4Y52K

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y52K00
4OIPA 1TWAK 2NVXC 4A3JC 3S1RK 2E2JK 4A3GC 4C3HK 3HOZK 4QJVB 2JA5C 2JA8C 3I4NK 2A69A 5IP7C 5IYBC 4C2MK 2PA8D 2NVQK 3S1MC 4AYBL 5M3MK 5C44C 4BBSK 3K7AK 3PO3K 2PPBA 3S15C 4XSZA 4LJZA 1YNNA 5C3EC 3RZDK 4OIQA 4QJVA 4KMUA 3I4MC 2R93K 3GTGK 4A93C 2R92K 4OIOA 4A3GK 2JA8K 4Y52C 2E2JC 3S1RC 4A3CK 4BY1K 5C44K 3HOVK 1I6VA 3HOZC 1YNJA 3I4NC 3CQZC 3H0GK 1TWGC 2NVQC 5FJ8K 3K7AC 4QIWL 4Y7NK 5C4XC 4KN4A 2PMZL 5C4JC 3S2HK 3GTGC 1I6HC 4YFNA 4X6AK 3S14K 4Y52K 2R92C 3GTPK 5TMFA 2O5IA 2Y0SL 3PO2K 2WAQL 4KN7A 3CQZK 3M3YK 1TWGK 1K83C 2JA6C 4BY7C 2JA7K 4A3CC 4BY1C 2BE5A 3HOVC 1TWFC 3S1QK 4NOIA 3H0GC 1SMYA 3S17C 4GZYA 3HKZL 1R9TC 5C4XK 5C4JK 4A3KC 4A3DC 1I6HK 5FLMK 5M3FK 4Y7NC 2R7ZK 3S2HC 4X6AC 1I3QK 2WB1D 2YU9C 3HOUK 2A6HA 2PMZD 1IW7A 3GTPC 1K83K 4A3MK 2JA6K 3H3VL 3S14C 3PO2C 1Y1VK 1TWFK 3M3YC 5IP9K 3GTOK 4XLNA 1Y1WK 2JA7C 1I50K 1R9TK 4MEXA 3S17K 3S1QC 4A3KK 4A3DK 1XPPA 4AYBD 4BY7K 5M5XK 4BBRC 2NVYK 4XLPA 5FLMC 3HKZD 2YU9K 4OINA 4Q4ZA 2R7ZC 4ZH4A 2VUMK 3GTQC 1I3QC 3S16C 3HOUC 4JK1A 3RZOK 4A3FK 4C3JK 4A3MC 4G7OA 3HOYK 1Y1VC 3M4OK 4YFKA 1TWHK 5IP9C 3HOXK 3GTOC 1Y1WC 1I50C 4BBRK 4LLGA 4MQ9A 3DXJA 4A3EC 4Q5SA 4A3LK 4BXXK 1HQMA 2NVYC 2E2HK 4QIWD 2NVTC 3GTQK 3S2DK 3S16K 5IYDK 5M5WK 2E2IK 2VUMC 4MEYA 5TMCA 3RZOC 2Y0SD 3GTJK 2WAQD 3FKIK 4A3FC 3GTMC 1TWCK 1SFOC 3HOYC 3S1NK 4YFXA 1TWHC 3M4OC 3HOXC 4A3EK 3GTKK 2NVTK 5D4DA 4A3BK 2B63C 4A3LC 2CW0A 4BXXC 3WODA 5IYDC 2E2HC 5IYCK 3HOWK 3S2DC 4A3IC 2E2IC 3GTMK 1WCMK 1SFOK 4G7HA 3GTLC 3H3VD 2NVXK 3GTJC 4A3JK 3FKIC 1ZYRA 2PA8L 2O5JA 1TWCC 2JA5K 3S1NC 5IYBK 5IP7K 1BDFA 1TWAC 4OIRA 3S1MK 4LK0A 2B63K 4YG2A 3GTKC 4XSXA 3S15K 5C3EK 4A3IK 3I4MK 4A3BC 4BBSC 4C3IK 4G7ZA 2A6EA 3HOWC 5IYCC 3PO3C 2A68A 4A93K 2WB1L 3RZDC 3GTLK 2R93C 3EQLA 5M5YK 1WCMC 4LK1A
chains in the Genus database with same CATH superfamily
1TWAK 2NVXC 3N3YA 3S1RK 4C3HK 1HI9A 3I4NK 2A69A 2PA8D 3S1MC 2GAHC 3GTPA 4RMFA 2PPBA 4P5BA 4XSZA 4OIQA 3CAGA 3GTGK 1DD5A 3G4AA 4A93C 2R92K 4OIOA 4Y52C 4BY1K 1O24A 1YNJA 2R7ZA 3H0GK 2NVQC 5FJ8K 5IORA 3K7AC 1WOOA 4G0WA 1Y1VA 4BLAA 1F7UA 4YFNA 4Y52K 3GTPK 2EBBA 3GEIA 5TMFA 3N0BA 2WAQL 1B4AA 1O2AA 2NVYA 1K83C 4KMDA 4A3CC 2BE5A 1IBAA 2VUMA 4NOIA 1SMYA 3S17C 1R9TC 1EK8A 1DCPA 2CFAB 5M3FK 1SFOA 4Y7NC 1TWHA 3NUHA 2R7ZK 4X6AC 1JQWA 4P9SA 1IW7A 2PMZD 1K83K 1Y1VK 5IP9K 3S17K 1R9TK 2Y3PA 3S1QC 4AYBD 5JVOA 2NVYK 5FLMC 1TWCA 3G4CA 5HL8A 1WIHA 2VUMK 1I3QC 1XXCA 2XCRB 3HOUC 3RZOK 4A3FK 4C3JK 4A3MC 3LAJA 3HOYK 4YFKA 1TWHK 3BP3A 1EQRA 1WQGA 4BXXK 4QIWD 2XCQA 3GEEA 5M5WK 1XZQA 3FOFA 3L4KA 1EI6A 1TWCK 3M4OC 4KM9A 3TTGA 1WORA 4YFXA 5EGEA 3GTLA 1BS2A 2CW0A 5JFEA 5IYCK 2ZUFA 4C3IC 2E2IC 4KARA 1VGXA 4GTEA 3H3VD 4G7HA 3GTLC 3S1NC 5IYBK 5IP7K 1BDFA 1PJ7A 4OIRA 1VJEA 1YCLA 3OEPA 4XSXA 3S15K 5C3EK 4WILA 4C3IK 3HOWC 3PO3C 2A68A 3RZDC 3GTLK 4GTBA 4OIPA 3HOZK 4QJVB 2JA5C 2JA8C 2YU9A 3PO3K 3JSTA 4KB4A 1YNNA 3RZDK 3I4MC 4KMUA 2JA7A 4XCHA 2JA8K 4DDQA 3S1RC 3HOVK 4C3HC 1I6VA 1DCHA 3I4NC 3AH5A 4KATA 4KN4A 3S2HK 3GTGC 2R92C 2Y0SL 1IS1A 4AH6A 2KWAA 2JA7K 4BY1C 3VA7A 2GSNA 3H0GC 1X31C 1JOEA 4GZYA 4A3KC 1IQ0A 3SZZA 1XZQB 1INNA 3GSIA 3GTPC 3OPFA 1L0WA 1JVIA 1O27A 5CHPA 4G0VA 4FZBA 3OREA 4A3KK 1WOPA 1RU0A 2FQTA 1AB4A 5TJ3A 2R7ZC 4ZH4A 3IPJA 1PJ6A 3S16C 4GTAA 1Y1VC 4BKWA 3AQOA 5IP9C 3HOXK 2RH6A 1XZPA 1F7VA 4ILDA 3TFJA 1WCMA 3DXJA 3GTMA 4KMAA 2NVYC 5IYDK 3S2DK 3S16K 2VUMC 2B63A 4PABA 3AQPA 3RZOC 4A3FC 4C3JC 3GTMC 3HOYC 1SFOC 1VH2A 3V4GA 1TWHC 5D4DA 2B63C 4BXXC 3WODA 3CQZA 4KAWX 3GTMK 1WCMK 1SFOK 4A3JK 1YX2A 1TWCC 2V6TA 2B63K 1O2FB 5L46A 3FOEA 4KMHA 1EFWA 4BBSC 2JA6A 5IYCC 3GDZA 2V6UA 3AD7C 2JH3A 1G51A 1XXBA 4WJ4A 2E2JK 4A3GC 5IYBC 5IP7C 4C2MK 2ZUEA 4GFQA 4AYBL 5M3MK 5C44C 4BBSK 3S15C 5C3EC 1V5VA 1TWGA 1ISEA 4LOWA 2D6FC 1PJ5A 4C45A 4A3GK 1KQ4A 4BY7K 5C44K 3Q3QA 3HOZC 3T02A 1TWGC 3GTQA 2P5MA 1ZBSA 4QIWL 1TWFA 4GTCA 3A8IA 5CJ9A 3GTOA 5C4JC 1Y1WA 1I50A 3S14K 3PO2K 4KN7A 3M3YK 1TWGK 3HOVC 1TWFC 3A8JA 3GEHA 3HKZL 5C4JK 2P8TA 2FQOA 1UV7A 3S2HC 1VLOA 2GAGC 2WB1D 2YU9C 3H3VL 4LR2A 2CFAA 1TWFK 2PHCB 2E2HA 3GTOK 4XLNA 1Y1WK 2JA7C 1I50K 4MEXA 1XPPA 3T01A 4BBRC 5M5XK 3GTJA 3FKIA 2YU9K 1TWAA 3HXAA 3GTKA 4G7OA 4BLBA 4BBRK 4LLGA 4MQ9A 3SZYA 4A3LK 1DCOA 2NVXA 2E2HK 1J6XA 1O29A 3GTJK 2WAQD 3FKIK 1F93A 1USOA 3HOXC 1WQHA 2W7VA 3GTKK 1BGWA 4A3BK 5IYDC 3S2DC 1WOSA 3TFIA 2NVXK 1ZYRA 2PA8L 2R93A 1ZXOA 4J3NA 3S1MK 4LK0A 4YG2A 5IOSA 1O26A 1BJTA 1K83A 4G7ZA 4A93K 2R93C 4G0UA 3EQLA 5M5YK 1R9TA 1WCMC 1IE0A 4A3JC 3ERED 1VRQC 2NVQK 3K7AK 4GTLA 1EH1A 4LJZA 2R93K 4GTDA 4QJVA 3BUEA 3MMLB 3TFHA 3L4JA 2E2JC 4A3CK 5IOTA 3CQZC 2V6SA 4C2MC 1I3QA 1IL2A 1C0AA 5E68A 1J98A 4FM9A 4Y7NK 3QX3A 5C4XC 2PMZL 1I6HC 4X6AK 3AD8C 4KB2A 1J6VA 1O25A 2O5IA 3CQZK 2JA6C 4BY7C 1O28A 1ZVUA 3S1QK 2GSOA 2XCOA 4P5AA 5C4XK 4A3DC 1I6HK 5FLMK 1USMA 4GTFA 1XXAA 4GT9A 1I3QK 3HOUK 1F9NA 2A6HA 3S14C 4A3MK 2JA6K 3BP8C 3PO2C 4M1XA 3LAPA 3M3YC 3T00A 3A8KA 3N0CA 4A3DK 2E2IA 4XLPA 3HKZD 4OINA 3ADAC 4Q4ZA 2RGRA 3GTQC 1XZPB 4JK1A 3LPXA 1B4BA 3M4OK 1J6WA 3GTOC 3S0XA 1Y1WC 1I50C 3AD9C 1WSVA 4A3EC 4Q5SA 1HQMA 2NVTC 3GTQK 2JA5A 2E2IK 4LQYA 4MEYA 1O2BA 5TMCA 4KC6A 1ZQ1C 2Y0SD 2GSUA 3S1NK 4A3EK 3FHZA 2NVTK 4O2DA 5EGHA 4KM8A 4A3LC 2ZFZA 4KDDA 2E2HC 3HOWK 1WQFA 4A3IC 1GE9A 1WSRA 3GTJC 3FKIC 4WJ3M 2O5JA 2JA5K 4PAAA 1TWAC 3GTGA 2R92A 3GTKC 5IOQA 4A3IK 3I4MK 3GIRA 4A3BC 2A6EA 2WB1L 4KASA 3H0GA 4LK1A
chains in the Genus database with same CATH topology
4OIPA 1TWAK 2NVXC 4A3JC 3S1RK 2E2JK 4A3GC 4C3HK 3HOZK 4QJVB 2JA5C 2JA8C 3I4NK 2A69A 5IP7C 5IYBC 4C2MK 2PA8D 2NVQK 3S1MC 4AYBL 5M3MK 5C44C 4BBSK 3K7AK 3PO3K 2PPBA 3S15C 4XSZA 4LJZA 1YNNA 5C3EC 3RZDK 4OIQA 4QJVA 4KMUA 3I4MC 2R93K 3GTGK 4A93C 2R92K 4OIOA 4A3GK 2JA8K 4Y52C 2E2JC 3S1RC 4A3CK 4BY1K 5C44K 3HOVK 1I6VA 3HOZC 1YNJA 3I4NC 3CQZC 3H0GK 1TWGC 2NVQC 5FJ8K 3K7AC 4QIWL 4Y7NK 5C4XC 4KN4A 2PMZL 5C4JC 3S2HK 3GTGC 1I6HC 4YFNA 4X6AK 3S14K 4Y52K 2R92C 3GTPK 5TMFA 2O5IA 2Y0SL 3PO2K 2WAQL 4KN7A 3CQZK 3M3YK 1TWGK 1K83C 2JA6C 4BY7C 2JA7K 4A3CC 4BY1C 2BE5A 3HOVC 1TWFC 3S1QK 4NOIA 3H0GC 1SMYA 3S17C 4GZYA 3HKZL 1R9TC 5C4XK 5C4JK 4A3KC 4A3DC 1I6HK 5FLMK 5M3FK 4Y7NC 2R7ZK 3S2HC 4X6AC 1I3QK 2WB1D 2YU9C 3HOUK 2A6HA 2PMZD 1IW7A 3GTPC 1K83K 4A3MK 2JA6K 3H3VL 3S14C 3PO2C 1Y1VK 1TWFK 3M3YC 5IP9K 3GTOK 4XLNA 1Y1WK 2JA7C 1I50K 1R9TK 4MEXA 3S17K 3S1QC 4A3KK 4A3DK 1XPPA 4AYBD 4BY7K 5M5XK 4BBRC 2NVYK 4XLPA 5FLMC 3HKZD 2YU9K 4OINA 4Q4ZA 2R7ZC 4ZH4A 2VUMK 3GTQC 1I3QC 3S16C 3HOUC 4JK1A 3RZOK 4A3FK 4C3JK 4A3MC 4G7OA 3HOYK 1Y1VC 3M4OK 4YFKA 1TWHK 5IP9C 3HOXK 3GTOC 1Y1WC 1I50C 4BBRK 4LLGA 4MQ9A 3DXJA 4A3EC 4Q5SA 4A3LK 4BXXK 1HQMA 2NVYC 2E2HK 4QIWD 2NVTC 3GTQK 3S2DK 3S16K 5IYDK 5M5WK 2E2IK 2VUMC 4MEYA 5TMCA 3RZOC 2Y0SD 3GTJK 2WAQD 3FKIK 4A3FC 3GTMC 1TWCK 1SFOC 3HOYC 3S1NK 4YFXA 1TWHC 3M4OC 3HOXC 4A3EK 3GTKK 2NVTK 5D4DA 4A3BK 2B63C 4A3LC 2CW0A 4BXXC 3WODA 5IYDC 2E2HC 5IYCK 3HOWK 3S2DC 4A3IC 2E2IC 3GTMK 1WCMK 1SFOK 4G7HA 3GTLC 3H3VD 2NVXK 3GTJC 4A3JK 3FKIC 1ZYRA 2PA8L 2O5JA 1TWCC 2JA5K 3S1NC 5IYBK 5IP7K 1BDFA 1TWAC 4OIRA 3S1MK 4LK0A 2B63K 4YG2A 3GTKC 4XSXA 3S15K 5C3EK 4A3IK 3I4MK 4A3BC 4BBSC 4C3IK 4G7ZA 2A6EA 3HOWC 5IYCC 3PO3C 2A68A 4A93K 2WB1L 3RZDC 3GTLK 2R93C 3EQLA 5M5YK 1WCMC 4LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIP A;  1TWA K;  2NVX C;  4A3J C;  3S1R K;  2E2J K;  4A3G C;  4C3H K;  3HOZ K;  4QJV B;  2JA5 C;  2JA8 C;  3I4N K;  2A69 A;  5IP7 C;  5IYB C;  4C2M K;  2PA8 D;  2NVQ K;  3S1M C;  4AYB L;  5M3M K;  5C44 C;  4BBS K;  3K7A K;  3PO3 K;  2PPB A;  3S15 C;  4XSZ A;  4LJZ A;  1YNN A;  5C3E C;  3RZD K;  4OIQ A;  4QJV A;  4KMU A;  3I4M C;  2R93 K;  3GTG K;  4A93 C;  2R92 K;  4OIO A;  4A3G K;  2JA8 K;  4Y52 C;  2E2J C;  3S1R C;  4A3C K;  4BY1 K;  5C44 K;  3HOV K;  1I6V A;  3HOZ C;  1YNJ A;  3I4N C;  3CQZ C;  3H0G K;  1TWG C;  2NVQ C;  5FJ8 K;  3K7A C;  4QIW L;  4Y7N K;  5C4X C;  4KN4 A;  2PMZ L;  5C4J C;  3S2H K;  3GTG C;  1I6H C;  4YFN A;  4X6A K;  3S14 K;  4Y52 K;  2R92 C;  3GTP K;  5TMF A;  2O5I A;  2Y0S L;  3PO2 K;  2WAQ L;  4KN7 A;  3CQZ K;  3M3Y K;  1TWG K;  1K83 C;  2JA6 C;  4BY7 C;  2JA7 K;  4A3C C;  4BY1 C;  2BE5 A;  3HOV C;  1TWF C;  3S1Q K;  4NOI A;  3H0G C;  1SMY A;  3S17 C;  4GZY A;  3HKZ L;  1R9T C;  5C4X K;  5C4J K;  4A3K C;  4A3D C;  1I6H K;  5FLM K;  5M3F K;  4Y7N C;  2R7Z K;  3S2H C;  4X6A C;  1I3Q K;  2WB1 D;  2YU9 C;  3HOU K;  2A6H A;  2PMZ D;  1IW7 A;  3GTP C;  1K83 K;  4A3M K;  2JA6 K;  3H3V L;  3S14 C;  3PO2 C;  1Y1V K;  1TWF K;  3M3Y C;  5IP9 K;  3GTO K;  4XLN A;  1Y1W K;  2JA7 C;  1I50 K;  1R9T K;  4MEX A;  3S17 K;  3S1Q C;  4A3K K;  4A3D K;  1XPP A;  4AYB D;  4BY7 K;  5M5X K;  4BBR C;  2NVY K;  4XLP A;  5FLM C;  3HKZ D;  2YU9 K;  4OIN A;  4Q4Z A;  2R7Z C;  4ZH4 A;  2VUM K;  3GTQ C;  1I3Q C;  3S16 C;  3HOU C;  4JK1 A;  3RZO K;  4A3F K;  4C3J K;  4A3M C;  4G7O A;  3HOY K;  1Y1V C;  3M4O K;  4YFK A;  1TWH K;  5IP9 C;  3HOX K;  3GTO C;  1Y1W C;  1I50 C;  4BBR K;  4LLG A;  4MQ9 A;  3DXJ A;  4A3E C;  4Q5S A;  4A3L K;  4BXX K;  1HQM A;  2NVY C;  2E2H K;  4QIW D;  2NVT C;  3GTQ K;  3S2D K;  3S16 K;  5IYD K;  5M5W K;  2E2I K;  2VUM C;  4MEY A;  5TMC A;  3RZO C;  2Y0S D;  3GTJ K;  2WAQ D;  3FKI K;  4A3F C;  3GTM C;  1TWC K;  1SFO C;  3HOY C;  3S1N K;  4YFX A;  1TWH C;  3M4O C;  3HOX C;  4A3E K;  3GTK K;  2NVT K;  5D4D A;  4A3B K;  2B63 C;  4A3L C;  2CW0 A;  4BXX C;  3WOD A;  5IYD C;  2E2H C;  5IYC K;  3HOW K;  3S2D C;  4A3I C;  2E2I C;  3GTM K;  1WCM K;  1SFO K;  4G7H A;  3GTL C;  3H3V D;  2NVX K;  3GTJ C;  4A3J K;  3FKI C;  1ZYR A;  2PA8 L;  2O5J A;  1TWC C;  2JA5 K;  3S1N C;  5IYB K;  5IP7 K;  1BDF A;  1TWA C;  4OIR A;  3S1M K;  4LK0 A;  2B63 K;  4YG2 A;  3GTK C;  4XSX A;  3S15 K;  5C3E K;  4A3I K;  3I4M K;  4A3B C;  4BBS C;  4C3I K;  4G7Z A;  2A6E A;  3HOW C;  5IYC C;  3PO3 C;  2A68 A;  4A93 K;  2WB1 L;  3RZD C;  3GTL K;  2R93 C;  3EQL A;  5M5Y K;  1WCM C;  4LK1 A; 
#chains in the Genus database with same CATH topology
 1TWA K;  2NVX C;  3N3Y A;  3S1R K;  4C3H K;  1HI9 A;  3I4N K;  2A69 A;  2PA8 D;  3S1M C;  2GAH C;  3GTP A;  4RMF A;  2PPB A;  4P5B A;  4XSZ A;  4OIQ A;  3CAG A;  3GTG K;  1DD5 A;  3G4A A;  4A93 C;  2R92 K;  4OIO A;  4Y52 C;  4BY1 K;  1O24 A;  1YNJ A;  2R7Z A;  3H0G K;  2NVQ C;  5FJ8 K;  5IOR A;  3K7A C;  1WOO A;  4G0W A;  1Y1V A;  4BLA A;  1F7U A;  4YFN A;  4Y52 K;  3GTP K;  2EBB A;  3GEI A;  5TMF A;  3N0B A;  2WAQ L;  1B4A A;  1O2A A;  2NVY A;  1K83 C;  4KMD A;  4A3C C;  2BE5 A;  1IBA A;  2VUM A;  4NOI A;  1SMY A;  3S17 C;  1R9T C;  1EK8 A;  1DCP A;  2CFA B;  5M3F K;  1SFO A;  4Y7N C;  1TWH A;  3NUH A;  2R7Z K;  4X6A C;  1JQW A;  4P9S A;  1IW7 A;  2PMZ D;  1K83 K;  1Y1V K;  5IP9 K;  3S17 K;  1R9T K;  2Y3P A;  3S1Q C;  4AYB D;  5JVO A;  2NVY K;  5FLM C;  1TWC A;  3G4C A;  5HL8 A;  1WIH A;  2VUM K;  1I3Q C;  1XXC A;  2XCR B;  3HOU C;  3RZO K;  4A3F K;  4C3J K;  4A3M C;  3LAJ A;  3HOY K;  4YFK A;  1TWH K;  3BP3 A;  1EQR A;  1WQG A;  4BXX K;  4QIW D;  2XCQ A;  3GEE A;  5M5W K;  1XZQ A;  3FOF A;  3L4K A;  1EI6 A;  1TWC K;  3M4O C;  4KM9 A;  3TTG A;  1WOR A;  4YFX A;  5EGE A;  3GTL A;  1BS2 A;  2CW0 A;  5JFE A;  5IYC K;  2ZUF A;  4C3I C;  2E2I C;  4KAR A;  1VGX A;  4GTE A;  3H3V D;  4G7H A;  3GTL C;  3S1N C;  5IYB K;  5IP7 K;  1BDF A;  1PJ7 A;  4OIR A;  1VJE A;  1YCL A;  3OEP A;  4XSX A;  3S15 K;  5C3E K;  4WIL A;  4C3I K;  3HOW C;  3PO3 C;  2A68 A;  3RZD C;  3GTL K;  4GTB A;  4OIP A;  3HOZ K;  4QJV B;  2JA5 C;  2JA8 C;  2YU9 A;  3PO3 K;  3JST A;  4KB4 A;  1YNN A;  3RZD K;  3I4M C;  4KMU A;  2JA7 A;  4XCH A;  2JA8 K;  4DDQ A;  3S1R C;  3HOV K;  4C3H C;  1I6V A;  1DCH A;  3I4N C;  3AH5 A;  4KAT A;  4KN4 A;  3S2H K;  3GTG C;  2R92 C;  2Y0S L;  1IS1 A;  4AH6 A;  2KWA A;  2JA7 K;  4BY1 C;  3VA7 A;  2GSN A;  3H0G C;  1X31 C;  1JOE A;  4GZY A;  4A3K C;  1IQ0 A;  3SZZ A;  1XZQ B;  1INN A;  3GSI A;  3GTP C;  3OPF A;  1L0W A;  1JVI A;  1O27 A;  5CHP A;  4G0V A;  4FZB A;  3ORE A;  4A3K K;  1WOP A;  1RU0 A;  2FQT A;  1AB4 A;  5TJ3 A;  2R7Z C;  4ZH4 A;  3IPJ A;  1PJ6 A;  3S16 C;  4GTA A;  1Y1V C;  4BKW A;  3AQO A;  5IP9 C;  3HOX K;  2RH6 A;  1XZP A;  1F7V A;  4ILD A;  3TFJ A;  1WCM A;  3DXJ A;  3GTM A;  4KMA A;  2NVY C;  5IYD K;  3S2D K;  3S16 K;  2VUM C;  2B63 A;  4PAB A;  3AQP A;  3RZO C;  4A3F C;  4C3J C;  3GTM C;  3HOY C;  1SFO C;  1VH2 A;  3V4G A;  1TWH C;  5D4D A;  2B63 C;  4BXX C;  3WOD A;  3CQZ A;  4KAW X;  3GTM K;  1WCM K;  1SFO K;  4A3J K;  1YX2 A;  1TWC C;  2V6T A;  2B63 K;  1O2F B;  5L46 A;  3FOE A;  4KMH A;  1EFW A;  4BBS C;  2JA6 A;  5IYC C;  3GDZ A;  2V6U A;  3AD7 C;  2JH3 A;  1G51 A;  1XXB A;  4WJ4 A;  2E2J K;  4A3G C;  5IYB C;  5IP7 C;  4C2M K;  2ZUE A;  4GFQ A;  4AYB L;  5M3M K;  5C44 C;  4BBS K;  3S15 C;  5C3E C;  1V5V A;  1TWG A;  1ISE A;  4LOW A;  2D6F C;  1PJ5 A;  4C45 A;  4A3G K;  1KQ4 A;  4BY7 K;  5C44 K;  3Q3Q A;  3HOZ C;  3T02 A;  1TWG C;  3GTQ A;  2P5M A;  1ZBS A;  4QIW L;  1TWF A;  4GTC A;  3A8I A;  5CJ9 A;  3GTO A;  5C4J C;  1Y1W A;  1I50 A;  3S14 K;  3PO2 K;  4KN7 A;  3M3Y K;  1TWG K;  3HOV C;  1TWF C;  3A8J A;  3GEH A;  3HKZ L;  5C4J K;  2P8T A;  2FQO A;  1UV7 A;  3S2H C;  1VLO A;  2GAG C;  2WB1 D;  2YU9 C;  3H3V L;  4LR2 A;  2CFA A;  1TWF K;  2PHC B;  2E2H A;  3GTO K;  4XLN A;  1Y1W K;  2JA7 C;  1I50 K;  4MEX A;  1XPP A;  3T01 A;  4BBR C;  5M5X K;  3GTJ A;  3FKI A;  2YU9 K;  1TWA A;  3HXA A;  3GTK A;  4G7O A;  4BLB A;  4BBR K;  4LLG A;  4MQ9 A;  3SZY A;  4A3L K;  1DCO A;  2NVX A;  2E2H K;  1J6X A;  1O29 A;  3GTJ K;  2WAQ D;  3FKI K;  1F93 A;  1USO A;  3HOX C;  1WQH A;  2W7V A;  3GTK K;  1BGW A;  4A3B K;  5IYD C;  3S2D C;  1WOS A;  3TFI A;  2NVX K;  1ZYR A;  2PA8 L;  2R93 A;  1ZXO A;  4J3N A;  3S1M K;  4LK0 A;  4YG2 A;  5IOS A;  1O26 A;  1BJT A;  1K83 A;  4G7Z A;  4A93 K;  2R93 C;  4G0U A;  3EQL A;  5M5Y K;  1R9T A;  1WCM C;  1IE0 A;  4A3J C;  3ERE D;  1VRQ C;  2NVQ K;  3K7A K;  4GTL A;  1EH1 A;  4LJZ A;  2R93 K;  4GTD A;  4QJV A;  3BUE A;  3MML B;  3TFH A;  3L4J A;  2E2J C;  4A3C K;  5IOT A;  3CQZ C;  2V6S A;  4C2M C;  1I3Q A;  1IL2 A;  1C0A A;  5E68 A;  1J98 A;  4FM9 A;  4Y7N K;  3QX3 A;  5C4X C;  2PMZ L;  1I6H C;  4X6A K;  3AD8 C;  4KB2 A;  1J6V A;  1O25 A;  2O5I A;  3CQZ K;  2JA6 C;  4BY7 C;  1O28 A;  1ZVU A;  3S1Q K;  2GSO A;  2XCO A;  4P5A A;  5C4X K;  4A3D C;  1I6H K;  5FLM K;  1USM A;  4GTF A;  1XXA A;  4GT9 A;  1I3Q K;  3HOU K;  1F9N A;  2A6H A;  3S14 C;  4A3M K;  2JA6 K;  3BP8 C;  3PO2 C;  4M1X A;  3LAP A;  3M3Y C;  3T00 A;  3A8K A;  3N0C A;  4A3D K;  2E2I A;  4XLP A;  3HKZ D;  4OIN A;  3ADA C;  4Q4Z A;  2RGR A;  3GTQ C;  1XZP B;  4JK1 A;  3LPX A;  1B4B A;  3M4O K;  1J6W A;  3GTO C;  3S0X A;  1Y1W C;  1I50 C;  3AD9 C;  1WSV A;  4A3E C;  4Q5S A;  1HQM A;  2NVT C;  3GTQ K;  2JA5 A;  2E2I K;  4LQY A;  4MEY A;  1O2B A;  5TMC A;  4KC6 A;  1ZQ1 C;  2Y0S D;  2GSU A;  3S1N K;  4A3E K;  3FHZ A;  2NVT K;  4O2D A;  5EGH A;  4KM8 A;  4A3L C;  2ZFZ A;  4KDD A;  2E2H C;  3HOW K;  1WQF A;  4A3I C;  1GE9 A;  1WSR A;  3GTJ C;  3FKI C;  4WJ3 M;  2O5J A;  2JA5 K;  4PAA A;  1TWA C;  3GTG A;  2R92 A;  3GTK C;  5IOQ A;  4A3I K;  3I4M K;  3GIR A;  4A3B C;  2A6E A;  2WB1 L;  4KAS A;  3H0G A;  4LK1 A; 
#chains in the Genus database with same CATH homology
 4OIP A;  1TWA K;  2NVX C;  4A3J C;  3S1R K;  2E2J K;  4A3G C;  4C3H K;  3HOZ K;  4QJV B;  2JA5 C;  2JA8 C;  3I4N K;  2A69 A;  5IP7 C;  5IYB C;  4C2M K;  2PA8 D;  2NVQ K;  3S1M C;  4AYB L;  5M3M K;  5C44 C;  4BBS K;  3K7A K;  3PO3 K;  2PPB A;  3S15 C;  4XSZ A;  4LJZ A;  1YNN A;  5C3E C;  3RZD K;  4OIQ A;  4QJV A;  4KMU A;  3I4M C;  2R93 K;  3GTG K;  4A93 C;  2R92 K;  4OIO A;  4A3G K;  2JA8 K;  4Y52 C;  2E2J C;  3S1R C;  4A3C K;  4BY1 K;  5C44 K;  3HOV K;  1I6V A;  3HOZ C;  1YNJ A;  3I4N C;  3CQZ C;  3H0G K;  1TWG C;  2NVQ C;  5FJ8 K;  3K7A C;  4QIW L;  4Y7N K;  5C4X C;  4KN4 A;  2PMZ L;  5C4J C;  3S2H K;  3GTG C;  1I6H C;  4YFN A;  4X6A K;  3S14 K;  4Y52 K;  2R92 C;  3GTP K;  5TMF A;  2O5I A;  2Y0S L;  3PO2 K;  2WAQ L;  4KN7 A;  3CQZ K;  3M3Y K;  1TWG K;  1K83 C;  2JA6 C;  4BY7 C;  2JA7 K;  4A3C C;  4BY1 C;  2BE5 A;  3HOV C;  1TWF C;  3S1Q K;  4NOI A;  3H0G C;  1SMY A;  3S17 C;  4GZY A;  3HKZ L;  1R9T C;  5C4X K;  5C4J K;  4A3K C;  4A3D C;  1I6H K;  5FLM K;  5M3F K;  4Y7N C;  2R7Z K;  3S2H C;  4X6A C;  1I3Q K;  2WB1 D;  2YU9 C;  3HOU K;  2A6H A;  2PMZ D;  1IW7 A;  3GTP C;  1K83 K;  4A3M K;  2JA6 K;  3H3V L;  3S14 C;  3PO2 C;  1Y1V K;  1TWF K;  3M3Y C;  5IP9 K;  3GTO K;  4XLN A;  1Y1W K;  2JA7 C;  1I50 K;  1R9T K;  4MEX A;  3S17 K;  3S1Q C;  4A3K K;  4A3D K;  1XPP A;  4AYB D;  4BY7 K;  5M5X K;  4BBR C;  2NVY K;  4XLP A;  5FLM C;  3HKZ D;  2YU9 K;  4OIN A;  4Q4Z A;  2R7Z C;  4ZH4 A;  2VUM K;  3GTQ C;  1I3Q C;  3S16 C;  3HOU C;  4JK1 A;  3RZO K;  4A3F K;  4C3J K;  4A3M C;  4G7O A;  3HOY K;  1Y1V C;  3M4O K;  4YFK A;  1TWH K;  5IP9 C;  3HOX K;  3GTO C;  1Y1W C;  1I50 C;  4BBR K;  4LLG A;  4MQ9 A;  3DXJ A;  4A3E C;  4Q5S A;  4A3L K;  4BXX K;  1HQM A;  2NVY C;  2E2H K;  4QIW D;  2NVT C;  3GTQ K;  3S2D K;  3S16 K;  5IYD K;  5M5W K;  2E2I K;  2VUM C;  4MEY A;  5TMC A;  3RZO C;  2Y0S D;  3GTJ K;  2WAQ D;  3FKI K;  4A3F C;  3GTM C;  1TWC K;  1SFO C;  3HOY C;  3S1N K;  4YFX A;  1TWH C;  3M4O C;  3HOX C;  4A3E K;  3GTK K;  2NVT K;  5D4D A;  4A3B K;  2B63 C;  4A3L C;  2CW0 A;  4BXX C;  3WOD A;  5IYD C;  2E2H C;  5IYC K;  3HOW K;  3S2D C;  4A3I C;  2E2I C;  3GTM K;  1WCM K;  1SFO K;  4G7H A;  3GTL C;  3H3V D;  2NVX K;  3GTJ C;  4A3J K;  3FKI C;  1ZYR A;  2PA8 L;  2O5J A;  1TWC C;  2JA5 K;  3S1N C;  5IYB K;  5IP7 K;  1BDF A;  1TWA C;  4OIR A;  3S1M K;  4LK0 A;  2B63 K;  4YG2 A;  3GTK C;  4XSX A;  3S15 K;  5C3E K;  4A3I K;  3I4M K;  4A3B C;  4BBS C;  4C3I K;  4G7Z A;  2A6E A;  3HOW C;  5IYC C;  3PO3 C;  2A68 A;  4A93 K;  2WB1 L;  3RZD C;  3GTL K;  2R93 C;  3EQL A;  5M5Y K;  1WCM C;  4LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...