2WB1L

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2wb1L00
4YFKA 1HQMA 4A93C 2R93C 4NOIA 3RZOC 3FKIC 4X6AK 4LLGA 2B63K 3S1QC 4A3DK 1I3QC 1I50K 2BE5A 3CQZC 4MEXA 3GTKK 1TWGC 4BY1K 3I4NK 3I4MC 4BXXK 4Y52C 1YNNA 1TWCK 3GTMK 3S2HC 4LJZA 1TWAC 4Q4ZA 4QJVB 4YG2A 4BBRK 5M3MK 2PA8L 4Y7NC 4A3IC 1R9TK 5IYDC 5IYCC 4OINA 3GTQK 1I6HK 2E2HC 3GTLC 4Q5SA 4A3KK 3RZDC 3S1RC 2NVYC 3M3YC 4GZYA 3HOUC 3S16K 4XLNA 4G7HA 2A69A 4C3JK 1ZYRA 1SMYA 3HOXC 3HOYC 2PMZL 4YFNA 4G7ZA 4ZH4A 3HOWC 3RZOK 3FKIK 2PA8D 5FLMK 3S14C 1I3QK 2E2JC 3WODA 2NVXC 3GTOC 3S15C 4A3EC 3CQZK 3PO2C 3DXJA 1TWGK 4LK1A 3I4MK 4Y52K 3GTJK 4C3IK 3S2HK 5M5WK 4A3JC 4JK1A 4A3LC 4Y7NK 4A3IK 2YU9C 5IYCK 2PMZD 4A3FK 4A3MK 2Y0SL 1BDFA 2E2HK 2R92C 3GTLK 3S1MK 3S1NC 2NVYK 5IP7K 2E2IC 3M3YK 5M5YK 3M4OC 2VUMC 3HOUK 3S2DC 3K7AC 4MEYA 1SFOC 2A6HA 1Y1WC 2O5IA 3S17C 4A3CC 3GTJC 3HOXK 2A68A 3HOYK 3PO3C 1WCMC 3H3VL 3HOWK 4A93K 2R93K 1Y1VC 2JA5C 4G7OA 3GTGC 1TWHC 3HOZC 1YNJA 2E2JK 2CW0A 2Y0SD 2NVXK 3S15K 4A3BC 4OIRA 3HKZD 2B63C 3S1QK 5C4JC 1XPPA 4XSXA 1TWFC 4OIPA 5C44C 1I6VA 4LK0A 3GTKC 5IP9C 4A3JK 4BBSC 5C4XC 5FJ8K 4BY1C 4A3LK 2R7ZC 2YU9K 4AYBD 2JA8C 1TWAK 2WAQL 3H3VD 2R92K 2JA7C 1K83C 4XSZA 5IYDK 4KN7A 3GTPC 2NVQC 2WB1D 3M4OK 2VUMK 4KMUA 5TMFA 3S2DK 5D4DA 2A6EA 3HKZL 3RZDK 3S1RK 3HOVK 1SFOK 1Y1WK 4A3CK 4YFXA 5M3FK 4BY7C 3H0GC 5C3EC 3PO3K 2NVTC 4C2MK 1WCMK 2JA6C 4QIWL 3EQLA 4AYBL 5IYBC 1Y1VK 2JA5K 3GTGK 1TWHK 3HOZK 2WAQD 4A3BK 2WB1L 3S14K 5FLMC 5M5XK 5C4JK 4X6AC 3GTOK 4C3HK 4A3EK 1TWFK 3PO2K 5C44K 4A3DC 5IP9K 5C4XK 1I50C 4XLPA 4BBSK 2R7ZK 4OIQA 2JA8K 3I4NC 4QIWD 2PPBA 1K83K 1TWCC 2JA7K 3GTMC 3GTPK 1IW7A 2NVQK 4A3FC 4A3MC 4BBRC 4BXXC 3GTQC 3HOVC 4MQ9A 1R9TC 4A3GK 4A3GC 3S1NK 3S1MC 1I6HC 2E2IK 5IP7C 4QJVA 2O5JA 3K7AK 4KN4A 4A3KC 3H0GK 4BY7K 5C3EK 4OIOA 2NVTK 2JA6K 3S17K 3S16C 5TMCA 5IYBK
chains in the Genus database with same CATH superfamily
4GTBA 4A93C 4NOIA 1TWGA 1ZVUA 1DCOA 2GAHC 3T01A 3TFHA 3RZOC 4LLGA 1TWCA 2BE5A 1J6XA 2GSOA 1WQFA 1R9TA 1TWGC 3I4MC 3A8JA 1L0WA 3ERED 4QJVB 4BBRK 4OINA 3GTQK 4BXXK 1VJEA 2P5MA 3AD9C 3Q3QA 4LOWA 4XLNA 2RGRA 1WOSA 3HOXC 2P8TA 3IPJA 3HOWC 3RZOK 2FQTA 2PA8D 3S14C 2E2JC 3N0CA 4C3HC 1TWAA 3S15C 1TWGK 4LK1A 3I4MK 3GEIA 2VUMA 1F9NA 4A3JC 4JK1A 4A3MK 2ZUEA 3S1MK 1IQ0A 3S1NC 2E2IC 3NUHA 5M5YK 2VUMC 1GE9A 4G0WA 2O5IA 3GTJC 3HOXK 2FQOA 1WQGA 3GTOA 3HOWK 4P9SA 5L46A 1JQWA 3HOZC 1O25A 2E2JK 4LR2A 3S15K 4A3BC 4OIRA 1PJ6A 3GDZA 1I6VA 4LK0A 3GTKC 4A3JK 4BBSC 1VH2A 1TWAK 4KN7A 2NVQC 4A3GC 2VUMK 5D4DA 4GTCA 3S1RK 5M3FK 4LQYA 1WSRA 1IS1A 1KQ4A 5IYBC 1B4AA 1I50A 3HOZK 5CHPA 4KC6A 4A3BK 3AD7C 4X6AC 3GTOK 4GTDA 4A3EK 3PO2K 4A3DC 2CFAB 1I50C 4XLPA 4G0VA 3GTPA 4ILDA 4BBSK 4OIQA 4KASA 4QIWD 2PPBA 1J6VA 2NVQK 4A3FC 4A3GK 4PAAA 1I6HC 2XCQA 5IP7C 4QJVA 1UV7A 1XXAA 5IYBK 2W7VA 4C3JC 3T02A 1HQMA 2R93C 1O24A 3GEHA 1F7VA 4X6AK 3S1QC 4A3DK 1I3QC 1I50K 3BP3A 4MEXA 3GTQA 4GFQA 4BY1K 2NVYA 4LJZA 1XZQB 4WJ4A 1I6HK 5IYDC 3N3YA 3GTLC 2NVYC 3M3YC 3SZYA 4GZYA 4XCHA 2A69A 1WQHA 2EBBA 4C3JK 5HL8A 3HOYC 1VRQC 2PMZL 2KWAA 4GTAA 4AH6A 5FLMK 1I3QK 2NVXC 4KMAA 1WORA 3GIRA 4GTLA 3DXJA 4KAWX 4A3LC 3S0XA 2R92C 3GTLK 2NVYK 4KMDA 3M3YK 1Y1VA 1TWHA 1ISEA 1Y1WC 1O2BA 3HOYK 1XZPA 4A93K 1Y1VC 2JA5C 3GTGC 1TWHC 2NVXK 3HKZD 2B63C 5C4JC 2JA7A 4OIPA 1TWFC 5C44C 5IP9C 5FJ8K 4A3LK 1J98A 2E2IA 2JA8C 5TJ3A 2GSNA 2WAQL 4FZBA 2R92K 2JA7C 5CJ9A 3GTJA 2WB1D 4C45A 4KMUA 5TMFA 2A6EA 3HKZL 4GTEA 1Y1WK 1PJ5A 4BY7C 1IBAA 2Y3PA 3T00A 4GT9A 3EQLA 3A8IA 1Y1VK 2JA5K 3GTGK 1TWHK 4KDDA 3GTKA 2WB1L 3AD8C 4KATA 3S14K 5C4JK 2GAGC 1ZBSA 4C3HK 1TWFK 5C44K 1O28A 5IP9K 3MMLB 2JA8K 2XCOA 3I4NC 1USOA 1XXBA 2JA7K 3AQPA 1IW7A 3HOVC 4MQ9A 5EGHA 3S1NK 2E2IK 1O26A 4A3KC 4BY7K 5E68A 3GTJK 3GSIA 3FKIC 1RU0A 1IL2A 3OPFA 3CQZC 1ZQ1C 3GTKK 2E2HA 3I4NK 4Y52C 1J6WA 1YNNA 3S2HC 4Q4ZA 4DDQA 3TFJA 3HOVK 2E2HC 4Q5SA 4A3KK 3RZDC 2R93A 3N0BA 3HOUC 2ZUFA 4G7HA 1ZYRA 1SMYA 1O29A 1I3QA 4YFNA 1HI9A 3FKIK 3WODA 4KB2A 3CQZK 1EFWA 4Y52K 3S2HK 3GTLA 5M5WK 4KM9A 1C0AA 1JOEA 2PMZD 4A3FK 2Y0SL 1BDFA 2E2HK 1WCMA 1G51A 4P5AA 5IP7K 3HOUK 3S2DC 3K7AC 4P5BA 1SFOC 2A6HA 3S17C 2A68A 3PO3C 3A8KA 1WCMC 2NVXA 4O2DA 3H3VL 2R93K 4G7OA 1YNJA 2CW0A 4KARA 1F7UA 3S1QK 3LAPA 1XPPA 3OREA 5IOSA 3V4GA 2R92A 3FOEA 4AYBD 2ZFZA 3L4JA 1K83C 1Y1WA 5IYDK 3S2DK 1SFOK 2JA5A 3H0GC 3GTGA 3PO3K 2V6TA 2NVTC 1WCMK 2JA6C 2B63A 1AB4A 4AYBL 1TWFA 2WAQD 2RH6A 1INNA 5M5XK 3GTMA 1YX2A 1XXCA 1B4BA 3ADAC 1VLOA 3BUEA 1K83K 1TWCC 3LPXA 3GTMC 2CFAA 1BS2A 4PABA 4A3MC 3G4CA 1IE0A 1R9TC 3S1MC 4KMHA 3H0GK 4OIOA 2NVTK 2JA6K 3S16C 2V6SA 3L4KA 1DCHA 4KB4A 4YFKA 4WJ3M 1YCLA 3TTGA 2B63K 1WIHA 1JVIA 3G4AA 1TWCK 4C3IC 3GTMK 1TWAC 3CAGA 4M1XA 4YG2A 5M3MK 2PA8L 4Y7NC 4A3IC 1R9TK 3QX3A 5JFEA 5IYCC 5EGEA 3S1RC 1BGWA 1XZQA 3S16K 4KM8A 1EI6A 1O2FB 3FKIA 5JVOA 5IOQA 3TFIA 1F93A 3CQZA 2V6UA 2PHCB 4ZH4A 4G7ZA 1EQRA 3SZZA 2YU9A 3HXAA 3GTOC 4A3EC 3PO2C 3FHZA 4C3IK 1O27A 2GSUA 1VGXA 4Y7NK 3BP8C 4A3IK 2YU9C 1V5VA 5IYCK 4BLAA 4RMFA 3LAJA 3M4OC 1XZPB 4MEYA 4A3CC 4WILA 4C2MC 1ZXOA 3JSTA 1EH1A 2R7ZA 2Y0SD 2D6FC 1DCPA 4J3NA 4XSXA 1PJ7A 1X31C 5IOTA 4FM9A 5C4XC 4BY1C 2R7ZC 3FOFA 2YU9K 3GEEA 3H3VD 1SFOA 4XSZA 3GTPC 5IORA 3M4OK 1EK8A 3VA7A 3RZDK 2XCRB 4A3CK 4YFXA 1WOOA 5C3EC 4C2MK 4QIWL 3OEPA 4G0UA 1O2AA 3AH5A 1WOPA 1BJTA 5FLMC 5C4XK 1WSVA 1K83A 2R7ZK 3AQOA 4BLBA 4BKWA 1USMA 3GTPK 2JH3A 3H0GA 4BBRC 4BXXC 3GTQC 2JA6A 2O5JA 3K7AK 4KN4A 5C3EK 4GTFA 3S17K 1DD5A 5TMCA
chains in the Genus database with same CATH topology
4YFKA 1HQMA 4A93C 2R93C 4NOIA 3RZOC 3FKIC 4X6AK 4LLGA 2B63K 3S1QC 4A3DK 1I3QC 1I50K 2BE5A 3CQZC 4MEXA 3GTKK 1TWGC 4BY1K 3I4NK 3I4MC 4BXXK 4Y52C 1YNNA 1TWCK 3GTMK 3S2HC 4LJZA 1TWAC 4Q4ZA 4QJVB 4YG2A 4BBRK 5M3MK 2PA8L 4Y7NC 4A3IC 1R9TK 5IYDC 5IYCC 4OINA 3GTQK 1I6HK 2E2HC 3GTLC 4Q5SA 4A3KK 3RZDC 3S1RC 2NVYC 3M3YC 4GZYA 3HOUC 3S16K 4XLNA 4G7HA 2A69A 4C3JK 1ZYRA 1SMYA 3HOXC 3HOYC 2PMZL 4YFNA 4G7ZA 4ZH4A 3HOWC 3RZOK 3FKIK 2PA8D 5FLMK 3S14C 1I3QK 2E2JC 3WODA 2NVXC 3GTOC 3S15C 4A3EC 3CQZK 3PO2C 3DXJA 1TWGK 4LK1A 3I4MK 4Y52K 3GTJK 4C3IK 3S2HK 5M5WK 4A3JC 4JK1A 4A3LC 4Y7NK 4A3IK 2YU9C 5IYCK 2PMZD 4A3FK 4A3MK 2Y0SL 1BDFA 2E2HK 2R92C 3GTLK 3S1MK 3S1NC 2NVYK 5IP7K 2E2IC 3M3YK 5M5YK 3M4OC 2VUMC 3HOUK 3S2DC 3K7AC 4MEYA 1SFOC 2A6HA 1Y1WC 2O5IA 3S17C 4A3CC 3GTJC 3HOXK 2A68A 3HOYK 3PO3C 1WCMC 3H3VL 3HOWK 4A93K 2R93K 1Y1VC 2JA5C 4G7OA 3GTGC 1TWHC 3HOZC 1YNJA 2E2JK 2CW0A 2Y0SD 2NVXK 3S15K 4A3BC 4OIRA 3HKZD 2B63C 3S1QK 5C4JC 1XPPA 4XSXA 1TWFC 4OIPA 5C44C 1I6VA 4LK0A 3GTKC 5IP9C 4A3JK 4BBSC 5C4XC 5FJ8K 4BY1C 4A3LK 2R7ZC 2YU9K 4AYBD 2JA8C 1TWAK 2WAQL 3H3VD 2R92K 2JA7C 1K83C 4XSZA 5IYDK 4KN7A 3GTPC 2NVQC 2WB1D 3M4OK 2VUMK 4KMUA 5TMFA 3S2DK 5D4DA 2A6EA 3HKZL 3RZDK 3S1RK 3HOVK 1SFOK 1Y1WK 4A3CK 4YFXA 5M3FK 4BY7C 3H0GC 5C3EC 3PO3K 2NVTC 4C2MK 1WCMK 2JA6C 4QIWL 3EQLA 4AYBL 5IYBC 1Y1VK 2JA5K 3GTGK 1TWHK 3HOZK 2WAQD 4A3BK 2WB1L 3S14K 5FLMC 5M5XK 5C4JK 4X6AC 3GTOK 4C3HK 4A3EK 1TWFK 3PO2K 5C44K 4A3DC 5IP9K 5C4XK 1I50C 4XLPA 4BBSK 2R7ZK 4OIQA 2JA8K 3I4NC 4QIWD 2PPBA 1K83K 1TWCC 2JA7K 3GTMC 3GTPK 1IW7A 2NVQK 4A3FC 4A3MC 4BBRC 4BXXC 3GTQC 3HOVC 4MQ9A 1R9TC 4A3GK 4A3GC 3S1NK 3S1MC 1I6HC 2E2IK 5IP7C 4QJVA 2O5JA 3K7AK 4KN4A 4A3KC 3H0GK 4BY7K 5C3EK 4OIOA 2NVTK 2JA6K 3S17K 3S16C 5TMCA 5IYBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFK A;  1HQM A;  4A93 C;  2R93 C;  4NOI A;  3RZO C;  3FKI C;  4X6A K;  4LLG A;  2B63 K;  3S1Q C;  4A3D K;  1I3Q C;  1I50 K;  2BE5 A;  3CQZ C;  4MEX A;  3GTK K;  1TWG C;  4BY1 K;  3I4N K;  3I4M C;  4BXX K;  4Y52 C;  1YNN A;  1TWC K;  3GTM K;  3S2H C;  4LJZ A;  1TWA C;  4Q4Z A;  4QJV B;  4YG2 A;  4BBR K;  5M3M K;  2PA8 L;  4Y7N C;  4A3I C;  1R9T K;  5IYD C;  5IYC C;  4OIN A;  3GTQ K;  1I6H K;  2E2H C;  3GTL C;  4Q5S A;  4A3K K;  3RZD C;  3S1R C;  2NVY C;  3M3Y C;  4GZY A;  3HOU C;  3S16 K;  4XLN A;  4G7H A;  2A69 A;  4C3J K;  1ZYR A;  1SMY A;  3HOX C;  3HOY C;  2PMZ L;  4YFN A;  4G7Z A;  4ZH4 A;  3HOW C;  3RZO K;  3FKI K;  2PA8 D;  5FLM K;  3S14 C;  1I3Q K;  2E2J C;  3WOD A;  2NVX C;  3GTO C;  3S15 C;  4A3E C;  3CQZ K;  3PO2 C;  3DXJ A;  1TWG K;  4LK1 A;  3I4M K;  4Y52 K;  3GTJ K;  4C3I K;  3S2H K;  5M5W K;  4A3J C;  4JK1 A;  4A3L C;  4Y7N K;  4A3I K;  2YU9 C;  5IYC K;  2PMZ D;  4A3F K;  4A3M K;  2Y0S L;  1BDF A;  2E2H K;  2R92 C;  3GTL K;  3S1M K;  3S1N C;  2NVY K;  5IP7 K;  2E2I C;  3M3Y K;  5M5Y K;  3M4O C;  2VUM C;  3HOU K;  3S2D C;  3K7A C;  4MEY A;  1SFO C;  2A6H A;  1Y1W C;  2O5I A;  3S17 C;  4A3C C;  3GTJ C;  3HOX K;  2A68 A;  3HOY K;  3PO3 C;  1WCM C;  3H3V L;  3HOW K;  4A93 K;  2R93 K;  1Y1V C;  2JA5 C;  4G7O A;  3GTG C;  1TWH C;  3HOZ C;  1YNJ A;  2E2J K;  2CW0 A;  2Y0S D;  2NVX K;  3S15 K;  4A3B C;  4OIR A;  3HKZ D;  2B63 C;  3S1Q K;  5C4J C;  1XPP A;  4XSX A;  1TWF C;  4OIP A;  5C44 C;  1I6V A;  4LK0 A;  3GTK C;  5IP9 C;  4A3J K;  4BBS C;  5C4X C;  5FJ8 K;  4BY1 C;  4A3L K;  2R7Z C;  2YU9 K;  4AYB D;  2JA8 C;  1TWA K;  2WAQ L;  3H3V D;  2R92 K;  2JA7 C;  1K83 C;  4XSZ A;  5IYD K;  4KN7 A;  3GTP C;  2NVQ C;  2WB1 D;  3M4O K;  2VUM K;  4KMU A;  5TMF A;  3S2D K;  5D4D A;  2A6E A;  3HKZ L;  3RZD K;  3S1R K;  3HOV K;  1SFO K;  1Y1W K;  4A3C K;  4YFX A;  5M3F K;  4BY7 C;  3H0G C;  5C3E C;  3PO3 K;  2NVT C;  4C2M K;  1WCM K;  2JA6 C;  4QIW L;  3EQL A;  4AYB L;  5IYB C;  1Y1V K;  2JA5 K;  3GTG K;  1TWH K;  3HOZ K;  2WAQ D;  4A3B K;  2WB1 L;  3S14 K;  5FLM C;  5M5X K;  5C4J K;  4X6A C;  3GTO K;  4C3H K;  4A3E K;  1TWF K;  3PO2 K;  5C44 K;  4A3D C;  5IP9 K;  5C4X K;  1I50 C;  4XLP A;  4BBS K;  2R7Z K;  4OIQ A;  2JA8 K;  3I4N C;  4QIW D;  2PPB A;  1K83 K;  1TWC C;  2JA7 K;  3GTM C;  3GTP K;  1IW7 A;  2NVQ K;  4A3F C;  4A3M C;  4BBR C;  4BXX C;  3GTQ C;  3HOV C;  4MQ9 A;  1R9T C;  4A3G K;  4A3G C;  3S1N K;  3S1M C;  1I6H C;  2E2I K;  5IP7 C;  4QJV A;  2O5J A;  3K7A K;  4KN4 A;  4A3K C;  3H0G K;  4BY7 K;  5C3E K;  4OIO A;  2NVT K;  2JA6 K;  3S17 K;  3S16 C;  5TMC A;  5IYB K; 
#chains in the Genus database with same CATH topology
 4GTB A;  4A93 C;  4NOI A;  1TWG A;  1ZVU A;  1DCO A;  2GAH C;  3T01 A;  3TFH A;  3RZO C;  4LLG A;  1TWC A;  2BE5 A;  1J6X A;  2GSO A;  1WQF A;  1R9T A;  1TWG C;  3I4M C;  3A8J A;  1L0W A;  3ERE D;  4QJV B;  4BBR K;  4OIN A;  3GTQ K;  4BXX K;  1VJE A;  2P5M A;  3AD9 C;  3Q3Q A;  4LOW A;  4XLN A;  2RGR A;  1WOS A;  3HOX C;  2P8T A;  3IPJ A;  3HOW C;  3RZO K;  2FQT A;  2PA8 D;  3S14 C;  2E2J C;  3N0C A;  4C3H C;  1TWA A;  3S15 C;  1TWG K;  4LK1 A;  3I4M K;  3GEI A;  2VUM A;  1F9N A;  4A3J C;  4JK1 A;  4A3M K;  2ZUE A;  3S1M K;  1IQ0 A;  3S1N C;  2E2I C;  3NUH A;  5M5Y K;  2VUM C;  1GE9 A;  4G0W A;  2O5I A;  3GTJ C;  3HOX K;  2FQO A;  1WQG A;  3GTO A;  3HOW K;  4P9S A;  5L46 A;  1JQW A;  3HOZ C;  1O25 A;  2E2J K;  4LR2 A;  3S15 K;  4A3B C;  4OIR A;  1PJ6 A;  3GDZ A;  1I6V A;  4LK0 A;  3GTK C;  4A3J K;  4BBS C;  1VH2 A;  1TWA K;  4KN7 A;  2NVQ C;  4A3G C;  2VUM K;  5D4D A;  4GTC A;  3S1R K;  5M3F K;  4LQY A;  1WSR A;  1IS1 A;  1KQ4 A;  5IYB C;  1B4A A;  1I50 A;  3HOZ K;  5CHP A;  4KC6 A;  4A3B K;  3AD7 C;  4X6A C;  3GTO K;  4GTD A;  4A3E K;  3PO2 K;  4A3D C;  2CFA B;  1I50 C;  4XLP A;  4G0V A;  3GTP A;  4ILD A;  4BBS K;  4OIQ A;  4KAS A;  4QIW D;  2PPB A;  1J6V A;  2NVQ K;  4A3F C;  4A3G K;  4PAA A;  1I6H C;  2XCQ A;  5IP7 C;  4QJV A;  1UV7 A;  1XXA A;  5IYB K;  2W7V A;  4C3J C;  3T02 A;  1HQM A;  2R93 C;  1O24 A;  3GEH A;  1F7V A;  4X6A K;  3S1Q C;  4A3D K;  1I3Q C;  1I50 K;  3BP3 A;  4MEX A;  3GTQ A;  4GFQ A;  4BY1 K;  2NVY A;  4LJZ A;  1XZQ B;  4WJ4 A;  1I6H K;  5IYD C;  3N3Y A;  3GTL C;  2NVY C;  3M3Y C;  3SZY A;  4GZY A;  4XCH A;  2A69 A;  1WQH A;  2EBB A;  4C3J K;  5HL8 A;  3HOY C;  1VRQ C;  2PMZ L;  2KWA A;  4GTA A;  4AH6 A;  5FLM K;  1I3Q K;  2NVX C;  4KMA A;  1WOR A;  3GIR A;  4GTL A;  3DXJ A;  4KAW X;  4A3L C;  3S0X A;  2R92 C;  3GTL K;  2NVY K;  4KMD A;  3M3Y K;  1Y1V A;  1TWH A;  1ISE A;  1Y1W C;  1O2B A;  3HOY K;  1XZP A;  4A93 K;  1Y1V C;  2JA5 C;  3GTG C;  1TWH C;  2NVX K;  3HKZ D;  2B63 C;  5C4J C;  2JA7 A;  4OIP A;  1TWF C;  5C44 C;  5IP9 C;  5FJ8 K;  4A3L K;  1J98 A;  2E2I A;  2JA8 C;  5TJ3 A;  2GSN A;  2WAQ L;  4FZB A;  2R92 K;  2JA7 C;  5CJ9 A;  3GTJ A;  2WB1 D;  4C45 A;  4KMU A;  5TMF A;  2A6E A;  3HKZ L;  4GTE A;  1Y1W K;  1PJ5 A;  4BY7 C;  1IBA A;  2Y3P A;  3T00 A;  4GT9 A;  3EQL A;  3A8I A;  1Y1V K;  2JA5 K;  3GTG K;  1TWH K;  4KDD A;  3GTK A;  2WB1 L;  3AD8 C;  4KAT A;  3S14 K;  5C4J K;  2GAG C;  1ZBS A;  4C3H K;  1TWF K;  5C44 K;  1O28 A;  5IP9 K;  3MML B;  2JA8 K;  2XCO A;  3I4N C;  1USO A;  1XXB A;  2JA7 K;  3AQP A;  1IW7 A;  3HOV C;  4MQ9 A;  5EGH A;  3S1N K;  2E2I K;  1O26 A;  4A3K C;  4BY7 K;  5E68 A;  3GTJ K;  3GSI A;  3FKI C;  1RU0 A;  1IL2 A;  3OPF A;  3CQZ C;  1ZQ1 C;  3GTK K;  2E2H A;  3I4N K;  4Y52 C;  1J6W A;  1YNN A;  3S2H C;  4Q4Z A;  4DDQ A;  3TFJ A;  3HOV K;  2E2H C;  4Q5S A;  4A3K K;  3RZD C;  2R93 A;  3N0B A;  3HOU C;  2ZUF A;  4G7H A;  1ZYR A;  1SMY A;  1O29 A;  1I3Q A;  4YFN A;  1HI9 A;  3FKI K;  3WOD A;  4KB2 A;  3CQZ K;  1EFW A;  4Y52 K;  3S2H K;  3GTL A;  5M5W K;  4KM9 A;  1C0A A;  1JOE A;  2PMZ D;  4A3F K;  2Y0S L;  1BDF A;  2E2H K;  1WCM A;  1G51 A;  4P5A A;  5IP7 K;  3HOU K;  3S2D C;  3K7A C;  4P5B A;  1SFO C;  2A6H A;  3S17 C;  2A68 A;  3PO3 C;  3A8K A;  1WCM C;  2NVX A;  4O2D A;  3H3V L;  2R93 K;  4G7O A;  1YNJ A;  2CW0 A;  4KAR A;  1F7U A;  3S1Q K;  3LAP A;  1XPP A;  3ORE A;  5IOS A;  3V4G A;  2R92 A;  3FOE A;  4AYB D;  2ZFZ A;  3L4J A;  1K83 C;  1Y1W A;  5IYD K;  3S2D K;  1SFO K;  2JA5 A;  3H0G C;  3GTG A;  3PO3 K;  2V6T A;  2NVT C;  1WCM K;  2JA6 C;  2B63 A;  1AB4 A;  4AYB L;  1TWF A;  2WAQ D;  2RH6 A;  1INN A;  5M5X K;  3GTM A;  1YX2 A;  1XXC A;  1B4B A;  3ADA C;  1VLO A;  3BUE A;  1K83 K;  1TWC C;  3LPX A;  3GTM C;  2CFA A;  1BS2 A;  4PAB A;  4A3M C;  3G4C A;  1IE0 A;  1R9T C;  3S1M C;  4KMH A;  3H0G K;  4OIO A;  2NVT K;  2JA6 K;  3S16 C;  2V6S A;  3L4K A;  1DCH A;  4KB4 A;  4YFK A;  4WJ3 M;  1YCL A;  3TTG A;  2B63 K;  1WIH A;  1JVI A;  3G4A A;  1TWC K;  4C3I C;  3GTM K;  1TWA C;  3CAG A;  4M1X A;  4YG2 A;  5M3M K;  2PA8 L;  4Y7N C;  4A3I C;  1R9T K;  3QX3 A;  5JFE A;  5IYC C;  5EGE A;  3S1R C;  1BGW A;  1XZQ A;  3S16 K;  4KM8 A;  1EI6 A;  1O2F B;  3FKI A;  5JVO A;  5IOQ A;  3TFI A;  1F93 A;  3CQZ A;  2V6U A;  2PHC B;  4ZH4 A;  4G7Z A;  1EQR A;  3SZZ A;  2YU9 A;  3HXA A;  3GTO C;  4A3E C;  3PO2 C;  3FHZ A;  4C3I K;  1O27 A;  2GSU A;  1VGX A;  4Y7N K;  3BP8 C;  4A3I K;  2YU9 C;  1V5V A;  5IYC K;  4BLA A;  4RMF A;  3LAJ A;  3M4O C;  1XZP B;  4MEY A;  4A3C C;  4WIL A;  4C2M C;  1ZXO A;  3JST A;  1EH1 A;  2R7Z A;  2Y0S D;  2D6F C;  1DCP A;  4J3N A;  4XSX A;  1PJ7 A;  1X31 C;  5IOT A;  4FM9 A;  5C4X C;  4BY1 C;  2R7Z C;  3FOF A;  2YU9 K;  3GEE A;  3H3V D;  1SFO A;  4XSZ A;  3GTP C;  5IOR A;  3M4O K;  1EK8 A;  3VA7 A;  3RZD K;  2XCR B;  4A3C K;  4YFX A;  1WOO A;  5C3E C;  4C2M K;  4QIW L;  3OEP A;  4G0U A;  1O2A A;  3AH5 A;  1WOP A;  1BJT A;  5FLM C;  5C4X K;  1WSV A;  1K83 A;  2R7Z K;  3AQO A;  4BLB A;  4BKW A;  1USM A;  3GTP K;  2JH3 A;  3H0G A;  4BBR C;  4BXX C;  3GTQ C;  2JA6 A;  2O5J A;  3K7A K;  4KN4 A;  5C3E K;  4GTF A;  3S17 K;  1DD5 A;  5TMC A; 
#chains in the Genus database with same CATH homology
 4YFK A;  1HQM A;  4A93 C;  2R93 C;  4NOI A;  3RZO C;  3FKI C;  4X6A K;  4LLG A;  2B63 K;  3S1Q C;  4A3D K;  1I3Q C;  1I50 K;  2BE5 A;  3CQZ C;  4MEX A;  3GTK K;  1TWG C;  4BY1 K;  3I4N K;  3I4M C;  4BXX K;  4Y52 C;  1YNN A;  1TWC K;  3GTM K;  3S2H C;  4LJZ A;  1TWA C;  4Q4Z A;  4QJV B;  4YG2 A;  4BBR K;  5M3M K;  2PA8 L;  4Y7N C;  4A3I C;  1R9T K;  5IYD C;  5IYC C;  4OIN A;  3GTQ K;  1I6H K;  2E2H C;  3GTL C;  4Q5S A;  4A3K K;  3RZD C;  3S1R C;  2NVY C;  3M3Y C;  4GZY A;  3HOU C;  3S16 K;  4XLN A;  4G7H A;  2A69 A;  4C3J K;  1ZYR A;  1SMY A;  3HOX C;  3HOY C;  2PMZ L;  4YFN A;  4G7Z A;  4ZH4 A;  3HOW C;  3RZO K;  3FKI K;  2PA8 D;  5FLM K;  3S14 C;  1I3Q K;  2E2J C;  3WOD A;  2NVX C;  3GTO C;  3S15 C;  4A3E C;  3CQZ K;  3PO2 C;  3DXJ A;  1TWG K;  4LK1 A;  3I4M K;  4Y52 K;  3GTJ K;  4C3I K;  3S2H K;  5M5W K;  4A3J C;  4JK1 A;  4A3L C;  4Y7N K;  4A3I K;  2YU9 C;  5IYC K;  2PMZ D;  4A3F K;  4A3M K;  2Y0S L;  1BDF A;  2E2H K;  2R92 C;  3GTL K;  3S1M K;  3S1N C;  2NVY K;  5IP7 K;  2E2I C;  3M3Y K;  5M5Y K;  3M4O C;  2VUM C;  3HOU K;  3S2D C;  3K7A C;  4MEY A;  1SFO C;  2A6H A;  1Y1W C;  2O5I A;  3S17 C;  4A3C C;  3GTJ C;  3HOX K;  2A68 A;  3HOY K;  3PO3 C;  1WCM C;  3H3V L;  3HOW K;  4A93 K;  2R93 K;  1Y1V C;  2JA5 C;  4G7O A;  3GTG C;  1TWH C;  3HOZ C;  1YNJ A;  2E2J K;  2CW0 A;  2Y0S D;  2NVX K;  3S15 K;  4A3B C;  4OIR A;  3HKZ D;  2B63 C;  3S1Q K;  5C4J C;  1XPP A;  4XSX A;  1TWF C;  4OIP A;  5C44 C;  1I6V A;  4LK0 A;  3GTK C;  5IP9 C;  4A3J K;  4BBS C;  5C4X C;  5FJ8 K;  4BY1 C;  4A3L K;  2R7Z C;  2YU9 K;  4AYB D;  2JA8 C;  1TWA K;  2WAQ L;  3H3V D;  2R92 K;  2JA7 C;  1K83 C;  4XSZ A;  5IYD K;  4KN7 A;  3GTP C;  2NVQ C;  2WB1 D;  3M4O K;  2VUM K;  4KMU A;  5TMF A;  3S2D K;  5D4D A;  2A6E A;  3HKZ L;  3RZD K;  3S1R K;  3HOV K;  1SFO K;  1Y1W K;  4A3C K;  4YFX A;  5M3F K;  4BY7 C;  3H0G C;  5C3E C;  3PO3 K;  2NVT C;  4C2M K;  1WCM K;  2JA6 C;  4QIW L;  3EQL A;  4AYB L;  5IYB C;  1Y1V K;  2JA5 K;  3GTG K;  1TWH K;  3HOZ K;  2WAQ D;  4A3B K;  2WB1 L;  3S14 K;  5FLM C;  5M5X K;  5C4J K;  4X6A C;  3GTO K;  4C3H K;  4A3E K;  1TWF K;  3PO2 K;  5C44 K;  4A3D C;  5IP9 K;  5C4X K;  1I50 C;  4XLP A;  4BBS K;  2R7Z K;  4OIQ A;  2JA8 K;  3I4N C;  4QIW D;  2PPB A;  1K83 K;  1TWC C;  2JA7 K;  3GTM C;  3GTP K;  1IW7 A;  2NVQ K;  4A3F C;  4A3M C;  4BBR C;  4BXX C;  3GTQ C;  3HOV C;  4MQ9 A;  1R9T C;  4A3G K;  4A3G C;  3S1N K;  3S1M C;  1I6H C;  2E2I K;  5IP7 C;  4QJV A;  2O5J A;  3K7A K;  4KN4 A;  4A3K C;  3H0G K;  4BY7 K;  5C3E K;  4OIO A;  2NVT K;  2JA6 K;  3S17 K;  3S16 C;  5TMC A;  5IYB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...