2WB1L

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
total genus 22
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2wb1L00
4A3FC 4YFKA 4BBRC 4A3IK 4BXXK 3GTPK 4A3MC 1TWGC 2WB1D 5IP7K 3GTQC 5TMCA 3GTLC 2NVXK 4C2MK 4A3LC 1TWFC 3K7AK 3PO2C 4BBSC 3CQZC 4QIWL 4LJZA 5TMFA 4OIRA 2YU9C 4G7OA 1I3QC 2WAQL 5C4JK 4OIQA 4A3BC 2JA7K 3S2HK 4KMUA 1K83C 2JA6K 5C44K 1IW7A 2E2JC 3S15C 3HOYK 5IYCC 4GZYA 5M3MK 4A3CK 3GTQK 4QJVB 3RZDK 3GTLK 2NVYC 4LK1A 4NOIA 2JA8K 3S17C 3K7AC 3EQLA 2R7ZK 1YNNA 4XSZA 4AYBD 4A3KC 3CQZK 3S14C 4OIOA 4OINA 4KN7A 5IYCK 4YFXA 1I6VA 2WB1L 3HKZL 5M5XK 3S1RK 2CW0A 3HOZC 3I4MK 1BDFA 4A3CC 5C4XC 5C3EK 2B63K 5FJ8K 3S2HC 1R9TC 4MQ9A 2JA6C 2NVTC 1YNJA 5C44C 1TWHK 4YFNA 2E2JK 3GTMK 3M3YK 1ZYRA 3H0GC 4JK1A 4Q4ZA 5M3FK 1SFOK 3I4NK 1TWAC 3GTKK 3HOWK 2BE5A 3PO3K 3GTJC 2A69A 1Y1VK 4ZH4A 4X6AC 3S1QK 3HKZD 3GTGC 4A3KK 2YU9K 3S14K 4A3FK 3HOXC 3I4MC 4Y7NC 4BBRK 3PO3C 4BY7C 3GTPC 2R93C 1I50C 3M4OK 1SMYA 5IP7C 5IYDK 4A3LK 1Y1VC 4X6AK 3HOUC 2E2HK 4Y52K 1K83K 4C3JK 2PA8D 4MEXA 3S15K 2Y0SL 1WCMK 3S2DC 1SFOC 3H3VD 1I3QK 4G7HA 3H3VL 4A3DK 2JA7C 2A6HA 2Y0SD 3GTJK 2VUMC 4A3EK 4YG2A 2WAQD 2O5IA 2PA8L 1WCMC 4C3HK 2E2IC 2A6EA 5IP9C 3I4NC 4A93C 5D4DA 5C4XK 3HOVC 4A3IC 3HOZK 2R93K 4LK0A 4A3JK 2NVXC 1I50K 3M4OC 5IYDC 2A68A 2NVYK 3PO2K 4BBSK 2JA8C 2E2HC 3S17K 4A3GC 5FLMC 5M5WK 2E2IK 3S1NK 4A93K 3FKIK 3HOVK 2NVQC 4AYBL 5IYBC 4KN4A 1XPPA 4A3JC 1I6HK 4A3MK 4C3IK 4A3DC 4QJVA 3S1QC 3WODA 2VUMK 1R9TK 1TWCK 1Y1WC 3HOYC 2PMZL 3FKIC 1TWHC 3GTMC 2NVQK 3M3YC 3H0GK 2JA5K 1HQMA 1I6HC 4XSXA 4XLPA 3DXJA 4BY1K 3HOUK 4Y52C 2O5JA 2R7ZC 5FLMK 3GTGK 4MEYA 3S1RC 4QIWD 4LLGA 3HOXK 2JA5C 5IYBK 1TWGK 4BXXC 4Y7NK 3S16C 3S1MC 4BY1C 4BY7K 1TWFK 3RZDC 4A3EC 3GTOC 3RZOC 2R92C 1TWCC 1Y1WK 5IP9K 3S2DK 2PMZD 4Q5SA 5C4JC 1TWAK 3GTKC 3HOWC 3S16K 3S1MK 4A3BK 2PPBA 3GTOK 5C3EC 4G7ZA 2B63C 3RZOK 4A3GK 5M5YK 2R92K 3S1NC 2NVTK 4OIPA 4XLNA
chains in the Genus database with same CATH superfamily
4YFKA 4C45A 3GTPK 1VLOA 4A3LC 2NVXK 2ZFZA 3A8IA 4C2MK 4QIWL 2V6UA 4LJZA 4OIRA 1XXBA 3GTQA 3AD9C 4GFQA 4KMUA 3FKIA 3S0XA 1IL2A 2E2JC 5IYCC 3MMLB 4A3CK 5IORA 3FOEA 3GTQK 1DCPA 1DCOA 1G51A 4GTBA 4KM9A 2R7ZK 4XSZA 3H0GA 4YFXA 1I6VA 1BS2A 3HOZC 1XZQA 5C3EK 2B63K 3S2HC 2NVTC 5C44C 1ZYRA 4Q4ZA 5M3FK 1SFOK 4WJ4A 4KMDA 3GTKK 1WOPA 3GTJC 1J6WA 4KATA 4KMAA 3GTGC 4A3KK 1USMA 1J98A 1BGWA 1JVIA 4BY7C 5JVOA 1I50C 2E2HK 4Y52K 4MEXA 4ILDA 3S15K 3S2DC 1VGXA 3GTJK 3GTPA 2E2HA 2E2IA 4BKWA 1WCMC 3BUEA 2NVXC 2A68A 2NVYK 1VRQC 2JA8C 4C3HC 2P5MA 1Y1VA 2E2IK 3S1NK 3FKIK 4AYBL 5IYBC 4C3IK 3V4GA 3OPFA 3HOYC 1K83A 3GTMC 2NVQK 3AD7C 2JA5K 4KAWX 1I6HC 3DXJA 1XZQB 4Y52C 2R7ZC 1WSVA 1J6VA 4MEYA 2JA5C 5IYBK 1TWGK 4GTFA 3RZDC 4A3EC 3GTOC 4GTCA 5IP9K 3ERED 1F7VA 4G0UA 2PMZD 4Q5SA 1INNA 3LAJA 3GTKC 1TWGA 1EH1A 4G7ZA 3G4AA 4GTLA 3S1NC 4XLNA 3OREA 4BXXK 3A8KA 1TWGC 2WB1D 5IP7K 3GTJA 5TMFA 4P9SA 1DCHA 5C4JK 4OIQA 4A3BC 3GDZA 2RGRA 1WQHA 4GTAA 2JA6K 1I50A 1ZQ1C 2PHCB 1PJ6A 3S15C 3HOYK 3AH5A 4GZYA 5M3MK 2XCOA 1JOEA 4QJVB 3G4CA 2JA8K 4A3KC 4OIOA 4KN7A 3I4MK 3I4NK 1BDFA 2ZUFA 4LOWA 5FJ8K 1B4BA 3JSTA 1TWHK 3M3YK 4JK1A 1TWAC 3PO3K 5L46A 2A69A 4X6AC 4ZH4A 3S1QK 3HKZD 1VJEA 4Y7NC 3A8JA 4BBRK 4DDQA 2VUMA 3M4OK 2JA7A 4G0WA 4X6AK 1TWAA 3GEHA 1KQ4A 4KC6A 4C3IC 4A3DK 2JA7C 2VUMC 4C3JC 2WAQD 4C3HK 2E2IC 3ADAC 5IP9C 3I4NC 4A93C 5D4DA 3FHZA 1WSRA 1F7UA 1C0AA 3PO2K 1Y1WA 3GTKA 4BBSK 1XXCA 1L0WA 1O28A 1JQWA 3HOVK 4KN4A 4A3JC 1I6HK 4A3MK 4QJVA 3S1QC 3WODA 1R9TK 1Y1WC 1WOSA 3M3YC 3H0GK 1O24A 1HQMA 1WCMA 4XLPA 2JA6A 1PJ7A 1R9TA 3GTGK 3TTGA 4KM8A 4LLGA 4BXXC 3S16C 3S1MC 4BY1C 4C2MC 1XXAA 1TWFK 2YU9A 4GTEA 1TWCC 1AB4A 3TFJA 3S16K 3S1MK 1IBAA 3GTOK 4WILA 5C3EC 2B63C 4A3GK 4KB2A 3GSIA 1RU0A 4A3FC 3T02A 5HL8A 3SZYA 4BBRC 4A3IK 4A3MC 3GTQC 5TMCA 2JA5A 3K7AK 4BBSC 3CQZC 1O27A 4G7OA 1DD5A 3OEPA 1WOOA 1EK8A 5C44K 1IW7A 2XCQA 3CQZA 1O2BA 3RZDK 3CAGA 3GTLK 4NOIA 2NVYC 3S17C 1F93A 1YNNA 4AYBD 3AQOA 3GIRA 3CQZK 3NUHA 3S14C 3GTMA 2EBBA 2WB1L 5M5XK 5C4XC 2GSNA 2Y3PA 5IOSA 4FZBA 4M1XA 4MQ9A 2JA6C 1BJTA 1YNJA 2R92A 1USOA 3GTMK 3H0GC 2GAHC 1EFWA 2W7VA 3BP3A 3HOWK 3LPXA 2KWAA 1YCLA 5CHPA 3S14K 3N3YA 4A3FK 3HOXC 1B4AA 3PO3C 3GTPC 1SMYA 5IP7C 4A3LK 4GTDA 3T00A 3HOUC 1K83K 3GTOA 3GTGA 1IQ0A 2V6TA 2P8TA 1SFOC 3TFIA 3H3VD 1I3QK 3H3VL 2GAGC 2ZUEA 4A3EK 2PA8L 5EGEA 2A6EA 3VA7A 1HI9A 3HOZK 2GSUA 1SFOA 1EQRA 3M4OC 2E2HC 4P5AA 2NVQC 1XPPA 4WJ3M 1O25A 2FQTA 3AQPA 3FOFA 5TJ3A 5EGHA 1TWHC 2PMZL 3GEIA 4XSXA 4BY1K 1WORA 4BLAA 2O5JA 3QX3A 5FLMK 4O2DA 1ZBSA 1XZPB 4QIWD 3HOXK 1TWHA 2GSOA 1X31C 3RZOC 2RH6A 1ZXOA 2R92C 2NVYA 5C4JC 3HOWC 4A3BK 4GT9A 1WIHA 3RZOK 2R92K 4OIPA 4KARA 1EI6A 4RMFA 5IOTA 2R93K 3GTLC 1TWFC 1ISEA 3PO2C 1XZPA 3L4JA 1F9NA 2YU9C 1I3QC 2WAQL 2JA7K 2NVXA 2XCRB 3S2HK 1K83C 3Q3QA 1TWFA 4KASA 5JFEA 4J3NA 1TWCA 4LK1A 3K7AC 3EQLA 1O2FB 4OINA 5IYCK 5CJ9A 3HKZL 3S1RK 4A3CC 2CW0A 1V5VA 3AD8C 1R9TC 1ZVUA 2R7ZA 4YFNA 2E2JK 2V6SA 2BE5A 1UV7A 4P5BA 2CFAB 2B63A 1Y1VK 2YU9K 3GEEA 4LQYA 3I4MC 2R93C 5IYDK 3N0CA 1Y1VC 4FM9A 1WQGA 4AH6A 4C3JK 2PA8D 2Y0SL 1WCMK 4BLBA 4G7HA 2A6HA 2Y0SD 2R93A 4YG2A 1IS1A 4G0VA 2O5IA 5E68A 4KDDA 4XCHA 1O2AA 1PJ5A 3IPJA 3N0BA 5C4XK 4A3IC 3HOVC 3LAPA 4LK0A 4A3JK 2CFAA 1I50K 1IE0A 5IYDC 3S17K 4LR2A 4A3GC 5FLMC 1YX2A 4KB4A 5M5WK 3HXAA 3SZZA 4A93K 1O26A 4A3DC 4PABA 1O29A 2VUMK 4PAAA 3GTLA 1TWCK 3FKIC 3L4KA 4KMHA 1WQFA 2FQOA 3HOUK 1I3QA 5IOQA 1VH2A 3S1RC 3T01A 4Y7NK 2D6FC 4BY7K 3TFHA 2JH3A 1Y1WK 1GE9A 1J6XA 3S2DK 1TWAK 3BP8C 2PPBA 5M5YK 2NVTK
chains in the Genus database with same CATH topology
4A3FC 4YFKA 4BBRC 4A3IK 4BXXK 3GTPK 4A3MC 1TWGC 2WB1D 5IP7K 3GTQC 5TMCA 3GTLC 2NVXK 4C2MK 4A3LC 1TWFC 3K7AK 3PO2C 4BBSC 3CQZC 4QIWL 4LJZA 5TMFA 4OIRA 2YU9C 4G7OA 1I3QC 2WAQL 5C4JK 4OIQA 4A3BC 2JA7K 3S2HK 4KMUA 1K83C 2JA6K 5C44K 1IW7A 2E2JC 3S15C 3HOYK 5IYCC 4GZYA 5M3MK 4A3CK 3GTQK 4QJVB 3RZDK 3GTLK 2NVYC 4LK1A 4NOIA 2JA8K 3S17C 3K7AC 3EQLA 2R7ZK 1YNNA 4XSZA 4AYBD 4A3KC 3CQZK 3S14C 4OIOA 4OINA 4KN7A 5IYCK 4YFXA 1I6VA 2WB1L 3HKZL 5M5XK 3S1RK 2CW0A 3HOZC 3I4MK 1BDFA 4A3CC 5C4XC 5C3EK 2B63K 5FJ8K 3S2HC 1R9TC 4MQ9A 2JA6C 2NVTC 1YNJA 5C44C 1TWHK 4YFNA 2E2JK 3GTMK 3M3YK 1ZYRA 3H0GC 4JK1A 4Q4ZA 5M3FK 1SFOK 3I4NK 1TWAC 3GTKK 3HOWK 2BE5A 3PO3K 3GTJC 2A69A 1Y1VK 4ZH4A 4X6AC 3S1QK 3HKZD 3GTGC 4A3KK 2YU9K 3S14K 4A3FK 3HOXC 3I4MC 4Y7NC 4BBRK 3PO3C 4BY7C 3GTPC 2R93C 1I50C 3M4OK 1SMYA 5IP7C 5IYDK 4A3LK 1Y1VC 4X6AK 3HOUC 2E2HK 4Y52K 1K83K 4C3JK 2PA8D 4MEXA 3S15K 2Y0SL 1WCMK 3S2DC 1SFOC 3H3VD 1I3QK 4G7HA 3H3VL 4A3DK 2JA7C 2A6HA 2Y0SD 3GTJK 2VUMC 4A3EK 4YG2A 2WAQD 2O5IA 2PA8L 1WCMC 4C3HK 2E2IC 2A6EA 5IP9C 3I4NC 4A93C 5D4DA 5C4XK 3HOVC 4A3IC 3HOZK 2R93K 4LK0A 4A3JK 2NVXC 1I50K 3M4OC 5IYDC 2A68A 2NVYK 3PO2K 4BBSK 2JA8C 2E2HC 3S17K 4A3GC 5FLMC 5M5WK 2E2IK 3S1NK 4A93K 3FKIK 3HOVK 2NVQC 4AYBL 5IYBC 4KN4A 1XPPA 4A3JC 1I6HK 4A3MK 4C3IK 4A3DC 4QJVA 3S1QC 3WODA 2VUMK 1R9TK 1TWCK 1Y1WC 3HOYC 2PMZL 3FKIC 1TWHC 3GTMC 2NVQK 3M3YC 3H0GK 2JA5K 1HQMA 1I6HC 4XSXA 4XLPA 3DXJA 4BY1K 3HOUK 4Y52C 2O5JA 2R7ZC 5FLMK 3GTGK 4MEYA 3S1RC 4QIWD 4LLGA 3HOXK 2JA5C 5IYBK 1TWGK 4BXXC 4Y7NK 3S16C 3S1MC 4BY1C 4BY7K 1TWFK 3RZDC 4A3EC 3GTOC 3RZOC 2R92C 1TWCC 1Y1WK 5IP9K 3S2DK 2PMZD 4Q5SA 5C4JC 1TWAK 3GTKC 3HOWC 3S16K 3S1MK 4A3BK 2PPBA 3GTOK 5C3EC 4G7ZA 2B63C 3RZOK 4A3GK 5M5YK 2R92K 3S1NC 2NVTK 4OIPA 4XLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F C;  4YFK A;  4BBR C;  4A3I K;  4BXX K;  3GTP K;  4A3M C;  1TWG C;  2WB1 D;  5IP7 K;  3GTQ C;  5TMC A;  3GTL C;  2NVX K;  4C2M K;  4A3L C;  1TWF C;  3K7A K;  3PO2 C;  4BBS C;  3CQZ C;  4QIW L;  4LJZ A;  5TMF A;  4OIR A;  2YU9 C;  4G7O A;  1I3Q C;  2WAQ L;  5C4J K;  4OIQ A;  4A3B C;  2JA7 K;  3S2H K;  4KMU A;  1K83 C;  2JA6 K;  5C44 K;  1IW7 A;  2E2J C;  3S15 C;  3HOY K;  5IYC C;  4GZY A;  5M3M K;  4A3C K;  3GTQ K;  4QJV B;  3RZD K;  3GTL K;  2NVY C;  4LK1 A;  4NOI A;  2JA8 K;  3S17 C;  3K7A C;  3EQL A;  2R7Z K;  1YNN A;  4XSZ A;  4AYB D;  4A3K C;  3CQZ K;  3S14 C;  4OIO A;  4OIN A;  4KN7 A;  5IYC K;  4YFX A;  1I6V A;  2WB1 L;  3HKZ L;  5M5X K;  3S1R K;  2CW0 A;  3HOZ C;  3I4M K;  1BDF A;  4A3C C;  5C4X C;  5C3E K;  2B63 K;  5FJ8 K;  3S2H C;  1R9T C;  4MQ9 A;  2JA6 C;  2NVT C;  1YNJ A;  5C44 C;  1TWH K;  4YFN A;  2E2J K;  3GTM K;  3M3Y K;  1ZYR A;  3H0G C;  4JK1 A;  4Q4Z A;  5M3F K;  1SFO K;  3I4N K;  1TWA C;  3GTK K;  3HOW K;  2BE5 A;  3PO3 K;  3GTJ C;  2A69 A;  1Y1V K;  4ZH4 A;  4X6A C;  3S1Q K;  3HKZ D;  3GTG C;  4A3K K;  2YU9 K;  3S14 K;  4A3F K;  3HOX C;  3I4M C;  4Y7N C;  4BBR K;  3PO3 C;  4BY7 C;  3GTP C;  2R93 C;  1I50 C;  3M4O K;  1SMY A;  5IP7 C;  5IYD K;  4A3L K;  1Y1V C;  4X6A K;  3HOU C;  2E2H K;  4Y52 K;  1K83 K;  4C3J K;  2PA8 D;  4MEX A;  3S15 K;  2Y0S L;  1WCM K;  3S2D C;  1SFO C;  3H3V D;  1I3Q K;  4G7H A;  3H3V L;  4A3D K;  2JA7 C;  2A6H A;  2Y0S D;  3GTJ K;  2VUM C;  4A3E K;  4YG2 A;  2WAQ D;  2O5I A;  2PA8 L;  1WCM C;  4C3H K;  2E2I C;  2A6E A;  5IP9 C;  3I4N C;  4A93 C;  5D4D A;  5C4X K;  3HOV C;  4A3I C;  3HOZ K;  2R93 K;  4LK0 A;  4A3J K;  2NVX C;  1I50 K;  3M4O C;  5IYD C;  2A68 A;  2NVY K;  3PO2 K;  4BBS K;  2JA8 C;  2E2H C;  3S17 K;  4A3G C;  5FLM C;  5M5W K;  2E2I K;  3S1N K;  4A93 K;  3FKI K;  3HOV K;  2NVQ C;  4AYB L;  5IYB C;  4KN4 A;  1XPP A;  4A3J C;  1I6H K;  4A3M K;  4C3I K;  4A3D C;  4QJV A;  3S1Q C;  3WOD A;  2VUM K;  1R9T K;  1TWC K;  1Y1W C;  3HOY C;  2PMZ L;  3FKI C;  1TWH C;  3GTM C;  2NVQ K;  3M3Y C;  3H0G K;  2JA5 K;  1HQM A;  1I6H C;  4XSX A;  4XLP A;  3DXJ A;  4BY1 K;  3HOU K;  4Y52 C;  2O5J A;  2R7Z C;  5FLM K;  3GTG K;  4MEY A;  3S1R C;  4QIW D;  4LLG A;  3HOX K;  2JA5 C;  5IYB K;  1TWG K;  4BXX C;  4Y7N K;  3S16 C;  3S1M C;  4BY1 C;  4BY7 K;  1TWF K;  3RZD C;  4A3E C;  3GTO C;  3RZO C;  2R92 C;  1TWC C;  1Y1W K;  5IP9 K;  3S2D K;  2PMZ D;  4Q5S A;  5C4J C;  1TWA K;  3GTK C;  3HOW C;  3S16 K;  3S1M K;  4A3B K;  2PPB A;  3GTO K;  5C3E C;  4G7Z A;  2B63 C;  3RZO K;  4A3G K;  5M5Y K;  2R92 K;  3S1N C;  2NVT K;  4OIP A;  4XLN A; 
#chains in the Genus database with same CATH topology
 4YFK A;  4C45 A;  3GTP K;  1VLO A;  4A3L C;  2NVX K;  2ZFZ A;  3A8I A;  4C2M K;  4QIW L;  2V6U A;  4LJZ A;  4OIR A;  1XXB A;  3GTQ A;  3AD9 C;  4GFQ A;  4KMU A;  3FKI A;  3S0X A;  1IL2 A;  2E2J C;  5IYC C;  3MML B;  4A3C K;  5IOR A;  3FOE A;  3GTQ K;  1DCP A;  1DCO A;  1G51 A;  4GTB A;  4KM9 A;  2R7Z K;  4XSZ A;  3H0G A;  4YFX A;  1I6V A;  1BS2 A;  3HOZ C;  1XZQ A;  5C3E K;  2B63 K;  3S2H C;  2NVT C;  5C44 C;  1ZYR A;  4Q4Z A;  5M3F K;  1SFO K;  4WJ4 A;  4KMD A;  3GTK K;  1WOP A;  3GTJ C;  1J6W A;  4KAT A;  4KMA A;  3GTG C;  4A3K K;  1USM A;  1J98 A;  1BGW A;  1JVI A;  4BY7 C;  5JVO A;  1I50 C;  2E2H K;  4Y52 K;  4MEX A;  4ILD A;  3S15 K;  3S2D C;  1VGX A;  3GTJ K;  3GTP A;  2E2H A;  2E2I A;  4BKW A;  1WCM C;  3BUE A;  2NVX C;  2A68 A;  2NVY K;  1VRQ C;  2JA8 C;  4C3H C;  2P5M A;  1Y1V A;  2E2I K;  3S1N K;  3FKI K;  4AYB L;  5IYB C;  4C3I K;  3V4G A;  3OPF A;  3HOY C;  1K83 A;  3GTM C;  2NVQ K;  3AD7 C;  2JA5 K;  4KAW X;  1I6H C;  3DXJ A;  1XZQ B;  4Y52 C;  2R7Z C;  1WSV A;  1J6V A;  4MEY A;  2JA5 C;  5IYB K;  1TWG K;  4GTF A;  3RZD C;  4A3E C;  3GTO C;  4GTC A;  5IP9 K;  3ERE D;  1F7V A;  4G0U A;  2PMZ D;  4Q5S A;  1INN A;  3LAJ A;  3GTK C;  1TWG A;  1EH1 A;  4G7Z A;  3G4A A;  4GTL A;  3S1N C;  4XLN A;  3ORE A;  4BXX K;  3A8K A;  1TWG C;  2WB1 D;  5IP7 K;  3GTJ A;  5TMF A;  4P9S A;  1DCH A;  5C4J K;  4OIQ A;  4A3B C;  3GDZ A;  2RGR A;  1WQH A;  4GTA A;  2JA6 K;  1I50 A;  1ZQ1 C;  2PHC B;  1PJ6 A;  3S15 C;  3HOY K;  3AH5 A;  4GZY A;  5M3M K;  2XCO A;  1JOE A;  4QJV B;  3G4C A;  2JA8 K;  4A3K C;  4OIO A;  4KN7 A;  3I4M K;  3I4N K;  1BDF A;  2ZUF A;  4LOW A;  5FJ8 K;  1B4B A;  3JST A;  1TWH K;  3M3Y K;  4JK1 A;  1TWA C;  3PO3 K;  5L46 A;  2A69 A;  4X6A C;  4ZH4 A;  3S1Q K;  3HKZ D;  1VJE A;  4Y7N C;  3A8J A;  4BBR K;  4DDQ A;  2VUM A;  3M4O K;  2JA7 A;  4G0W A;  4X6A K;  1TWA A;  3GEH A;  1KQ4 A;  4KC6 A;  4C3I C;  4A3D K;  2JA7 C;  2VUM C;  4C3J C;  2WAQ D;  4C3H K;  2E2I C;  3ADA C;  5IP9 C;  3I4N C;  4A93 C;  5D4D A;  3FHZ A;  1WSR A;  1F7U A;  1C0A A;  3PO2 K;  1Y1W A;  3GTK A;  4BBS K;  1XXC A;  1L0W A;  1O28 A;  1JQW A;  3HOV K;  4KN4 A;  4A3J C;  1I6H K;  4A3M K;  4QJV A;  3S1Q C;  3WOD A;  1R9T K;  1Y1W C;  1WOS A;  3M3Y C;  3H0G K;  1O24 A;  1HQM A;  1WCM A;  4XLP A;  2JA6 A;  1PJ7 A;  1R9T A;  3GTG K;  3TTG A;  4KM8 A;  4LLG A;  4BXX C;  3S16 C;  3S1M C;  4BY1 C;  4C2M C;  1XXA A;  1TWF K;  2YU9 A;  4GTE A;  1TWC C;  1AB4 A;  3TFJ A;  3S16 K;  3S1M K;  1IBA A;  3GTO K;  4WIL A;  5C3E C;  2B63 C;  4A3G K;  4KB2 A;  3GSI A;  1RU0 A;  4A3F C;  3T02 A;  5HL8 A;  3SZY A;  4BBR C;  4A3I K;  4A3M C;  3GTQ C;  5TMC A;  2JA5 A;  3K7A K;  4BBS C;  3CQZ C;  1O27 A;  4G7O A;  1DD5 A;  3OEP A;  1WOO A;  1EK8 A;  5C44 K;  1IW7 A;  2XCQ A;  3CQZ A;  1O2B A;  3RZD K;  3CAG A;  3GTL K;  4NOI A;  2NVY C;  3S17 C;  1F93 A;  1YNN A;  4AYB D;  3AQO A;  3GIR A;  3CQZ K;  3NUH A;  3S14 C;  3GTM A;  2EBB A;  2WB1 L;  5M5X K;  5C4X C;  2GSN A;  2Y3P A;  5IOS A;  4FZB A;  4M1X A;  4MQ9 A;  2JA6 C;  1BJT A;  1YNJ A;  2R92 A;  1USO A;  3GTM K;  3H0G C;  2GAH C;  1EFW A;  2W7V A;  3BP3 A;  3HOW K;  3LPX A;  2KWA A;  1YCL A;  5CHP A;  3S14 K;  3N3Y A;  4A3F K;  3HOX C;  1B4A A;  3PO3 C;  3GTP C;  1SMY A;  5IP7 C;  4A3L K;  4GTD A;  3T00 A;  3HOU C;  1K83 K;  3GTO A;  3GTG A;  1IQ0 A;  2V6T A;  2P8T A;  1SFO C;  3TFI A;  3H3V D;  1I3Q K;  3H3V L;  2GAG C;  2ZUE A;  4A3E K;  2PA8 L;  5EGE A;  2A6E A;  3VA7 A;  1HI9 A;  3HOZ K;  2GSU A;  1SFO A;  1EQR A;  3M4O C;  2E2H C;  4P5A A;  2NVQ C;  1XPP A;  4WJ3 M;  1O25 A;  2FQT A;  3AQP A;  3FOF A;  5TJ3 A;  5EGH A;  1TWH C;  2PMZ L;  3GEI A;  4XSX A;  4BY1 K;  1WOR A;  4BLA A;  2O5J A;  3QX3 A;  5FLM K;  4O2D A;  1ZBS A;  1XZP B;  4QIW D;  3HOX K;  1TWH A;  2GSO A;  1X31 C;  3RZO C;  2RH6 A;  1ZXO A;  2R92 C;  2NVY A;  5C4J C;  3HOW C;  4A3B K;  4GT9 A;  1WIH A;  3RZO K;  2R92 K;  4OIP A;  4KAR A;  1EI6 A;  4RMF A;  5IOT A;  2R93 K;  3GTL C;  1TWF C;  1ISE A;  3PO2 C;  1XZP A;  3L4J A;  1F9N A;  2YU9 C;  1I3Q C;  2WAQ L;  2JA7 K;  2NVX A;  2XCR B;  3S2H K;  1K83 C;  3Q3Q A;  1TWF A;  4KAS A;  5JFE A;  4J3N A;  1TWC A;  4LK1 A;  3K7A C;  3EQL A;  1O2F B;  4OIN A;  5IYC K;  5CJ9 A;  3HKZ L;  3S1R K;  4A3C C;  2CW0 A;  1V5V A;  3AD8 C;  1R9T C;  1ZVU A;  2R7Z A;  4YFN A;  2E2J K;  2V6S A;  2BE5 A;  1UV7 A;  4P5B A;  2CFA B;  2B63 A;  1Y1V K;  2YU9 K;  3GEE A;  4LQY A;  3I4M C;  2R93 C;  5IYD K;  3N0C A;  1Y1V C;  4FM9 A;  1WQG A;  4AH6 A;  4C3J K;  2PA8 D;  2Y0S L;  1WCM K;  4BLB A;  4G7H A;  2A6H A;  2Y0S D;  2R93 A;  4YG2 A;  1IS1 A;  4G0V A;  2O5I A;  5E68 A;  4KDD A;  4XCH A;  1O2A A;  1PJ5 A;  3IPJ A;  3N0B A;  5C4X K;  4A3I C;  3HOV C;  3LAP A;  4LK0 A;  4A3J K;  2CFA A;  1I50 K;  1IE0 A;  5IYD C;  3S17 K;  4LR2 A;  4A3G C;  5FLM C;  1YX2 A;  4KB4 A;  5M5W K;  3HXA A;  3SZZ A;  4A93 K;  1O26 A;  4A3D C;  4PAB A;  1O29 A;  2VUM K;  4PAA A;  3GTL A;  1TWC K;  3FKI C;  3L4K A;  4KMH A;  1WQF A;  2FQO A;  3HOU K;  1I3Q A;  5IOQ A;  1VH2 A;  3S1R C;  3T01 A;  4Y7N K;  2D6F C;  4BY7 K;  3TFH A;  2JH3 A;  1Y1W K;  1GE9 A;  1J6X A;  3S2D K;  1TWA K;  3BP8 C;  2PPB A;  5M5Y K;  2NVT K; 
#chains in the Genus database with same CATH homology
 4A3F C;  4YFK A;  4BBR C;  4A3I K;  4BXX K;  3GTP K;  4A3M C;  1TWG C;  2WB1 D;  5IP7 K;  3GTQ C;  5TMC A;  3GTL C;  2NVX K;  4C2M K;  4A3L C;  1TWF C;  3K7A K;  3PO2 C;  4BBS C;  3CQZ C;  4QIW L;  4LJZ A;  5TMF A;  4OIR A;  2YU9 C;  4G7O A;  1I3Q C;  2WAQ L;  5C4J K;  4OIQ A;  4A3B C;  2JA7 K;  3S2H K;  4KMU A;  1K83 C;  2JA6 K;  5C44 K;  1IW7 A;  2E2J C;  3S15 C;  3HOY K;  5IYC C;  4GZY A;  5M3M K;  4A3C K;  3GTQ K;  4QJV B;  3RZD K;  3GTL K;  2NVY C;  4LK1 A;  4NOI A;  2JA8 K;  3S17 C;  3K7A C;  3EQL A;  2R7Z K;  1YNN A;  4XSZ A;  4AYB D;  4A3K C;  3CQZ K;  3S14 C;  4OIO A;  4OIN A;  4KN7 A;  5IYC K;  4YFX A;  1I6V A;  2WB1 L;  3HKZ L;  5M5X K;  3S1R K;  2CW0 A;  3HOZ C;  3I4M K;  1BDF A;  4A3C C;  5C4X C;  5C3E K;  2B63 K;  5FJ8 K;  3S2H C;  1R9T C;  4MQ9 A;  2JA6 C;  2NVT C;  1YNJ A;  5C44 C;  1TWH K;  4YFN A;  2E2J K;  3GTM K;  3M3Y K;  1ZYR A;  3H0G C;  4JK1 A;  4Q4Z A;  5M3F K;  1SFO K;  3I4N K;  1TWA C;  3GTK K;  3HOW K;  2BE5 A;  3PO3 K;  3GTJ C;  2A69 A;  1Y1V K;  4ZH4 A;  4X6A C;  3S1Q K;  3HKZ D;  3GTG C;  4A3K K;  2YU9 K;  3S14 K;  4A3F K;  3HOX C;  3I4M C;  4Y7N C;  4BBR K;  3PO3 C;  4BY7 C;  3GTP C;  2R93 C;  1I50 C;  3M4O K;  1SMY A;  5IP7 C;  5IYD K;  4A3L K;  1Y1V C;  4X6A K;  3HOU C;  2E2H K;  4Y52 K;  1K83 K;  4C3J K;  2PA8 D;  4MEX A;  3S15 K;  2Y0S L;  1WCM K;  3S2D C;  1SFO C;  3H3V D;  1I3Q K;  4G7H A;  3H3V L;  4A3D K;  2JA7 C;  2A6H A;  2Y0S D;  3GTJ K;  2VUM C;  4A3E K;  4YG2 A;  2WAQ D;  2O5I A;  2PA8 L;  1WCM C;  4C3H K;  2E2I C;  2A6E A;  5IP9 C;  3I4N C;  4A93 C;  5D4D A;  5C4X K;  3HOV C;  4A3I C;  3HOZ K;  2R93 K;  4LK0 A;  4A3J K;  2NVX C;  1I50 K;  3M4O C;  5IYD C;  2A68 A;  2NVY K;  3PO2 K;  4BBS K;  2JA8 C;  2E2H C;  3S17 K;  4A3G C;  5FLM C;  5M5W K;  2E2I K;  3S1N K;  4A93 K;  3FKI K;  3HOV K;  2NVQ C;  4AYB L;  5IYB C;  4KN4 A;  1XPP A;  4A3J C;  1I6H K;  4A3M K;  4C3I K;  4A3D C;  4QJV A;  3S1Q C;  3WOD A;  2VUM K;  1R9T K;  1TWC K;  1Y1W C;  3HOY C;  2PMZ L;  3FKI C;  1TWH C;  3GTM C;  2NVQ K;  3M3Y C;  3H0G K;  2JA5 K;  1HQM A;  1I6H C;  4XSX A;  4XLP A;  3DXJ A;  4BY1 K;  3HOU K;  4Y52 C;  2O5J A;  2R7Z C;  5FLM K;  3GTG K;  4MEY A;  3S1R C;  4QIW D;  4LLG A;  3HOX K;  2JA5 C;  5IYB K;  1TWG K;  4BXX C;  4Y7N K;  3S16 C;  3S1M C;  4BY1 C;  4BY7 K;  1TWF K;  3RZD C;  4A3E C;  3GTO C;  3RZO C;  2R92 C;  1TWC C;  1Y1W K;  5IP9 K;  3S2D K;  2PMZ D;  4Q5S A;  5C4J C;  1TWA K;  3GTK C;  3HOW C;  3S16 K;  3S1M K;  4A3B K;  2PPB A;  3GTO K;  5C3E C;  4G7Z A;  2B63 C;  3RZO K;  4A3G K;  5M5Y K;  2R92 K;  3S1N C;  2NVT K;  4OIP A;  4XLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...