2WB1L

The complete structure of the archaeal 13-subunit dna-directed rna polymerase
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE RPO1N SUBUNIT
publication title Evolution of Complex RNA Polymerase: The Complete Archaeal RNA Polymerase Structure
pubmed doi rcsb
total genus 22
structure length 91
sequence length 91
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2wb1L00
5IP7C 2JA8K 3M4OC 4Y52K 3S2HK 5C4JK 3K7AK 1I50C 3S1MC 1K83C 2YU9K 3GTKC 4KMUA 4AYBD 4A3DK 2B63K 4A3KC 3S1QC 3S17C 3S16C 4A3BC 3GTLK 2E2IK 3GTGK 4ZH4A 3S1RK 4OIOA 2NVQK 1I3QK 2PMZL 2WB1L 2NVYC 4A3JC 2O5JA 3S14C 3I4NK 4OINA 2CW0A 2E2JK 2VUMK 4YFNA 2A6EA 4A93K 1Y1WK 3GTOC 3HOXK 5IYDK 3PO3K 3I4MK 4LK0A 3HOUK 1I6HK 2NVXC 1BDFA 2E2HC 3M3YK 2A69A 4BY1K 2JA6C 3HOWC 4X6AK 3S15K 3GTQC 3HOVC 5IYBK 3GTPK 1TWCC 3HOYC 5IP9C 3S1NK 4LLGA 3HKZD 5M5WK 3H0GC 5C4XC 5FLMK 4YG2A 3H3VL 2Y0SD 1Y1VC 2PA8L 2WAQD 4OIRA 2JA5K 4BXXC 5C44C 2R93K 4Y7NK 4BBRK 3GTJK 4A3CC 4XLNA 2NVTK 3FKIK 5IYCK 3CQZC 4YFKA 2JA7C 4BY7C 2PMZD 2WB1D 4A3FK 1TWAC 4A3MC 5C3EK 2R92C 4KN4A 4A3IC 1TWFC 1YNNA 1SFOK 5M5XK 2PPBA 4A3LK 5IP7K 3GTGC 1SMYA 3GTMK 4A3GK 5M3MK 1I50K 1K83K 1I3QC 2R7ZC 3S1QK 5TMCA 3I4NC 4QIWL 3S16K 4A3BK 4Q5SA 2VUMC 5FJ8K 1TWHC 4A3EC 4XLPA 3HOXC 1TWGC 3S2DC 5M5YK 2NVYK 4G7ZA 3S14K 3HOZC 4BBSC 4LJZA 5M3FK 4GZYA 2PA8D 3RZOK 4NOIA 3RZDC 3S15C 4C3IK 1WCMC 3GTPC 3S1RC 4YFXA 2JA8C 3PO2K 4LK1A 4Y52C 4XSZA 3S2HC 5C4JC 2A68A 3K7AC 4A3DC 1R9TK 2YU9C 2JA6K 3HOWK 1XPPA 2B63C 3GTQK 3HOVK 5IP9K 4Y7NC 3GTLC 2E2IC 3DXJA 3M4OK 1HQMA 5IYCC 3S1MK 3GTKK 5C4XK 4Q4ZA 2NVQC 2BE5A 4QIWD 4A3KK 4BXXK 3WODA 1SFOC 5C44K 3S17K 4C3HK 2E2JC 4C2MK 4A3CK 4A93C 1Y1WC 3GTMC 4A3GC 3CQZK 2JA7K 4BY7K 1IW7A 3HKZL 4A3MK 1TWAK 2R92K 5IYDC 3PO3C 4AYBL 4A3JK 3HOUC 3I4MC 2Y0SL 1TWFK 4A3IK 4XSXA 3EQLA 2WAQL 1I6HC 3H3VD 4OIQA 3M3YC 4MEXA 4BY1C 4JK1A 3GTOK 4X6AC 5IYBC 5D4DA 2R7ZK 4C3JK 3S1NC 2NVXK 2O5IA 2E2HK 4G7OA 1TWHK 5FLMC 3RZOC 4A3EK 4MEYA 4QJVB 4KN7A 1TWGK 2JA5C 4OIPA 4G7HA 3S2DK 1TWCK 3HOYK 1I6VA 4BBRC 3GTJC 3PO2C 3HOZK 4BBSK 2NVTC 2R93C 3FKIC 3H0GK 1R9TC 4A3FC 2A6HA 4MQ9A 5C3EC 3RZDK 1Y1VK 1WCMK 1YNJA 5TMFA 1ZYRA 4QJVA 4A3LC
chains in the Genus database with same CATH superfamily
2JA8K 4Y52K 1WIHA 1L0WA 3GEHA 3S17C 3S16C 2FQOA 2E2IK 4ZH4A 1USMA 1RU0A 3FOFA 2WB1L 4GTDA 3S0XA 3S14C 1YX2A 2CW0A 2PHCB 1DCPA 2E2JK 1F7UA 4C3IC 3I4MK 4KC6A 1TWCA 1JOEA 3GTQC 3TFHA 4LLGA 2V6SA 5FLMK 2PA8L 1TWAA 4GT9A 4Y7NK 4BBRK 3GTJK 1WOSA 4XLNA 5IYCK 4YFKA 2JA7C 1KQ4A 4FZBA 2R92C 3L4KA 5IP7K 2JH3A 4GTLA 1J98A 4KAWX 1I50K 5M3MK 2E2HA 1TWHA 1UV7A 4GTAA 5FJ8K 4A3EC 2P8TA 4GTEA 3HOXC 3AD9C 2GSOA 3GEEA 5E68A 1Y1VA 4GZYA 1EH1A 3RZOK 2GSUA 3GIRA 1ZQ1C 3S2HC 4A3DC 2E2IA 2B63C 3HOVK 4KATA 5IP9K 3DXJA 1HQMA 3GTKK 2BE5A 3WODA 1O27A 4A3CK 4A93C 1Y1WC 4A3GC 1XZPB 1IW7A 3HKZL 5IYDC 3PO3C 4A3JK 4A3IK 1TWFK 4GTCA 1XZPA 1EQRA 5D4DA 4C3JK 2NVXK 3OREA 2O5IA 4G7OA 4KB2A 3GTJA 1WQGA 4LOWA 1IS1A 1TWGK 1TWCK 2R93C 3PO2C 3HOZK 2NVTC 3H0GK 3GEIA 3RZDK 1I50A 1BS2A 1WQFA 1YNJA 1ZYRA 3M4OC 3K7AK 5L46A 3A8KA 1J6WA 3S1QC 1EFWA 3OPFA 1O2BA 3GTLK 3GTGK 3AQOA 4OIOA 2NVQK 3ERED 2NVYC 2O5JA 3I4NK 4OINA 3V4GA 4YFNA 2A6EA 3GTOC 4WJ3M 1F93A 3HOUK 2CFAB 1BDFA 2E2HC 1PJ7A 2JA6C 1WSRA 3S15K 3GTKA 3QX3A 3TFIA 4LQYA 3HOYC 3S1NK 3HKZD 3T00A 3TFJA 5M5WK 2CFAA 5C4XC 4YG2A 1Y1VC 4O2DA 2JA5K 3SZYA 4BXXC 4C3HC 1B4AA 1TWFA 4C2MC 3BP8C 3FKIK 3CQZC 4BY7C 4GFQA 3IPJA 1ISEA 3AD8C 2PPBA 2GAGC 2NVXA 3GTMK 1XZQB 2R7ZC 5TMCA 1TWGA 3S16K 5CHPA 3H0GA 4XLPA 3S2DC 3A8IA 1XZQA 3S14K 4BBSC 3NUHA 1O26A 4NOIA 1PJ6A 5CJ9A 4C3IK 1WCMC 3AD7C 4P9SA 3GSIA 4YFXA 4KMDA 4KMAA 5C4JC 2A68A 1R9TK 2YU9C 3GTLA 3GTGA 3GTQK 4Y7NC 5IYCC 1INNA 3S1MK 3FHZA 4A3KK 1PJ5A 2JA7K 5JFEA 2R92K 1I6HC 3EQLA 3M3YC 5TJ3A 4BY1C 4JK1A 1O29A 4X6AC 5IYBC 3GDZA 3BP3A 2JA5A 1JQWA 3T01A 2XCOA 1AB4A 3RZOC 3FKIA 2XCRB 4MEYA 4A3EK 1I6VA 4A3FC 5C3EC 4MQ9A 1DCHA 3GTMA 5IOQA 1IE0A 4A3LC 3S2HK 4A3DK 1K83C 3GTKC 4AYBD 1X31C 2B63K 3JSTA 1BGWA 1XXCA 4A3BC 3FOEA 1BJTA 1HI9A 1V5VA 1I3QK 4A3JC 2VUMK 4A93K 4KM9A 1EI6A 1Y1WK 3A8JA 1R9TA 5IYDK 3PO3K 4PABA 4C3JC 2NVXC 3GTQA 4ILDA 3AQPA 3HOWC 3GTPK 1TWCC 2P5MA 4RMFA 3H0GC 3H3VL 2JA7A 5C44C 2R92A 2R93K 2GAHC 2NVTK 1VRQC 2PMZD 4A3MC 1TWAC 3BUEA 1SFOK 5M5XK 3GTGC 1ZBSA 4M1XA 4GTFA 3CAGA 4XCHA 3S1QK 3I4NC 4C45A 1TWHC 1WQHA 4KARA 5M5YK 1O2FB 2NVYK 4G7ZA 4G0UA 4LJZA 1JVIA 5M3FK 1VH2A 2FQTA 3S15C 4P5BA 2B63A 3S1RC 2V6TA 2JA8C 4LK1A 4Y52C 1DCOA 3VA7A 4FM9A 2ZUEA 3SZZA 2JA6K 1XPPA 1O25A 1I3QA 4G0WA 2E2IC 4LR2A 2VUMA 5C4XK 1Y1WA 2GSNA 4QIWD 4AH6A 4BXXK 2EBBA 3S17K 4C3HK 2E2JC 4C2MK 3GTMC 3CQZK 1G51A 4BY7K 1C0AA 3N3YA 4AYBL 3I4MC 2Y0SL 5JVOA 4XSXA 1F9NA 2WAQL 3GTPA 3H3VD 4KB4A 2R7ZK 2W7VA 1WOPA 1YCLA 1O28A 1GE9A 2R93A 1XXBA 5FLMC 1J6XA 2RH6A 5EGHA 4QJVB 4KN7A 3S2DK 4OIPA 4G7HA 4BBRC 3GTJC 4BBSK 1SFOA 4BKWA 1R9TC 1EK8A 1XXAA 2A6HA 1WCMK 4QJVA 5IP7C 1WSVA 3LAJA 5C4JK 1I50C 3S1MC 2YU9K 4KMUA 4BLBA 4G0VA 4A3KC 3L4JA 2NVYA 3GTOA 2PMZL 4DDQA 1IL2A 3HOXK 2JA6A 4LK0A 1I6HK 3M3YK 2A69A 4BY1K 4X6AK 3HOVC 2D6FC 5IYBK 5IP9C 3N0CA 2ZUFA 1F7VA 2Y0SD 3OEPA 3CQZA 4OIRA 2WAQD 3TTGA 4PAAA 1O2AA 3Q3QA 4A3CC 2WB1D 4A3FK 5C3EK 4KN4A 4A3IC 1TWFC 1YNNA 4A3LK 2R7ZA 3AH5A 4KASA 1DD5A 2XCQA 4J3NA 1SMYA 4A3GK 1K83K 1I3QC 4KMHA 1VLOA 4QIWL 4A3BK 4Q5SA 2VUMC 5IOSA 4WILA 1TWGC 4KDDA 5HL8A 1WCMA 3HOZC 2PA8D 3G4CA 3RZDC 2YU9A 3GTPC 3PO2K 4XSZA 1IBAA 1B4BA 3K7AC 3LAPA 3HOWK 4P5AA 3ADAC 3MMLB 2KWAA 2Y3PA 3GTLC 3M4OK 4Q4ZA 2NVQC 3N0BA 3T02A 1SFOC 5C44K 4GTBA 1IQ0A 2V6UA 1ZVUA 1J6VA 4A3MK 1TWAK 3HXAA 1USOA 3HOUC 5EGEA 1O24A 1ZXOA 1WOOA 4OIQA 4KM8A 4MEXA 3GTOK 2ZFZA 2RGRA 4WJ4A 3LPXA 5IOTA 3S1NC 2E2HK 4BLAA 1TWHK 1VJEA 5IORA 2JA5C 1WORA 3HOYK 3G4AA 3FKIC 1Y1VK 1K83A 1VGXA 5TMFA 3S1RK
chains in the Genus database with same CATH topology
5IP7C 2JA8K 3M4OC 4Y52K 3S2HK 5C4JK 3K7AK 1I50C 3S1MC 1K83C 2YU9K 3GTKC 4KMUA 4AYBD 4A3DK 2B63K 4A3KC 3S1QC 3S17C 3S16C 4A3BC 3GTLK 2E2IK 3GTGK 4ZH4A 3S1RK 4OIOA 2NVQK 1I3QK 2PMZL 2WB1L 2NVYC 4A3JC 2O5JA 3S14C 3I4NK 4OINA 2CW0A 2E2JK 2VUMK 4YFNA 2A6EA 4A93K 1Y1WK 3GTOC 3HOXK 5IYDK 3PO3K 3I4MK 4LK0A 3HOUK 1I6HK 2NVXC 1BDFA 2E2HC 3M3YK 2A69A 4BY1K 2JA6C 3HOWC 4X6AK 3S15K 3GTQC 3HOVC 5IYBK 3GTPK 1TWCC 3HOYC 5IP9C 3S1NK 4LLGA 3HKZD 5M5WK 3H0GC 5C4XC 5FLMK 4YG2A 3H3VL 2Y0SD 1Y1VC 2PA8L 2WAQD 4OIRA 2JA5K 4BXXC 5C44C 2R93K 4Y7NK 4BBRK 3GTJK 4A3CC 4XLNA 2NVTK 3FKIK 5IYCK 3CQZC 4YFKA 2JA7C 4BY7C 2PMZD 2WB1D 4A3FK 1TWAC 4A3MC 5C3EK 2R92C 4KN4A 4A3IC 1TWFC 1YNNA 1SFOK 5M5XK 2PPBA 4A3LK 5IP7K 3GTGC 1SMYA 3GTMK 4A3GK 5M3MK 1I50K 1K83K 1I3QC 2R7ZC 3S1QK 5TMCA 3I4NC 4QIWL 3S16K 4A3BK 4Q5SA 2VUMC 5FJ8K 1TWHC 4A3EC 4XLPA 3HOXC 1TWGC 3S2DC 5M5YK 2NVYK 4G7ZA 3S14K 3HOZC 4BBSC 4LJZA 5M3FK 4GZYA 2PA8D 3RZOK 4NOIA 3RZDC 3S15C 4C3IK 1WCMC 3GTPC 3S1RC 4YFXA 2JA8C 3PO2K 4LK1A 4Y52C 4XSZA 3S2HC 5C4JC 2A68A 3K7AC 4A3DC 1R9TK 2YU9C 2JA6K 3HOWK 1XPPA 2B63C 3GTQK 3HOVK 5IP9K 4Y7NC 3GTLC 2E2IC 3DXJA 3M4OK 1HQMA 5IYCC 3S1MK 3GTKK 5C4XK 4Q4ZA 2NVQC 2BE5A 4QIWD 4A3KK 4BXXK 3WODA 1SFOC 5C44K 3S17K 4C3HK 2E2JC 4C2MK 4A3CK 4A93C 1Y1WC 3GTMC 4A3GC 3CQZK 2JA7K 4BY7K 1IW7A 3HKZL 4A3MK 1TWAK 2R92K 5IYDC 3PO3C 4AYBL 4A3JK 3HOUC 3I4MC 2Y0SL 1TWFK 4A3IK 4XSXA 3EQLA 2WAQL 1I6HC 3H3VD 4OIQA 3M3YC 4MEXA 4BY1C 4JK1A 3GTOK 4X6AC 5IYBC 5D4DA 2R7ZK 4C3JK 3S1NC 2NVXK 2O5IA 2E2HK 4G7OA 1TWHK 5FLMC 3RZOC 4A3EK 4MEYA 4QJVB 4KN7A 1TWGK 2JA5C 4OIPA 4G7HA 3S2DK 1TWCK 3HOYK 1I6VA 4BBRC 3GTJC 3PO2C 3HOZK 4BBSK 2NVTC 2R93C 3FKIC 3H0GK 1R9TC 4A3FC 2A6HA 4MQ9A 5C3EC 3RZDK 1Y1VK 1WCMK 1YNJA 5TMFA 1ZYRA 4QJVA 4A3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 C;  2JA8 K;  3M4O C;  4Y52 K;  3S2H K;  5C4J K;  3K7A K;  1I50 C;  3S1M C;  1K83 C;  2YU9 K;  3GTK C;  4KMU A;  4AYB D;  4A3D K;  2B63 K;  4A3K C;  3S1Q C;  3S17 C;  3S16 C;  4A3B C;  3GTL K;  2E2I K;  3GTG K;  4ZH4 A;  3S1R K;  4OIO A;  2NVQ K;  1I3Q K;  2PMZ L;  2WB1 L;  2NVY C;  4A3J C;  2O5J A;  3S14 C;  3I4N K;  4OIN A;  2CW0 A;  2E2J K;  2VUM K;  4YFN A;  2A6E A;  4A93 K;  1Y1W K;  3GTO C;  3HOX K;  5IYD K;  3PO3 K;  3I4M K;  4LK0 A;  3HOU K;  1I6H K;  2NVX C;  1BDF A;  2E2H C;  3M3Y K;  2A69 A;  4BY1 K;  2JA6 C;  3HOW C;  4X6A K;  3S15 K;  3GTQ C;  3HOV C;  5IYB K;  3GTP K;  1TWC C;  3HOY C;  5IP9 C;  3S1N K;  4LLG A;  3HKZ D;  5M5W K;  3H0G C;  5C4X C;  5FLM K;  4YG2 A;  3H3V L;  2Y0S D;  1Y1V C;  2PA8 L;  2WAQ D;  4OIR A;  2JA5 K;  4BXX C;  5C44 C;  2R93 K;  4Y7N K;  4BBR K;  3GTJ K;  4A3C C;  4XLN A;  2NVT K;  3FKI K;  5IYC K;  3CQZ C;  4YFK A;  2JA7 C;  4BY7 C;  2PMZ D;  2WB1 D;  4A3F K;  1TWA C;  4A3M C;  5C3E K;  2R92 C;  4KN4 A;  4A3I C;  1TWF C;  1YNN A;  1SFO K;  5M5X K;  2PPB A;  4A3L K;  5IP7 K;  3GTG C;  1SMY A;  3GTM K;  4A3G K;  5M3M K;  1I50 K;  1K83 K;  1I3Q C;  2R7Z C;  3S1Q K;  5TMC A;  3I4N C;  4QIW L;  3S16 K;  4A3B K;  4Q5S A;  2VUM C;  5FJ8 K;  1TWH C;  4A3E C;  4XLP A;  3HOX C;  1TWG C;  3S2D C;  5M5Y K;  2NVY K;  4G7Z A;  3S14 K;  3HOZ C;  4BBS C;  4LJZ A;  5M3F K;  4GZY A;  2PA8 D;  3RZO K;  4NOI A;  3RZD C;  3S15 C;  4C3I K;  1WCM C;  3GTP C;  3S1R C;  4YFX A;  2JA8 C;  3PO2 K;  4LK1 A;  4Y52 C;  4XSZ A;  3S2H C;  5C4J C;  2A68 A;  3K7A C;  4A3D C;  1R9T K;  2YU9 C;  2JA6 K;  3HOW K;  1XPP A;  2B63 C;  3GTQ K;  3HOV K;  5IP9 K;  4Y7N C;  3GTL C;  2E2I C;  3DXJ A;  3M4O K;  1HQM A;  5IYC C;  3S1M K;  3GTK K;  5C4X K;  4Q4Z A;  2NVQ C;  2BE5 A;  4QIW D;  4A3K K;  4BXX K;  3WOD A;  1SFO C;  5C44 K;  3S17 K;  4C3H K;  2E2J C;  4C2M K;  4A3C K;  4A93 C;  1Y1W C;  3GTM C;  4A3G C;  3CQZ K;  2JA7 K;  4BY7 K;  1IW7 A;  3HKZ L;  4A3M K;  1TWA K;  2R92 K;  5IYD C;  3PO3 C;  4AYB L;  4A3J K;  3HOU C;  3I4M C;  2Y0S L;  1TWF K;  4A3I K;  4XSX A;  3EQL A;  2WAQ L;  1I6H C;  3H3V D;  4OIQ A;  3M3Y C;  4MEX A;  4BY1 C;  4JK1 A;  3GTO K;  4X6A C;  5IYB C;  5D4D A;  2R7Z K;  4C3J K;  3S1N C;  2NVX K;  2O5I A;  2E2H K;  4G7O A;  1TWH K;  5FLM C;  3RZO C;  4A3E K;  4MEY A;  4QJV B;  4KN7 A;  1TWG K;  2JA5 C;  4OIP A;  4G7H A;  3S2D K;  1TWC K;  3HOY K;  1I6V A;  4BBR C;  3GTJ C;  3PO2 C;  3HOZ K;  4BBS K;  2NVT C;  2R93 C;  3FKI C;  3H0G K;  1R9T C;  4A3F C;  2A6H A;  4MQ9 A;  5C3E C;  3RZD K;  1Y1V K;  1WCM K;  1YNJ A;  5TMF A;  1ZYR A;  4QJV A;  4A3L C; 
#chains in the Genus database with same CATH topology
 2JA8 K;  4Y52 K;  1WIH A;  1L0W A;  3GEH A;  3S17 C;  3S16 C;  2FQO A;  2E2I K;  4ZH4 A;  1USM A;  1RU0 A;  3FOF A;  2WB1 L;  4GTD A;  3S0X A;  3S14 C;  1YX2 A;  2CW0 A;  2PHC B;  1DCP A;  2E2J K;  1F7U A;  4C3I C;  3I4M K;  4KC6 A;  1TWC A;  1JOE A;  3GTQ C;  3TFH A;  4LLG A;  2V6S A;  5FLM K;  2PA8 L;  1TWA A;  4GT9 A;  4Y7N K;  4BBR K;  3GTJ K;  1WOS A;  4XLN A;  5IYC K;  4YFK A;  2JA7 C;  1KQ4 A;  4FZB A;  2R92 C;  3L4K A;  5IP7 K;  2JH3 A;  4GTL A;  1J98 A;  4KAW X;  1I50 K;  5M3M K;  2E2H A;  1TWH A;  1UV7 A;  4GTA A;  5FJ8 K;  4A3E C;  2P8T A;  4GTE A;  3HOX C;  3AD9 C;  2GSO A;  3GEE A;  5E68 A;  1Y1V A;  4GZY A;  1EH1 A;  3RZO K;  2GSU A;  3GIR A;  1ZQ1 C;  3S2H C;  4A3D C;  2E2I A;  2B63 C;  3HOV K;  4KAT A;  5IP9 K;  3DXJ A;  1HQM A;  3GTK K;  2BE5 A;  3WOD A;  1O27 A;  4A3C K;  4A93 C;  1Y1W C;  4A3G C;  1XZP B;  1IW7 A;  3HKZ L;  5IYD C;  3PO3 C;  4A3J K;  4A3I K;  1TWF K;  4GTC A;  1XZP A;  1EQR A;  5D4D A;  4C3J K;  2NVX K;  3ORE A;  2O5I A;  4G7O A;  4KB2 A;  3GTJ A;  1WQG A;  4LOW A;  1IS1 A;  1TWG K;  1TWC K;  2R93 C;  3PO2 C;  3HOZ K;  2NVT C;  3H0G K;  3GEI A;  3RZD K;  1I50 A;  1BS2 A;  1WQF A;  1YNJ A;  1ZYR A;  3M4O C;  3K7A K;  5L46 A;  3A8K A;  1J6W A;  3S1Q C;  1EFW A;  3OPF A;  1O2B A;  3GTL K;  3GTG K;  3AQO A;  4OIO A;  2NVQ K;  3ERE D;  2NVY C;  2O5J A;  3I4N K;  4OIN A;  3V4G A;  4YFN A;  2A6E A;  3GTO C;  4WJ3 M;  1F93 A;  3HOU K;  2CFA B;  1BDF A;  2E2H C;  1PJ7 A;  2JA6 C;  1WSR A;  3S15 K;  3GTK A;  3QX3 A;  3TFI A;  4LQY A;  3HOY C;  3S1N K;  3HKZ D;  3T00 A;  3TFJ A;  5M5W K;  2CFA A;  5C4X C;  4YG2 A;  1Y1V C;  4O2D A;  2JA5 K;  3SZY A;  4BXX C;  4C3H C;  1B4A A;  1TWF A;  4C2M C;  3BP8 C;  3FKI K;  3CQZ C;  4BY7 C;  4GFQ A;  3IPJ A;  1ISE A;  3AD8 C;  2PPB A;  2GAG C;  2NVX A;  3GTM K;  1XZQ B;  2R7Z C;  5TMC A;  1TWG A;  3S16 K;  5CHP A;  3H0G A;  4XLP A;  3S2D C;  3A8I A;  1XZQ A;  3S14 K;  4BBS C;  3NUH A;  1O26 A;  4NOI A;  1PJ6 A;  5CJ9 A;  4C3I K;  1WCM C;  3AD7 C;  4P9S A;  3GSI A;  4YFX A;  4KMD A;  4KMA A;  5C4J C;  2A68 A;  1R9T K;  2YU9 C;  3GTL A;  3GTG A;  3GTQ K;  4Y7N C;  5IYC C;  1INN A;  3S1M K;  3FHZ A;  4A3K K;  1PJ5 A;  2JA7 K;  5JFE A;  2R92 K;  1I6H C;  3EQL A;  3M3Y C;  5TJ3 A;  4BY1 C;  4JK1 A;  1O29 A;  4X6A C;  5IYB C;  3GDZ A;  3BP3 A;  2JA5 A;  1JQW A;  3T01 A;  2XCO A;  1AB4 A;  3RZO C;  3FKI A;  2XCR B;  4MEY A;  4A3E K;  1I6V A;  4A3F C;  5C3E C;  4MQ9 A;  1DCH A;  3GTM A;  5IOQ A;  1IE0 A;  4A3L C;  3S2H K;  4A3D K;  1K83 C;  3GTK C;  4AYB D;  1X31 C;  2B63 K;  3JST A;  1BGW A;  1XXC A;  4A3B C;  3FOE A;  1BJT A;  1HI9 A;  1V5V A;  1I3Q K;  4A3J C;  2VUM K;  4A93 K;  4KM9 A;  1EI6 A;  1Y1W K;  3A8J A;  1R9T A;  5IYD K;  3PO3 K;  4PAB A;  4C3J C;  2NVX C;  3GTQ A;  4ILD A;  3AQP A;  3HOW C;  3GTP K;  1TWC C;  2P5M A;  4RMF A;  3H0G C;  3H3V L;  2JA7 A;  5C44 C;  2R92 A;  2R93 K;  2GAH C;  2NVT K;  1VRQ C;  2PMZ D;  4A3M C;  1TWA C;  3BUE A;  1SFO K;  5M5X K;  3GTG C;  1ZBS A;  4M1X A;  4GTF A;  3CAG A;  4XCH A;  3S1Q K;  3I4N C;  4C45 A;  1TWH C;  1WQH A;  4KAR A;  5M5Y K;  1O2F B;  2NVY K;  4G7Z A;  4G0U A;  4LJZ A;  1JVI A;  5M3F K;  1VH2 A;  2FQT A;  3S15 C;  4P5B A;  2B63 A;  3S1R C;  2V6T A;  2JA8 C;  4LK1 A;  4Y52 C;  1DCO A;  3VA7 A;  4FM9 A;  2ZUE A;  3SZZ A;  2JA6 K;  1XPP A;  1O25 A;  1I3Q A;  4G0W A;  2E2I C;  4LR2 A;  2VUM A;  5C4X K;  1Y1W A;  2GSN A;  4QIW D;  4AH6 A;  4BXX K;  2EBB A;  3S17 K;  4C3H K;  2E2J C;  4C2M K;  3GTM C;  3CQZ K;  1G51 A;  4BY7 K;  1C0A A;  3N3Y A;  4AYB L;  3I4M C;  2Y0S L;  5JVO A;  4XSX A;  1F9N A;  2WAQ L;  3GTP A;  3H3V D;  4KB4 A;  2R7Z K;  2W7V A;  1WOP A;  1YCL A;  1O28 A;  1GE9 A;  2R93 A;  1XXB A;  5FLM C;  1J6X A;  2RH6 A;  5EGH A;  4QJV B;  4KN7 A;  3S2D K;  4OIP A;  4G7H A;  4BBR C;  3GTJ C;  4BBS K;  1SFO A;  4BKW A;  1R9T C;  1EK8 A;  1XXA A;  2A6H A;  1WCM K;  4QJV A;  5IP7 C;  1WSV A;  3LAJ A;  5C4J K;  1I50 C;  3S1M C;  2YU9 K;  4KMU A;  4BLB A;  4G0V A;  4A3K C;  3L4J A;  2NVY A;  3GTO A;  2PMZ L;  4DDQ A;  1IL2 A;  3HOX K;  2JA6 A;  4LK0 A;  1I6H K;  3M3Y K;  2A69 A;  4BY1 K;  4X6A K;  3HOV C;  2D6F C;  5IYB K;  5IP9 C;  3N0C A;  2ZUF A;  1F7V A;  2Y0S D;  3OEP A;  3CQZ A;  4OIR A;  2WAQ D;  3TTG A;  4PAA A;  1O2A A;  3Q3Q A;  4A3C C;  2WB1 D;  4A3F K;  5C3E K;  4KN4 A;  4A3I C;  1TWF C;  1YNN A;  4A3L K;  2R7Z A;  3AH5 A;  4KAS A;  1DD5 A;  2XCQ A;  4J3N A;  1SMY A;  4A3G K;  1K83 K;  1I3Q C;  4KMH A;  1VLO A;  4QIW L;  4A3B K;  4Q5S A;  2VUM C;  5IOS A;  4WIL A;  1TWG C;  4KDD A;  5HL8 A;  1WCM A;  3HOZ C;  2PA8 D;  3G4C A;  3RZD C;  2YU9 A;  3GTP C;  3PO2 K;  4XSZ A;  1IBA A;  1B4B A;  3K7A C;  3LAP A;  3HOW K;  4P5A A;  3ADA C;  3MML B;  2KWA A;  2Y3P A;  3GTL C;  3M4O K;  4Q4Z A;  2NVQ C;  3N0B A;  3T02 A;  1SFO C;  5C44 K;  4GTB A;  1IQ0 A;  2V6U A;  1ZVU A;  1J6V A;  4A3M K;  1TWA K;  3HXA A;  1USO A;  3HOU C;  5EGE A;  1O24 A;  1ZXO A;  1WOO A;  4OIQ A;  4KM8 A;  4MEX A;  3GTO K;  2ZFZ A;  2RGR A;  4WJ4 A;  3LPX A;  5IOT A;  3S1N C;  2E2H K;  4BLA A;  1TWH K;  1VJE A;  5IOR A;  2JA5 C;  1WOR A;  3HOY K;  3G4A A;  3FKI C;  1Y1V K;  1K83 A;  1VGX A;  5TMF A;  3S1R K; 
#chains in the Genus database with same CATH homology
 5IP7 C;  2JA8 K;  3M4O C;  4Y52 K;  3S2H K;  5C4J K;  3K7A K;  1I50 C;  3S1M C;  1K83 C;  2YU9 K;  3GTK C;  4KMU A;  4AYB D;  4A3D K;  2B63 K;  4A3K C;  3S1Q C;  3S17 C;  3S16 C;  4A3B C;  3GTL K;  2E2I K;  3GTG K;  4ZH4 A;  3S1R K;  4OIO A;  2NVQ K;  1I3Q K;  2PMZ L;  2WB1 L;  2NVY C;  4A3J C;  2O5J A;  3S14 C;  3I4N K;  4OIN A;  2CW0 A;  2E2J K;  2VUM K;  4YFN A;  2A6E A;  4A93 K;  1Y1W K;  3GTO C;  3HOX K;  5IYD K;  3PO3 K;  3I4M K;  4LK0 A;  3HOU K;  1I6H K;  2NVX C;  1BDF A;  2E2H C;  3M3Y K;  2A69 A;  4BY1 K;  2JA6 C;  3HOW C;  4X6A K;  3S15 K;  3GTQ C;  3HOV C;  5IYB K;  3GTP K;  1TWC C;  3HOY C;  5IP9 C;  3S1N K;  4LLG A;  3HKZ D;  5M5W K;  3H0G C;  5C4X C;  5FLM K;  4YG2 A;  3H3V L;  2Y0S D;  1Y1V C;  2PA8 L;  2WAQ D;  4OIR A;  2JA5 K;  4BXX C;  5C44 C;  2R93 K;  4Y7N K;  4BBR K;  3GTJ K;  4A3C C;  4XLN A;  2NVT K;  3FKI K;  5IYC K;  3CQZ C;  4YFK A;  2JA7 C;  4BY7 C;  2PMZ D;  2WB1 D;  4A3F K;  1TWA C;  4A3M C;  5C3E K;  2R92 C;  4KN4 A;  4A3I C;  1TWF C;  1YNN A;  1SFO K;  5M5X K;  2PPB A;  4A3L K;  5IP7 K;  3GTG C;  1SMY A;  3GTM K;  4A3G K;  5M3M K;  1I50 K;  1K83 K;  1I3Q C;  2R7Z C;  3S1Q K;  5TMC A;  3I4N C;  4QIW L;  3S16 K;  4A3B K;  4Q5S A;  2VUM C;  5FJ8 K;  1TWH C;  4A3E C;  4XLP A;  3HOX C;  1TWG C;  3S2D C;  5M5Y K;  2NVY K;  4G7Z A;  3S14 K;  3HOZ C;  4BBS C;  4LJZ A;  5M3F K;  4GZY A;  2PA8 D;  3RZO K;  4NOI A;  3RZD C;  3S15 C;  4C3I K;  1WCM C;  3GTP C;  3S1R C;  4YFX A;  2JA8 C;  3PO2 K;  4LK1 A;  4Y52 C;  4XSZ A;  3S2H C;  5C4J C;  2A68 A;  3K7A C;  4A3D C;  1R9T K;  2YU9 C;  2JA6 K;  3HOW K;  1XPP A;  2B63 C;  3GTQ K;  3HOV K;  5IP9 K;  4Y7N C;  3GTL C;  2E2I C;  3DXJ A;  3M4O K;  1HQM A;  5IYC C;  3S1M K;  3GTK K;  5C4X K;  4Q4Z A;  2NVQ C;  2BE5 A;  4QIW D;  4A3K K;  4BXX K;  3WOD A;  1SFO C;  5C44 K;  3S17 K;  4C3H K;  2E2J C;  4C2M K;  4A3C K;  4A93 C;  1Y1W C;  3GTM C;  4A3G C;  3CQZ K;  2JA7 K;  4BY7 K;  1IW7 A;  3HKZ L;  4A3M K;  1TWA K;  2R92 K;  5IYD C;  3PO3 C;  4AYB L;  4A3J K;  3HOU C;  3I4M C;  2Y0S L;  1TWF K;  4A3I K;  4XSX A;  3EQL A;  2WAQ L;  1I6H C;  3H3V D;  4OIQ A;  3M3Y C;  4MEX A;  4BY1 C;  4JK1 A;  3GTO K;  4X6A C;  5IYB C;  5D4D A;  2R7Z K;  4C3J K;  3S1N C;  2NVX K;  2O5I A;  2E2H K;  4G7O A;  1TWH K;  5FLM C;  3RZO C;  4A3E K;  4MEY A;  4QJV B;  4KN7 A;  1TWG K;  2JA5 C;  4OIP A;  4G7H A;  3S2D K;  1TWC K;  3HOY K;  1I6V A;  4BBR C;  3GTJ C;  3PO2 C;  3HOZ K;  4BBS K;  2NVT C;  2R93 C;  3FKI C;  3H0G K;  1R9T C;  4A3F C;  2A6H A;  4MQ9 A;  5C3E C;  3RZD K;  1Y1V K;  1WCM K;  1YNJ A;  5TMF A;  1ZYR A;  4QJV A;  4A3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...