2WB1L

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
b'MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2wb1L00
3HOUK 2R7ZK 3GTKC 3S1MC 1TWHK 2VUMC 3HOZC 3S1RC 4KN4A 3RZDK 4Q4ZA 1Y1VC 2PMZL 3HKZD 2E2HC 4OIOA 4A3BC 5M3MK 3GTOC 3M4OC 2BE5A 2JA8K 3S2DK 4XSZA 2B63K 3HKZL 5D4DA 4YFKA 3H0GC 2NVYK 1I6VA 1TWFC 4C3JK 2A6HA 4X6AC 5IYDK 5IP7K 3FKIK 2NVQC 3HOUC 1SFOK 5IP9K 2R7ZC 4MEXA 3S1NK 1TWHC 2JA6K 5M3FK 3RZDC 4A3FK 4QJVA 4G7ZA 4G7OA 2R92K 4QJVB 2R93K 2JA8C 3S2DC 4C3IK 3GTJK 2B63C 3GTGK 3GTPK 2NVYC 2A69A 5M5WK 1TWGK 2PPBA 3I4NK 4A3CK 5IYDC 3PO3K 3FKIC 3S1NC 2PA8D 5IP9C 1SFOC 1I3QK 5C3EK 2O5IA 4BY1K 2JA6C 4A3FC 1ZYRA 4A3GK 2R92C 1TWAK 2R93C 2PA8L 5C44K 3RZOK 1K83K 4C2MK 3GTJC 3HOYK 3HOVK 3GTGC 3GTPC 4A3LK 3GTQC 4A3CC 1TWGC 2JA7K 3I4NC 2E2IK 3M3YK 4MEYA 2NVXK 3PO3C 1I3QC 2NVTK 3HOXK 5C3EC 4BY1C 3CQZK 4BBRC 2O5JA 4A3GC 5TMCA 1TWAC 3HOWK 4AYBD 5C44C 3RZOC 4LLGA 1K83C 1R9TK 3HOYC 1TWCK 2E2JK 5IYBK 3HOVC 4A3LC 2YU9K 4AYBL 4OINA 2JA7C 3GTQK 2E2IC 4A3MK 3M3YC 2NVXC 2CW0A 1HQMA 2NVTC 1BDFA 3HOXC 4BXXK 3CQZC 2A6EA 3K7AK 4OIPA 3S16K 4BBRK 3I4MK 3HOWC 4OIQA 4LK0A 4XLPA 4BBSK 4GZYA 1R9TC 4YG2A 1Y1WK 4Q5SA 1TWCC 4BY7K 2E2JC 5IYBC 3S1QK 4A3JK 4A3IK 2YU9C 1YNJA 2WAQL 3PO2K 4A93K 4A3MC 5TMFA 5FLMK 4G7HA 3S14K 4A3EK 4A3KK 4BXXC 2JA5K 5IYCK 3K7AC 4C3HK 3S16C 3I4MC 4BBSC 4Y7NK 1SMYA 1Y1WC 4YFNA 4BY7C 3GTLK 3GTMK 3S1QC 3EQLA 4LK1A 1XPPA 3WODA 4A3JC 5FJ8K 4QIWD 4LJZA 1IW7A 5C4JK 4A3IC 3PO2C 4A93C 4ZH4A 4XLNA 5FLMC 3H3VD 4JK1A 3S14C 4KMUA 1WCMK 4A3EC 4A3KC 2JA5C 5IYCC 3S2HK 4QIWL 4A3DK 4Y52K 3S17K 1I50K 3S15K 4Y7NC 3H3VL 1I6HK 2WAQD 2Y0SD 4KN7A 4YFXA 3GTLC 3DXJA 3GTMC 2A68A 5C4JC 5C4XK 3GTKK 3S1MK 4OIRA 5M5YK 2VUMK 3HOZK 2Y0SL 2WB1D 3S1RK 1WCMC 1Y1VK 2E2HK 4A3BK 4XSXA 3S2HC 5M5XK 3GTOK 3M4OK 4A3DC 4Y52C 3S17C 1I50C 4MQ9A 3S15C 2WB1L 1I6HC 4NOIA 3H0GK 2PMZD 1TWFK 4X6AK 5IP7C 1YNNA 5C4XC 2NVQK
chains in the Genus database with same CATH superfamily
2R7ZK 3S1MC 1Y1WA 1TWHK 1K83A 3HOZC 4KN4A 4Q4ZA 1Y1VC 4A3BC 4OIOA 2V6TA 3GTOC 3T01A 4ILDA 1PJ5A 1J98A 1WQGA 5D4DA 4YFKA 1TWFC 3FKIK 3HOUC 1SFOK 5IP9K 1TWCA 3RZDC 4G7ZA 2R92K 4RMFA 3S2DC 4C3IK 1O27A 2B63C 3S1NC 2PA8D 1I3QK 4BY1K 2D6FC 4KARA 3GEHA 2R93C 3RZOK 1F7VA 3A8IA 3AD7C 4FM9A 1J6XA 2JA7K 3I4NC 2FQOA 4KB2A 2E2IK 5L46A 1X31C 3GTLA 2O5JA 4A3GC 5TMCA 5EGHA 5C44C 4GTBA 4KMAA 4C2MC 1R9TK 2E2JK 1WCMA 3HOVC 4A3LC 1BS2A 1VJEA 4AYBL 4OINA 2NVXC 2NVYA 4XCHA 2A6EA 3S16K 5TJ3A 4OIQA 4BBSK 1AB4A 3OEPA 2JA6A 1VH2A 4YG2A 1Y1WK 4A3JK 2YU9C 1YNJA 1DCPA 1V5VA 4A3MC 3GTJA 2GSNA 5FLMK 4DDQA 4C3HK 3N0CA 1INNA 5JVOA 3EQLA 3S1QC 1XZPA 3PO2C 4ZH4A 3VA7A 3S14C 3H3VD 4A3EC 3GEEA 1EK8A 3FKIA 4Y7NC 1SFOA 5E68A 1YCLA 1RU0A 2GSOA 1C0AA 4P9SA 2R92A 3GTKK 4KM9A 5M5YK 2VUMK 2Y0SL 2PHCB 5M5XK 3GTQA 3SZZA 4A3DC 3BUEA 3G4AA 4NOIA 5CHPA 4X6AK 3GIRA 3AQPA 4GTLA 5IOTA 3Q3QA 2E2HC 3GEIA 5M3MK 2JA7A 2E2IA 3ADAC 3OPFA 2JA5A 3HKZL 1WIHA 2NVYK 3H0GC 1I6VA 2A6HA 4BLBA 5IP7K 2NVQC 3GDZA 4MEXA 1R9TA 3GTMA 2JA6K 2GAGC 5M3FK 4A3FK 4QJVA 4G7OA 4QJVB 2P8TA 2JA8C 1G51A 3NUHA 1XXCA 3JSTA 3GTJK 3FHZA 3BP3A 3GTPK 2A69A 4C3JC 4GTFA 5IYDC 3MMLB 5C3EK 3CAGA 3AH5A 4C45A 3IPJA 1O26A 3GTGC 4A3CC 1TWGC 1VGXA 3TTGA 3PO3C 1O29A 1EH1A 4GT9A 1F7UA 1TWAC 3HOWK 4AYBD 3BP8C 1K83C 3HOYC 4KMHA 1JQWA 1VRQC 3GTQK 3M3YC 1HQMA 2XCOA 2NVTC 1BDFA 3HOXC 3GSIA 3CQZC 4OIPA 4BBRK 4G0VA 1IE0A 3GTKA 4GZYA 1O2BA 3TFJA 2VUMA 1TWCC 4BY7K 1WSRA 4KASA 5IYBC 4KDDA 4LQYA 3L4JA 1L0WA 4BXXC 2JA5K 3K7AC 3I4MC 4BKWA 4FZBA 3GTMK 5IOQA 3N3YA 4LK1A 1XPPA 4A3IC 1WQHA 3OREA 4KB4A 4KC6A 4A93C 4A3KC 2Y3PA 5IYCC 5HL8A 1PJ6A 4QIWL 4Y52K 3S17K 2NVXA 3S15K 1HI9A 1I6HK 2WAQD 2Y0SD 4KN7A 3GTLC 2XCRB 1B4BA 5C4JC 1B4AA 4LR2A 3S1MK 1KQ4A 3HOZK 3SZYA 1EQRA 1WCMC 1O2FB 1Y1VK 4A3BK 2YU9A 1XZQB 4XSXA 3S2HC 3GTOK 3GTPA 1I50C 1ZVUA 4MQ9A 3HXAA 4BLAA 1O28A 1TWFK 4O2DA 3LAPA 5IP7C 5M5WK 1UV7A 5C4XC 4G0WA 3HOUK 3ERED 3S1RC 3RZDK 3HKZD 3M4OC 4KM8A 2BE5A 3S2DK 1WOPA 1PJ7A 2B63K 1O24A 4PABA 4WJ3M 1DD5A 4KATA 2GAHC 3S1NK 2R7ZC 1TWHC 1XXAA 2CFAA 3LAJA 1ISEA 2CFAB 1ZBSA 4LOWA 2R93K 4KAWX 4PAAA 3I4NK 3FKIC 2RGRA 1SFOC 1J6VA 5IP9C 2O5IA 2RH6A 1ZYRA 4A3GK 2R92C 4P5BA 4GFQA 4G0UA 5C44K 1ZQ1C 4C2MK 4C3IC 1O2AA 1YX2A 3HOVK 3L4KA 4A3LK 4J3NA 3GTQC 4MEYA 2NVXK 1I3QC 3H0GA 2FQTA 4BY1C 4BBRC 3AQOA 1VLOA 3RZOC 4LLGA 2YU9K 2JA7C 2E2IC 4A3MK 4M1XA 3AD8C 2KWAA 3A8JA 4XLPA 1R9TC 4Q5SA 2E2JC 1Y1VA 3S1QK 3GTOA 3LPXA 3PO2K 1WSVA 5CJ9A 3A8KA 3S14K 4A3EK 3GTGA 2GSUA 3S16C 1TWFA 1USOA 4BBSC 4Y7NK 1Y1WC 4YFNA 4A3JC 1F93A 3WODA 5FJ8K 4QIWD 4LJZA 1IW7A 1WQFA 2V6UA 4GTEA 5FLMC 4JK1A 2B63A 4C3HC 4A3DK 1EFWA 5IOSA 1GE9A 3CQZA 4GTCA 3DXJA 2A68A 2P5MA 1EI6A 1XXBA 3G4CA 2R93A 2E2HK 2WB1L 2ZFZA 3H0GK 1YNNA 2V6SA 2NVQK 3GTKC 2VUMC 2ZUEA 2PMZL 2JA8K 4XSZA 4C3JK 4X6AC 3T02A 5IYDK 1F9NA 1XZQA 5IORA 2W7VA 3FOEA 3GTGK 2NVYC 2PPBA 1TWGK 1J6WA 1I50A 1JOEA 4A3CK 3PO3K 1USMA 1IQ0A 2ZUFA 2JA6C 4A3FC 1TWAK 3FOFA 2PA8L 1K83K 1IL2A 3GTJC 3HOYK 3AD9C 3GTPC 2EBBA 3T00A 2XCQA 3QX3A 3M3YK 2NVTK 3HOXK 5EGEA 5C3EC 3CQZK 3N0BA 2R7ZA 4GTDA 1TWHA 4P5AA 1DCOA 1TWCK 5IYBK 1XZPB 2CW0A 4BXXK 5JFEA 3K7AK 3I4MK 3HOWC 4LK0A 2E2HA 1WOSA 4A3IK 1BJTA 1JVIA 1ZXOA 2WAQL 4A93K 5TMFA 4G7HA 1BGWA 4A3KK 5IYCK 1IBAA 1IS1A 1I3QA 1SMYA 3TFIA 4BY7C 3GTLK 5C4JK 2JH3A 4KMDA 4WJ4A 4XLNA 4AH6A 4KMUA 1WCMK 2JA5C 3S2HK 3S0XA 1I50K 3H3VL 4YFXA 3V4GA 3GTMC 1O25A 5C4XK 1WOOA 4OIRA 2WB1D 3S1RK 3M4OK 4WILA 1TWGA 1DCHA 4Y52C 3S17C 3S15C 3TFHA 1I6HC 1WORA 2PMZD 4GTAA 1TWAA
chains in the Genus database with same CATH topology
3HOUK 2R7ZK 3GTKC 3S1MC 1TWHK 2VUMC 3HOZC 3S1RC 4KN4A 3RZDK 4Q4ZA 1Y1VC 2PMZL 3HKZD 2E2HC 4OIOA 4A3BC 5M3MK 3GTOC 3M4OC 2BE5A 2JA8K 3S2DK 4XSZA 2B63K 3HKZL 5D4DA 4YFKA 3H0GC 2NVYK 1I6VA 1TWFC 4C3JK 2A6HA 4X6AC 5IYDK 5IP7K 3FKIK 2NVQC 3HOUC 1SFOK 5IP9K 2R7ZC 4MEXA 3S1NK 1TWHC 2JA6K 5M3FK 3RZDC 4A3FK 4QJVA 4G7ZA 4G7OA 2R92K 4QJVB 2R93K 2JA8C 3S2DC 4C3IK 3GTJK 2B63C 3GTGK 3GTPK 2NVYC 2A69A 5M5WK 1TWGK 2PPBA 3I4NK 4A3CK 5IYDC 3PO3K 3FKIC 3S1NC 2PA8D 5IP9C 1SFOC 1I3QK 5C3EK 2O5IA 4BY1K 2JA6C 4A3FC 1ZYRA 4A3GK 2R92C 1TWAK 2R93C 2PA8L 5C44K 3RZOK 1K83K 4C2MK 3GTJC 3HOYK 3HOVK 3GTGC 3GTPC 4A3LK 3GTQC 4A3CC 1TWGC 2JA7K 3I4NC 2E2IK 3M3YK 4MEYA 2NVXK 3PO3C 1I3QC 2NVTK 3HOXK 5C3EC 4BY1C 3CQZK 4BBRC 2O5JA 4A3GC 5TMCA 1TWAC 3HOWK 4AYBD 5C44C 3RZOC 4LLGA 1K83C 1R9TK 3HOYC 1TWCK 2E2JK 5IYBK 3HOVC 4A3LC 2YU9K 4AYBL 4OINA 2JA7C 3GTQK 2E2IC 4A3MK 3M3YC 2NVXC 2CW0A 1HQMA 2NVTC 1BDFA 3HOXC 4BXXK 3CQZC 2A6EA 3K7AK 4OIPA 3S16K 4BBRK 3I4MK 3HOWC 4OIQA 4LK0A 4XLPA 4BBSK 4GZYA 1R9TC 4YG2A 1Y1WK 4Q5SA 1TWCC 4BY7K 2E2JC 5IYBC 3S1QK 4A3JK 4A3IK 2YU9C 1YNJA 2WAQL 3PO2K 4A93K 4A3MC 5TMFA 5FLMK 4G7HA 3S14K 4A3EK 4A3KK 4BXXC 2JA5K 5IYCK 3K7AC 4C3HK 3S16C 3I4MC 4BBSC 4Y7NK 1SMYA 1Y1WC 4YFNA 4BY7C 3GTLK 3GTMK 3S1QC 3EQLA 4LK1A 1XPPA 3WODA 4A3JC 5FJ8K 4QIWD 4LJZA 1IW7A 5C4JK 4A3IC 3PO2C 4A93C 4ZH4A 4XLNA 5FLMC 3H3VD 4JK1A 3S14C 4KMUA 1WCMK 4A3EC 4A3KC 2JA5C 5IYCC 3S2HK 4QIWL 4A3DK 4Y52K 3S17K 1I50K 3S15K 4Y7NC 3H3VL 1I6HK 2WAQD 2Y0SD 4KN7A 4YFXA 3GTLC 3DXJA 3GTMC 2A68A 5C4JC 5C4XK 3GTKK 3S1MK 4OIRA 5M5YK 2VUMK 3HOZK 2Y0SL 2WB1D 3S1RK 1WCMC 1Y1VK 2E2HK 4A3BK 4XSXA 3S2HC 5M5XK 3GTOK 3M4OK 4A3DC 4Y52C 3S17C 1I50C 4MQ9A 3S15C 2WB1L 1I6HC 4NOIA 3H0GK 2PMZD 1TWFK 4X6AK 5IP7C 1YNNA 5C4XC 2NVQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU K;  2R7Z K;  3GTK C;  3S1M C;  1TWH K;  2VUM C;  3HOZ C;  3S1R C;  4KN4 A;  3RZD K;  4Q4Z A;  1Y1V C;  2PMZ L;  3HKZ D;  2E2H C;  4OIO A;  4A3B C;  5M3M K;  3GTO C;  3M4O C;  2BE5 A;  2JA8 K;  3S2D K;  4XSZ A;  2B63 K;  3HKZ L;  5D4D A;  4YFK A;  3H0G C;  2NVY K;  1I6V A;  1TWF C;  4C3J K;  2A6H A;  4X6A C;  5IYD K;  5IP7 K;  3FKI K;  2NVQ C;  3HOU C;  1SFO K;  5IP9 K;  2R7Z C;  4MEX A;  3S1N K;  1TWH C;  2JA6 K;  5M3F K;  3RZD C;  4A3F K;  4QJV A;  4G7Z A;  4G7O A;  2R92 K;  4QJV B;  2R93 K;  2JA8 C;  3S2D C;  4C3I K;  3GTJ K;  2B63 C;  3GTG K;  3GTP K;  2NVY C;  2A69 A;  5M5W K;  1TWG K;  2PPB A;  3I4N K;  4A3C K;  5IYD C;  3PO3 K;  3FKI C;  3S1N C;  2PA8 D;  5IP9 C;  1SFO C;  1I3Q K;  5C3E K;  2O5I A;  4BY1 K;  2JA6 C;  4A3F C;  1ZYR A;  4A3G K;  2R92 C;  1TWA K;  2R93 C;  2PA8 L;  5C44 K;  3RZO K;  1K83 K;  4C2M K;  3GTJ C;  3HOY K;  3HOV K;  3GTG C;  3GTP C;  4A3L K;  3GTQ C;  4A3C C;  1TWG C;  2JA7 K;  3I4N C;  2E2I K;  3M3Y K;  4MEY A;  2NVX K;  3PO3 C;  1I3Q C;  2NVT K;  3HOX K;  5C3E C;  4BY1 C;  3CQZ K;  4BBR C;  2O5J A;  4A3G C;  5TMC A;  1TWA C;  3HOW K;  4AYB D;  5C44 C;  3RZO C;  4LLG A;  1K83 C;  1R9T K;  3HOY C;  1TWC K;  2E2J K;  5IYB K;  3HOV C;  4A3L C;  2YU9 K;  4AYB L;  4OIN A;  2JA7 C;  3GTQ K;  2E2I C;  4A3M K;  3M3Y C;  2NVX C;  2CW0 A;  1HQM A;  2NVT C;  1BDF A;  3HOX C;  4BXX K;  3CQZ C;  2A6E A;  3K7A K;  4OIP A;  3S16 K;  4BBR K;  3I4M K;  3HOW C;  4OIQ A;  4LK0 A;  4XLP A;  4BBS K;  4GZY A;  1R9T C;  4YG2 A;  1Y1W K;  4Q5S A;  1TWC C;  4BY7 K;  2E2J C;  5IYB C;  3S1Q K;  4A3J K;  4A3I K;  2YU9 C;  1YNJ A;  2WAQ L;  3PO2 K;  4A93 K;  4A3M C;  5TMF A;  5FLM K;  4G7H A;  3S14 K;  4A3E K;  4A3K K;  4BXX C;  2JA5 K;  5IYC K;  3K7A C;  4C3H K;  3S16 C;  3I4M C;  4BBS C;  4Y7N K;  1SMY A;  1Y1W C;  4YFN A;  4BY7 C;  3GTL K;  3GTM K;  3S1Q C;  3EQL A;  4LK1 A;  1XPP A;  3WOD A;  4A3J C;  5FJ8 K;  4QIW D;  4LJZ A;  1IW7 A;  5C4J K;  4A3I C;  3PO2 C;  4A93 C;  4ZH4 A;  4XLN A;  5FLM C;  3H3V D;  4JK1 A;  3S14 C;  4KMU A;  1WCM K;  4A3E C;  4A3K C;  2JA5 C;  5IYC C;  3S2H K;  4QIW L;  4A3D K;  4Y52 K;  3S17 K;  1I50 K;  3S15 K;  4Y7N C;  3H3V L;  1I6H K;  2WAQ D;  2Y0S D;  4KN7 A;  4YFX A;  3GTL C;  3DXJ A;  3GTM C;  2A68 A;  5C4J C;  5C4X K;  3GTK K;  3S1M K;  4OIR A;  5M5Y K;  2VUM K;  3HOZ K;  2Y0S L;  2WB1 D;  3S1R K;  1WCM C;  1Y1V K;  2E2H K;  4A3B K;  4XSX A;  3S2H C;  5M5X K;  3GTO K;  3M4O K;  4A3D C;  4Y52 C;  3S17 C;  1I50 C;  4MQ9 A;  3S15 C;  2WB1 L;  1I6H C;  4NOI A;  3H0G K;  2PMZ D;  1TWF K;  4X6A K;  5IP7 C;  1YNN A;  5C4X C;  2NVQ K; 
#chains in the Genus database with same CATH topology
 2R7Z K;  3S1M C;  1Y1W A;  1TWH K;  1K83 A;  3HOZ C;  4KN4 A;  4Q4Z A;  1Y1V C;  4A3B C;  4OIO A;  2V6T A;  3GTO C;  3T01 A;  4ILD A;  1PJ5 A;  1J98 A;  1WQG A;  5D4D A;  4YFK A;  1TWF C;  3FKI K;  3HOU C;  1SFO K;  5IP9 K;  1TWC A;  3RZD C;  4G7Z A;  2R92 K;  4RMF A;  3S2D C;  4C3I K;  1O27 A;  2B63 C;  3S1N C;  2PA8 D;  1I3Q K;  4BY1 K;  2D6F C;  4KAR A;  3GEH A;  2R93 C;  3RZO K;  1F7V A;  3A8I A;  3AD7 C;  4FM9 A;  1J6X A;  2JA7 K;  3I4N C;  2FQO A;  4KB2 A;  2E2I K;  5L46 A;  1X31 C;  3GTL A;  2O5J A;  4A3G C;  5TMC A;  5EGH A;  5C44 C;  4GTB A;  4KMA A;  4C2M C;  1R9T K;  2E2J K;  1WCM A;  3HOV C;  4A3L C;  1BS2 A;  1VJE A;  4AYB L;  4OIN A;  2NVX C;  2NVY A;  4XCH A;  2A6E A;  3S16 K;  5TJ3 A;  4OIQ A;  4BBS K;  1AB4 A;  3OEP A;  2JA6 A;  1VH2 A;  4YG2 A;  1Y1W K;  4A3J K;  2YU9 C;  1YNJ A;  1DCP A;  1V5V A;  4A3M C;  3GTJ A;  2GSN A;  5FLM K;  4DDQ A;  4C3H K;  3N0C A;  1INN A;  5JVO A;  3EQL A;  3S1Q C;  1XZP A;  3PO2 C;  4ZH4 A;  3VA7 A;  3S14 C;  3H3V D;  4A3E C;  3GEE A;  1EK8 A;  3FKI A;  4Y7N C;  1SFO A;  5E68 A;  1YCL A;  1RU0 A;  2GSO A;  1C0A A;  4P9S A;  2R92 A;  3GTK K;  4KM9 A;  5M5Y K;  2VUM K;  2Y0S L;  2PHC B;  5M5X K;  3GTQ A;  3SZZ A;  4A3D C;  3BUE A;  3G4A A;  4NOI A;  5CHP A;  4X6A K;  3GIR A;  3AQP A;  4GTL A;  5IOT A;  3Q3Q A;  2E2H C;  3GEI A;  5M3M K;  2JA7 A;  2E2I A;  3ADA C;  3OPF A;  2JA5 A;  3HKZ L;  1WIH A;  2NVY K;  3H0G C;  1I6V A;  2A6H A;  4BLB A;  5IP7 K;  2NVQ C;  3GDZ A;  4MEX A;  1R9T A;  3GTM A;  2JA6 K;  2GAG C;  5M3F K;  4A3F K;  4QJV A;  4G7O A;  4QJV B;  2P8T A;  2JA8 C;  1G51 A;  3NUH A;  1XXC A;  3JST A;  3GTJ K;  3FHZ A;  3BP3 A;  3GTP K;  2A69 A;  4C3J C;  4GTF A;  5IYD C;  3MML B;  5C3E K;  3CAG A;  3AH5 A;  4C45 A;  3IPJ A;  1O26 A;  3GTG C;  4A3C C;  1TWG C;  1VGX A;  3TTG A;  3PO3 C;  1O29 A;  1EH1 A;  4GT9 A;  1F7U A;  1TWA C;  3HOW K;  4AYB D;  3BP8 C;  1K83 C;  3HOY C;  4KMH A;  1JQW A;  1VRQ C;  3GTQ K;  3M3Y C;  1HQM A;  2XCO A;  2NVT C;  1BDF A;  3HOX C;  3GSI A;  3CQZ C;  4OIP A;  4BBR K;  4G0V A;  1IE0 A;  3GTK A;  4GZY A;  1O2B A;  3TFJ A;  2VUM A;  1TWC C;  4BY7 K;  1WSR A;  4KAS A;  5IYB C;  4KDD A;  4LQY A;  3L4J A;  1L0W A;  4BXX C;  2JA5 K;  3K7A C;  3I4M C;  4BKW A;  4FZB A;  3GTM K;  5IOQ A;  3N3Y A;  4LK1 A;  1XPP A;  4A3I C;  1WQH A;  3ORE A;  4KB4 A;  4KC6 A;  4A93 C;  4A3K C;  2Y3P A;  5IYC C;  5HL8 A;  1PJ6 A;  4QIW L;  4Y52 K;  3S17 K;  2NVX A;  3S15 K;  1HI9 A;  1I6H K;  2WAQ D;  2Y0S D;  4KN7 A;  3GTL C;  2XCR B;  1B4B A;  5C4J C;  1B4A A;  4LR2 A;  3S1M K;  1KQ4 A;  3HOZ K;  3SZY A;  1EQR A;  1WCM C;  1O2F B;  1Y1V K;  4A3B K;  2YU9 A;  1XZQ B;  4XSX A;  3S2H C;  3GTO K;  3GTP A;  1I50 C;  1ZVU A;  4MQ9 A;  3HXA A;  4BLA A;  1O28 A;  1TWF K;  4O2D A;  3LAP A;  5IP7 C;  5M5W K;  1UV7 A;  5C4X C;  4G0W A;  3HOU K;  3ERE D;  3S1R C;  3RZD K;  3HKZ D;  3M4O C;  4KM8 A;  2BE5 A;  3S2D K;  1WOP A;  1PJ7 A;  2B63 K;  1O24 A;  4PAB A;  4WJ3 M;  1DD5 A;  4KAT A;  2GAH C;  3S1N K;  2R7Z C;  1TWH C;  1XXA A;  2CFA A;  3LAJ A;  1ISE A;  2CFA B;  1ZBS A;  4LOW A;  2R93 K;  4KAW X;  4PAA A;  3I4N K;  3FKI C;  2RGR A;  1SFO C;  1J6V A;  5IP9 C;  2O5I A;  2RH6 A;  1ZYR A;  4A3G K;  2R92 C;  4P5B A;  4GFQ A;  4G0U A;  5C44 K;  1ZQ1 C;  4C2M K;  4C3I C;  1O2A A;  1YX2 A;  3HOV K;  3L4K A;  4A3L K;  4J3N A;  3GTQ C;  4MEY A;  2NVX K;  1I3Q C;  3H0G A;  2FQT A;  4BY1 C;  4BBR C;  3AQO A;  1VLO A;  3RZO C;  4LLG A;  2YU9 K;  2JA7 C;  2E2I C;  4A3M K;  4M1X A;  3AD8 C;  2KWA A;  3A8J A;  4XLP A;  1R9T C;  4Q5S A;  2E2J C;  1Y1V A;  3S1Q K;  3GTO A;  3LPX A;  3PO2 K;  1WSV A;  5CJ9 A;  3A8K A;  3S14 K;  4A3E K;  3GTG A;  2GSU A;  3S16 C;  1TWF A;  1USO A;  4BBS C;  4Y7N K;  1Y1W C;  4YFN A;  4A3J C;  1F93 A;  3WOD A;  5FJ8 K;  4QIW D;  4LJZ A;  1IW7 A;  1WQF A;  2V6U A;  4GTE A;  5FLM C;  4JK1 A;  2B63 A;  4C3H C;  4A3D K;  1EFW A;  5IOS A;  1GE9 A;  3CQZ A;  4GTC A;  3DXJ A;  2A68 A;  2P5M A;  1EI6 A;  1XXB A;  3G4C A;  2R93 A;  2E2H K;  2WB1 L;  2ZFZ A;  3H0G K;  1YNN A;  2V6S A;  2NVQ K;  3GTK C;  2VUM C;  2ZUE A;  2PMZ L;  2JA8 K;  4XSZ A;  4C3J K;  4X6A C;  3T02 A;  5IYD K;  1F9N A;  1XZQ A;  5IOR A;  2W7V A;  3FOE A;  3GTG K;  2NVY C;  2PPB A;  1TWG K;  1J6W A;  1I50 A;  1JOE A;  4A3C K;  3PO3 K;  1USM A;  1IQ0 A;  2ZUF A;  2JA6 C;  4A3F C;  1TWA K;  3FOF A;  2PA8 L;  1K83 K;  1IL2 A;  3GTJ C;  3HOY K;  3AD9 C;  3GTP C;  2EBB A;  3T00 A;  2XCQ A;  3QX3 A;  3M3Y K;  2NVT K;  3HOX K;  5EGE A;  5C3E C;  3CQZ K;  3N0B A;  2R7Z A;  4GTD A;  1TWH A;  4P5A A;  1DCO A;  1TWC K;  5IYB K;  1XZP B;  2CW0 A;  4BXX K;  5JFE A;  3K7A K;  3I4M K;  3HOW C;  4LK0 A;  2E2H A;  1WOS A;  4A3I K;  1BJT A;  1JVI A;  1ZXO A;  2WAQ L;  4A93 K;  5TMF A;  4G7H A;  1BGW A;  4A3K K;  5IYC K;  1IBA A;  1IS1 A;  1I3Q A;  1SMY A;  3TFI A;  4BY7 C;  3GTL K;  5C4J K;  2JH3 A;  4KMD A;  4WJ4 A;  4XLN A;  4AH6 A;  4KMU A;  1WCM K;  2JA5 C;  3S2H K;  3S0X A;  1I50 K;  3H3V L;  4YFX A;  3V4G A;  3GTM C;  1O25 A;  5C4X K;  1WOO A;  4OIR A;  2WB1 D;  3S1R K;  3M4O K;  4WIL A;  1TWG A;  1DCH A;  4Y52 C;  3S17 C;  3S15 C;  3TFH A;  1I6H C;  1WOR A;  2PMZ D;  4GTA A;  1TWA A; 
#chains in the Genus database with same CATH homology
 3HOU K;  2R7Z K;  3GTK C;  3S1M C;  1TWH K;  2VUM C;  3HOZ C;  3S1R C;  4KN4 A;  3RZD K;  4Q4Z A;  1Y1V C;  2PMZ L;  3HKZ D;  2E2H C;  4OIO A;  4A3B C;  5M3M K;  3GTO C;  3M4O C;  2BE5 A;  2JA8 K;  3S2D K;  4XSZ A;  2B63 K;  3HKZ L;  5D4D A;  4YFK A;  3H0G C;  2NVY K;  1I6V A;  1TWF C;  4C3J K;  2A6H A;  4X6A C;  5IYD K;  5IP7 K;  3FKI K;  2NVQ C;  3HOU C;  1SFO K;  5IP9 K;  2R7Z C;  4MEX A;  3S1N K;  1TWH C;  2JA6 K;  5M3F K;  3RZD C;  4A3F K;  4QJV A;  4G7Z A;  4G7O A;  2R92 K;  4QJV B;  2R93 K;  2JA8 C;  3S2D C;  4C3I K;  3GTJ K;  2B63 C;  3GTG K;  3GTP K;  2NVY C;  2A69 A;  5M5W K;  1TWG K;  2PPB A;  3I4N K;  4A3C K;  5IYD C;  3PO3 K;  3FKI C;  3S1N C;  2PA8 D;  5IP9 C;  1SFO C;  1I3Q K;  5C3E K;  2O5I A;  4BY1 K;  2JA6 C;  4A3F C;  1ZYR A;  4A3G K;  2R92 C;  1TWA K;  2R93 C;  2PA8 L;  5C44 K;  3RZO K;  1K83 K;  4C2M K;  3GTJ C;  3HOY K;  3HOV K;  3GTG C;  3GTP C;  4A3L K;  3GTQ C;  4A3C C;  1TWG C;  2JA7 K;  3I4N C;  2E2I K;  3M3Y K;  4MEY A;  2NVX K;  3PO3 C;  1I3Q C;  2NVT K;  3HOX K;  5C3E C;  4BY1 C;  3CQZ K;  4BBR C;  2O5J A;  4A3G C;  5TMC A;  1TWA C;  3HOW K;  4AYB D;  5C44 C;  3RZO C;  4LLG A;  1K83 C;  1R9T K;  3HOY C;  1TWC K;  2E2J K;  5IYB K;  3HOV C;  4A3L C;  2YU9 K;  4AYB L;  4OIN A;  2JA7 C;  3GTQ K;  2E2I C;  4A3M K;  3M3Y C;  2NVX C;  2CW0 A;  1HQM A;  2NVT C;  1BDF A;  3HOX C;  4BXX K;  3CQZ C;  2A6E A;  3K7A K;  4OIP A;  3S16 K;  4BBR K;  3I4M K;  3HOW C;  4OIQ A;  4LK0 A;  4XLP A;  4BBS K;  4GZY A;  1R9T C;  4YG2 A;  1Y1W K;  4Q5S A;  1TWC C;  4BY7 K;  2E2J C;  5IYB C;  3S1Q K;  4A3J K;  4A3I K;  2YU9 C;  1YNJ A;  2WAQ L;  3PO2 K;  4A93 K;  4A3M C;  5TMF A;  5FLM K;  4G7H A;  3S14 K;  4A3E K;  4A3K K;  4BXX C;  2JA5 K;  5IYC K;  3K7A C;  4C3H K;  3S16 C;  3I4M C;  4BBS C;  4Y7N K;  1SMY A;  1Y1W C;  4YFN A;  4BY7 C;  3GTL K;  3GTM K;  3S1Q C;  3EQL A;  4LK1 A;  1XPP A;  3WOD A;  4A3J C;  5FJ8 K;  4QIW D;  4LJZ A;  1IW7 A;  5C4J K;  4A3I C;  3PO2 C;  4A93 C;  4ZH4 A;  4XLN A;  5FLM C;  3H3V D;  4JK1 A;  3S14 C;  4KMU A;  1WCM K;  4A3E C;  4A3K C;  2JA5 C;  5IYC C;  3S2H K;  4QIW L;  4A3D K;  4Y52 K;  3S17 K;  1I50 K;  3S15 K;  4Y7N C;  3H3V L;  1I6H K;  2WAQ D;  2Y0S D;  4KN7 A;  4YFX A;  3GTL C;  3DXJ A;  3GTM C;  2A68 A;  5C4J C;  5C4X K;  3GTK K;  3S1M K;  4OIR A;  5M5Y K;  2VUM K;  3HOZ K;  2Y0S L;  2WB1 D;  3S1R K;  1WCM C;  1Y1V K;  2E2H K;  4A3B K;  4XSX A;  3S2H C;  5M5X K;  3GTO K;  3M4O K;  4A3D C;  4Y52 C;  3S17 C;  1I50 C;  4MQ9 A;  3S15 C;  2WB1 L;  1I6H C;  4NOI A;  3H0G K;  2PMZ D;  1TWF K;  4X6A K;  5IP7 C;  1YNN A;  5C4X C;  2NVQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...