYBK 4WJ4A 1AB4A 4KATA 4KMAA 1ZYRA 3GSIA 4NOIA 4YFXA 4RMFA 3GTGA 5C44C 1WOSA 4KMUA 3HOYK 4A3BK 1TWFC 1VGXA 3FOEA 2NVTC 4BXXK 2E2HK 3M4OK 4XLPA 2PA8L 5IORA 3RZOK 4Y7NK 2JH3A 3Q3QA 3I4NC 1O24A 1Y1VA 4BBSC 1I6HC 3TFHA 4BKWA 3AD9C 4KB4A 3PO2K 3GTJC 2R93A 3OPFA 1J98A 3VA7A 5C3EK 3GTKC 4P5BA 2WAQD 3RZDK 3M3YK 1WCMC 1USMA 1PJ7A 1R9TA 4BY1K 5IYDC 4A3MC 3GTLA 3GEIA 3WODA 1KQ4A 4KDDA 4G0WA 3FKIK 1V5VA 1XXAA 2GSOA 3S1NC 4QJVB 2NVQK 3GTQK 5EGHA 2XCRB 3LPXA 4A3LK 4G0VA 3H0GC 3T01A 4MQ9A 1TWCA 5JVOA 3AQPA 3HOWC 1EQRA 5IP7K 3CQZA 1YNJA 3S2DK 4AH6A 4ILDA 5EGEA 2PPBA 2RGRA 4DDQA 1WQFA 4GT9A 3HKZD 2PHCB 2NVXA 1PJ6A 2KWAA 4G0UA 3GEEA 3H3VD 1X31C 2FQTA 4GTEA 5FLMK 1EI6A 5IYCK 3GDZA 1VLOA 1K83C 4Y52K 2PMZD 4A3CC 4BLAA 3GTPA 1WOPA 2B63K 2NVYC 1XZPA 4C3JC 3SZYA 4GTDA 2O5IA 2VUMK 3S2HC 2GAHC 1BGWA 3S15C 1B4AA 1O29A 1TWHK 2E2JC 1I50A 5C4JC 4AYBD 4Q4ZA 1BDFA 1HI9A 2GSUA 2NVTK 4A93K 2CFAB 1ISEA 3S1QC 1IQ0A 1YNNA 1Y1VC 3TFIA 3S17C 4BY7K 4A3JK 3I4NK 5FJ8K 2JA7K 2R93C 2E2HA 2R7ZK 1I6HK 3V4GA 5M5WK 4LK0A 1R9TC 3A8KA 3GTLC 2GAGC 4LLGA 1WSVA 4KAWX 5C4XK 2JA8K 3GTMK 2JA5K 1XXCA 2A68A 5TMCA 4PABA 4A3KC 4XCHA 1B4BA 1YX2A 4LQYA 4OIQA 1BJTA 3BP8C 1BS2A 1TWGK 4OIRA 3FKIA 4A3EC 3CQZC 2ZUFA 5IP9C 4A3GK 2E2IC 3S16C 3T02A 3GTQA 4P5AA 1GE9A 4QIWD 2EBBA 2NVXC 1VH2A 4C2MC 3AQOA 3AD7C 5L46A 1XXBA 4WJ3M 2V6UA 3S1RK 2Y0SD 3HOXC 3HOZC 3ADAC 1Y1WK 2YU9K 3A8IA 3GTPC 4LK1A 4M1XA 3PO3C 3GTOC 3HKZL 1WIHA 3G4AA 3H3VL 3FHZA 2A69A 3BUEA 1I50C 3K7AC 4KN7A 4A3FK 2Y3PA 1DCOA 2PMZL 3N3YA 3I4MK 4C3HK 3S14C 2B63A 4A3DK 3ERED 2BE5A 5IYBC 3N0BA 3HOVK 4BBRC 2JA6K 2VUMA 2P5MA 3T00A 1SFOK 3HOYC 3OEPA 4A3BC 1F7UA 1Y1VK 1TWHA 4BXXC 2E2HC 1JVIA 5M3FK 3RZOC 3A8JA 4Y7NC 1ZQ1C 1DD5A 2R93K 4KM8A 2R92K 4AYBL 1WSRA 2WB1D 1ZVUA 4KARA 1WQHA 4KC6A 1I3QK 4GFQA 4QJVA 1INNA 4GTLA 4KM9A 1TWAK 2JA7A 4G7ZA 4X6AK 2R7ZA 3DXJA 1WQGA 1VJEA 3GTGC 3RZDC 2W7VA 3OREA 4BY1C 1IL2A 3GTMA 3FKIC 5C44K 2JA5A 3JSTA 3MMLB 1WORA 5D4DA 1TWFK 4OIPA 2NVQC 3FOFA 3GTQC 3GIRA 1O2AA 1XZQB 1USOA 2E2IK 3S16K 4A3LC 1I6VA 2GSNA 1VRQC 4WILA 1TWGA 5IP7C 4BBSK 1IS1A 3GTJK 4GTAA 4LOWA 5CJ9A 1DCHA 3GTKK 4Q5SA 1WCMK 5IYDK 4A3MK 4QIWL 4YFNA 5IYCC 3S1NK 3GTOK 3LAPA 5HL8A 4A3IC 4J3NA 1TWCC 1J6XA 3TTGA 3GEHA 3L4JA 2WAQL 4YG2A 3H0GK 4LJZA 2YU9A 2XCQA 3SZZA 1Y1WA 2CFAA 2Y0SL 1F93A 1YCLA 3K7AK 3HOWK 4OIOA 4XSZA 1EH1A 2D6FC 5TJ3A 1O2FB 2VUMC 2A6EA 1RU0A 4ZH4A 5IOQA 3S1MC 4BBRK 1TWHC 4C3IC 1C0AA 4MEYA 4GTBA 2RH6A 4G7OA 1O2BA 4A93C 1JQWA 1L0WA 1IBAA 1O25A 1DCPA 1K83K 2JA6A 1SFOA 4A3CK 4BY7C 1PJ5A 3N0CA 4A3JC 4O2DA 2JA7C 2V6TA 2R7ZC 5E68A 2NVYK 4C3JK 1O28A 3NUHA 2R92A 3G4CA 3S2HK 5M5YK 2JA8C 3GTGK 3GTMC 5C4XC 2JA5C 2PA8D 1I3QA 3S15K 4OINA 2WB1L 1ZXOA 2E2JK 3HXAA 5C4JK 1XPPA 5CHPA 3HOUC 4GZYA 1TWAA 3L4KA 1EFWA 2P8TA 3S1QK 1XZPB 1IE0A 1O27A 1TWGC 3S17K 1UV7A 3M4OC 3AD8C 4XSXA 4A3GC 4BLBA 1TWFA 4YFKA
chains in the Genus database with same CATH topology
5TMCA 4A3KC 5C3EK 2E2IK 3GTKC 3S16K 4A3LC 2WAQD 1I6VA 3RZDK 3M3YK 1WCMC 4OIQA 1R9TK 3GTLK 4BY1K 5IYDC 4A3MC 1TWGK 3WODA 3FKIK 2R93C 4OIRA 3PO2C 5IP7C 4A3EC 4BBSK 3CQZC 4A3GK 5IP9C 3S1NC 5C3EC 4QJVB 2E2IC 3S16C 2NVQK 2NVQC 3GTJK 3GTQK 3M3YC 5M3MK 4A3KK 3S1RC 3GTKK 4A3LK 4QIWD 4Q5SA 4A3IK 2NVXC 2A6HA 2YU9C 1Y1WC 1WCMK 3H0GC 1TWCK 4MQ9A 5IYDK 4A3MK 4QIWL 3HOWC 5IP7K 4A3EK 3CQZK 4YFNA 5IYCC 5IP9K 3S1NK 1YNJA 3EQLA 3S2DK 3GTOK 4A3IC 2O5JA 2CW0A 2PPBA 5M5XK 4G7HA 1TWCC 3S1RK 1HQMA 2Y0SD 3S2DC 3HOXC 3HKZD 2NVXK 3HOZC 2YU9K 2WAQL 4LJZA 3H0GK 4YG2A 1Y1WK 4C2MK 4A3FC 3GTPC 3S1MK 3H3VD 4GZYA 4LK1A 3PO3C 3I4MC 2Y0SL 3GTOC 4MEXA 3HKZL 3K7AK 5FLMK 4OIOA 4XSZA 3HOWK 4A3DC 4C3IK 5IYCK 3H3VL 2VUMC 3HOVC 2A6EA 2JA6C 1K83C 2A69A 1SFOC 4ZH4A 4Y52K 4KN4A 2PMZD 3S1MC 4A3CC 4BBRK 3HOXK 1I50C 1TWHC 3HOZK 3K7AC 5FLMC 4KN7A 4A3FK 3GTPK 4MEYA 4BXXC 2PMZL 3PO3K 3I4MK 4C3HK 1SMYA 2B63K 3S14C 4G7OA 3GTQC 4A93C 2NVYC 2R92C 4A3DK 2BE5A 5IYBC 4Y52C 2O5IA 4JK1A 2VUMK 3S2HC 3HOVK 4BBRC 2JA6K 1K83K 1I3QC 1SFOK 4BY7C 3S15C 4A3CK 4A3JC 3HOYC 1I50K 1TWHK 4A3BC 2B63C 1Y1VK 4Q4ZA 5C4JC 4AYBD 2E2HC 2E2JC 5M3FK 1TWAC 1BDFA 2JA7C 2R7ZC 3RZOC 4X6AC 4Y7NC 4XLNA 3S14K 2NVTK 3HOUK 4A93K 2NVYK 2R92K 2R93K 4AYBL 4C3JK 1IW7A 5IYBK 3S1QC 2WB1D 5TMFA 3S2HK 4YFXA 1ZYRA 4NOIA 5M5YK 2JA8C 1YNNA 3GTGK 3GTMC 1Y1VC 3S17C 1I3QK 2JA5C 5C4XC 2PA8D 5C44C 4BY7K 3S15K 4OINA 2WB1L 4KMUA 4QJVA 4A3JK 3HOYK 3I4NK 4A3BK 5FJ8K 1TWFC 2E2JK 2NVTC 5C4JK 2JA7K 1XPPA 2E2HK 3HOUC 1TWAK 3M4OK 4BXXK 4XLPA 2PA8L 4G7ZA 2R7ZK 3RZOK 1I6HK 4X6AK 5M5WK 4Y7NK 3DXJA 4LK0A 3GTGC 3RZDC 3S1QK 1R9TC 3GTLC 4BY1C 3I4NC 4LLGA 2JA8K 3GTMK 1TWGC 5C4XK 3S17K 2JA5K 3FKIC 3M4OC 5C44K 4BBSC 1I6HC 4XSXA 4A3GC 5D4DA 1TWFK 2A68A 4OIPA 4YFKA 3PO2K 3GTJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TMC A;  4A3K C;  5C3E K;  2E2I K;  3GTK C;  3S16 K;  4A3L C;  2WAQ D;  1I6V A;  3RZD K;  3M3Y K;  1WCM C;  4OIQ A;  1R9T K;  3GTL K;  4BY1 K;  5IYD C;  4A3M C;  1TWG K;  3WOD A;  3FKI K;  2R93 C;  4OIR A;  3PO2 C;  5IP7 C;  4A3E C;  4BBS K;  3CQZ C;  4A3G K;  5IP9 C;  3S1N C;  5C3E C;  4QJV B;  2E2I C;  3S16 C;  2NVQ K;  2NVQ C;  3GTJ K;  3GTQ K;  3M3Y C;  5M3M K;  4A3K K;  3S1R C;  3GTK K;  4A3L K;  4QIW D;  4Q5S A;  4A3I K;  2NVX C;  2A6H A;  2YU9 C;  1Y1W C;  1WCM K;  3H0G C;  1TWC K;  4MQ9 A;  5IYD K;  4A3M K;  4QIW L;  3HOW C;  5IP7 K;  4A3E K;  3CQZ K;  4YFN A;  5IYC C;  5IP9 K;  3S1N K;  1YNJ A;  3EQL A;  3S2D K;  3GTO K;  4A3I C;  2O5J A;  2CW0 A;  2PPB A;  5M5X K;  4G7H A;  1TWC C;  3S1R K;  1HQM A;  2Y0S D;  3S2D C;  3HOX C;  3HKZ D;  2NVX K;  3HOZ C;  2YU9 K;  2WAQ L;  4LJZ A;  3H0G K;  4YG2 A;  1Y1W K;  4C2M K;  4A3F C;  3GTP C;  3S1M K;  3H3V D;  4GZY A;  4LK1 A;  3PO3 C;  3I4M C;  2Y0S L;  3GTO C;  4MEX A;  3HKZ L;  3K7A K;  5FLM K;  4OIO A;  4XSZ A;  3HOW K;  4A3D C;  4C3I K;  5IYC K;  3H3V L;  2VUM C;  3HOV C;  2A6E A;  2JA6 C;  1K83 C;  2A69 A;  1SFO C;  4ZH4 A;  4Y52 K;  4KN4 A;  2PMZ D;  3S1M C;  4A3C C;  4BBR K;  3HOX K;  1I50 C;  1TWH C;  3HOZ K;  3K7A C;  5FLM C;  4KN7 A;  4A3F K;  3GTP K;  4MEY A;  4BXX C;  2PMZ L;  3PO3 K;  3I4M K;  4C3H K;  1SMY A;  2B63 K;  3S14 C;  4G7O A;  3GTQ C;  4A93 C;  2NVY C;  2R92 C;  4A3D K;  2BE5 A;  5IYB C;  4Y52 C;  2O5I A;  4JK1 A;  2VUM K;  3S2H C;  3HOV K;  4BBR C;  2JA6 K;  1K83 K;  1I3Q C;  1SFO K;  4BY7 C;  3S15 C;  4A3C K;  4A3J C;  3HOY C;  1I50 K;  1TWH K;  4A3B C;  2B63 C;  1Y1V K;  4Q4Z A;  5C4J C;  4AYB D;  2E2H C;  2E2J C;  5M3F K;  1TWA C;  1BDF A;  2JA7 C;  2R7Z C;  3RZO C;  4X6A C;  4Y7N C;  4XLN A;  3S14 K;  2NVT K;  3HOU K;  4A93 K;  2NVY K;  2R92 K;  2R93 K;  4AYB L;  4C3J K;  1IW7 A;  5IYB K;  3S1Q C;  2WB1 D;  5TMF A;  3S2H K;  4YFX A;  1ZYR A;  4NOI A;  5M5Y K;  2JA8 C;  1YNN A;  3GTG K;  3GTM C;  1Y1V C;  3S17 C;  1I3Q K;  2JA5 C;  5C4X C;  2PA8 D;  5C44 C;  4BY7 K;  3S15 K;  4OIN A;  2WB1 L;  4KMU A;  4QJV A;  4A3J K;  3HOY K;  3I4N K;  4A3B K;  5FJ8 K;  1TWF C;  2E2J K;  2NVT C;  5C4J K;  2JA7 K;  1XPP A;  2E2H K;  3HOU C;  1TWA K;  3M4O K;  4BXX K;  4XLP A;  2PA8 L;  4G7Z A;  2R7Z K;  3RZO K;  1I6H K;  4X6A K;  5M5W K;  4Y7N K;  3DXJ A;  4LK0 A;  3GTG C;  3RZD C;  3S1Q K;  1R9T C;  3GTL C;  4BY1 C;  3I4N C;  4LLG A;  2JA8 K;  3GTM K;  1TWG C;  5C4X K;  3S17 K;  2JA5 K;  3FKI C;  3M4O C;  5C44 K;  4BBS C;  1I6H C;  4XSX A;  4A3G C;  5D4D A;  1TWF K;  2A68 A;  4OIP A;  4YFK A;  3PO2 K;  3GTJ C; 
#chains in the Genus database with same CATH topology
 4FZB A;  2E2I A;  1O26 A;  5JFE A;  1R9T K;  3GTL K;  2ZUE A;  1F7V A;  3PO2 C;  1JOE A;  5C3E C;  4GTC A;  1ZBS A;  3M3Y C;  1WOO A;  5M3M K;  3GTJ A;  4A3K K;  3S1R C;  3GTK A;  4A3I K;  2V6S A;  2A6H A;  2YU9 C;  1Y1W C;  1TWC K;  1WCM A;  2ZFZ A;  4A3E K;  5IOS A;  3CQZ K;  5IP9 K;  3EQL A;  4GTF A;  4KMH A;  3GTO A;  2O5J A;  2CW0 A;  5M5X K;  4G7H A;  3BP3 A;  1HQM A;  3AH5 A;  2NVX K;  3QX3 A;  1F9N A;  1J6W A;  3H0G A;  4KMD A;  4C2M K;  4A3F C;  3S1M K;  3S2D C;  3I4M C;  4C3H C;  4MEX A;  4A3D C;  4C3I K;  3CAG A;  4P9S A;  3HOV C;  2JA6 C;  3S0X A;  1SFO C;  4KB2 A;  4KN4 A;  3TFJ A;  3HOX K;  3HOZ K;  1EK8 A;  5FLM C;  4C45 A;  3GTP K;  4KAS A;  1G51 A;  3PO3 K;  1SMY A;  3LAJ A;  2R92 C;  5IOT A;  4Y52 C;  4JK1 A;  2FQO A;  4FM9 A;  1I3Q C;  1K83 A;  1I50 K;  2B63 C;  2XCO A;  1TWA C;  1XZQ A;  4X6A C;  4XLN A;  3S14 K;  4PAA A;  3HOU K;  3IPJ A;  1IW7 A;  2NVY A;  1J6V A;  4LR2 A;  5TMF A;  5IYB K;  4WJ4 A;  1AB4 A;  4KAT A;  4KMA A;  1ZYR A;  3GSI A;  4NOI A;  4YFX A;  4RMF A;  3GTG A;  5C44 C;  1WOS A;  4KMU A;  3HOY K;  4A3B K;  1TWF C;  1VGX A;  3FOE A;  2NVT C;  4BXX K;  2E2H K;  3M4O K;  4XLP A;  2PA8 L;  5IOR A;  3RZO K;  4Y7N K;  2JH3 A;  3Q3Q A;  3I4N C;  1O24 A;  1Y1V A;  4BBS C;  1I6H C;  3TFH A;  4BKW A;  3AD9 C;  4KB4 A;  3PO2 K;  3GTJ C;  2R93 A;  3OPF A;  1J98 A;  3VA7 A;  5C3E K;  3GTK C;  4P5B A;  2WAQ D;  3RZD K;  3M3Y K;  1WCM C;  1USM A;  1PJ7 A;  1R9T A;  4BY1 K;  5IYD C;  4A3M C;  3GTL A;  3GEI A;  3WOD A;  1KQ4 A;  4KDD A;  4G0W A;  3FKI K;  1V5V A;  1XXA A;  2GSO A;  3S1N C;  4QJV B;  2NVQ K;  3GTQ K;  5EGH A;  2XCR B;  3LPX A;  4A3L K;  4G0V A;  3H0G C;  3T01 A;  4MQ9 A;  1TWC A;  5JVO A;  3AQP A;  3HOW C;  1EQR A;  5IP7 K;  3CQZ A;  1YNJ A;  3S2D K;  4AH6 A;  4ILD A;  5EGE A;  2PPB A;  2RGR A;  4DDQ A;  1WQF A;  4GT9 A;  3HKZ D;  2PHC B;  2NVX A;  1PJ6 A;  2KWA A;  4G0U A;  3GEE A;  3H3V D;  1X31 C;  2FQT A;  4GTE A;  5FLM K;  1EI6 A;  5IYC K;  3GDZ A;  1VLO A;  1K83 C;  4Y52 K;  2PMZ D;  4A3C C;  4BLA A;  3GTP A;  1WOP A;  2B63 K;  2NVY C;  1XZP A;  4C3J C;  3SZY A;  4GTD A;  2O5I A;  2VUM K;  3S2H C;  2GAH C;  1BGW A;  3S15 C;  1B4A A;  1O29 A;  1TWH K;  2E2J C;  1I50 A;  5C4J C;  4AYB D;  4Q4Z A;  1BDF A;  1HI9 A;  2GSU A;  2NVT K;  4A93 K;  2CFA B;  1ISE A;  3S1Q C;  1IQ0 A;  1YNN A;  1Y1V C;  3TFI A;  3S17 C;  4BY7 K;  4A3J K;  3I4N K;  5FJ8 K;  2JA7 K;  2R93 C;  2E2H A;  2R7Z K;  1I6H K;  3V4G A;  5M5W K;  4LK0 A;  1R9T C;  3A8K A;  3GTL C;  2GAG C;  4LLG A;  1WSV A;  4KAW X;  5C4X K;  2JA8 K;  3GTM K;  2JA5 K;  1XXC A;  2A68 A;  5TMC A;  4PAB A;  4A3K C;  4XCH A;  1B4B A;  1YX2 A;  4LQY A;  4OIQ A;  1BJT A;  3BP8 C;  1BS2 A;  1TWG K;  4OIR A;  3FKI A;  4A3E C;  3CQZ C;  2ZUF A;  5IP9 C;  4A3G K;  2E2I C;  3S16 C;  3T02 A;  3GTQ A;  4P5A A;  1GE9 A;  4QIW D;  2EBB A;  2NVX C;  1VH2 A;  4C2M C;  3AQO A;  3AD7 C;  5L46 A;  1XXB A;  4WJ3 M;  2V6U A;  3S1R K;  2Y0S D;  3HOX C;  3HOZ C;  3ADA C;  1Y1W K;  2YU9 K;  3A8I A;  3GTP C;  4LK1 A;  4M1X A;  3PO3 C;  3GTO C;  3HKZ L;  1WIH A;  3G4A A;  3H3V L;  3FHZ A;  2A69 A;  3BUE A;  1I50 C;  3K7A C;  4KN7 A;  4A3F K;  2Y3P A;  1DCO A;  2PMZ L;  3N3Y A;  3I4M K;  4C3H K;  3S14 C;  2B63 A;  4A3D K;  3ERE D;  2BE5 A;  5IYB C;  3N0B A;  3HOV K;  4BBR C;  2JA6 K;  2VUM A;  2P5M A;  3T00 A;  1SFO K;  3HOY C;  3OEP A;  4A3B C;  1F7U A;  1Y1V K;  1TWH A;  4BXX C;  2E2H C;  1JVI A;  5M3F K;  3RZO C;  3A8J A;  4Y7N C;  1ZQ1 C;  1DD5 A;  2R93 K;  4KM8 A;  2R92 K;  4AYB L;  1WSR A;  2WB1 D;  1ZVU A;  4KAR A;  1WQH A;  4KC6 A;  1I3Q K;  4GFQ A;  4QJV A;  1INN A;  4GTL A;  4KM9 A;  1TWA K;  2JA7 A;  4G7Z A;  4X6A K;  2R7Z A;  3DXJ A;  1WQG A;  1VJE A;  3GTG C;  3RZD C;  2W7V A;  3ORE A;  4BY1 C;  1IL2 A;  3GTM A;  3FKI C;  5C44 K;  2JA5 A;  3JST A;  3MML B;  1WOR A;  5D4D A;  1TWF K;  4OIP A;  2NVQ C;  3FOF A;  3GTQ C;  3GIR A;  1O2A A;  1XZQ B;  1USO A;  2E2I K;  3S16 K;  4A3L C;  1I6V A;  2GSN A;  1VRQ C;  4WIL A;  1TWG A;  5IP7 C;  4BBS K;  1IS1 A;  3GTJ K;  4GTA A;  4LOW A;  5CJ9 A;  1DCH A;  3GTK K;  4Q5S A;  1WCM K;  5IYD K;  4A3M K;  4QIW L;  4YFN A;  5IYC C;  3S1N K;  3GTO K;  3LAP A;  5HL8 A;  4A3I C;  4J3N A;  1TWC C;  1J6X A;  3TTG A;  3GEH A;  3L4J A;  2WAQ L;  4YG2 A;  3H0G K;  4LJZ A;  2YU9 A;  2XCQ A;  3SZZ A;  1Y1W A;  2CFA A;  2Y0S L;  1F93 A;  1YCL A;  3K7A K;  3HOW K;  4OIO A;  4XSZ A;  1EH1 A;  2D6F C;  5TJ3 A;  1O2F B;  2VUM C;  2A6E A;  1RU0 A;  4ZH4 A;  5IOQ A;  3S1M C;  4BBR K;  1TWH C;  4C3I C;  1C0A A;  4MEY A;  4GTB A;  2RH6 A;  4G7O A;  1O2B A;  4A93 C;  1JQW A;  1L0W A;  1IBA A;  1O25 A;  1DCP A;  1K83 K;  2JA6 A;  1SFO A;  4A3C K;  4BY7 C;  1PJ5 A;  3N0C A;  4A3J C;  4O2D A;  2JA7 C;  2V6T A;  2R7Z C;  5E68 A;  2NVY K;  4C3J K;  1O28 A;  3NUH A;  2R92 A;  3G4C A;  3S2H K;  5M5Y K;  2JA8 C;  3GTG K;  3GTM C;  5C4X C;  2JA5 C;  2PA8 D;  1I3Q A;  3S15 K;  4OIN A;  2WB1 L;  1ZXO A;  2E2J K;  3HXA A;  5C4J K;  1XPP A;  5CHP A;  3HOU C;  4GZY A;  1TWA A;  3L4K A;  1EFW A;  2P8T A;  3S1Q K;  1XZP B;  1IE0 A;  1O27 A;  1TWG C;  3S17 K;  1UV7 A;  3M4O C;  3AD8 C;  4XSX A;  4A3G C;  4BLB A;  1TWF A;  4YFK A; 
#chains in the Genus database with same CATH homology
 5TMC A;  4A3K C;  5C3E K;  2E2I K;  3GTK C;  3S16 K;  4A3L C;  2WAQ D;  1I6V A;  3RZD K;  3M3Y K;  1WCM C;  4OIQ A;  1R9T K;  3GTL K;  4BY1 K;  5IYD C;  4A3M C;  1TWG K;  3WOD A;  3FKI K;  2R93 C;  4OIR A;  3PO2 C;  5IP7 C;  4A3E C;  4BBS K;  3CQZ C;  4A3G K;  5IP9 C;  3S1N C;  5C3E C;  4QJV B;  2E2I C;  3S16 C;  2NVQ K;  2NVQ C;  3GTJ K;  3GTQ K;  3M3Y C;  5M3M K;  4A3K K;  3S1R C;  3GTK K;  4A3L K;  4QIW D;  4Q5S A;  4A3I K;  2NVX C;  2A6H A;  2YU9 C;  1Y1W C;  1WCM K;  3H0G C;  1TWC K;  4MQ9 A;  5IYD K;  4A3M K;  4QIW L;  3HOW C;  5IP7 K;  4A3E K;  3CQZ K;  4YFN A;  5IYC C;  5IP9 K;  3S1N K;  1YNJ A;  3EQL A;  3S2D K;  3GTO K;  4A3I C;  2O5J A;  2CW0 A;  2PPB A;  5M5X K;  4G7H A;  1TWC C;  3S1R K;  1HQM A;  2Y0S D;  3S2D C;  3HOX C;  3HKZ D;  2NVX K;  3HOZ C;  2YU9 K;  2WAQ L;  4LJZ A;  3H0G K;  4YG2 A;  1Y1W K;  4C2M K;  4A3F C;  3GTP C;  3S1M K;  3H3V D;  4GZY A;  4LK1 A;  3PO3 C;  3I4M C;  2Y0S L;  3GTO C;  4MEX A;  3HKZ L;  3K7A K;  5FLM K;  4OIO A;  4XSZ A;  3HOW K;  4A3D C;  4C3I K;  5IYC K;  3H3V L;  2VUM C;  3HOV C;  2A6E A;  2JA6 C;  1K83 C;  2A69 A;  1SFO C;  4ZH4 A;  4Y52 K;  4KN4 A;  2PMZ D;  3S1M C;  4A3C C;  4BBR K;  3HOX K;  1I50 C;  1TWH C;  3HOZ K;  3K7A C;  5FLM C;  4KN7 A;  4A3F K;  3GTP K;  4MEY A;  4BXX C;  2PMZ L;  3PO3 K;  3I4M K;  4C3H K;  1SMY A;  2B63 K;  3S14 C;  4G7O A;  3GTQ C;  4A93 C;  2NVY C;  2R92 C;  4A3D K;  2BE5 A;  5IYB C;  4Y52 C;  2O5I A;  4JK1 A;  2VUM K;  3S2H C;  3HOV K;  4BBR C;  2JA6 K;  1K83 K;  1I3Q C;  1SFO K;  4BY7 C;  3S15 C;  4A3C K;  4A3J C;  3HOY C;  1I50 K;  1TWH K;  4A3B C;  2B63 C;  1Y1V K;  4Q4Z A;  5C4J C;  4AYB D;  2E2H C;  2E2J C;  5M3F K;  1TWA C;  1BDF A;  2JA7 C;  2R7Z C;  3RZO C;  4X6A C;  4Y7N C;  4XLN A;  3S14 K;  2NVT K;  3HOU K;  4A93 K;  2NVY K;  2R92 K;  2R93 K;  4AYB L;  4C3J K;  1IW7 A;  5IYB K;  3S1Q C;  2WB1 D;  5TMF A;  3S2H K;  4YFX A;  1ZYR A;  4NOI A;  5M5Y K;  2JA8 C;  1YNN A;  3GTG K;  3GTM C;  1Y1V C;  3S17 C;  1I3Q K;  2JA5 C;  5C4X C;  2PA8 D;  5C44 C;  4BY7 K;  3S15 K;  4OIN A;  2WB1 L;  4KMU A;  4QJV A;  4A3J K;  3HOY K;  3I4N K;  4A3B K;  5FJ8 K;  1TWF C;  2E2J K;  2NVT C;  5C4J K;  2JA7 K;  1XPP A;  2E2H K;  3HOU C;  1TWA K;  3M4O K;  4BXX K;  4XLP A;  2PA8 L;  4G7Z A;  2R7Z K;  3RZO K;  1I6H K;  4X6A K;  5M5W K;  4Y7N K;  3DXJ A;  4LK0 A;  3GTG C;  3RZD C;  3S1Q K;  1R9T C;  3GTL C;  4BY1 C;  3I4N C;  4LLG A;  2JA8 K;  3GTM K;  1TWG C;  5C4X K;  3S17 K;  2JA5 K;  3FKI C;  3M4O C;  5C44 K;  4BBS C;  1I6H C;  4XSX A;  4A3G C;  5D4D A;  1TWF K;  2A68 A;  4OIP A;  4YFK A;  3PO2 K;  3GTJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...