2WB1L

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
total genus 22
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2wb1L00
5TMCA 3RZDK 4OIPA 4XSXA 2E2HK 4LJZA 4A3MC 2JA5K 1IW7A 5IP7K 4MEYA 3GTKK 4BXXC 3HOXC 3GTQC 1TWAK 2CW0A 1SFOK 5M3FK 3S14K 4BY1K 2WAQL 5C3EC 4OINA 4A3DK 1BDFA 1XPPA 2JA5C 4A3MK 5C3EK 4A3DC 2E2HC 4BY1C 3PO2K 1TWAC 4LK1A 4C3JK 3RZDC 4BXXK 3GTLK 3GTKC 4YFXA 3S17K 4ZH4A 3S15C 1TWCC 5IYDC 2PPBA 3WODA 3HKZD 4KN4A 4BY7C 3HOUC 4A3GC 3HKZL 5C4JC 4YFNA 3M3YK 4G7OA 2B63K 3RZOC 1I6HK 1TWFC 4A3GK 4XLPA 1HQMA 4BY7K 5M5WK 2NVTC 5IYDK 2A6HA 5D4DA 3S17C 4A3LK 3GTLC 3S15K 3FKIK 3I4NC 2JA6C 3H0GK 3GTOC 5FLMK 5C4XK 2JA8C 4A3EK 3CQZC 3GTQK 3GTPC 4LLGA 5IP7C 4YG2A 2R7ZK 1R9TC 5IYCC 2PMZL 1K83K 2R93K 5M5YK 4A3JK 1Y1WK 2Y0SD 4KN7A 4Q4ZA 3HOWC 4A3CC 1I3QK 1Y1VC 4Y7NC 4MEXA 3S2HC 1I50K 3S1RC 4BBRK 5IYBC 4A3IC 2E2JK 2NVXC 1TWHK 2NVYK 2YU9K 1TWGC 4MQ9A 2JA7C 4A3KK 3GTGK 3HOVK 4LK0A 2O5JA 2VUMK 4AYBL 4Q5SA 3PO3K 2WB1D 3M4OC 4A3BC 2E2IK 4A93K 2Y0SL 3DXJA 5C44C 3K7AK 1ZYRA 5FJ8K 2NVQK 2VUMC 3S1MK 5IP9K 3S1QK 4OIOA 4A3KC 3GTGC 4QJVB 1I6VA 2NVYC 3HOVC 2O5IA 3I4MC 3HOYC 3S1NC 5TMFA 4QJVA 3HOZK 1WCMC 4Y7NK 2R92C 3GTMC 4Y52C 4QIWD 2WB1L 1Y1WC 4X6AC 4QIWL 4C3IK 3HOZC 3EQLA 5IYCK 3S1NK 2R7ZC 4BBSK 3I4MK 1SMYA 4X6AK 2PMZD 3GTJK 3S2DK 4XSZA 2BE5A 4Y52K 3K7AC 2NVQC 2A6EA 2R92K 1WCMK 3GTMK 3S16C 2E2IC 3HOYK 3PO3C 4A3FK 2JA6K 3S1MC 3I4NK 3S1QC 5C44K 4A3FC 2NVXK 4AYBD 4A93C 2PA8D 1I50C 3S1RK 3S16K 3S2HK 2PA8L 1TWFK 2A68A 2B63C 3RZOK 3HOWK 4A3CK 5M5XK 4GZYA 5C4JK 3GTJC 3S2DC 1TWGK 2JA7K 3HOUK 2R93C 1TWHC 4BBSC 1R9TK 4C2MK 1TWCK 1I3QC 1Y1VK 3GTPK 4G7ZA 2WAQD 3PO2C 4A3JC 1I6HC 1K83C 4NOIA 2JA8K 5C4XC 3S14C 5M3MK 1YNNA 1SFOC 5IP9C 4JK1A 3CQZK 3HOXK 4A3EC 4A3LC 1YNJA 4YFKA 4OIRA 4C3HK 2NVTK 4KMUA 3M4OK 4A3BK 5FLMC 3GTOK 3H0GC 3M3YC 3FKIC 2YU9C 4BBRC 5IYBK 4A3IK 2E2JC 4OIQA 3H3VL 4G7HA 2A69A 3H3VD 4XLNA
chains in the Genus database with same CATH superfamily
1BGWA 1XXAA 1ISEA 3RZDK 2CFAA 3AQPA 4OIPA 2E2HK 3FOEA 1J6VA 3L4KA 2GAHC 1IW7A 5IP7K 2CW0A 1SFOK 4BY1K 5C3EC 4OINA 2GSOA 2JA5C 4A3MK 4A3DC 1TWCA 2JA6A 1TWFA 1TWCC 2PPBA 4WJ4A 3M3YK 2B63K 3LAPA 4A3GK 2GSUA 4BLAA 3L4JA 3S17C 4A3LK 3H0GK 3GTOC 3A8JA 3N0BA 2ZUFA 1F7UA 2NVXA 4LLGA 3TTGA 1O29A 5IYCC 4KMHA 1Y1WK 3GTKA 3OEPA 3HOWC 5IOQA 3A8KA 3S2HC 4BBRK 2E2JK 3N3YA 1WQFA 2YU9K 5IORA 4GFQA 3GTQA 1VLOA 3M4OC 4A93K 2E2IK 2Y0SL 3DXJA 5FJ8K 3S1QK 3OREA 3I4MC 4KATA 3HOZK 1J98A 1F9NA 3GSIA 4Y52C 5IOTA 1EI6A 4X6AC 4QIWL 1BJTA 3HOZC 3EQLA 5IYCK 4BBSK 3I4MK 4XSZA 2BE5A 3GTMK 1VJEA 2FQTA 2E2IC 3CQZA 2CFAB 3H0GA 2NVXK 1XXCA 2PA8D 3V4GA 1DCHA 4KM9A 3S1RK 3G4CA 2NVYA 3RZOK 3HOWK 3GTGA 5M5XK 4GZYA 3S2DC 3TFIA 2RH6A 4C2MK 1XZQB 3SZZA 1ZBSA 5L46A 1O24A 4A3JC 3OPFA 1SFOC 4KMDA 3CQZK 4C45A 4A3EC 4A3LC 3GDZA 1BS2A 3JSTA 4A3BK 3M3YC 3FKIC 1VGXA 3GIRA 5IYBK 4OIQA 1F93A 1I50A 4XLNA 5CJ9A 2D6FC 3AD7C 4LJZA 1AB4A 1X31C 4C3JC 5M3FK 1WOPA 1BDFA 2YU9A 2E2HC 1YX2A 1Y1VA 3BUEA 1TWAC 3RZDC 3GTLK 4YFXA 3IPJA 4ZH4A 5C4JC 4G7OA 1I6HK 4BY7K 4XLPA 2NVTC 5IYDK 2A6HA 3FHZA 2RGRA 3GTLC 3I4NC 1I3QA 3Q3QA 5FLMK 2P5MA 2JA8C 4KM8A 1ZXOA 1O27A 3CQZC 3GTQK 1J6WA 4GTFA 2R7ZK 1R9TC 3FOFA 2PMZL 4A3JK 1O2AA 1WSVA 1USOA 3AD9C 5IYBC 1WQGA 4GTLA 3NUHA 2P8TA 4BKWA 4MQ9A 3GTGK 3HOVK 3SZYA 4AYBL 1JQWA 4A3BC 1TWAA 2ZUEA 4GTAA 2NVQK 1ZYRA 3GTMA 3HOVC 1WQHA 2O5IA 3HOYC 5TMFA 1L0WA 1O2FB 4QIWD 2WB1L 5EGHA 3TFJA 4C2MC 3S1NK 1UV7A 4X6AK 3S2DK 4P9SA 4Y52K 2NVQC 3S16C 3PO3C 1K83A 1Y1WA 2KWAA 3I4NK 5C44K 1HI9A 4M1XA 1I50C 3GTJC 2JA7K 3HOUK 2ZFZA 4BBSC 1R9TK 1EK8A 4G7ZA 3PO2C 1K83C 4NOIA 5C4XC 4LQYA 4KB4A 4PABA 3HOXK 4C3HK 2NVTK 4P5BA 1DD5A 3GTOK 3H0GC 1VRQC 1PJ6A 4A3IK 4AH6A 2A69A 1F7VA 2JH3A 1R9TA 4XSXA 4MEYA 4BLBA 2PHCB 3QX3A 3S14K 2WAQL 4A3DK 4DDQA 1XPPA 5C3EK 3MMLB 4BY1C 1WIHA 4LK1A 3S17K 4A3GC 3BP8C 3HKZL 4WJ3M 3RZOC 1XZPB 2R7ZA 2XCQA 5M5WK 4WILA 4KASA 3GTLA 4GTDA 4ILDA 3ADAC 1O26A 2GSNA 5IP7C 3GTOA 1K83K 2R93K 5M5YK 2GAGC 2Y0SD 4Q4ZA 4KC6A 1I3QK 1Y1VC 3S1RC 4A3IC 1WORA 2NVXC 1TWHK 4GT9A 2O5JA 2JA7C 3T01A 4LK0A 4G0WA 4C3HC 3G4AA 4PAAA 1SFOA 1WOOA 3GTPA 5C44C 3K7AK 5IP9K 2R92A 1WCMA 1XXBA 4QJVB 1I6VA 1TWGA 4QJVA 1VH2A 1WCMC 4G0UA 2R92C 1YCLA 3FKIA 1Y1WC 4GTEA 1KQ4A 1IQ0A 2W7VA 3GTJK 4GTBA 1XZQA 2FQOA 3GEIA 3K7AC 3HXAA 2A6EA 4J3NA 1EFWA 4KB2A 3HOYK 4A3FK 3AD8C 5CHPA 3S1MC 2E2IA 3S16K 3S2HK 2A68A 2B63C 4O2DA 4FM9A 1TWGK 3S0XA 1USMA 2R93C 1TWCK 4C3IC 1XZPA 4LR2A 4KMAA 3LPXA 1JOEA 3S14C 5M3MK 1O25A 1YNJA 2Y3PA 3T00A 5FLMC 4G0VA 1WOSA 5E68A 3CAGA 2V6TA 4G7HA 3H3VD 1I6HC 5TMCA 3GEHA 4A3MC 2JA5K 2R93A 3GTKK 2EBBA 4BXXC 3HOXC 3GTQC 1TWAK 1EQRA 4KAWX 3LAJA 1ZQ1C 1IE0A 3PO2K 4C3JK 1IS1A 4BXXK 3S15C 3GTKC 2E2HA 5IYDC 1O28A 5TJ3A 3WODA 3HKZD 4KN4A 4BY7C 3HOUC 4KARA 4YFNA 1TWFC 4FZBA 1HQMA 2VUMA 5D4DA 3S15K 3FKIK 1O2BA 3AH5A 2JA6C 2JA5A 4RMFA 5C4XK 4A3EK 3GTJA 5EGEA 4P5AA 3GTPC 1DCOA 4YG2A 3GEEA 1G51A 4KN7A 4A3CC 4Y7NC 3AQOA 4MEXA 1I50K 2NVYK 1JVIA 1TWGC 4KDDA 4A3KK 1GE9A 2VUMK 3VA7A 4Q5SA 3PO3K 2WB1D 2V6UA 2VUMC 3S1MK 4OIOA 4A3KC 1IL2A 3GTGC 2NVYC 3S1NC 5JVOA 2JA7A 4Y7NK 3GTMC 3N0CA 1PJ7A 3T02A 4C3IK 1RU0A 1ZVUA 2R7ZC 1SMYA 1EH1A 2PMZD 2R92K 1WCMK 2XCOA 1DCPA 3BP3A 2JA6K 3S1QC 3TFHA 4A3FC 3ERED 4GTCA 4AYBD 4A93C 1B4BA 1TWHA 1TWFK 2PA8L 4A3CK 5C4JK 1WSRA 5HL8A 1TWHC 1C0AA 1IBAA 1I3QC 1Y1VK 3GTPK 2WAQD 2XCRB 1B4AA 1V5VA 1INNA 2JA8K 1PJ5A 1YNNA 3A8IA 5IP9C 4JK1A 4XCHA 5IOSA 4YFKA 4OIRA 3M4OK 4KMUA 1J6XA 5JFEA 2YU9C 4LOWA 2B63A 4BBRC 2E2JC 3H3VL 2V6SA
chains in the Genus database with same CATH topology
5TMCA 3RZDK 4OIPA 4XSXA 2E2HK 4LJZA 4A3MC 2JA5K 1IW7A 5IP7K 4MEYA 3GTKK 4BXXC 3HOXC 3GTQC 1TWAK 2CW0A 1SFOK 5M3FK 3S14K 4BY1K 2WAQL 5C3EC 4OINA 4A3DK 1BDFA 1XPPA 2JA5C 4A3MK 5C3EK 4A3DC 2E2HC 4BY1C 3PO2K 1TWAC 4LK1A 4C3JK 3RZDC 4BXXK 3GTLK 3GTKC 4YFXA 3S17K 4ZH4A 3S15C 1TWCC 5IYDC 2PPBA 3WODA 3HKZD 4KN4A 4BY7C 3HOUC 4A3GC 3HKZL 5C4JC 4YFNA 3M3YK 4G7OA 2B63K 3RZOC 1I6HK 1TWFC 4A3GK 4XLPA 1HQMA 4BY7K 5M5WK 2NVTC 5IYDK 2A6HA 5D4DA 3S17C 4A3LK 3GTLC 3S15K 3FKIK 3I4NC 2JA6C 3H0GK 3GTOC 5FLMK 5C4XK 2JA8C 4A3EK 3CQZC 3GTQK 3GTPC 4LLGA 5IP7C 4YG2A 2R7ZK 1R9TC 5IYCC 2PMZL 1K83K 2R93K 5M5YK 4A3JK 1Y1WK 2Y0SD 4KN7A 4Q4ZA 3HOWC 4A3CC 1I3QK 1Y1VC 4Y7NC 4MEXA 3S2HC 1I50K 3S1RC 4BBRK 5IYBC 4A3IC 2E2JK 2NVXC 1TWHK 2NVYK 2YU9K 1TWGC 4MQ9A 2JA7C 4A3KK 3GTGK 3HOVK 4LK0A 2O5JA 2VUMK 4AYBL 4Q5SA 3PO3K 2WB1D 3M4OC 4A3BC 2E2IK 4A93K 2Y0SL 3DXJA 5C44C 3K7AK 1ZYRA 5FJ8K 2NVQK 2VUMC 3S1MK 5IP9K 3S1QK 4OIOA 4A3KC 3GTGC 4QJVB 1I6VA 2NVYC 3HOVC 2O5IA 3I4MC 3HOYC 3S1NC 5TMFA 4QJVA 3HOZK 1WCMC 4Y7NK 2R92C 3GTMC 4Y52C 4QIWD 2WB1L 1Y1WC 4X6AC 4QIWL 4C3IK 3HOZC 3EQLA 5IYCK 3S1NK 2R7ZC 4BBSK 3I4MK 1SMYA 4X6AK 2PMZD 3GTJK 3S2DK 4XSZA 2BE5A 4Y52K 3K7AC 2NVQC 2A6EA 2R92K 1WCMK 3GTMK 3S16C 2E2IC 3HOYK 3PO3C 4A3FK 2JA6K 3S1MC 3I4NK 3S1QC 5C44K 4A3FC 2NVXK 4AYBD 4A93C 2PA8D 1I50C 3S1RK 3S16K 3S2HK 2PA8L 1TWFK 2A68A 2B63C 3RZOK 3HOWK 4A3CK 5M5XK 4GZYA 5C4JK 3GTJC 3S2DC 1TWGK 2JA7K 3HOUK 2R93C 1TWHC 4BBSC 1R9TK 4C2MK 1TWCK 1I3QC 1Y1VK 3GTPK 4G7ZA 2WAQD 3PO2C 4A3JC 1I6HC 1K83C 4NOIA 2JA8K 5C4XC 3S14C 5M3MK 1YNNA 1SFOC 5IP9C 4JK1A 3CQZK 3HOXK 4A3EC 4A3LC 1YNJA 4YFKA 4OIRA 4C3HK 2NVTK 4KMUA 3M4OK 4A3BK 5FLMC 3GTOK 3H0GC 3M3YC 3FKIC 2YU9C 4BBRC 5IYBK 4A3IK 2E2JC 4OIQA 3H3VL 4G7HA 2A69A 3H3VD 4XLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TMC A;  3RZD K;  4OIP A;  4XSX A;  2E2H K;  4LJZ A;  4A3M C;  2JA5 K;  1IW7 A;  5IP7 K;  4MEY A;  3GTK K;  4BXX C;  3HOX C;  3GTQ C;  1TWA K;  2CW0 A;  1SFO K;  5M3F K;  3S14 K;  4BY1 K;  2WAQ L;  5C3E C;  4OIN A;  4A3D K;  1BDF A;  1XPP A;  2JA5 C;  4A3M K;  5C3E K;  4A3D C;  2E2H C;  4BY1 C;  3PO2 K;  1TWA C;  4LK1 A;  4C3J K;  3RZD C;  4BXX K;  3GTL K;  3GTK C;  4YFX A;  3S17 K;  4ZH4 A;  3S15 C;  1TWC C;  5IYD C;  2PPB A;  3WOD A;  3HKZ D;  4KN4 A;  4BY7 C;  3HOU C;  4A3G C;  3HKZ L;  5C4J C;  4YFN A;  3M3Y K;  4G7O A;  2B63 K;  3RZO C;  1I6H K;  1TWF C;  4A3G K;  4XLP A;  1HQM A;  4BY7 K;  5M5W K;  2NVT C;  5IYD K;  2A6H A;  5D4D A;  3S17 C;  4A3L K;  3GTL C;  3S15 K;  3FKI K;  3I4N C;  2JA6 C;  3H0G K;  3GTO C;  5FLM K;  5C4X K;  2JA8 C;  4A3E K;  3CQZ C;  3GTQ K;  3GTP C;  4LLG A;  5IP7 C;  4YG2 A;  2R7Z K;  1R9T C;  5IYC C;  2PMZ L;  1K83 K;  2R93 K;  5M5Y K;  4A3J K;  1Y1W K;  2Y0S D;  4KN7 A;  4Q4Z A;  3HOW C;  4A3C C;  1I3Q K;  1Y1V C;  4Y7N C;  4MEX A;  3S2H C;  1I50 K;  3S1R C;  4BBR K;  5IYB C;  4A3I C;  2E2J K;  2NVX C;  1TWH K;  2NVY K;  2YU9 K;  1TWG C;  4MQ9 A;  2JA7 C;  4A3K K;  3GTG K;  3HOV K;  4LK0 A;  2O5J A;  2VUM K;  4AYB L;  4Q5S A;  3PO3 K;  2WB1 D;  3M4O C;  4A3B C;  2E2I K;  4A93 K;  2Y0S L;  3DXJ A;  5C44 C;  3K7A K;  1ZYR A;  5FJ8 K;  2NVQ K;  2VUM C;  3S1M K;  5IP9 K;  3S1Q K;  4OIO A;  4A3K C;  3GTG C;  4QJV B;  1I6V A;  2NVY C;  3HOV C;  2O5I A;  3I4M C;  3HOY C;  3S1N C;  5TMF A;  4QJV A;  3HOZ K;  1WCM C;  4Y7N K;  2R92 C;  3GTM C;  4Y52 C;  4QIW D;  2WB1 L;  1Y1W C;  4X6A C;  4QIW L;  4C3I K;  3HOZ C;  3EQL A;  5IYC K;  3S1N K;  2R7Z C;  4BBS K;  3I4M K;  1SMY A;  4X6A K;  2PMZ D;  3GTJ K;  3S2D K;  4XSZ A;  2BE5 A;  4Y52 K;  3K7A C;  2NVQ C;  2A6E A;  2R92 K;  1WCM K;  3GTM K;  3S16 C;  2E2I C;  3HOY K;  3PO3 C;  4A3F K;  2JA6 K;  3S1M C;  3I4N K;  3S1Q C;  5C44 K;  4A3F C;  2NVX K;  4AYB D;  4A93 C;  2PA8 D;  1I50 C;  3S1R K;  3S16 K;  3S2H K;  2PA8 L;  1TWF K;  2A68 A;  2B63 C;  3RZO K;  3HOW K;  4A3C K;  5M5X K;  4GZY A;  5C4J K;  3GTJ C;  3S2D C;  1TWG K;  2JA7 K;  3HOU K;  2R93 C;  1TWH C;  4BBS C;  1R9T K;  4C2M K;  1TWC K;  1I3Q C;  1Y1V K;  3GTP K;  4G7Z A;  2WAQ D;  3PO2 C;  4A3J C;  1I6H C;  1K83 C;  4NOI A;  2JA8 K;  5C4X C;  3S14 C;  5M3M K;  1YNN A;  1SFO C;  5IP9 C;  4JK1 A;  3CQZ K;  3HOX K;  4A3E C;  4A3L C;  1YNJ A;  4YFK A;  4OIR A;  4C3H K;  2NVT K;  4KMU A;  3M4O K;  4A3B K;  5FLM C;  3GTO K;  3H0G C;  3M3Y C;  3FKI C;  2YU9 C;  4BBR C;  5IYB K;  4A3I K;  2E2J C;  4OIQ A;  3H3V L;  4G7H A;  2A69 A;  3H3V D;  4XLN A; 
#chains in the Genus database with same CATH topology
 1BGW A;  1XXA A;  1ISE A;  3RZD K;  2CFA A;  3AQP A;  4OIP A;  2E2H K;  3FOE A;  1J6V A;  3L4K A;  2GAH C;  1IW7 A;  5IP7 K;  2CW0 A;  1SFO K;  4BY1 K;  5C3E C;  4OIN A;  2GSO A;  2JA5 C;  4A3M K;  4A3D C;  1TWC A;  2JA6 A;  1TWF A;  1TWC C;  2PPB A;  4WJ4 A;  3M3Y K;  2B63 K;  3LAP A;  4A3G K;  2GSU A;  4BLA A;  3L4J A;  3S17 C;  4A3L K;  3H0G K;  3GTO C;  3A8J A;  3N0B A;  2ZUF A;  1F7U A;  2NVX A;  4LLG A;  3TTG A;  1O29 A;  5IYC C;  4KMH A;  1Y1W K;  3GTK A;  3OEP A;  3HOW C;  5IOQ A;  3A8K A;  3S2H C;  4BBR K;  2E2J K;  3N3Y A;  1WQF A;  2YU9 K;  5IOR A;  4GFQ A;  3GTQ A;  1VLO A;  3M4O C;  4A93 K;  2E2I K;  2Y0S L;  3DXJ A;  5FJ8 K;  3S1Q K;  3ORE A;  3I4M C;  4KAT A;  3HOZ K;  1J98 A;  1F9N A;  3GSI A;  4Y52 C;  5IOT A;  1EI6 A;  4X6A C;  4QIW L;  1BJT A;  3HOZ C;  3EQL A;  5IYC K;  4BBS K;  3I4M K;  4XSZ A;  2BE5 A;  3GTM K;  1VJE A;  2FQT A;  2E2I C;  3CQZ A;  2CFA B;  3H0G A;  2NVX K;  1XXC A;  2PA8 D;  3V4G A;  1DCH A;  4KM9 A;  3S1R K;  3G4C A;  2NVY A;  3RZO K;  3HOW K;  3GTG A;  5M5X K;  4GZY A;  3S2D C;  3TFI A;  2RH6 A;  4C2M K;  1XZQ B;  3SZZ A;  1ZBS A;  5L46 A;  1O24 A;  4A3J C;  3OPF A;  1SFO C;  4KMD A;  3CQZ K;  4C45 A;  4A3E C;  4A3L C;  3GDZ A;  1BS2 A;  3JST A;  4A3B K;  3M3Y C;  3FKI C;  1VGX A;  3GIR A;  5IYB K;  4OIQ A;  1F93 A;  1I50 A;  4XLN A;  5CJ9 A;  2D6F C;  3AD7 C;  4LJZ A;  1AB4 A;  1X31 C;  4C3J C;  5M3F K;  1WOP A;  1BDF A;  2YU9 A;  2E2H C;  1YX2 A;  1Y1V A;  3BUE A;  1TWA C;  3RZD C;  3GTL K;  4YFX A;  3IPJ A;  4ZH4 A;  5C4J C;  4G7O A;  1I6H K;  4BY7 K;  4XLP A;  2NVT C;  5IYD K;  2A6H A;  3FHZ A;  2RGR A;  3GTL C;  3I4N C;  1I3Q A;  3Q3Q A;  5FLM K;  2P5M A;  2JA8 C;  4KM8 A;  1ZXO A;  1O27 A;  3CQZ C;  3GTQ K;  1J6W A;  4GTF A;  2R7Z K;  1R9T C;  3FOF A;  2PMZ L;  4A3J K;  1O2A A;  1WSV A;  1USO A;  3AD9 C;  5IYB C;  1WQG A;  4GTL A;  3NUH A;  2P8T A;  4BKW A;  4MQ9 A;  3GTG K;  3HOV K;  3SZY A;  4AYB L;  1JQW A;  4A3B C;  1TWA A;  2ZUE A;  4GTA A;  2NVQ K;  1ZYR A;  3GTM A;  3HOV C;  1WQH A;  2O5I A;  3HOY C;  5TMF A;  1L0W A;  1O2F B;  4QIW D;  2WB1 L;  5EGH A;  3TFJ A;  4C2M C;  3S1N K;  1UV7 A;  4X6A K;  3S2D K;  4P9S A;  4Y52 K;  2NVQ C;  3S16 C;  3PO3 C;  1K83 A;  1Y1W A;  2KWA A;  3I4N K;  5C44 K;  1HI9 A;  4M1X A;  1I50 C;  3GTJ C;  2JA7 K;  3HOU K;  2ZFZ A;  4BBS C;  1R9T K;  1EK8 A;  4G7Z A;  3PO2 C;  1K83 C;  4NOI A;  5C4X C;  4LQY A;  4KB4 A;  4PAB A;  3HOX K;  4C3H K;  2NVT K;  4P5B A;  1DD5 A;  3GTO K;  3H0G C;  1VRQ C;  1PJ6 A;  4A3I K;  4AH6 A;  2A69 A;  1F7V A;  2JH3 A;  1R9T A;  4XSX A;  4MEY A;  4BLB A;  2PHC B;  3QX3 A;  3S14 K;  2WAQ L;  4A3D K;  4DDQ A;  1XPP A;  5C3E K;  3MML B;  4BY1 C;  1WIH A;  4LK1 A;  3S17 K;  4A3G C;  3BP8 C;  3HKZ L;  4WJ3 M;  3RZO C;  1XZP B;  2R7Z A;  2XCQ A;  5M5W K;  4WIL A;  4KAS A;  3GTL A;  4GTD A;  4ILD A;  3ADA C;  1O26 A;  2GSN A;  5IP7 C;  3GTO A;  1K83 K;  2R93 K;  5M5Y K;  2GAG C;  2Y0S D;  4Q4Z A;  4KC6 A;  1I3Q K;  1Y1V C;  3S1R C;  4A3I C;  1WOR A;  2NVX C;  1TWH K;  4GT9 A;  2O5J A;  2JA7 C;  3T01 A;  4LK0 A;  4G0W A;  4C3H C;  3G4A A;  4PAA A;  1SFO A;  1WOO A;  3GTP A;  5C44 C;  3K7A K;  5IP9 K;  2R92 A;  1WCM A;  1XXB A;  4QJV B;  1I6V A;  1TWG A;  4QJV A;  1VH2 A;  1WCM C;  4G0U A;  2R92 C;  1YCL A;  3FKI A;  1Y1W C;  4GTE A;  1KQ4 A;  1IQ0 A;  2W7V A;  3GTJ K;  4GTB A;  1XZQ A;  2FQO A;  3GEI A;  3K7A C;  3HXA A;  2A6E A;  4J3N A;  1EFW A;  4KB2 A;  3HOY K;  4A3F K;  3AD8 C;  5CHP A;  3S1M C;  2E2I A;  3S16 K;  3S2H K;  2A68 A;  2B63 C;  4O2D A;  4FM9 A;  1TWG K;  3S0X A;  1USM A;  2R93 C;  1TWC K;  4C3I C;  1XZP A;  4LR2 A;  4KMA A;  3LPX A;  1JOE A;  3S14 C;  5M3M K;  1O25 A;  1YNJ A;  2Y3P A;  3T00 A;  5FLM C;  4G0V A;  1WOS A;  5E68 A;  3CAG A;  2V6T A;  4G7H A;  3H3V D;  1I6H C;  5TMC A;  3GEH A;  4A3M C;  2JA5 K;  2R93 A;  3GTK K;  2EBB A;  4BXX C;  3HOX C;  3GTQ C;  1TWA K;  1EQR A;  4KAW X;  3LAJ A;  1ZQ1 C;  1IE0 A;  3PO2 K;  4C3J K;  1IS1 A;  4BXX K;  3S15 C;  3GTK C;  2E2H A;  5IYD C;  1O28 A;  5TJ3 A;  3WOD A;  3HKZ D;  4KN4 A;  4BY7 C;  3HOU C;  4KAR A;  4YFN A;  1TWF C;  4FZB A;  1HQM A;  2VUM A;  5D4D A;  3S15 K;  3FKI K;  1O2B A;  3AH5 A;  2JA6 C;  2JA5 A;  4RMF A;  5C4X K;  4A3E K;  3GTJ A;  5EGE A;  4P5A A;  3GTP C;  1DCO A;  4YG2 A;  3GEE A;  1G51 A;  4KN7 A;  4A3C C;  4Y7N C;  3AQO A;  4MEX A;  1I50 K;  2NVY K;  1JVI A;  1TWG C;  4KDD A;  4A3K K;  1GE9 A;  2VUM K;  3VA7 A;  4Q5S A;  3PO3 K;  2WB1 D;  2V6U A;  2VUM C;  3S1M K;  4OIO A;  4A3K C;  1IL2 A;  3GTG C;  2NVY C;  3S1N C;  5JVO A;  2JA7 A;  4Y7N K;  3GTM C;  3N0C A;  1PJ7 A;  3T02 A;  4C3I K;  1RU0 A;  1ZVU A;  2R7Z C;  1SMY A;  1EH1 A;  2PMZ D;  2R92 K;  1WCM K;  2XCO A;  1DCP A;  3BP3 A;  2JA6 K;  3S1Q C;  3TFH A;  4A3F C;  3ERE D;  4GTC A;  4AYB D;  4A93 C;  1B4B A;  1TWH A;  1TWF K;  2PA8 L;  4A3C K;  5C4J K;  1WSR A;  5HL8 A;  1TWH C;  1C0A A;  1IBA A;  1I3Q C;  1Y1V K;  3GTP K;  2WAQ D;  2XCR B;  1B4A A;  1V5V A;  1INN A;  2JA8 K;  1PJ5 A;  1YNN A;  3A8I A;  5IP9 C;  4JK1 A;  4XCH A;  5IOS A;  4YFK A;  4OIR A;  3M4O K;  4KMU A;  1J6X A;  5JFE A;  2YU9 C;  4LOW A;  2B63 A;  4BBR C;  2E2J C;  3H3V L;  2V6S A; 
#chains in the Genus database with same CATH homology
 5TMC A;  3RZD K;  4OIP A;  4XSX A;  2E2H K;  4LJZ A;  4A3M C;  2JA5 K;  1IW7 A;  5IP7 K;  4MEY A;  3GTK K;  4BXX C;  3HOX C;  3GTQ C;  1TWA K;  2CW0 A;  1SFO K;  5M3F K;  3S14 K;  4BY1 K;  2WAQ L;  5C3E C;  4OIN A;  4A3D K;  1BDF A;  1XPP A;  2JA5 C;  4A3M K;  5C3E K;  4A3D C;  2E2H C;  4BY1 C;  3PO2 K;  1TWA C;  4LK1 A;  4C3J K;  3RZD C;  4BXX K;  3GTL K;  3GTK C;  4YFX A;  3S17 K;  4ZH4 A;  3S15 C;  1TWC C;  5IYD C;  2PPB A;  3WOD A;  3HKZ D;  4KN4 A;  4BY7 C;  3HOU C;  4A3G C;  3HKZ L;  5C4J C;  4YFN A;  3M3Y K;  4G7O A;  2B63 K;  3RZO C;  1I6H K;  1TWF C;  4A3G K;  4XLP A;  1HQM A;  4BY7 K;  5M5W K;  2NVT C;  5IYD K;  2A6H A;  5D4D A;  3S17 C;  4A3L K;  3GTL C;  3S15 K;  3FKI K;  3I4N C;  2JA6 C;  3H0G K;  3GTO C;  5FLM K;  5C4X K;  2JA8 C;  4A3E K;  3CQZ C;  3GTQ K;  3GTP C;  4LLG A;  5IP7 C;  4YG2 A;  2R7Z K;  1R9T C;  5IYC C;  2PMZ L;  1K83 K;  2R93 K;  5M5Y K;  4A3J K;  1Y1W K;  2Y0S D;  4KN7 A;  4Q4Z A;  3HOW C;  4A3C C;  1I3Q K;  1Y1V C;  4Y7N C;  4MEX A;  3S2H C;  1I50 K;  3S1R C;  4BBR K;  5IYB C;  4A3I C;  2E2J K;  2NVX C;  1TWH K;  2NVY K;  2YU9 K;  1TWG C;  4MQ9 A;  2JA7 C;  4A3K K;  3GTG K;  3HOV K;  4LK0 A;  2O5J A;  2VUM K;  4AYB L;  4Q5S A;  3PO3 K;  2WB1 D;  3M4O C;  4A3B C;  2E2I K;  4A93 K;  2Y0S L;  3DXJ A;  5C44 C;  3K7A K;  1ZYR A;  5FJ8 K;  2NVQ K;  2VUM C;  3S1M K;  5IP9 K;  3S1Q K;  4OIO A;  4A3K C;  3GTG C;  4QJV B;  1I6V A;  2NVY C;  3HOV C;  2O5I A;  3I4M C;  3HOY C;  3S1N C;  5TMF A;  4QJV A;  3HOZ K;  1WCM C;  4Y7N K;  2R92 C;  3GTM C;  4Y52 C;  4QIW D;  2WB1 L;  1Y1W C;  4X6A C;  4QIW L;  4C3I K;  3HOZ C;  3EQL A;  5IYC K;  3S1N K;  2R7Z C;  4BBS K;  3I4M K;  1SMY A;  4X6A K;  2PMZ D;  3GTJ K;  3S2D K;  4XSZ A;  2BE5 A;  4Y52 K;  3K7A C;  2NVQ C;  2A6E A;  2R92 K;  1WCM K;  3GTM K;  3S16 C;  2E2I C;  3HOY K;  3PO3 C;  4A3F K;  2JA6 K;  3S1M C;  3I4N K;  3S1Q C;  5C44 K;  4A3F C;  2NVX K;  4AYB D;  4A93 C;  2PA8 D;  1I50 C;  3S1R K;  3S16 K;  3S2H K;  2PA8 L;  1TWF K;  2A68 A;  2B63 C;  3RZO K;  3HOW K;  4A3C K;  5M5X K;  4GZY A;  5C4J K;  3GTJ C;  3S2D C;  1TWG K;  2JA7 K;  3HOU K;  2R93 C;  1TWH C;  4BBS C;  1R9T K;  4C2M K;  1TWC K;  1I3Q C;  1Y1V K;  3GTP K;  4G7Z A;  2WAQ D;  3PO2 C;  4A3J C;  1I6H C;  1K83 C;  4NOI A;  2JA8 K;  5C4X C;  3S14 C;  5M3M K;  1YNN A;  1SFO C;  5IP9 C;  4JK1 A;  3CQZ K;  3HOX K;  4A3E C;  4A3L C;  1YNJ A;  4YFK A;  4OIR A;  4C3H K;  2NVT K;  4KMU A;  3M4O K;  4A3B K;  5FLM C;  3GTO K;  3H0G C;  3M3Y C;  3FKI C;  2YU9 C;  4BBR C;  5IYB K;  4A3I K;  2E2J C;  4OIQ A;  3H3V L;  4G7H A;  2A69 A;  3H3V D;  4XLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...