4Y52K

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y52K00
1TWCK 2NVYC 5M5WK 2NVQK 3GTPK 4OIRA 2NVTK 4OINA 3GTGK 5C44C 4LLGA 2JA8C 4A3IC 5C4XK 5FLMK 1SFOC 3HOUK 1I3QK 3FKIK 5IP9C 5IP7C 4YG2A 4BY7K 4LK1A 1R9TK 3HOZK 3HOVK 4BXXK 2JA7K 2NVQC 3GTPC 2E2IK 3PO2C 4MQ9A 4KMUA 4G7HA 1TWAK 1TWFK 4AYBD 4XLNA 5C44K 2Y0SL 2JA8K 1HQMA 3HOXK 3GTLC 1Y1VK 1YNJA 2E2HK 3CQZK 4XLPA 4A93C 4ZH4A 5IYCC 3GTKK 3GTMC 4A3GC 4A3JC 3GTQC 3S2DC 4A3LC 2E2JC 3HOYK 2NVXC 2R93C 1SMYA 3S1NK 4A3DC 4QJVB 5M5XK 3M3YC 3K7AC 4A3KC 5C4JC 2A6EA 2WB1L 3H3VD 1TWGK 3PO3C 3S1QC 4QJVA 2CW0A 1I50C 2A6HA 2WB1D 3H3VL 2R7ZK 4A3CK 2YU9C 1I6VA 3HOWC 3M4OK 4BBSK 3H0GC 3S2HC 3RZDC 1YNNA 5IYBC 1BDFA 2JA6K 3GTOC 2VUMK 3HKZD 5M3FK 4Y52K 3S1RK 2R92C 3S17K 3S16K 1Y1WC 4BBRC 3K7AK 4A3EC 4A3KK 4A3MC 2JA5K 2B63C 3DXJA 5IYDK 5C3EK 5D4DA 3RZOK 4JK1A 4A3LK 1WCMK 1IW7A 1K83K 4MEXA 4YFXA 1TWHC 3RZDK 3HOZC 2PMZD 4BY7C 3HOXC 3S14C 4C2MK 1TWAC 1TWFC 4XSZA 2E2IC 3HOUC 3PO2K 2WAQD 3GTLK 1ZYRA 1Y1VC 5M3MK 4LK0A 3I4NC 2Y0SD 4XSXA 5IYCK 2JA7C 3HOVC 1WCMC 1R9TC 4BY1C 2E2HC 2PPBA 5C4XC 3GTJC 1SFOK 4YFNA 3GTMK 3S1MK 5FJ8K 2BE5A 3FKIC 5IP9K 4A3MK 2JA5C 4A93K 3I4MK 4A3IK 1XPPA 2PA8D 4Y7NK 3S1RC 1K83C 4QIWL 4G7ZA 1TWHK 4BXXC 1TWCC 4Q4ZA 2NVYK 4BBSC 3S14K 3EQLA 5TMCA 4KN7A 2WAQL 5FLMC 4OIQA 3S15K 5IP7K 2JA6C 4A3BC 4G7OA 3GTGC 5C3EC 1I3QC 3S1QK 4A3FK 4C3JK 4BBRK 2PMZL 4A3EK 2R92K 3S17C 3S16C 4X6AC 5IYDC 4C3IK 2R93K 4C3HK 5M5YK 5IYBK 2NVTC 1Y1WK 3S2HK 4Q5SA 2VUMC 3GTKC 4KN4A 4Y52C 3RZOC 2E2JK 3HOYC 4GZYA 1I6HC 3WODA 3PO3K 2B63K 1TWGC 2O5IA 3HKZL 4A3JK 3HOWK 4MEYA 4OIOA 2A68A 2R7ZC 2O5JA 3S1NC 4A3DK 4X6AK 2NVXK 4OIPA 3GTOK 3S1MC 3M3YK 3GTQK 3S2DK 3S15C 3M4OC 4QIWD 4A3BK 3GTJK 5TMFA 3I4MC 1I50K 4BY1K 4A3CC 2PA8L 4AYBL 4A3FC 4LJZA 4NOIA 3I4NK 1I6HK 3CQZC 3H0GK 4YFKA 5C4JK 4Y7NC 2YU9K 4A3GK 2A69A
chains in the Genus database with same CATH superfamily
2V6SA 3AD7C 4A3IC 1VH2A 3AH5A 2GSUA 3FKIK 5IP9C 2RGRA 1G51A 3OREA 3HXAA 2JA7K 2NVQC 3GTPC 3PO2C 3BUEA 2KWAA 1EK8A 4KMUA 1YNJA 1TWHA 1YX2A 3CQZK 4XLPA 5IYCC 3GTKK 3GTMC 2GAGC 3GTQC 1VJEA 2E2JC 4KATA 4GTAA 3JSTA 2FQOA 1I50A 4A3DC 1EH1A 1VGXA 2WB1L 3H3VD 2CFAA 4A3CK 2WB1D 3H3VL 2YU9C 1YNNA 1BDFA 3GTOC 2VUMK 5M3FK 2NVYA 4C3JC 1Y1WC 4BBRC 3K7AK 5C3EK 5IORA 2E2HA 5D4DA 2E2IA 4JK1A 1K83K 4MEXA 4YFXA 1TWHC 3RZDK 2PMZD 4C3HC 3TTGA 4P9SA 4M1XA 2WAQD 5TJ3A 1K83A 1B4BA 4LK0A 3G4AA 3HOVC 4XSXA 1JVIA 1J6XA 1R9TC 3GTJC 3GTMK 1XPPA 1INNA 1F7UA 4QIWL 2W7VA 5TMCA 4A3BC 3H0GA 3GTGC 4A3FK 4C3JK 5EGHA 4BBRK 2R92K 2FQTA 3FKIA 4C3IK 4BKWA 3G4CA 1Y1WK 1C0AA 3S2HK 4Y52C 4ILDA 4GZYA 1I6HC 2B63K 3HOWK 1R9TA 4OIOA 2A68A 2NVXK 3GTOK 1WORA 3S1MC 3M3YK 3S2DK 3GTJK 3I4MC 1DCOA 1I50K 2NVXA 1XZPB 3GTOA 5C4JK 4Y7NC 3SZZA 1TWCK 2GSOA 2NVYC 5M5WK 2NVQK 3GTPK 4KMHA 4OIRA 4LLGA 5C4XK 3GSIA 1SFOC 3GTPA 1DCPA 2R93A 4XCHA 5IP7C 1ZQ1C 4BY7K 3L4JA 3HOZK 3FOFA 3HOVK 2E2IK 1F9NA 4C2MC 4G7HA 1O2FB 1TWAK 1TWFK 1WOPA 4AYBD 4KDDA 4KAWX 2JA8K 3GTQA 1O26A 3HOXK 1Y1VK 2V6UA 1TWAA 1TWFA 1IQ0A 4A3GC 3GIRA 4A3LC 2NVXC 4C45A 3S1NK 1O25A 3M3YC 3AQOA 3K7AC 4G0VA 4QJVA 3BP3A 2CW0A 4GTDA 4KB4A 2RH6A 1DD5A 1O27A 4BBSK 2V6TA 1I6VA 4O2DA 3H0GC 3GTGA 1WIHA 3RZDC 2JA6K 3S17K 1EQRA 3S16K 4A3KK 4A3MC 2JA5K 2B63C 3DXJA 5IYDK 1XZPA 4KM8A 3RZOK 3HOZC 2JA5A 5JFEA 3S0XA 4C2MK 1DCHA 1L0WA 1TWAC 1TWFC 1ZYRA 1Y1VC 5M3MK 3I4NC 4G0WA 2D6FC 1V5VA 3N0BA 1X31C 3S1RC 3CQZA 4G7ZA 4Q4ZA 3S14K 4KASA 4OIQA 2WAQL 3S15K 1YCLA 3VA7A 1I3QC 5C3EC 3S1QK 1PJ5A 2ZUEA 5IYDC 1ZVUA 2R93K 4C3HK 5M5YK 5IYBK 2VUMC 3GTKC 4KN4A 5E68A 3RZOC 3N0CA 1USMA 3WODA 1ZXOA 3HKZL 1J98A 4A3DK 3LAJA 3N3YA 1PJ6A 3M4OC 4QIWD 5TMFA 4A3CC 4BY1K 4NOIA 4AH6A 3I4NK 3CQZC 4GTFA 5IOTA 2P8TA 4LQYA 1O24A 4KC6A 4GTEA 2NVTK 1XZQA 1I3QA 2XCOA 4KM9A 1WQGA 2JA8C 3GTGK 2XCRB 1I3QK 4YG2A 3BP8C 4LK1A 3A8IA 2VUMA 4XLNA 5C44K 1HQMA 3GTLC 2E2HK 4BLBA 3T01A 3S2DC 4PAAA 4C3IC 2ZFZA 1HI9A 1BGWA 1ZBSA 2R7ZA 4J3NA 3V4GA 4LR2A 4A3KC 5C4JC 3PO3C 3S1QC 1TWGK 3AD8C 3MMLB 2A6HA 2R7ZK 3GEEA 3QX3A 3HOWC 3M4OK 2B63A 5IYBC 2PHCB 3HKZD 3GTMA 4WILA 2R92C 4KMDA 1O2BA 1BS2A 5IOSA 3GTJA 3GTKA 1O28A 4KMAA 3GTLA 1KQ4A 1WSRA 1IBAA 3HOXC 4G0UA 2YU9A 1WOOA 2GAHC 4RMFA 5L46A 3HOUC 3PO2K 3GTLK 5CHPA 4PABA 1Y1WA 4KARA 5IYCK 3ADAC 1WCMC 2E2HC 2PPBA 4YFNA 5FJ8K 1VRQC 2BE5A 3FKIC 5IP9K 4A93K 2JA7A 3FOEA 1WQHA 3TFHA 3FHZA 1K83C 5JVOA 1TWHK 1UV7A 2EBBA 3EQLA 1XXBA 4KN7A 4DDQA 5FLMC 4G7OA 5IP7K 1BJTA 3GEHA 1TWCA 4KB2A 3LAPA 3HOYC 1ISEA 3PO3K 3TFIA 1TWGC 3CAGA 4BLAA 2P5MA 4A3JK 3LPXA 2O5IA 4MEYA 2ZUFA 2R7ZC 3S1NC 4X6AK 1SFOA 4OIPA 3GTQK 3Q3QA 4A3BK 3L4KA 4GTBA 3SZYA 4A3FC 4YFKA 3H0GK 3S1RK 4A3GK 2A69A 2R92A 4OINA 5C44C 1RU0A 3NUHA 5FLMK 1IS1A 3HOUK 3OPFA 2JA6A 1R9TK 3T00A 4BXXK 5IOQA 4MQ9A 3TFJA 1PJ7A 2Y0SL 4A93C 4WJ3M 4ZH4A 4A3JC 3HOYK 2R93C 1USOA 1SMYA 3IPJA 4LOWA 4QJVB 5EGEA 5M5XK 1F93A 2A6EA 1JOEA 1I50C 3AD9C 3S2HC 2GSNA 4Y52K 3GEIA 4GTLA 4A3EC 1WSVA 4WJ4A 4FM9A 1J6VA 1VLOA 4A3LK 1WCMK 1IW7A 4BY7C 1J6WA 3S14C 4P5AA 4XSZA 1B4AA 1WCMA 2E2IC 1EI6A 2Y0SD 2JA7C 4BY1C 5C4XC 1SFOK 4GFQA 3S1MK 4A3MK 2JA5C 5CJ9A 3I4MK 1WOSA 4A3IK 1XXCA 2PA8D 1EFWA 1XXAA 4Y7NK 1Y1VA 3GDZA 4BXXC 1TWCC 2NVYK 4BBSC 1AB4A 2JA6C 1XZQB 4GTCA 4A3EK 2PMZL 5HL8A 3S17C 3S16C 3A8KA 4X6AC 1GE9A 1TWGA 4GT9A 1IE0A 2NVTC 2Y3PA 3ERED 4Q5SA 2E2JK 3A8JA 4FZBA 2O5JA 2CFAB 1JQWA 2XCQA 1WQFA 3S15C 1IL2A 1F7VA 3T02A 1O29A 1O2AA 2PA8L 2JH3A 4P5BA 4AYBL 4LJZA 1I6HK 3OEPA 3AQPA 2YU9K
chains in the Genus database with same CATH topology
1TWCK 2NVYC 5M5WK 2NVQK 3GTPK 4OIRA 2NVTK 4OINA 3GTGK 5C44C 4LLGA 2JA8C 4A3IC 5C4XK 5FLMK 1SFOC 3HOUK 1I3QK 3FKIK 5IP9C 5IP7C 4YG2A 4BY7K 4LK1A 1R9TK 3HOZK 3HOVK 4BXXK 2JA7K 2NVQC 3GTPC 2E2IK 3PO2C 4MQ9A 4KMUA 4G7HA 1TWAK 1TWFK 4AYBD 4XLNA 5C44K 2Y0SL 2JA8K 1HQMA 3HOXK 3GTLC 1Y1VK 1YNJA 2E2HK 3CQZK 4XLPA 4A93C 4ZH4A 5IYCC 3GTKK 3GTMC 4A3GC 4A3JC 3GTQC 3S2DC 4A3LC 2E2JC 3HOYK 2NVXC 2R93C 1SMYA 3S1NK 4A3DC 4QJVB 5M5XK 3M3YC 3K7AC 4A3KC 5C4JC 2A6EA 2WB1L 3H3VD 1TWGK 3PO3C 3S1QC 4QJVA 2CW0A 1I50C 2A6HA 2WB1D 3H3VL 2R7ZK 4A3CK 2YU9C 1I6VA 3HOWC 3M4OK 4BBSK 3H0GC 3S2HC 3RZDC 1YNNA 5IYBC 1BDFA 2JA6K 3GTOC 2VUMK 3HKZD 5M3FK 4Y52K 3S1RK 2R92C 3S17K 3S16K 1Y1WC 4BBRC 3K7AK 4A3EC 4A3KK 4A3MC 2JA5K 2B63C 3DXJA 5IYDK 5C3EK 5D4DA 3RZOK 4JK1A 4A3LK 1WCMK 1IW7A 1K83K 4MEXA 4YFXA 1TWHC 3RZDK 3HOZC 2PMZD 4BY7C 3HOXC 3S14C 4C2MK 1TWAC 1TWFC 4XSZA 2E2IC 3HOUC 3PO2K 2WAQD 3GTLK 1ZYRA 1Y1VC 5M3MK 4LK0A 3I4NC 2Y0SD 4XSXA 5IYCK 2JA7C 3HOVC 1WCMC 1R9TC 4BY1C 2E2HC 2PPBA 5C4XC 3GTJC 1SFOK 4YFNA 3GTMK 3S1MK 5FJ8K 2BE5A 3FKIC 5IP9K 4A3MK 2JA5C 4A93K 3I4MK 4A3IK 1XPPA 2PA8D 4Y7NK 3S1RC 1K83C 4QIWL 4G7ZA 1TWHK 4BXXC 1TWCC 4Q4ZA 2NVYK 4BBSC 3S14K 3EQLA 5TMCA 4KN7A 2WAQL 5FLMC 4OIQA 3S15K 5IP7K 2JA6C 4A3BC 4G7OA 3GTGC 5C3EC 1I3QC 3S1QK 4A3FK 4C3JK 4BBRK 2PMZL 4A3EK 2R92K 3S17C 3S16C 4X6AC 5IYDC 4C3IK 2R93K 4C3HK 5M5YK 5IYBK 2NVTC 1Y1WK 3S2HK 4Q5SA 2VUMC 3GTKC 4KN4A 4Y52C 3RZOC 2E2JK 3HOYC 4GZYA 1I6HC 3WODA 3PO3K 2B63K 1TWGC 2O5IA 3HKZL 4A3JK 3HOWK 4MEYA 4OIOA 2A68A 2R7ZC 2O5JA 3S1NC 4A3DK 4X6AK 2NVXK 4OIPA 3GTOK 3S1MC 3M3YK 3GTQK 3S2DK 3S15C 3M4OC 4QIWD 4A3BK 3GTJK 5TMFA 3I4MC 1I50K 4BY1K 4A3CC 2PA8L 4AYBL 4A3FC 4LJZA 4NOIA 3I4NK 1I6HK 3CQZC 3H0GK 4YFKA 5C4JK 4Y7NC 2YU9K 4A3GK 2A69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC K;  2NVY C;  5M5W K;  2NVQ K;  3GTP K;  4OIR A;  2NVT K;  4OIN A;  3GTG K;  5C44 C;  4LLG A;  2JA8 C;  4A3I C;  5C4X K;  5FLM K;  1SFO C;  3HOU K;  1I3Q K;  3FKI K;  5IP9 C;  5IP7 C;  4YG2 A;  4BY7 K;  4LK1 A;  1R9T K;  3HOZ K;  3HOV K;  4BXX K;  2JA7 K;  2NVQ C;  3GTP C;  2E2I K;  3PO2 C;  4MQ9 A;  4KMU A;  4G7H A;  1TWA K;  1TWF K;  4AYB D;  4XLN A;  5C44 K;  2Y0S L;  2JA8 K;  1HQM A;  3HOX K;  3GTL C;  1Y1V K;  1YNJ A;  2E2H K;  3CQZ K;  4XLP A;  4A93 C;  4ZH4 A;  5IYC C;  3GTK K;  3GTM C;  4A3G C;  4A3J C;  3GTQ C;  3S2D C;  4A3L C;  2E2J C;  3HOY K;  2NVX C;  2R93 C;  1SMY A;  3S1N K;  4A3D C;  4QJV B;  5M5X K;  3M3Y C;  3K7A C;  4A3K C;  5C4J C;  2A6E A;  2WB1 L;  3H3V D;  1TWG K;  3PO3 C;  3S1Q C;  4QJV A;  2CW0 A;  1I50 C;  2A6H A;  2WB1 D;  3H3V L;  2R7Z K;  4A3C K;  2YU9 C;  1I6V A;  3HOW C;  3M4O K;  4BBS K;  3H0G C;  3S2H C;  3RZD C;  1YNN A;  5IYB C;  1BDF A;  2JA6 K;  3GTO C;  2VUM K;  3HKZ D;  5M3F K;  4Y52 K;  3S1R K;  2R92 C;  3S17 K;  3S16 K;  1Y1W C;  4BBR C;  3K7A K;  4A3E C;  4A3K K;  4A3M C;  2JA5 K;  2B63 C;  3DXJ A;  5IYD K;  5C3E K;  5D4D A;  3RZO K;  4JK1 A;  4A3L K;  1WCM K;  1IW7 A;  1K83 K;  4MEX A;  4YFX A;  1TWH C;  3RZD K;  3HOZ C;  2PMZ D;  4BY7 C;  3HOX C;  3S14 C;  4C2M K;  1TWA C;  1TWF C;  4XSZ A;  2E2I C;  3HOU C;  3PO2 K;  2WAQ D;  3GTL K;  1ZYR A;  1Y1V C;  5M3M K;  4LK0 A;  3I4N C;  2Y0S D;  4XSX A;  5IYC K;  2JA7 C;  3HOV C;  1WCM C;  1R9T C;  4BY1 C;  2E2H C;  2PPB A;  5C4X C;  3GTJ C;  1SFO K;  4YFN A;  3GTM K;  3S1M K;  5FJ8 K;  2BE5 A;  3FKI C;  5IP9 K;  4A3M K;  2JA5 C;  4A93 K;  3I4M K;  4A3I K;  1XPP A;  2PA8 D;  4Y7N K;  3S1R C;  1K83 C;  4QIW L;  4G7Z A;  1TWH K;  4BXX C;  1TWC C;  4Q4Z A;  2NVY K;  4BBS C;  3S14 K;  3EQL A;  5TMC A;  4KN7 A;  2WAQ L;  5FLM C;  4OIQ A;  3S15 K;  5IP7 K;  2JA6 C;  4A3B C;  4G7O A;  3GTG C;  5C3E C;  1I3Q C;  3S1Q K;  4A3F K;  4C3J K;  4BBR K;  2PMZ L;  4A3E K;  2R92 K;  3S17 C;  3S16 C;  4X6A C;  5IYD C;  4C3I K;  2R93 K;  4C3H K;  5M5Y K;  5IYB K;  2NVT C;  1Y1W K;  3S2H K;  4Q5S A;  2VUM C;  3GTK C;  4KN4 A;  4Y52 C;  3RZO C;  2E2J K;  3HOY C;  4GZY A;  1I6H C;  3WOD A;  3PO3 K;  2B63 K;  1TWG C;  2O5I A;  3HKZ L;  4A3J K;  3HOW K;  4MEY A;  4OIO A;  2A68 A;  2R7Z C;  2O5J A;  3S1N C;  4A3D K;  4X6A K;  2NVX K;  4OIP A;  3GTO K;  3S1M C;  3M3Y K;  3GTQ K;  3S2D K;  3S15 C;  3M4O C;  4QIW D;  4A3B K;  3GTJ K;  5TMF A;  3I4M C;  1I50 K;  4BY1 K;  4A3C C;  2PA8 L;  4AYB L;  4A3F C;  4LJZ A;  4NOI A;  3I4N K;  1I6H K;  3CQZ C;  3H0G K;  4YFK A;  5C4J K;  4Y7N C;  2YU9 K;  4A3G K;  2A69 A; 
#chains in the Genus database with same CATH topology
 2V6S A;  3AD7 C;  4A3I C;  1VH2 A;  3AH5 A;  2GSU A;  3FKI K;  5IP9 C;  2RGR A;  1G51 A;  3ORE A;  3HXA A;  2JA7 K;  2NVQ C;  3GTP C;  3PO2 C;  3BUE A;  2KWA A;  1EK8 A;  4KMU A;  1YNJ A;  1TWH A;  1YX2 A;  3CQZ K;  4XLP A;  5IYC C;  3GTK K;  3GTM C;  2GAG C;  3GTQ C;  1VJE A;  2E2J C;  4KAT A;  4GTA A;  3JST A;  2FQO A;  1I50 A;  4A3D C;  1EH1 A;  1VGX A;  2WB1 L;  3H3V D;  2CFA A;  4A3C K;  2WB1 D;  3H3V L;  2YU9 C;  1YNN A;  1BDF A;  3GTO C;  2VUM K;  5M3F K;  2NVY A;  4C3J C;  1Y1W C;  4BBR C;  3K7A K;  5C3E K;  5IOR A;  2E2H A;  5D4D A;  2E2I A;  4JK1 A;  1K83 K;  4MEX A;  4YFX A;  1TWH C;  3RZD K;  2PMZ D;  4C3H C;  3TTG A;  4P9S A;  4M1X A;  2WAQ D;  5TJ3 A;  1K83 A;  1B4B A;  4LK0 A;  3G4A A;  3HOV C;  4XSX A;  1JVI A;  1J6X A;  1R9T C;  3GTJ C;  3GTM K;  1XPP A;  1INN A;  1F7U A;  4QIW L;  2W7V A;  5TMC A;  4A3B C;  3H0G A;  3GTG C;  4A3F K;  4C3J K;  5EGH A;  4BBR K;  2R92 K;  2FQT A;  3FKI A;  4C3I K;  4BKW A;  3G4C A;  1Y1W K;  1C0A A;  3S2H K;  4Y52 C;  4ILD A;  4GZY A;  1I6H C;  2B63 K;  3HOW K;  1R9T A;  4OIO A;  2A68 A;  2NVX K;  3GTO K;  1WOR A;  3S1M C;  3M3Y K;  3S2D K;  3GTJ K;  3I4M C;  1DCO A;  1I50 K;  2NVX A;  1XZP B;  3GTO A;  5C4J K;  4Y7N C;  3SZZ A;  1TWC K;  2GSO A;  2NVY C;  5M5W K;  2NVQ K;  3GTP K;  4KMH A;  4OIR A;  4LLG A;  5C4X K;  3GSI A;  1SFO C;  3GTP A;  1DCP A;  2R93 A;  4XCH A;  5IP7 C;  1ZQ1 C;  4BY7 K;  3L4J A;  3HOZ K;  3FOF A;  3HOV K;  2E2I K;  1F9N A;  4C2M C;  4G7H A;  1O2F B;  1TWA K;  1TWF K;  1WOP A;  4AYB D;  4KDD A;  4KAW X;  2JA8 K;  3GTQ A;  1O26 A;  3HOX K;  1Y1V K;  2V6U A;  1TWA A;  1TWF A;  1IQ0 A;  4A3G C;  3GIR A;  4A3L C;  2NVX C;  4C45 A;  3S1N K;  1O25 A;  3M3Y C;  3AQO A;  3K7A C;  4G0V A;  4QJV A;  3BP3 A;  2CW0 A;  4GTD A;  4KB4 A;  2RH6 A;  1DD5 A;  1O27 A;  4BBS K;  2V6T A;  1I6V A;  4O2D A;  3H0G C;  3GTG A;  1WIH A;  3RZD C;  2JA6 K;  3S17 K;  1EQR A;  3S16 K;  4A3K K;  4A3M C;  2JA5 K;  2B63 C;  3DXJ A;  5IYD K;  1XZP A;  4KM8 A;  3RZO K;  3HOZ C;  2JA5 A;  5JFE A;  3S0X A;  4C2M K;  1DCH A;  1L0W A;  1TWA C;  1TWF C;  1ZYR A;  1Y1V C;  5M3M K;  3I4N C;  4G0W A;  2D6F C;  1V5V A;  3N0B A;  1X31 C;  3S1R C;  3CQZ A;  4G7Z A;  4Q4Z A;  3S14 K;  4KAS A;  4OIQ A;  2WAQ L;  3S15 K;  1YCL A;  3VA7 A;  1I3Q C;  5C3E C;  3S1Q K;  1PJ5 A;  2ZUE A;  5IYD C;  1ZVU A;  2R93 K;  4C3H K;  5M5Y K;  5IYB K;  2VUM C;  3GTK C;  4KN4 A;  5E68 A;  3RZO C;  3N0C A;  1USM A;  3WOD A;  1ZXO A;  3HKZ L;  1J98 A;  4A3D K;  3LAJ A;  3N3Y A;  1PJ6 A;  3M4O C;  4QIW D;  5TMF A;  4A3C C;  4BY1 K;  4NOI A;  4AH6 A;  3I4N K;  3CQZ C;  4GTF A;  5IOT A;  2P8T A;  4LQY A;  1O24 A;  4KC6 A;  4GTE A;  2NVT K;  1XZQ A;  1I3Q A;  2XCO A;  4KM9 A;  1WQG A;  2JA8 C;  3GTG K;  2XCR B;  1I3Q K;  4YG2 A;  3BP8 C;  4LK1 A;  3A8I A;  2VUM A;  4XLN A;  5C44 K;  1HQM A;  3GTL C;  2E2H K;  4BLB A;  3T01 A;  3S2D C;  4PAA A;  4C3I C;  2ZFZ A;  1HI9 A;  1BGW A;  1ZBS A;  2R7Z A;  4J3N A;  3V4G A;  4LR2 A;  4A3K C;  5C4J C;  3PO3 C;  3S1Q C;  1TWG K;  3AD8 C;  3MML B;  2A6H A;  2R7Z K;  3GEE A;  3QX3 A;  3HOW C;  3M4O K;  2B63 A;  5IYB C;  2PHC B;  3HKZ D;  3GTM A;  4WIL A;  2R92 C;  4KMD A;  1O2B A;  1BS2 A;  5IOS A;  3GTJ A;  3GTK A;  1O28 A;  4KMA A;  3GTL A;  1KQ4 A;  1WSR A;  1IBA A;  3HOX C;  4G0U A;  2YU9 A;  1WOO A;  2GAH C;  4RMF A;  5L46 A;  3HOU C;  3PO2 K;  3GTL K;  5CHP A;  4PAB A;  1Y1W A;  4KAR A;  5IYC K;  3ADA C;  1WCM C;  2E2H C;  2PPB A;  4YFN A;  5FJ8 K;  1VRQ C;  2BE5 A;  3FKI C;  5IP9 K;  4A93 K;  2JA7 A;  3FOE A;  1WQH A;  3TFH A;  3FHZ A;  1K83 C;  5JVO A;  1TWH K;  1UV7 A;  2EBB A;  3EQL A;  1XXB A;  4KN7 A;  4DDQ A;  5FLM C;  4G7O A;  5IP7 K;  1BJT A;  3GEH A;  1TWC A;  4KB2 A;  3LAP A;  3HOY C;  1ISE A;  3PO3 K;  3TFI A;  1TWG C;  3CAG A;  4BLA A;  2P5M A;  4A3J K;  3LPX A;  2O5I A;  4MEY A;  2ZUF A;  2R7Z C;  3S1N C;  4X6A K;  1SFO A;  4OIP A;  3GTQ K;  3Q3Q A;  4A3B K;  3L4K A;  4GTB A;  3SZY A;  4A3F C;  4YFK A;  3H0G K;  3S1R K;  4A3G K;  2A69 A;  2R92 A;  4OIN A;  5C44 C;  1RU0 A;  3NUH A;  5FLM K;  1IS1 A;  3HOU K;  3OPF A;  2JA6 A;  1R9T K;  3T00 A;  4BXX K;  5IOQ A;  4MQ9 A;  3TFJ A;  1PJ7 A;  2Y0S L;  4A93 C;  4WJ3 M;  4ZH4 A;  4A3J C;  3HOY K;  2R93 C;  1USO A;  1SMY A;  3IPJ A;  4LOW A;  4QJV B;  5EGE A;  5M5X K;  1F93 A;  2A6E A;  1JOE A;  1I50 C;  3AD9 C;  3S2H C;  2GSN A;  4Y52 K;  3GEI A;  4GTL A;  4A3E C;  1WSV A;  4WJ4 A;  4FM9 A;  1J6V A;  1VLO A;  4A3L K;  1WCM K;  1IW7 A;  4BY7 C;  1J6W A;  3S14 C;  4P5A A;  4XSZ A;  1B4A A;  1WCM A;  2E2I C;  1EI6 A;  2Y0S D;  2JA7 C;  4BY1 C;  5C4X C;  1SFO K;  4GFQ A;  3S1M K;  4A3M K;  2JA5 C;  5CJ9 A;  3I4M K;  1WOS A;  4A3I K;  1XXC A;  2PA8 D;  1EFW A;  1XXA A;  4Y7N K;  1Y1V A;  3GDZ A;  4BXX C;  1TWC C;  2NVY K;  4BBS C;  1AB4 A;  2JA6 C;  1XZQ B;  4GTC A;  4A3E K;  2PMZ L;  5HL8 A;  3S17 C;  3S16 C;  3A8K A;  4X6A C;  1GE9 A;  1TWG A;  4GT9 A;  1IE0 A;  2NVT C;  2Y3P A;  3ERE D;  4Q5S A;  2E2J K;  3A8J A;  4FZB A;  2O5J A;  2CFA B;  1JQW A;  2XCQ A;  1WQF A;  3S15 C;  1IL2 A;  1F7V A;  3T02 A;  1O29 A;  1O2A A;  2PA8 L;  2JH3 A;  4P5B A;  4AYB L;  4LJZ A;  1I6H K;  3OEP A;  3AQP A;  2YU9 K; 
#chains in the Genus database with same CATH homology
 1TWC K;  2NVY C;  5M5W K;  2NVQ K;  3GTP K;  4OIR A;  2NVT K;  4OIN A;  3GTG K;  5C44 C;  4LLG A;  2JA8 C;  4A3I C;  5C4X K;  5FLM K;  1SFO C;  3HOU K;  1I3Q K;  3FKI K;  5IP9 C;  5IP7 C;  4YG2 A;  4BY7 K;  4LK1 A;  1R9T K;  3HOZ K;  3HOV K;  4BXX K;  2JA7 K;  2NVQ C;  3GTP C;  2E2I K;  3PO2 C;  4MQ9 A;  4KMU A;  4G7H A;  1TWA K;  1TWF K;  4AYB D;  4XLN A;  5C44 K;  2Y0S L;  2JA8 K;  1HQM A;  3HOX K;  3GTL C;  1Y1V K;  1YNJ A;  2E2H K;  3CQZ K;  4XLP A;  4A93 C;  4ZH4 A;  5IYC C;  3GTK K;  3GTM C;  4A3G C;  4A3J C;  3GTQ C;  3S2D C;  4A3L C;  2E2J C;  3HOY K;  2NVX C;  2R93 C;  1SMY A;  3S1N K;  4A3D C;  4QJV B;  5M5X K;  3M3Y C;  3K7A C;  4A3K C;  5C4J C;  2A6E A;  2WB1 L;  3H3V D;  1TWG K;  3PO3 C;  3S1Q C;  4QJV A;  2CW0 A;  1I50 C;  2A6H A;  2WB1 D;  3H3V L;  2R7Z K;  4A3C K;  2YU9 C;  1I6V A;  3HOW C;  3M4O K;  4BBS K;  3H0G C;  3S2H C;  3RZD C;  1YNN A;  5IYB C;  1BDF A;  2JA6 K;  3GTO C;  2VUM K;  3HKZ D;  5M3F K;  4Y52 K;  3S1R K;  2R92 C;  3S17 K;  3S16 K;  1Y1W C;  4BBR C;  3K7A K;  4A3E C;  4A3K K;  4A3M C;  2JA5 K;  2B63 C;  3DXJ A;  5IYD K;  5C3E K;  5D4D A;  3RZO K;  4JK1 A;  4A3L K;  1WCM K;  1IW7 A;  1K83 K;  4MEX A;  4YFX A;  1TWH C;  3RZD K;  3HOZ C;  2PMZ D;  4BY7 C;  3HOX C;  3S14 C;  4C2M K;  1TWA C;  1TWF C;  4XSZ A;  2E2I C;  3HOU C;  3PO2 K;  2WAQ D;  3GTL K;  1ZYR A;  1Y1V C;  5M3M K;  4LK0 A;  3I4N C;  2Y0S D;  4XSX A;  5IYC K;  2JA7 C;  3HOV C;  1WCM C;  1R9T C;  4BY1 C;  2E2H C;  2PPB A;  5C4X C;  3GTJ C;  1SFO K;  4YFN A;  3GTM K;  3S1M K;  5FJ8 K;  2BE5 A;  3FKI C;  5IP9 K;  4A3M K;  2JA5 C;  4A93 K;  3I4M K;  4A3I K;  1XPP A;  2PA8 D;  4Y7N K;  3S1R C;  1K83 C;  4QIW L;  4G7Z A;  1TWH K;  4BXX C;  1TWC C;  4Q4Z A;  2NVY K;  4BBS C;  3S14 K;  3EQL A;  5TMC A;  4KN7 A;  2WAQ L;  5FLM C;  4OIQ A;  3S15 K;  5IP7 K;  2JA6 C;  4A3B C;  4G7O A;  3GTG C;  5C3E C;  1I3Q C;  3S1Q K;  4A3F K;  4C3J K;  4BBR K;  2PMZ L;  4A3E K;  2R92 K;  3S17 C;  3S16 C;  4X6A C;  5IYD C;  4C3I K;  2R93 K;  4C3H K;  5M5Y K;  5IYB K;  2NVT C;  1Y1W K;  3S2H K;  4Q5S A;  2VUM C;  3GTK C;  4KN4 A;  4Y52 C;  3RZO C;  2E2J K;  3HOY C;  4GZY A;  1I6H C;  3WOD A;  3PO3 K;  2B63 K;  1TWG C;  2O5I A;  3HKZ L;  4A3J K;  3HOW K;  4MEY A;  4OIO A;  2A68 A;  2R7Z C;  2O5J A;  3S1N C;  4A3D K;  4X6A K;  2NVX K;  4OIP A;  3GTO K;  3S1M C;  3M3Y K;  3GTQ K;  3S2D K;  3S15 C;  3M4O C;  4QIW D;  4A3B K;  3GTJ K;  5TMF A;  3I4M C;  1I50 K;  4BY1 K;  4A3C C;  2PA8 L;  4AYB L;  4A3F C;  4LJZ A;  4NOI A;  3I4N K;  1I6H K;  3CQZ C;  3H0G K;  4YFK A;  5C4J K;  4Y7N C;  2YU9 K;  4A3G K;  2A69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...