4Y52K

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y52K00
3HOZK 4OIPA 2NVTC 5C4XK 1YNNA 5D4DA 2YU9K 5FLMK 2PA8D 3K7AK 1SFOC 2PA8L 4XLPA 3HOZC 2JA7K 1I6HK 4Y52K 2R7ZC 2YU9C 4G7OA 4Y52C 5C3EC 5IYDK 4A3DK 4X6AC 3PO2C 3S14C 4QIWD 2E2HC 2B63K 4QIWL 5IYDC 3CQZK 3HOXK 5C4JK 4YFXA 4YFNA 4Y7NK 4BBRK 3DXJA 1I50K 4A3CC 3HOXC 3HOVC 5C4JC 2E2JK 4A3BK 4A3LK 4Q5SA 3RZDK 3S2HC 1I50C 1SMYA 2VUMC 5IP9K 3I4NK 4A3FK 1TWAC 3HOWK 3S17K 3WODA 3S1RK 3I4MC 4A3FC 4C3IK 3HKZD 2JA8K 3GTPC 4A3IC 3HOWC 3HKZL 5IYCC 4OIQA 3S17C 3GTKK 5FJ8K 2JA8C 2O5IA 4LK0A 3RZOK 1R9TK 1TWFC 3H0GC 3S1MK 3PO3K 4BY7C 4XSXA 1WCMK 3HOUC 3GTGC 4BBSC 1R9TC 4C2MK 4A93K 4XLNA 4A3MK 2R92K 5C4XC 1TWCK 5FLMC 3K7AC 1I6HC 4A3EK 1TWHK 5C44K 2JA7C 1TWCC 2E2IK 5IP7K 4A3DC 3S16K 2B63C 5IP7C 3CQZC 1Y1VK 4BY1K 2NVQK 4AYBD 4YG2A 2WB1D 4AYBL 4Y7NC 4G7ZA 2A68A 1HQMA 1Y1VC 2WB1L 3FKIK 4QJVB 2PMZD 4BBRC 2PMZL 5M3MK 2E2JC 4BY1C 3RZDC 4OIRA 3FKIC 1BDFA 3GTOK 3GTMK 4A3LC 5IP9C 2CW0A 3I4NC 2NVXK 3GTMC 3GTOC 3GTJK 1I3QK 4ZH4A 3S1RC 2JA6K 4YFKA 3S2DK 4A3JK 4A3KK 4NOIA 3GTKC 4JK1A 4KMUA 3RZOC 3GTQK 3PO3C 3S1MC 1Y1WK 1IW7A 1WCMC 3S15K 5M5XK 4A3MC 1Y1WC 1TWGK 3M4OK 3S15C 2JA5K 3GTLK 2R92C 5TMFA 3M4OC 3M3YK 3S1QK 4A3EC 1TWHC 5C44C 4A3GK 4BXXK 2BE5A 3HOYK 5M3FK 2E2IC 1K83K 4KN7A 4A3GC 3S16C 1ZYRA 2O5JA 4LJZA 4A3BC 2NVQC 4MEYA 5M5YK 5IYBK 4LK1A 1YNJA 4A93C 3H3VD 3H3VL 1SFOK 4QJVA 2NVXC 4MEXA 2R7ZK 3GTJC 1I3QC 2JA6C 5C3EK 3S2DC 4X6AK 4A3JC 4KN4A 2E2HK 3PO2K 3S14K 2WAQD 4A3KC 3S1NK 2WAQL 2R93K 3GTQC 3S1NC 5M5WK 5TMCA 4Q4ZA 2R93C 4A3CK 1XPPA 3HOVK 2PPBA 4OINA 4G7HA 1TWGC 3S2HK 2VUMK 2Y0SD 2JA5C 1TWAK 3GTLC 2Y0SL 4OIOA 3I4MK 3GTPK 3M3YC 2A6HA 3S1QC 1I6VA 4A3IK 5IYCK 4C3JK 4C3HK 4BXXC 3HOYC 4GZYA 2NVYK 4BY7K 1K83C 1TWFK 3H0GK 2A69A 3EQLA 4MQ9A 3HOUK 2NVYC 4BBSK 3GTGK 2A6EA 5IYBC 2NVTK 4LLGA 4XSZA
chains in the Genus database with same CATH superfamily
4GTAA 5D4DA 2ZUEA 4M1XA 1SFOC 4Y52K 3GTKA 1VJEA 3A8IA 4Y52C 2E2HC 2B63K 4QIWL 2CFAB 3HOVC 1F9NA 1TWCA 4A3LK 4A3BK 4Q5SA 1SMYA 1XXAA 1TWHA 5IP9K 3I4NK 3WODA 2ZFZA 3S1RK 4XCHA 4RMFA 4C3IK 4OIQA 3GTKK 3RZOK 2O5IA 4LK0A 3PO3K 3GDZA 3FKIA 1J6VA 4KMDA 1WIHA 1O28A 3GTMA 4XLNA 5CHPA 3SZZA 1I3QA 1TWCK 5FLMC 2EBBA 1TWHK 1TWCC 1Y1WA 1JQWA 2R92A 4BLAA 1IBAA 2WB1D 4YG2A 1G51A 2A68A 3FKIK 3N0CA 4ILDA 4BBRC 1L0WA 3RZDC 3GTMK 3FKIC 1XZQB 1ZVUA 2V6TA 3GTMC 3GTJK 1I3QK 4KDDA 4A3KK 4NOIA 2GSNA 4KMUA 1Y1WK 4GTBA 1WCMC 1Y1WC 4J3NA 2R7ZA 2R92C 1DCPA 3G4AA 4GTCA 4A3EC 5C44C 1EK8A 2BE5A 5M3FK 3S16C 4DDQA 4LJZA 1O24A 3GTLA 4MEYA 5M5YK 3FOEA 3AH5A 2R7ZK 3H0GA 1O29A 3S2DC 4X6AK 4A3JC 1B4AA 1XXCA 4G0WA 1YX2A 3LAPA 3OEPA 4Q4ZA 4A3CK 2PPBA 2YU9A 3BP8C 3S2HK 1USOA 3SZYA 2Y0SD 2Y3PA 3A8JA 2JA5C 3GTLC 1ZBSA 1X31C 2A6HA 1I6VA 5IYCK 3CQZA 3AD8C 4GTLA 4BY7K 4FZBA 3H0GK 4MQ9A 2GSOA 4BBSK 1TWAA 2RGRA 4KATA 3GTPA 4XSZA 3IPJA 5JFEA 1YNNA 2YU9K 3AQPA 4BLBA 1I6HK 3G4CA 2YU9C 2V6UA 3N0BA 5C3EC 3S14C 4WJ3M 3CQZK 5C4JK 1PJ5A 4Y7NK 5C4JC 1WOSA 2E2JK 1TWAC 3S17K 3GTPC 1O26A 3S17C 1ZQ1C 3T02A 3OPFA 4WJ4A 3S1MK 4KMHA 4A3MK 3TFHA 5JVOA 2JA6A 1DCOA 1EQRA 3MMLB 3GTQA 1C0AA 2B63C 2FQTA 4BY1K 3NUHA 2WB1L 4LOWA 2PMZD 4BY1C 4A93K 5CJ9A 4OIRA 4A3BC 4A3LC 2KWAA 1BDFA 4KASA 5IP9C 2CFAA 1HI9A 2CW0A 3I4NC 2NVXK 4LQYA 1K83A 3S1RC 2JA6K 4YFKA 4C3IC 3GTKC 4JK1A 3RZOC 3GTQK 3PO3C 1IW7A 3S15K 5M5XK 3GTJA 1TWGK 3S15C 1WQFA 3GSIA 3M3YK 3S1QK 1TWHC 2R93A 4BXXK 1K83K 5EGEA 3OREA 1ZYRA 2O5JA 1V5VA 5IYBK 2VUMA 1YNJA 3A8KA 4O2DA 2GSUA 5E68A 3H3VD 3Q3QA 1VGXA 4MEXA 3GTJC 1I3QC 1TWFA 1IQ0A 1XZQA 3PO2K 3S1NK 3GTGA 4A3KC 1RU0A 1PJ7A 2R93K 3S1NC 5M5WK 3QX3A 2R93C 1WSRA 4G0VA 4OINA 4G7HA 1EI6A 2VUMK 2JA7A 2PHCB 2Y0SL 3T00A 4OIOA 4KMAA 1O2BA 3I4MK 1UV7A 4A3IK 4P9SA 4C3HK 4C3JK 1XZPB 4GZYA 1TWFK 3EQLA 1I50A 1VLOA 3HOUK 3GTGK 2NVTK 4PABA 4KM9A 3HOZK 2NVTC 4KB4A 5C4XK 1J98A 1BS2A 2PA8D 3K7AK 5TJ3A 1O2FB 4XLPA 3HOZC 3N3YA 2JA7K 2R7ZC 4GTEA 5IYDK 2XCQA 4A3DK 4X6AC 5IYDC 3GEHA 3HOXK 1JVIA 4YFNA 1BGWA 1I50K 4A3CC 3HOXC 1PJ6A 3S2HC 1I50C 1ZXOA 3HOWK 3ERED 4KM8A 5HL8A 3TTGA 3HKZD 2JA8K 3HOWC 3L4JA 5IYCC 2D6FC 1Y1VA 2JA8C 4BY7C 3H0GC 4XSXA 4BBSC 4C2MK 3GTOA 4PAAA 3V4GA 1JOEA 1I6HC 1WSVA 4KAWX 2E2IK 4GTFA 2FQOA 1YCLA 3CQZC 1Y1VK 2NVQK 4AYBD 1WQGA 4G7ZA 4Y7NC 5M3MK 1HQMA 1Y1VC 4QJVB 2E2JC 2PMZL 3FOFA 3GTOK 1J6WA 1BJTA 4GT9A 3GTOC 4ZH4A 4C45A 3S1MC 1WOPA 2NVXA 4A3MC 3M4OK 5TMFA 3M4OC 2E2HA 3HOYK 4KN7A 1TWGA 3CAGA 4LR2A 1F93A 1WQHA 4LK1A 2GAHC 4A93C 1IS1A 3H3VL 2JH3A 2XCRB 1SFOK 5IOSA 2NVXC 3GEIA 2JA6C 1GE9A 2E2HK 2WAQD 1DD5A 3GTQC 1EFWA 1XPPA 3HOVK 1TWGC 2P8TA 4GTDA 3M3YC 3S1QC 4BXXC 1O27A 3BUEA 1K83C 1VH2A 2A69A 3VA7A 1XXBA 4P5AA 2ZUFA 3LPXA 2A6EA 5IYBC 1EH1A 1AB4A 4KARA 1WOOA 4OIPA 1KQ4A 2RH6A 5FLMK 2PA8L 3GEEA 4G7OA 1R9TA 4WILA 3PO2C 1WCMA 4QIWD 2W7VA 4YFXA 4BBRK 3DXJA 3AQOA 3RZDK 4G0UA 2VUMC 4A3FK 3AD9C 5EGHA 4A3FC 3I4MC 4A3IC 3HKZL 4C3JC 4C3HC 5FJ8K 1R9TK 1TWFC 1VRQC 3HOUC 1WCMK 1XZPA 5L46A 3GTGC 1R9TC 1ISEA 1O2AA 2R92K 5C4XC 3K7AC 4AH6A 4A3EK 5C44K 2JA7C 2GAGC 5IP7K 4A3DC 4KC6A 3S16K 5IP7C 1F7VA 4AYBL 2JA5A 1B4BA 2XCOA 2E2IA 5IOTA 3S0XA 1INNA 1WORA 3S2DK 4KB2A 3JSTA 4A3JK 4C2MC 3LAJA 5IORA 3FHZA 1O25A 3HXAA 5IOQA 2JA5K 3GTLK 2V6SA 4A3GK 3T01A 1F7UA 1DCHA 2E2IC 4A3GC 1IE0A 1J6XA 2NVQC 3L4KA 3TFJA 4QJVA 4GFQA 2NVYA 5C3EK 3S14K 4KN4A 3BP3A 1USMA 4P5BA 2WAQL 1IL2A 2P5MA 5TMCA 4FM9A 1SFOA 4BKWA 1TWAK 3GIRA 3AD7C 3GTPK 2B63A 3ADAC 3HOYC 2NVYK 2NVYC 3TFIA 4LLGA
chains in the Genus database with same CATH topology
3HOZK 4OIPA 2NVTC 5C4XK 1YNNA 5D4DA 2YU9K 5FLMK 2PA8D 3K7AK 1SFOC 2PA8L 4XLPA 3HOZC 2JA7K 1I6HK 4Y52K 2R7ZC 2YU9C 4G7OA 4Y52C 5C3EC 5IYDK 4A3DK 4X6AC 3PO2C 3S14C 4QIWD 2E2HC 2B63K 4QIWL 5IYDC 3CQZK 3HOXK 5C4JK 4YFXA 4YFNA 4Y7NK 4BBRK 3DXJA 1I50K 4A3CC 3HOXC 3HOVC 5C4JC 2E2JK 4A3BK 4A3LK 4Q5SA 3RZDK 3S2HC 1I50C 1SMYA 2VUMC 5IP9K 3I4NK 4A3FK 1TWAC 3HOWK 3S17K 3WODA 3S1RK 3I4MC 4A3FC 4C3IK 3HKZD 2JA8K 3GTPC 4A3IC 3HOWC 3HKZL 5IYCC 4OIQA 3S17C 3GTKK 5FJ8K 2JA8C 2O5IA 4LK0A 3RZOK 1R9TK 1TWFC 3H0GC 3S1MK 3PO3K 4BY7C 4XSXA 1WCMK 3HOUC 3GTGC 4BBSC 1R9TC 4C2MK 4A93K 4XLNA 4A3MK 2R92K 5C4XC 1TWCK 5FLMC 3K7AC 1I6HC 4A3EK 1TWHK 5C44K 2JA7C 1TWCC 2E2IK 5IP7K 4A3DC 3S16K 2B63C 5IP7C 3CQZC 1Y1VK 4BY1K 2NVQK 4AYBD 4YG2A 2WB1D 4AYBL 4Y7NC 4G7ZA 2A68A 1HQMA 1Y1VC 2WB1L 3FKIK 4QJVB 2PMZD 4BBRC 2PMZL 5M3MK 2E2JC 4BY1C 3RZDC 4OIRA 3FKIC 1BDFA 3GTOK 3GTMK 4A3LC 5IP9C 2CW0A 3I4NC 2NVXK 3GTMC 3GTOC 3GTJK 1I3QK 4ZH4A 3S1RC 2JA6K 4YFKA 3S2DK 4A3JK 4A3KK 4NOIA 3GTKC 4JK1A 4KMUA 3RZOC 3GTQK 3PO3C 3S1MC 1Y1WK 1IW7A 1WCMC 3S15K 5M5XK 4A3MC 1Y1WC 1TWGK 3M4OK 3S15C 2JA5K 3GTLK 2R92C 5TMFA 3M4OC 3M3YK 3S1QK 4A3EC 1TWHC 5C44C 4A3GK 4BXXK 2BE5A 3HOYK 5M3FK 2E2IC 1K83K 4KN7A 4A3GC 3S16C 1ZYRA 2O5JA 4LJZA 4A3BC 2NVQC 4MEYA 5M5YK 5IYBK 4LK1A 1YNJA 4A93C 3H3VD 3H3VL 1SFOK 4QJVA 2NVXC 4MEXA 2R7ZK 3GTJC 1I3QC 2JA6C 5C3EK 3S2DC 4X6AK 4A3JC 4KN4A 2E2HK 3PO2K 3S14K 2WAQD 4A3KC 3S1NK 2WAQL 2R93K 3GTQC 3S1NC 5M5WK 5TMCA 4Q4ZA 2R93C 4A3CK 1XPPA 3HOVK 2PPBA 4OINA 4G7HA 1TWGC 3S2HK 2VUMK 2Y0SD 2JA5C 1TWAK 3GTLC 2Y0SL 4OIOA 3I4MK 3GTPK 3M3YC 2A6HA 3S1QC 1I6VA 4A3IK 5IYCK 4C3JK 4C3HK 4BXXC 3HOYC 4GZYA 2NVYK 4BY7K 1K83C 1TWFK 3H0GK 2A69A 3EQLA 4MQ9A 3HOUK 2NVYC 4BBSK 3GTGK 2A6EA 5IYBC 2NVTK 4LLGA 4XSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ K;  4OIP A;  2NVT C;  5C4X K;  1YNN A;  5D4D A;  2YU9 K;  5FLM K;  2PA8 D;  3K7A K;  1SFO C;  2PA8 L;  4XLP A;  3HOZ C;  2JA7 K;  1I6H K;  4Y52 K;  2R7Z C;  2YU9 C;  4G7O A;  4Y52 C;  5C3E C;  5IYD K;  4A3D K;  4X6A C;  3PO2 C;  3S14 C;  4QIW D;  2E2H C;  2B63 K;  4QIW L;  5IYD C;  3CQZ K;  3HOX K;  5C4J K;  4YFX A;  4YFN A;  4Y7N K;  4BBR K;  3DXJ A;  1I50 K;  4A3C C;  3HOX C;  3HOV C;  5C4J C;  2E2J K;  4A3B K;  4A3L K;  4Q5S A;  3RZD K;  3S2H C;  1I50 C;  1SMY A;  2VUM C;  5IP9 K;  3I4N K;  4A3F K;  1TWA C;  3HOW K;  3S17 K;  3WOD A;  3S1R K;  3I4M C;  4A3F C;  4C3I K;  3HKZ D;  2JA8 K;  3GTP C;  4A3I C;  3HOW C;  3HKZ L;  5IYC C;  4OIQ A;  3S17 C;  3GTK K;  5FJ8 K;  2JA8 C;  2O5I A;  4LK0 A;  3RZO K;  1R9T K;  1TWF C;  3H0G C;  3S1M K;  3PO3 K;  4BY7 C;  4XSX A;  1WCM K;  3HOU C;  3GTG C;  4BBS C;  1R9T C;  4C2M K;  4A93 K;  4XLN A;  4A3M K;  2R92 K;  5C4X C;  1TWC K;  5FLM C;  3K7A C;  1I6H C;  4A3E K;  1TWH K;  5C44 K;  2JA7 C;  1TWC C;  2E2I K;  5IP7 K;  4A3D C;  3S16 K;  2B63 C;  5IP7 C;  3CQZ C;  1Y1V K;  4BY1 K;  2NVQ K;  4AYB D;  4YG2 A;  2WB1 D;  4AYB L;  4Y7N C;  4G7Z A;  2A68 A;  1HQM A;  1Y1V C;  2WB1 L;  3FKI K;  4QJV B;  2PMZ D;  4BBR C;  2PMZ L;  5M3M K;  2E2J C;  4BY1 C;  3RZD C;  4OIR A;  3FKI C;  1BDF A;  3GTO K;  3GTM K;  4A3L C;  5IP9 C;  2CW0 A;  3I4N C;  2NVX K;  3GTM C;  3GTO C;  3GTJ K;  1I3Q K;  4ZH4 A;  3S1R C;  2JA6 K;  4YFK A;  3S2D K;  4A3J K;  4A3K K;  4NOI A;  3GTK C;  4JK1 A;  4KMU A;  3RZO C;  3GTQ K;  3PO3 C;  3S1M C;  1Y1W K;  1IW7 A;  1WCM C;  3S15 K;  5M5X K;  4A3M C;  1Y1W C;  1TWG K;  3M4O K;  3S15 C;  2JA5 K;  3GTL K;  2R92 C;  5TMF A;  3M4O C;  3M3Y K;  3S1Q K;  4A3E C;  1TWH C;  5C44 C;  4A3G K;  4BXX K;  2BE5 A;  3HOY K;  5M3F K;  2E2I C;  1K83 K;  4KN7 A;  4A3G C;  3S16 C;  1ZYR A;  2O5J A;  4LJZ A;  4A3B C;  2NVQ C;  4MEY A;  5M5Y K;  5IYB K;  4LK1 A;  1YNJ A;  4A93 C;  3H3V D;  3H3V L;  1SFO K;  4QJV A;  2NVX C;  4MEX A;  2R7Z K;  3GTJ C;  1I3Q C;  2JA6 C;  5C3E K;  3S2D C;  4X6A K;  4A3J C;  4KN4 A;  2E2H K;  3PO2 K;  3S14 K;  2WAQ D;  4A3K C;  3S1N K;  2WAQ L;  2R93 K;  3GTQ C;  3S1N C;  5M5W K;  5TMC A;  4Q4Z A;  2R93 C;  4A3C K;  1XPP A;  3HOV K;  2PPB A;  4OIN A;  4G7H A;  1TWG C;  3S2H K;  2VUM K;  2Y0S D;  2JA5 C;  1TWA K;  3GTL C;  2Y0S L;  4OIO A;  3I4M K;  3GTP K;  3M3Y C;  2A6H A;  3S1Q C;  1I6V A;  4A3I K;  5IYC K;  4C3J K;  4C3H K;  4BXX C;  3HOY C;  4GZY A;  2NVY K;  4BY7 K;  1K83 C;  1TWF K;  3H0G K;  2A69 A;  3EQL A;  4MQ9 A;  3HOU K;  2NVY C;  4BBS K;  3GTG K;  2A6E A;  5IYB C;  2NVT K;  4LLG A;  4XSZ A; 
#chains in the Genus database with same CATH topology
 4GTA A;  5D4D A;  2ZUE A;  4M1X A;  1SFO C;  4Y52 K;  3GTK A;  1VJE A;  3A8I A;  4Y52 C;  2E2H C;  2B63 K;  4QIW L;  2CFA B;  3HOV C;  1F9N A;  1TWC A;  4A3L K;  4A3B K;  4Q5S A;  1SMY A;  1XXA A;  1TWH A;  5IP9 K;  3I4N K;  3WOD A;  2ZFZ A;  3S1R K;  4XCH A;  4RMF A;  4C3I K;  4OIQ A;  3GTK K;  3RZO K;  2O5I A;  4LK0 A;  3PO3 K;  3GDZ A;  3FKI A;  1J6V A;  4KMD A;  1WIH A;  1O28 A;  3GTM A;  4XLN A;  5CHP A;  3SZZ A;  1I3Q A;  1TWC K;  5FLM C;  2EBB A;  1TWH K;  1TWC C;  1Y1W A;  1JQW A;  2R92 A;  4BLA A;  1IBA A;  2WB1 D;  4YG2 A;  1G51 A;  2A68 A;  3FKI K;  3N0C A;  4ILD A;  4BBR C;  1L0W A;  3RZD C;  3GTM K;  3FKI C;  1XZQ B;  1ZVU A;  2V6T A;  3GTM C;  3GTJ K;  1I3Q K;  4KDD A;  4A3K K;  4NOI A;  2GSN A;  4KMU A;  1Y1W K;  4GTB A;  1WCM C;  1Y1W C;  4J3N A;  2R7Z A;  2R92 C;  1DCP A;  3G4A A;  4GTC A;  4A3E C;  5C44 C;  1EK8 A;  2BE5 A;  5M3F K;  3S16 C;  4DDQ A;  4LJZ A;  1O24 A;  3GTL A;  4MEY A;  5M5Y K;  3FOE A;  3AH5 A;  2R7Z K;  3H0G A;  1O29 A;  3S2D C;  4X6A K;  4A3J C;  1B4A A;  1XXC A;  4G0W A;  1YX2 A;  3LAP A;  3OEP A;  4Q4Z A;  4A3C K;  2PPB A;  2YU9 A;  3BP8 C;  3S2H K;  1USO A;  3SZY A;  2Y0S D;  2Y3P A;  3A8J A;  2JA5 C;  3GTL C;  1ZBS A;  1X31 C;  2A6H A;  1I6V A;  5IYC K;  3CQZ A;  3AD8 C;  4GTL A;  4BY7 K;  4FZB A;  3H0G K;  4MQ9 A;  2GSO A;  4BBS K;  1TWA A;  2RGR A;  4KAT A;  3GTP A;  4XSZ A;  3IPJ A;  5JFE A;  1YNN A;  2YU9 K;  3AQP A;  4BLB A;  1I6H K;  3G4C A;  2YU9 C;  2V6U A;  3N0B A;  5C3E C;  3S14 C;  4WJ3 M;  3CQZ K;  5C4J K;  1PJ5 A;  4Y7N K;  5C4J C;  1WOS A;  2E2J K;  1TWA C;  3S17 K;  3GTP C;  1O26 A;  3S17 C;  1ZQ1 C;  3T02 A;  3OPF A;  4WJ4 A;  3S1M K;  4KMH A;  4A3M K;  3TFH A;  5JVO A;  2JA6 A;  1DCO A;  1EQR A;  3MML B;  3GTQ A;  1C0A A;  2B63 C;  2FQT A;  4BY1 K;  3NUH A;  2WB1 L;  4LOW A;  2PMZ D;  4BY1 C;  4A93 K;  5CJ9 A;  4OIR A;  4A3B C;  4A3L C;  2KWA A;  1BDF A;  4KAS A;  5IP9 C;  2CFA A;  1HI9 A;  2CW0 A;  3I4N C;  2NVX K;  4LQY A;  1K83 A;  3S1R C;  2JA6 K;  4YFK A;  4C3I C;  3GTK C;  4JK1 A;  3RZO C;  3GTQ K;  3PO3 C;  1IW7 A;  3S15 K;  5M5X K;  3GTJ A;  1TWG K;  3S15 C;  1WQF A;  3GSI A;  3M3Y K;  3S1Q K;  1TWH C;  2R93 A;  4BXX K;  1K83 K;  5EGE A;  3ORE A;  1ZYR A;  2O5J A;  1V5V A;  5IYB K;  2VUM A;  1YNJ A;  3A8K A;  4O2D A;  2GSU A;  5E68 A;  3H3V D;  3Q3Q A;  1VGX A;  4MEX A;  3GTJ C;  1I3Q C;  1TWF A;  1IQ0 A;  1XZQ A;  3PO2 K;  3S1N K;  3GTG A;  4A3K C;  1RU0 A;  1PJ7 A;  2R93 K;  3S1N C;  5M5W K;  3QX3 A;  2R93 C;  1WSR A;  4G0V A;  4OIN A;  4G7H A;  1EI6 A;  2VUM K;  2JA7 A;  2PHC B;  2Y0S L;  3T00 A;  4OIO A;  4KMA A;  1O2B A;  3I4M K;  1UV7 A;  4A3I K;  4P9S A;  4C3H K;  4C3J K;  1XZP B;  4GZY A;  1TWF K;  3EQL A;  1I50 A;  1VLO A;  3HOU K;  3GTG K;  2NVT K;  4PAB A;  4KM9 A;  3HOZ K;  2NVT C;  4KB4 A;  5C4X K;  1J98 A;  1BS2 A;  2PA8 D;  3K7A K;  5TJ3 A;  1O2F B;  4XLP A;  3HOZ C;  3N3Y A;  2JA7 K;  2R7Z C;  4GTE A;  5IYD K;  2XCQ A;  4A3D K;  4X6A C;  5IYD C;  3GEH A;  3HOX K;  1JVI A;  4YFN A;  1BGW A;  1I50 K;  4A3C C;  3HOX C;  1PJ6 A;  3S2H C;  1I50 C;  1ZXO A;  3HOW K;  3ERE D;  4KM8 A;  5HL8 A;  3TTG A;  3HKZ D;  2JA8 K;  3HOW C;  3L4J A;  5IYC C;  2D6F C;  1Y1V A;  2JA8 C;  4BY7 C;  3H0G C;  4XSX A;  4BBS C;  4C2M K;  3GTO A;  4PAA A;  3V4G A;  1JOE A;  1I6H C;  1WSV A;  4KAW X;  2E2I K;  4GTF A;  2FQO A;  1YCL A;  3CQZ C;  1Y1V K;  2NVQ K;  4AYB D;  1WQG A;  4G7Z A;  4Y7N C;  5M3M K;  1HQM A;  1Y1V C;  4QJV B;  2E2J C;  2PMZ L;  3FOF A;  3GTO K;  1J6W A;  1BJT A;  4GT9 A;  3GTO C;  4ZH4 A;  4C45 A;  3S1M C;  1WOP A;  2NVX A;  4A3M C;  3M4O K;  5TMF A;  3M4O C;  2E2H A;  3HOY K;  4KN7 A;  1TWG A;  3CAG A;  4LR2 A;  1F93 A;  1WQH A;  4LK1 A;  2GAH C;  4A93 C;  1IS1 A;  3H3V L;  2JH3 A;  2XCR B;  1SFO K;  5IOS A;  2NVX C;  3GEI A;  2JA6 C;  1GE9 A;  2E2H K;  2WAQ D;  1DD5 A;  3GTQ C;  1EFW A;  1XPP A;  3HOV K;  1TWG C;  2P8T A;  4GTD A;  3M3Y C;  3S1Q C;  4BXX C;  1O27 A;  3BUE A;  1K83 C;  1VH2 A;  2A69 A;  3VA7 A;  1XXB A;  4P5A A;  2ZUF A;  3LPX A;  2A6E A;  5IYB C;  1EH1 A;  1AB4 A;  4KAR A;  1WOO A;  4OIP A;  1KQ4 A;  2RH6 A;  5FLM K;  2PA8 L;  3GEE A;  4G7O A;  1R9T A;  4WIL A;  3PO2 C;  1WCM A;  4QIW D;  2W7V A;  4YFX A;  4BBR K;  3DXJ A;  3AQO A;  3RZD K;  4G0U A;  2VUM C;  4A3F K;  3AD9 C;  5EGH A;  4A3F C;  3I4M C;  4A3I C;  3HKZ L;  4C3J C;  4C3H C;  5FJ8 K;  1R9T K;  1TWF C;  1VRQ C;  3HOU C;  1WCM K;  1XZP A;  5L46 A;  3GTG C;  1R9T C;  1ISE A;  1O2A A;  2R92 K;  5C4X C;  3K7A C;  4AH6 A;  4A3E K;  5C44 K;  2JA7 C;  2GAG C;  5IP7 K;  4A3D C;  4KC6 A;  3S16 K;  5IP7 C;  1F7V A;  4AYB L;  2JA5 A;  1B4B A;  2XCO A;  2E2I A;  5IOT A;  3S0X A;  1INN A;  1WOR A;  3S2D K;  4KB2 A;  3JST A;  4A3J K;  4C2M C;  3LAJ A;  5IOR A;  3FHZ A;  1O25 A;  3HXA A;  5IOQ A;  2JA5 K;  3GTL K;  2V6S A;  4A3G K;  3T01 A;  1F7U A;  1DCH A;  2E2I C;  4A3G C;  1IE0 A;  1J6X A;  2NVQ C;  3L4K A;  3TFJ A;  4QJV A;  4GFQ A;  2NVY A;  5C3E K;  3S14 K;  4KN4 A;  3BP3 A;  1USM A;  4P5B A;  2WAQ L;  1IL2 A;  2P5M A;  5TMC A;  4FM9 A;  1SFO A;  4BKW A;  1TWA K;  3GIR A;  3AD7 C;  3GTP K;  2B63 A;  3ADA C;  3HOY C;  2NVY K;  2NVY C;  3TFI A;  4LLG A; 
#chains in the Genus database with same CATH homology
 3HOZ K;  4OIP A;  2NVT C;  5C4X K;  1YNN A;  5D4D A;  2YU9 K;  5FLM K;  2PA8 D;  3K7A K;  1SFO C;  2PA8 L;  4XLP A;  3HOZ C;  2JA7 K;  1I6H K;  4Y52 K;  2R7Z C;  2YU9 C;  4G7O A;  4Y52 C;  5C3E C;  5IYD K;  4A3D K;  4X6A C;  3PO2 C;  3S14 C;  4QIW D;  2E2H C;  2B63 K;  4QIW L;  5IYD C;  3CQZ K;  3HOX K;  5C4J K;  4YFX A;  4YFN A;  4Y7N K;  4BBR K;  3DXJ A;  1I50 K;  4A3C C;  3HOX C;  3HOV C;  5C4J C;  2E2J K;  4A3B K;  4A3L K;  4Q5S A;  3RZD K;  3S2H C;  1I50 C;  1SMY A;  2VUM C;  5IP9 K;  3I4N K;  4A3F K;  1TWA C;  3HOW K;  3S17 K;  3WOD A;  3S1R K;  3I4M C;  4A3F C;  4C3I K;  3HKZ D;  2JA8 K;  3GTP C;  4A3I C;  3HOW C;  3HKZ L;  5IYC C;  4OIQ A;  3S17 C;  3GTK K;  5FJ8 K;  2JA8 C;  2O5I A;  4LK0 A;  3RZO K;  1R9T K;  1TWF C;  3H0G C;  3S1M K;  3PO3 K;  4BY7 C;  4XSX A;  1WCM K;  3HOU C;  3GTG C;  4BBS C;  1R9T C;  4C2M K;  4A93 K;  4XLN A;  4A3M K;  2R92 K;  5C4X C;  1TWC K;  5FLM C;  3K7A C;  1I6H C;  4A3E K;  1TWH K;  5C44 K;  2JA7 C;  1TWC C;  2E2I K;  5IP7 K;  4A3D C;  3S16 K;  2B63 C;  5IP7 C;  3CQZ C;  1Y1V K;  4BY1 K;  2NVQ K;  4AYB D;  4YG2 A;  2WB1 D;  4AYB L;  4Y7N C;  4G7Z A;  2A68 A;  1HQM A;  1Y1V C;  2WB1 L;  3FKI K;  4QJV B;  2PMZ D;  4BBR C;  2PMZ L;  5M3M K;  2E2J C;  4BY1 C;  3RZD C;  4OIR A;  3FKI C;  1BDF A;  3GTO K;  3GTM K;  4A3L C;  5IP9 C;  2CW0 A;  3I4N C;  2NVX K;  3GTM C;  3GTO C;  3GTJ K;  1I3Q K;  4ZH4 A;  3S1R C;  2JA6 K;  4YFK A;  3S2D K;  4A3J K;  4A3K K;  4NOI A;  3GTK C;  4JK1 A;  4KMU A;  3RZO C;  3GTQ K;  3PO3 C;  3S1M C;  1Y1W K;  1IW7 A;  1WCM C;  3S15 K;  5M5X K;  4A3M C;  1Y1W C;  1TWG K;  3M4O K;  3S15 C;  2JA5 K;  3GTL K;  2R92 C;  5TMF A;  3M4O C;  3M3Y K;  3S1Q K;  4A3E C;  1TWH C;  5C44 C;  4A3G K;  4BXX K;  2BE5 A;  3HOY K;  5M3F K;  2E2I C;  1K83 K;  4KN7 A;  4A3G C;  3S16 C;  1ZYR A;  2O5J A;  4LJZ A;  4A3B C;  2NVQ C;  4MEY A;  5M5Y K;  5IYB K;  4LK1 A;  1YNJ A;  4A93 C;  3H3V D;  3H3V L;  1SFO K;  4QJV A;  2NVX C;  4MEX A;  2R7Z K;  3GTJ C;  1I3Q C;  2JA6 C;  5C3E K;  3S2D C;  4X6A K;  4A3J C;  4KN4 A;  2E2H K;  3PO2 K;  3S14 K;  2WAQ D;  4A3K C;  3S1N K;  2WAQ L;  2R93 K;  3GTQ C;  3S1N C;  5M5W K;  5TMC A;  4Q4Z A;  2R93 C;  4A3C K;  1XPP A;  3HOV K;  2PPB A;  4OIN A;  4G7H A;  1TWG C;  3S2H K;  2VUM K;  2Y0S D;  2JA5 C;  1TWA K;  3GTL C;  2Y0S L;  4OIO A;  3I4M K;  3GTP K;  3M3Y C;  2A6H A;  3S1Q C;  1I6V A;  4A3I K;  5IYC K;  4C3J K;  4C3H K;  4BXX C;  3HOY C;  4GZY A;  2NVY K;  4BY7 K;  1K83 C;  1TWF K;  3H0G K;  2A69 A;  3EQL A;  4MQ9 A;  3HOU K;  2NVY C;  4BBS K;  3GTG K;  2A6E A;  5IYB C;  2NVT K;  4LLG A;  4XSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...