4Y52K

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
total genus 28
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4y52K00
3WODA 2PMZL 2E2JK 1TWHC 2VUMK 5IP9K 3HOVK 3DXJA 2WB1L 2JA6C 5M5YK 2A6EA 2E2HK 2NVYC 5C4JC 1HQMA 4G7OA 4MEYA 3GTOC 4MQ9A 1R9TK 1BDFA 2YU9K 5TMFA 2JA6K 1WCMK 3S15C 4Y52C 4LLGA 4A3BC 3GTQC 1I6VA 2PA8L 4C3HK 2WAQL 3PO2K 5IYBC 3GTLC 4LJZA 3RZOC 4A3BK 2NVTK 3GTQK 4C3JK 5IYCC 3S14C 4YFXA 4A3IC 2O5JA 3GTLK 1YNJA 2R93C 4C2MK 3S17C 4A93C 3HKZL 3RZOK 4BY7K 4KMUA 4X6AK 4A3GC 5IYCK 3S14K 4A3IK 3HOVC 3M3YK 3S17K 3K7AC 3HOXK 5M5XK 3M4OC 4A3GK 4YG2A 3H3VD 3GTJC 4OINA 1R9TC 3K7AK 4BBRC 2YU9C 3M4OK 1WCMC 4LK1A 2Y0SD 1XPPA 3GTKC 4A3MC 4OIQA 4BBSK 2BE5A 3GTJK 3PO2C 3FKIC 4BBRK 4YFKA 1Y1WC 3HOZK 2A69A 3GTMC 5TMCA 2NVTC 1I3QK 4A3MK 3GTKK 2CW0A 3FKIK 1Y1WK 4JK1A 4BY7C 4KN7A 4MEXA 2JA8K 3GTMK 3S1NK 4A3EC 2Y0SL 1TWCC 3HOYK 4X6AC 4KN4A 2NVQC 4QJVA 3S2HC 3M3YC 1ZYRA 4LK0A 3HOXC 2B63C 1IW7A 3EQLA 1TWCK 4A3EK 5D4DA 3I4MC 2NVQK 3S2HK 4XLPA 1TWFC 2B63K 3GTPC 3PO3C 2O5IA 2R7ZC 4A3FC 3I4MK 4BBSC 1I6HC 4A3DC 2JA5C 1TWFK 4XSXA 4A3JK 3HOZC 3GTPK 3PO3K 4AYBD 2R7ZK 4A3FK 1I6HK 1I3QC 1Y1VK 4A3DK 2JA5K 3S2DK 5C4XC 5IP7C 2E2IK 3HOUC 2A6HA 4BXXC 3RZDK 4A3CC 4BY1K 4OIRA 2JA8C 4QIWD 3S1NC 3HOYC 5C4XK 5IP7K 3H3VL 3HOUK 4BXXK 5FJ8K 4A3CK 3S16K 3I4NC 4Q5SA 2NVXC 4AYBL 4NOIA 5FLMK 4A3KC 2R92C 4G7HA 4GZYA 4G7ZA 4OIOA 3S1QC 3I4NK 4Q4ZA 4OIPA 3S1RC 2NVXK 4A3KK 4QIWL 1I50K 2PA8D 2JA7C 2R92K 2WAQD 4YFNA 3S1QK 1K83C 4QJVB 1SFOC 4A3JC 3S1RK 3HOWK 1TWAC 4Y7NC 5C3EC 2JA7K 3GTGC 1TWHK 1TWGC 3CQZC 1Y1VC 4A3LC 3S2DC 2E2IC 1K83K 4XSZA 3HKZD 1SFOK 3RZDC 3S1MC 2NVYK 5C4JK 4BY1C 1TWAK 5C3EK 4Y7NK 3GTGK 3GTOK 3H0GC 1TWGK 3CQZK 4A3LK 3S1MK 3S15K 1YNNA 3S16C 4Y52K 5IYDC 5C44C 3H0GK 2PPBA 2PMZD 5FLMC 5IYBK 4ZH4A 5M5WK 2WB1D 4XLNA 5M3MK 5C44K 2A68A 4C3IK 5M3FK 5IYDK 1I50C 2E2JC 2R93K 2VUMC 5IP9C 4A93K 1SMYA 2E2HC 3HOWC
chains in the Genus database with same CATH superfamily
1DCHA 3CAGA 3WODA 5IORA 3CQZA 5IP9K 3HOVK 2E2IA 2A6EA 1HI9A 3JSTA 3LAPA 2P8TA 4WJ4A 4C3HC 4MQ9A 2ZUEA 2JA6K 2YU9K 1WCMK 3S15C 4Y52C 4A3BC 1I6VA 1VLOA 2WAQL 1IL2A 4GFQA 4PABA 3GTQK 5IYCC 4A3IC 2O5JA 2Y3PA 1IS1A 1USMA 2V6UA 3HKZL 4KMAA 4O2DA 4X6AK 3S17K 2JA6A 3OPFA 3GSIA 4YG2A 3GTOA 1O26A 3K7AK 2CFAA 4LK1A 3GDZA 5JVOA 1ZXOA 3GTQA 2GSNA 3PO2C 3GEHA 4YFKA 1JVIA 2FQOA 3ADAC 1AB4A 2A69A 2NVTC 1I3QK 4A3MK 3GTKK 2R93A 3FKIK 4BY7C 4MEXA 1ZBSA 2NVQC 3A8JA 2V6SA 1ZYRA 2EBBA 3HOXC 3EQLA 4A3EK 1TWCK 1J6WA 3AH5A 2B63K 2O5IA 3GTKA 3ERED 4A3DC 1TWFK 2JH3A 3FKIA 3GTPK 4G0WA 4AYBD 1PJ7A 1O27A 5C4XC 4BXXC 1BS2A 4ILDA 1TWCA 3AD8C 4GTDA 3HOYC 4A3CK 2B63A 1WOSA 4G7HA 4GZYA 1F7VA 1INNA 1PJ6A 1VH2A 1TWFA 1J98A 2NVXK 3GTPA 2WAQD 3GEEA 3S1QK 1K83C 4A3JC 4LOWA 3CQZC 4A3LC 3S0XA 2V6TA 2E2IC 3HKZD 2NVYK 4BY1C 3SZZA 5C3EK 4Y7NK 1XXCA 1VJEA 1B4BA 2NVXA 2PPBA 2PMZD 1EK8A 2KWAA 5IYBK 4KATA 4KB2A 5M3MK 2A68A 5IP9C 3A8KA 2ZUFA 1SMYA 1EI6A 3HOWC 1Y1VA 1XZQA 1XZPA 4KC6A 2JA6C 3IPJA 1HQMA 3GTOC 1USOA 1R9TK 1F7UA 3GTQC 1XXBA 5IOQA 1B4AA 1WORA 3T02A 3G4AA 4C3JK 3LAJA 2R93C 4C2MK 3S17C 3RZOK 5HL8A 3S14K 5IOTA 3TTGA 1TWHA 3K7AC 5M5XK 4A3GK 3G4CA 1ZQ1C 1G51A 1RU0A 3M4OK 2Y0SD 4BBSK 3GTKC 1F93A 4A3MC 3GTJK 2GSUA 3FKIC 3HOZK 5TMCA 1Y1WK 4JK1A 4KN7A 2JA8K 3S1NK 4A3EC 1TWCC 4GTLA 3M3YC 3SZYA 1L0WA 2B63C 5D4DA 2XCQA 4P5AA 3GTJA 4XLPA 1TWFC 2RH6A 2YU9A 1WCMA 3GTPC 3I4MK 3T00A 1Y1WA 1X31C 3Q3QA 1I6HK 4M1XA 3S2DK 2RGRA 2A6HA 3RZDK 4A3CC 4PAAA 2CFAB 4QIWD 5IP7K 3HOUK 2W7VA 1BJTA 2NVXC 5FLMK 4G7ZA 4OIOA 3S1QC 2P5MA 3OREA 1I50K 2R92K 1JQWA 4DDQA 1ISEA 3S1RK 1DCPA 5C3EC 4Y7NC 2JA7K 1I3QA 1Y1VC 4XSZA 5E68A 3GTGK 1YCLA 3S1MK 4KAWX 1WSVA 3S15K 1YNNA 3S16C 4Y52K 3H0GK 3NUHA 3TFIA 2R92A 4KDDA 5C44K 2GAGC 1YX2A 4KB4A 3GTGA 2E2JK 1TWHC 2VUMK 2WB1L 2E2HK 5C4JC 5CJ9A 4MEYA 3H0GA 1GE9A 4GTEA 5TMFA 1EFWA 4C3JC 1EQRA 1O2AA 1DCOA 3PO2K 3N0CA 1WSRA 3RZOC 2NVTK 1KQ4A 3S14C 3GTLK 1YNJA 2VUMA 3AQPA 4A93C 3QX3A 4BY7K 2E2HA 4A3GC 4LQYA 3HOVC 4KARA 5L46A 3HOXK 3M4OC 5TJ3A 2NVYA 1IQ0A 1F9NA 3GTJC 4BLBA 2YU9C 4G0UA 1WCMC 1ZVUA 4FM9A 4J3NA 1WOOA 4OIQA 1WIHA 2BE5A 3GTLA 1XZQB 4BBRK 1XZPB 1Y1WC 1XXAA 1O28A 3AD9C 2CW0A 3FOEA 3GTMK 4X6AC 3HOYK 4KN4A 3L4JA 3BUEA 3LPXA 4QJVA 4RMFA 4LK0A 1IW7A 5CHPA 3I4MC 3GEIA 3S2HK 1R9TA 3L4KA 2XCOA 1WQFA 1I6HC 4XSXA 3AD7C 4A3JK 3PO3K 3GTMA 2R7ZK 4A3FK 1I3QC 3GIRA 2JA5K 5IP7C 2E2IK 3HOUC 4BY1K 1J6VA 4GTFA 3H3VL 3N0BA 1EH1A 5FJ8K 4AYBL 4NOIA 2R92C 5EGEA 1VGXA 3I4NK 4LR2A 2XCRB 3S1RC 4A3KK 2JA7C 1JOEA 1WQHA 2R7ZA 2JA5A 4YFNA 3HOWK 4WJ3M 3GTGC 5JFEA 3S1MC 1SFOK 3TFHA 1TWAK 3VA7A 3GTOK 3H0GC 1TWGK 5C44C 1DD5A 4GTBA 4ZH4A 4XCHA 4C3IK 5IOSA 5M3FK 5IYDK 2E2JC 2R93K 1O2FB 2VUMC 1BGWA 4KMHA 1SFOA 2E2HC 1TWAA 2PMZL 1TWGA 4KMDA 4GTAA 3DXJA 4P9SA 2PHCB 5M5YK 2NVYC 4G7OA 3FHZA 1BDFA 4WILA 2ZFZA 3V4GA 4LLGA 2PA8L 4C3HK 5IYBC 3GTLC 4LJZA 4A3BK 3N3YA 4YFXA 1I50A 3A8IA 4C45A 4KMUA 5IYCK 2JA7A 4A3IK 3M3YK 3TFJA 3H3VD 4OINA 1R9TC 3AQOA 4BBRC 1XPPA 4KM8A 1C0AA 3GTMC 1WOPA 4BKWA 3FOFA 4C2MC 2D6FC 2Y0SL 3S2HC 1VRQC 4GTCA 3OEPA 3BP8C 2NVQK 4KASA 1O2BA 3PO3C 2R7ZC 4A3FC 4BBSC 4FZBA 2JA5C 1V5VA 1O24A 3HOZC 1Y1VK 3HXAA 4A3DK 5EGHA 4OIRA 2JA8C 3S1NC 1O29A 5C4XK 2FQTA 4BXXK 3S16K 3I4NC 4Q5SA 4A3KC 1IBAA 4Q4ZA 4OIPA 1WQGA 4QIWL 2PA8D 1J6XA 3MMLB 4QJVB 1SFOC 2GSOA 4G0VA 2GAHC 1TWAC 1TWHK 1TWGC 3S2DC 1K83K 3RZDC 4GT9A 4KM9A 5C4JK 3T01A 3CQZK 4A3LK 4AH6A 1PJ5A 5IYDC 4C3IC 5FLMC 1UV7A 5M5WK 2WB1D 4XLNA 1I50C 1IE0A 4A93K 1K83A 4BLAA 4P5BA 3BP3A 1O25A
chains in the Genus database with same CATH topology
3WODA 2PMZL 2E2JK 1TWHC 2VUMK 5IP9K 3HOVK 3DXJA 2WB1L 2JA6C 5M5YK 2A6EA 2E2HK 2NVYC 5C4JC 1HQMA 4G7OA 4MEYA 3GTOC 4MQ9A 1R9TK 1BDFA 2YU9K 5TMFA 2JA6K 1WCMK 3S15C 4Y52C 4LLGA 4A3BC 3GTQC 1I6VA 2PA8L 4C3HK 2WAQL 3PO2K 5IYBC 3GTLC 4LJZA 3RZOC 4A3BK 2NVTK 3GTQK 4C3JK 5IYCC 3S14C 4YFXA 4A3IC 2O5JA 3GTLK 1YNJA 2R93C 4C2MK 3S17C 4A93C 3HKZL 3RZOK 4BY7K 4KMUA 4X6AK 4A3GC 5IYCK 3S14K 4A3IK 3HOVC 3M3YK 3S17K 3K7AC 3HOXK 5M5XK 3M4OC 4A3GK 4YG2A 3H3VD 3GTJC 4OINA 1R9TC 3K7AK 4BBRC 2YU9C 3M4OK 1WCMC 4LK1A 2Y0SD 1XPPA 3GTKC 4A3MC 4OIQA 4BBSK 2BE5A 3GTJK 3PO2C 3FKIC 4BBRK 4YFKA 1Y1WC 3HOZK 2A69A 3GTMC 5TMCA 2NVTC 1I3QK 4A3MK 3GTKK 2CW0A 3FKIK 1Y1WK 4JK1A 4BY7C 4KN7A 4MEXA 2JA8K 3GTMK 3S1NK 4A3EC 2Y0SL 1TWCC 3HOYK 4X6AC 4KN4A 2NVQC 4QJVA 3S2HC 3M3YC 1ZYRA 4LK0A 3HOXC 2B63C 1IW7A 3EQLA 1TWCK 4A3EK 5D4DA 3I4MC 2NVQK 3S2HK 4XLPA 1TWFC 2B63K 3GTPC 3PO3C 2O5IA 2R7ZC 4A3FC 3I4MK 4BBSC 1I6HC 4A3DC 2JA5C 1TWFK 4XSXA 4A3JK 3HOZC 3GTPK 3PO3K 4AYBD 2R7ZK 4A3FK 1I6HK 1I3QC 1Y1VK 4A3DK 2JA5K 3S2DK 5C4XC 5IP7C 2E2IK 3HOUC 2A6HA 4BXXC 3RZDK 4A3CC 4BY1K 4OIRA 2JA8C 4QIWD 3S1NC 3HOYC 5C4XK 5IP7K 3H3VL 3HOUK 4BXXK 5FJ8K 4A3CK 3S16K 3I4NC 4Q5SA 2NVXC 4AYBL 4NOIA 5FLMK 4A3KC 2R92C 4G7HA 4GZYA 4G7ZA 4OIOA 3S1QC 3I4NK 4Q4ZA 4OIPA 3S1RC 2NVXK 4A3KK 4QIWL 1I50K 2PA8D 2JA7C 2R92K 2WAQD 4YFNA 3S1QK 1K83C 4QJVB 1SFOC 4A3JC 3S1RK 3HOWK 1TWAC 4Y7NC 5C3EC 2JA7K 3GTGC 1TWHK 1TWGC 3CQZC 1Y1VC 4A3LC 3S2DC 2E2IC 1K83K 4XSZA 3HKZD 1SFOK 3RZDC 3S1MC 2NVYK 5C4JK 4BY1C 1TWAK 5C3EK 4Y7NK 3GTGK 3GTOK 3H0GC 1TWGK 3CQZK 4A3LK 3S1MK 3S15K 1YNNA 3S16C 4Y52K 5IYDC 5C44C 3H0GK 2PPBA 2PMZD 5FLMC 5IYBK 4ZH4A 5M5WK 2WB1D 4XLNA 5M3MK 5C44K 2A68A 4C3IK 5M3FK 5IYDK 1I50C 2E2JC 2R93K 2VUMC 5IP9C 4A93K 1SMYA 2E2HC 3HOWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD A;  2PMZ L;  2E2J K;  1TWH C;  2VUM K;  5IP9 K;  3HOV K;  3DXJ A;  2WB1 L;  2JA6 C;  5M5Y K;  2A6E A;  2E2H K;  2NVY C;  5C4J C;  1HQM A;  4G7O A;  4MEY A;  3GTO C;  4MQ9 A;  1R9T K;  1BDF A;  2YU9 K;  5TMF A;  2JA6 K;  1WCM K;  3S15 C;  4Y52 C;  4LLG A;  4A3B C;  3GTQ C;  1I6V A;  2PA8 L;  4C3H K;  2WAQ L;  3PO2 K;  5IYB C;  3GTL C;  4LJZ A;  3RZO C;  4A3B K;  2NVT K;  3GTQ K;  4C3J K;  5IYC C;  3S14 C;  4YFX A;  4A3I C;  2O5J A;  3GTL K;  1YNJ A;  2R93 C;  4C2M K;  3S17 C;  4A93 C;  3HKZ L;  3RZO K;  4BY7 K;  4KMU A;  4X6A K;  4A3G C;  5IYC K;  3S14 K;  4A3I K;  3HOV C;  3M3Y K;  3S17 K;  3K7A C;  3HOX K;  5M5X K;  3M4O C;  4A3G K;  4YG2 A;  3H3V D;  3GTJ C;  4OIN A;  1R9T C;  3K7A K;  4BBR C;  2YU9 C;  3M4O K;  1WCM C;  4LK1 A;  2Y0S D;  1XPP A;  3GTK C;  4A3M C;  4OIQ A;  4BBS K;  2BE5 A;  3GTJ K;  3PO2 C;  3FKI C;  4BBR K;  4YFK A;  1Y1W C;  3HOZ K;  2A69 A;  3GTM C;  5TMC A;  2NVT C;  1I3Q K;  4A3M K;  3GTK K;  2CW0 A;  3FKI K;  1Y1W K;  4JK1 A;  4BY7 C;  4KN7 A;  4MEX A;  2JA8 K;  3GTM K;  3S1N K;  4A3E C;  2Y0S L;  1TWC C;  3HOY K;  4X6A C;  4KN4 A;  2NVQ C;  4QJV A;  3S2H C;  3M3Y C;  1ZYR A;  4LK0 A;  3HOX C;  2B63 C;  1IW7 A;  3EQL A;  1TWC K;  4A3E K;  5D4D A;  3I4M C;  2NVQ K;  3S2H K;  4XLP A;  1TWF C;  2B63 K;  3GTP C;  3PO3 C;  2O5I A;  2R7Z C;  4A3F C;  3I4M K;  4BBS C;  1I6H C;  4A3D C;  2JA5 C;  1TWF K;  4XSX A;  4A3J K;  3HOZ C;  3GTP K;  3PO3 K;  4AYB D;  2R7Z K;  4A3F K;  1I6H K;  1I3Q C;  1Y1V K;  4A3D K;  2JA5 K;  3S2D K;  5C4X C;  5IP7 C;  2E2I K;  3HOU C;  2A6H A;  4BXX C;  3RZD K;  4A3C C;  4BY1 K;  4OIR A;  2JA8 C;  4QIW D;  3S1N C;  3HOY C;  5C4X K;  5IP7 K;  3H3V L;  3HOU K;  4BXX K;  5FJ8 K;  4A3C K;  3S16 K;  3I4N C;  4Q5S A;  2NVX C;  4AYB L;  4NOI A;  5FLM K;  4A3K C;  2R92 C;  4G7H A;  4GZY A;  4G7Z A;  4OIO A;  3S1Q C;  3I4N K;  4Q4Z A;  4OIP A;  3S1R C;  2NVX K;  4A3K K;  4QIW L;  1I50 K;  2PA8 D;  2JA7 C;  2R92 K;  2WAQ D;  4YFN A;  3S1Q K;  1K83 C;  4QJV B;  1SFO C;  4A3J C;  3S1R K;  3HOW K;  1TWA C;  4Y7N C;  5C3E C;  2JA7 K;  3GTG C;  1TWH K;  1TWG C;  3CQZ C;  1Y1V C;  4A3L C;  3S2D C;  2E2I C;  1K83 K;  4XSZ A;  3HKZ D;  1SFO K;  3RZD C;  3S1M C;  2NVY K;  5C4J K;  4BY1 C;  1TWA K;  5C3E K;  4Y7N K;  3GTG K;  3GTO K;  3H0G C;  1TWG K;  3CQZ K;  4A3L K;  3S1M K;  3S15 K;  1YNN A;  3S16 C;  4Y52 K;  5IYD C;  5C44 C;  3H0G K;  2PPB A;  2PMZ D;  5FLM C;  5IYB K;  4ZH4 A;  5M5W K;  2WB1 D;  4XLN A;  5M3M K;  5C44 K;  2A68 A;  4C3I K;  5M3F K;  5IYD K;  1I50 C;  2E2J C;  2R93 K;  2VUM C;  5IP9 C;  4A93 K;  1SMY A;  2E2H C;  3HOW C; 
#chains in the Genus database with same CATH topology
 1DCH A;  3CAG A;  3WOD A;  5IOR A;  3CQZ A;  5IP9 K;  3HOV K;  2E2I A;  2A6E A;  1HI9 A;  3JST A;  3LAP A;  2P8T A;  4WJ4 A;  4C3H C;  4MQ9 A;  2ZUE A;  2JA6 K;  2YU9 K;  1WCM K;  3S15 C;  4Y52 C;  4A3B C;  1I6V A;  1VLO A;  2WAQ L;  1IL2 A;  4GFQ A;  4PAB A;  3GTQ K;  5IYC C;  4A3I C;  2O5J A;  2Y3P A;  1IS1 A;  1USM A;  2V6U A;  3HKZ L;  4KMA A;  4O2D A;  4X6A K;  3S17 K;  2JA6 A;  3OPF A;  3GSI A;  4YG2 A;  3GTO A;  1O26 A;  3K7A K;  2CFA A;  4LK1 A;  3GDZ A;  5JVO A;  1ZXO A;  3GTQ A;  2GSN A;  3PO2 C;  3GEH A;  4YFK A;  1JVI A;  2FQO A;  3ADA C;  1AB4 A;  2A69 A;  2NVT C;  1I3Q K;  4A3M K;  3GTK K;  2R93 A;  3FKI K;  4BY7 C;  4MEX A;  1ZBS A;  2NVQ C;  3A8J A;  2V6S A;  1ZYR A;  2EBB A;  3HOX C;  3EQL A;  4A3E K;  1TWC K;  1J6W A;  3AH5 A;  2B63 K;  2O5I A;  3GTK A;  3ERE D;  4A3D C;  1TWF K;  2JH3 A;  3FKI A;  3GTP K;  4G0W A;  4AYB D;  1PJ7 A;  1O27 A;  5C4X C;  4BXX C;  1BS2 A;  4ILD A;  1TWC A;  3AD8 C;  4GTD A;  3HOY C;  4A3C K;  2B63 A;  1WOS A;  4G7H A;  4GZY A;  1F7V A;  1INN A;  1PJ6 A;  1VH2 A;  1TWF A;  1J98 A;  2NVX K;  3GTP A;  2WAQ D;  3GEE A;  3S1Q K;  1K83 C;  4A3J C;  4LOW A;  3CQZ C;  4A3L C;  3S0X A;  2V6T A;  2E2I C;  3HKZ D;  2NVY K;  4BY1 C;  3SZZ A;  5C3E K;  4Y7N K;  1XXC A;  1VJE A;  1B4B A;  2NVX A;  2PPB A;  2PMZ D;  1EK8 A;  2KWA A;  5IYB K;  4KAT A;  4KB2 A;  5M3M K;  2A68 A;  5IP9 C;  3A8K A;  2ZUF A;  1SMY A;  1EI6 A;  3HOW C;  1Y1V A;  1XZQ A;  1XZP A;  4KC6 A;  2JA6 C;  3IPJ A;  1HQM A;  3GTO C;  1USO A;  1R9T K;  1F7U A;  3GTQ C;  1XXB A;  5IOQ A;  1B4A A;  1WOR A;  3T02 A;  3G4A A;  4C3J K;  3LAJ A;  2R93 C;  4C2M K;  3S17 C;  3RZO K;  5HL8 A;  3S14 K;  5IOT A;  3TTG A;  1TWH A;  3K7A C;  5M5X K;  4A3G K;  3G4C A;  1ZQ1 C;  1G51 A;  1RU0 A;  3M4O K;  2Y0S D;  4BBS K;  3GTK C;  1F93 A;  4A3M C;  3GTJ K;  2GSU A;  3FKI C;  3HOZ K;  5TMC A;  1Y1W K;  4JK1 A;  4KN7 A;  2JA8 K;  3S1N K;  4A3E C;  1TWC C;  4GTL A;  3M3Y C;  3SZY A;  1L0W A;  2B63 C;  5D4D A;  2XCQ A;  4P5A A;  3GTJ A;  4XLP A;  1TWF C;  2RH6 A;  2YU9 A;  1WCM A;  3GTP C;  3I4M K;  3T00 A;  1Y1W A;  1X31 C;  3Q3Q A;  1I6H K;  4M1X A;  3S2D K;  2RGR A;  2A6H A;  3RZD K;  4A3C C;  4PAA A;  2CFA B;  4QIW D;  5IP7 K;  3HOU K;  2W7V A;  1BJT A;  2NVX C;  5FLM K;  4G7Z A;  4OIO A;  3S1Q C;  2P5M A;  3ORE A;  1I50 K;  2R92 K;  1JQW A;  4DDQ A;  1ISE A;  3S1R K;  1DCP A;  5C3E C;  4Y7N C;  2JA7 K;  1I3Q A;  1Y1V C;  4XSZ A;  5E68 A;  3GTG K;  1YCL A;  3S1M K;  4KAW X;  1WSV A;  3S15 K;  1YNN A;  3S16 C;  4Y52 K;  3H0G K;  3NUH A;  3TFI A;  2R92 A;  4KDD A;  5C44 K;  2GAG C;  1YX2 A;  4KB4 A;  3GTG A;  2E2J K;  1TWH C;  2VUM K;  2WB1 L;  2E2H K;  5C4J C;  5CJ9 A;  4MEY A;  3H0G A;  1GE9 A;  4GTE A;  5TMF A;  1EFW A;  4C3J C;  1EQR A;  1O2A A;  1DCO A;  3PO2 K;  3N0C A;  1WSR A;  3RZO C;  2NVT K;  1KQ4 A;  3S14 C;  3GTL K;  1YNJ A;  2VUM A;  3AQP A;  4A93 C;  3QX3 A;  4BY7 K;  2E2H A;  4A3G C;  4LQY A;  3HOV C;  4KAR A;  5L46 A;  3HOX K;  3M4O C;  5TJ3 A;  2NVY A;  1IQ0 A;  1F9N A;  3GTJ C;  4BLB A;  2YU9 C;  4G0U A;  1WCM C;  1ZVU A;  4FM9 A;  4J3N A;  1WOO A;  4OIQ A;  1WIH A;  2BE5 A;  3GTL A;  1XZQ B;  4BBR K;  1XZP B;  1Y1W C;  1XXA A;  1O28 A;  3AD9 C;  2CW0 A;  3FOE A;  3GTM K;  4X6A C;  3HOY K;  4KN4 A;  3L4J A;  3BUE A;  3LPX A;  4QJV A;  4RMF A;  4LK0 A;  1IW7 A;  5CHP A;  3I4M C;  3GEI A;  3S2H K;  1R9T A;  3L4K A;  2XCO A;  1WQF A;  1I6H C;  4XSX A;  3AD7 C;  4A3J K;  3PO3 K;  3GTM A;  2R7Z K;  4A3F K;  1I3Q C;  3GIR A;  2JA5 K;  5IP7 C;  2E2I K;  3HOU C;  4BY1 K;  1J6V A;  4GTF A;  3H3V L;  3N0B A;  1EH1 A;  5FJ8 K;  4AYB L;  4NOI A;  2R92 C;  5EGE A;  1VGX A;  3I4N K;  4LR2 A;  2XCR B;  3S1R C;  4A3K K;  2JA7 C;  1JOE A;  1WQH A;  2R7Z A;  2JA5 A;  4YFN A;  3HOW K;  4WJ3 M;  3GTG C;  5JFE A;  3S1M C;  1SFO K;  3TFH A;  1TWA K;  3VA7 A;  3GTO K;  3H0G C;  1TWG K;  5C44 C;  1DD5 A;  4GTB A;  4ZH4 A;  4XCH A;  4C3I K;  5IOS A;  5M3F K;  5IYD K;  2E2J C;  2R93 K;  1O2F B;  2VUM C;  1BGW A;  4KMH A;  1SFO A;  2E2H C;  1TWA A;  2PMZ L;  1TWG A;  4KMD A;  4GTA A;  3DXJ A;  4P9S A;  2PHC B;  5M5Y K;  2NVY C;  4G7O A;  3FHZ A;  1BDF A;  4WIL A;  2ZFZ A;  3V4G A;  4LLG A;  2PA8 L;  4C3H K;  5IYB C;  3GTL C;  4LJZ A;  4A3B K;  3N3Y A;  4YFX A;  1I50 A;  3A8I A;  4C45 A;  4KMU A;  5IYC K;  2JA7 A;  4A3I K;  3M3Y K;  3TFJ A;  3H3V D;  4OIN A;  1R9T C;  3AQO A;  4BBR C;  1XPP A;  4KM8 A;  1C0A A;  3GTM C;  1WOP A;  4BKW A;  3FOF A;  4C2M C;  2D6F C;  2Y0S L;  3S2H C;  1VRQ C;  4GTC A;  3OEP A;  3BP8 C;  2NVQ K;  4KAS A;  1O2B A;  3PO3 C;  2R7Z C;  4A3F C;  4BBS C;  4FZB A;  2JA5 C;  1V5V A;  1O24 A;  3HOZ C;  1Y1V K;  3HXA A;  4A3D K;  5EGH A;  4OIR A;  2JA8 C;  3S1N C;  1O29 A;  5C4X K;  2FQT A;  4BXX K;  3S16 K;  3I4N C;  4Q5S A;  4A3K C;  1IBA A;  4Q4Z A;  4OIP A;  1WQG A;  4QIW L;  2PA8 D;  1J6X A;  3MML B;  4QJV B;  1SFO C;  2GSO A;  4G0V A;  2GAH C;  1TWA C;  1TWH K;  1TWG C;  3S2D C;  1K83 K;  3RZD C;  4GT9 A;  4KM9 A;  5C4J K;  3T01 A;  3CQZ K;  4A3L K;  4AH6 A;  1PJ5 A;  5IYD C;  4C3I C;  5FLM C;  1UV7 A;  5M5W K;  2WB1 D;  4XLN A;  1I50 C;  1IE0 A;  4A93 K;  1K83 A;  4BLA A;  4P5B A;  3BP3 A;  1O25 A; 
#chains in the Genus database with same CATH homology
 3WOD A;  2PMZ L;  2E2J K;  1TWH C;  2VUM K;  5IP9 K;  3HOV K;  3DXJ A;  2WB1 L;  2JA6 C;  5M5Y K;  2A6E A;  2E2H K;  2NVY C;  5C4J C;  1HQM A;  4G7O A;  4MEY A;  3GTO C;  4MQ9 A;  1R9T K;  1BDF A;  2YU9 K;  5TMF A;  2JA6 K;  1WCM K;  3S15 C;  4Y52 C;  4LLG A;  4A3B C;  3GTQ C;  1I6V A;  2PA8 L;  4C3H K;  2WAQ L;  3PO2 K;  5IYB C;  3GTL C;  4LJZ A;  3RZO C;  4A3B K;  2NVT K;  3GTQ K;  4C3J K;  5IYC C;  3S14 C;  4YFX A;  4A3I C;  2O5J A;  3GTL K;  1YNJ A;  2R93 C;  4C2M K;  3S17 C;  4A93 C;  3HKZ L;  3RZO K;  4BY7 K;  4KMU A;  4X6A K;  4A3G C;  5IYC K;  3S14 K;  4A3I K;  3HOV C;  3M3Y K;  3S17 K;  3K7A C;  3HOX K;  5M5X K;  3M4O C;  4A3G K;  4YG2 A;  3H3V D;  3GTJ C;  4OIN A;  1R9T C;  3K7A K;  4BBR C;  2YU9 C;  3M4O K;  1WCM C;  4LK1 A;  2Y0S D;  1XPP A;  3GTK C;  4A3M C;  4OIQ A;  4BBS K;  2BE5 A;  3GTJ K;  3PO2 C;  3FKI C;  4BBR K;  4YFK A;  1Y1W C;  3HOZ K;  2A69 A;  3GTM C;  5TMC A;  2NVT C;  1I3Q K;  4A3M K;  3GTK K;  2CW0 A;  3FKI K;  1Y1W K;  4JK1 A;  4BY7 C;  4KN7 A;  4MEX A;  2JA8 K;  3GTM K;  3S1N K;  4A3E C;  2Y0S L;  1TWC C;  3HOY K;  4X6A C;  4KN4 A;  2NVQ C;  4QJV A;  3S2H C;  3M3Y C;  1ZYR A;  4LK0 A;  3HOX C;  2B63 C;  1IW7 A;  3EQL A;  1TWC K;  4A3E K;  5D4D A;  3I4M C;  2NVQ K;  3S2H K;  4XLP A;  1TWF C;  2B63 K;  3GTP C;  3PO3 C;  2O5I A;  2R7Z C;  4A3F C;  3I4M K;  4BBS C;  1I6H C;  4A3D C;  2JA5 C;  1TWF K;  4XSX A;  4A3J K;  3HOZ C;  3GTP K;  3PO3 K;  4AYB D;  2R7Z K;  4A3F K;  1I6H K;  1I3Q C;  1Y1V K;  4A3D K;  2JA5 K;  3S2D K;  5C4X C;  5IP7 C;  2E2I K;  3HOU C;  2A6H A;  4BXX C;  3RZD K;  4A3C C;  4BY1 K;  4OIR A;  2JA8 C;  4QIW D;  3S1N C;  3HOY C;  5C4X K;  5IP7 K;  3H3V L;  3HOU K;  4BXX K;  5FJ8 K;  4A3C K;  3S16 K;  3I4N C;  4Q5S A;  2NVX C;  4AYB L;  4NOI A;  5FLM K;  4A3K C;  2R92 C;  4G7H A;  4GZY A;  4G7Z A;  4OIO A;  3S1Q C;  3I4N K;  4Q4Z A;  4OIP A;  3S1R C;  2NVX K;  4A3K K;  4QIW L;  1I50 K;  2PA8 D;  2JA7 C;  2R92 K;  2WAQ D;  4YFN A;  3S1Q K;  1K83 C;  4QJV B;  1SFO C;  4A3J C;  3S1R K;  3HOW K;  1TWA C;  4Y7N C;  5C3E C;  2JA7 K;  3GTG C;  1TWH K;  1TWG C;  3CQZ C;  1Y1V C;  4A3L C;  3S2D C;  2E2I C;  1K83 K;  4XSZ A;  3HKZ D;  1SFO K;  3RZD C;  3S1M C;  2NVY K;  5C4J K;  4BY1 C;  1TWA K;  5C3E K;  4Y7N K;  3GTG K;  3GTO K;  3H0G C;  1TWG K;  3CQZ K;  4A3L K;  3S1M K;  3S15 K;  1YNN A;  3S16 C;  4Y52 K;  5IYD C;  5C44 C;  3H0G K;  2PPB A;  2PMZ D;  5FLM C;  5IYB K;  4ZH4 A;  5M5W K;  2WB1 D;  4XLN A;  5M3M K;  5C44 K;  2A68 A;  4C3I K;  5M3F K;  5IYD K;  1I50 C;  2E2J C;  2R93 K;  2VUM C;  5IP9 C;  4A93 K;  1SMY A;  2E2H C;  3HOW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...