1RU0A

Crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DcoH-like protein DCoHm
publication title Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
total genus 37
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1ru0A00
4C45A 1RU0A 2V6SA 2EBBA 1F93A 1DCOA 1USMA 4LOWA 1DCHA 1USOA 4WILA 2V6UA 1DCPA 3HXAA 3JSTA 2V6TA
chains in the Genus database with same CATH superfamily
4GZYA 4Y7NK 2NVYA 4YFNA 1WQFA 1USOA 4P5AA 1O24A 4WILA 1WCMA 3G4AA 3M4OK 3GTQC 3HOVC 1V5VA 4O2DA 1TWGC 1ZXOA 2NVQK 4LK1A 3HOWC 2A69A 5CJ9A 5C4XK 3T00A 4G0UA 3RZOC 3PO2K 1UV7A 1BGWA 1K83A 3GEEA 5EGHA 2JH3A 4Q4ZA 1R9TC 4XLPA 1ISEA 4C3IC 1WCMC 3I4MC 3GTKK 1JOEA 4JK1A 3BP8C 3Q3QA 2JA6K 1XXBA 2WAQD 3FKIK 1DCPA 1I50A 4LJZA 3S14K 3N3YA 1EFWA 3AQPA 4A3DC 5IP9K 1HI9A 2RGRA 4KC6A 4LQYA 4OIQA 2PMZL 3HOYC 1XPPA 2EBBA 4KM9A 3RZDK 4BY7K 2GSNA 1PJ6A 1Y1VA 1XXAA 4C3IK 4GTLA 1B4AA 4MEYA 4C3HC 4A3IK 3FOFA 1XZQB 4A3CC 5C44K 1JQWA 4AYBD 3GTMK 1DD5A 5M5XK 1KQ4A 5FLMC 4A93C 4KASA 1TWCA 3QX3A 2JA7C 2V6TA 4BXXK 2NVXA 3GTGK 1BJTA 2GAHC 3TFJA 1WSRA 4MEXA 4BY1K 3GTPA 4A3JC 4LLGA 4Y52K 3S16K 3K7AK 2E2HK 2ZUFA 4A3KK 4NOIA 1Y1VC 1PJ5A 4GTFA 1TWFC 3GTLK 4A3LK 3S2DC 5TMCA 1XZQA 5C4JC 2R92K 1SFOA 2R7ZA 4P9SA 3S2HK 4OIPA 1JVIA 2WAQL 4LR2A 2JA5A 4GTAA 3GTOA 2WB1D 3HOZK 2CW0A 4C3JK 4Q5SA 4X6AC 2W7VA 4PABA 5IYCK 1SMYA 1TWAK 2R93A 2NVXC 2Y0SD 3GTPC 4WJ3M 2PPBA 4FM9A 1I3QC 3I4NK 2B63K 3H0GK 1Y1WK 1SFOC 1TWFK 3FHZA 3AD8C 3HKZD 3S1QK 4ILDA 3OREA 3ADAC 3GTOC 3N0BA 3HOXC 4AYBL 4GTCA 2R93C 3GTKA 2YU9A 1IBAA 3FKIA 5L46A 2GAGC 4OIOA 1X31C 3M3YK 4GTDA 5FJ8K 3S1RC 5IOQA 4QJVB 4QIWD 3IPJA 4KB2A 2O5JA 5IOTA 4XCHA 4C2MC 2PA8D 5JVOA 4GTBA 3GEIA 5TMFA 1VGXA 1ZYRA 4GTEA 2E2JK 2YU9C 1O2AA 2WB1L 2D6FC 5IYDC 4KAWX 2RH6A 2NVYC 5IP7C 3PO3C 1F9NA 3A8JA 2Y0SL 1I6VA 1ZQ1C 3WODA 5C3EC 4KN7A 3GTQK 3HOVK 4BKWA 2JA8C 1WQGA 3A8KA 1TWGK 4A3FC 3HOWK 3L4KA 2VUMA 4A3EC 1WOOA 2E2HA 3HKZL 3RZOK 1K83C 4KATA 1PJ7A 4LK0A 1WQHA 4YFKA 4YFXA 1R9TK 2Y3PA 3GTJA 4A3MC 1WCMK 3I4MK 1J6XA 1I50C 4OIRA 4BBSC 4OINA 4KARA 4QIWL 1XZPB 2O5IA 4KN4A 3S17C 2VUMC 4J3NA 3S1NC 2NVTC 1USMA 4A3FK 3VA7A 1DCHA 4BLAA 1VRQC 2E2IA 4M1XA 2GSUA 4A3DK 4BLBA 1O2FB 2PA8L 1IS1A 3MMLB 4P5BA 3OPFA 4BBRC 1TWHA 2PHCB 4KM8A 3HOYK 1J98A 1BS2A 4LOWA 4KMAA 3GTJC 3G4CA 1O29A 1XZPA 4YG2A 4C45A 1XXCA 3S1MC 2GSOA 1I50K 4C3HK 3CQZA 1F7VA 5TJ3A 4A3CK 5D4DA 1YNJA 3T01A 2E2IC 1TWCC 5FLMK 1EQRA 3TFHA 4A93K 1BDFA 1TWHC 3S15C 3SZZA 2JA7K 2V6SA 4A3JK 1DCOA 2ZFZA 5IYBC 2A6EA 1EI6A 1Y1VK 3S2DK 1VH2A 4XSZA 5C4JK 2R7ZC 2V6UA 3AD7C 3CQZC 2JA5C 2ZUEA 4KMHA 4Y7NC 1WSVA 3T02A 1IE0A 3M4OC 2JA6A 4X6AK 1AB4A 1C0AA 1IL2A 2NVQC 2NVXK 3GSIA 3L4JA 3GTPK 5C4XC 1I3QK 5IYBK 4KB4A 4G7OA 4G7HA 3PO2C 4A3BC 1SFOK 3JSTA 2A6HA 4RMFA 5M3FK 1J6WA 3V4GA 3AD9C 3TTGA 3LAPA 1R9TA 1I6HC 3GTKC 3GTOK 3HOXK 4G0VA 4FZBA 2JA6C 1YX2A 2XCQA 3FKIC 3HXAA 2R93K 5IORA 4QJVA 1ZBSA 3BP3A 1EK8A 1VJEA 3S14C 3GTMA 5IP9C 3S1RK 4KMUA 1INNA 1O27A 4KMDA 2BE5A 3S0XA 3HOUC 1VLOA 3GTGA 4WJ4A 4A3BK 3RZDC 4BY7C 2CFAB 5M5YK 4C2MK 4XLNA 5E68A 3N0CA 3GTLA 5EGEA 1IW7A 2R92A 1I6HK 1J6VA 4A3IC 2YU9K 5IYDK 4MQ9A 1WOPA 2NVYK 5IP7K 5C44C 3PO3K 3GTMC 1GE9A 1WIHA 4PAAA 4GFQA 5C3EK 4G0WA 1O28A 1TWAA 2CFAA 4BXXC 3GTGC 2JA8K 4BY1C 4Y52C 3S16C 3K7AC 2E2HC 3HOUK 2JA7A 4A3KC 4A3EK 3GTLC 4A3LC 1RU0A 1B4BA 2XCOA 2B63A 1O25A 3H0GA 2KWAA 2R92C 1Y1WA 4G7ZA 4DDQA 1K83K 3EQLA 1TWFA 1WOSA 3H3VD 1F93A 3S2HC 3HOZC 3AH5A 4ZH4A 4C3JC 4A3MK 4A3GC 5IYCC 1YNNA 1TWAC 2FQOA 4BBSK 1ZVUA 1L0WA 1IQ0A 3LPXA 1O26A 3S17K 2VUMK 3I4NC 1YCLA 3OEPA 2P8TA 3S1NK 2NVTK 3GEHA 2B63C 3DXJA 3H0GC 1I3QA 1Y1WC 3TFIA 3GIRA 5IOSA 3SZYA 4BBRK 3S1QC 4GT9A 3BUEA 1HQMA 4AH6A 3AQOA 3GDZA 3GTJK 3S1MK 1O2BA 4A3GK 2FQTA 5JFEA 3FOEA 3M3YC 5M5WK 2E2IK 3CAGA 1TWCK 4XSXA 3GTQA 3A8IA 5HL8A 1TWGA 1F7UA 1TWHK 3S15K 1EH1A 3ERED 3H3VL 2A68A 5CHPA 2XCRB 5M3MK 1G51A 3NUHA 2PMZD 2E2JC 1WORA 2R7ZK 3LAJA 2P5MA 4KDDA 3CQZK 2JA5K
chains in the Genus database with same CATH topology
4C45A 1RU0A 2V6SA 2EBBA 1F93A 1DCOA 1USMA 4LOWA 1DCHA 1USOA 4WILA 2V6UA 1DCPA 3HXAA 3JSTA 2V6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C45 A;  1RU0 A;  2V6S A;  2EBB A;  1F93 A;  1DCO A;  1USM A;  4LOW A;  1DCH A;  1USO A;  4WIL A;  2V6U A;  1DCP A;  3HXA A;  3JST A;  2V6T A; 
#chains in the Genus database with same CATH topology
 4GZY A;  4Y7N K;  2NVY A;  4YFN A;  1WQF A;  1USO A;  4P5A A;  1O24 A;  4WIL A;  1WCM A;  3G4A A;  3M4O K;  3GTQ C;  3HOV C;  1V5V A;  4O2D A;  1TWG C;  1ZXO A;  2NVQ K;  4LK1 A;  3HOW C;  2A69 A;  5CJ9 A;  5C4X K;  3T00 A;  4G0U A;  3RZO C;  3PO2 K;  1UV7 A;  1BGW A;  1K83 A;  3GEE A;  5EGH A;  2JH3 A;  4Q4Z A;  1R9T C;  4XLP A;  1ISE A;  4C3I C;  1WCM C;  3I4M C;  3GTK K;  1JOE A;  4JK1 A;  3BP8 C;  3Q3Q A;  2JA6 K;  1XXB A;  2WAQ D;  3FKI K;  1DCP A;  1I50 A;  4LJZ A;  3S14 K;  3N3Y A;  1EFW A;  3AQP A;  4A3D C;  5IP9 K;  1HI9 A;  2RGR A;  4KC6 A;  4LQY A;  4OIQ A;  2PMZ L;  3HOY C;  1XPP A;  2EBB A;  4KM9 A;  3RZD K;  4BY7 K;  2GSN A;  1PJ6 A;  1Y1V A;  1XXA A;  4C3I K;  4GTL A;  1B4A A;  4MEY A;  4C3H C;  4A3I K;  3FOF A;  1XZQ B;  4A3C C;  5C44 K;  1JQW A;  4AYB D;  3GTM K;  1DD5 A;  5M5X K;  1KQ4 A;  5FLM C;  4A93 C;  4KAS A;  1TWC A;  3QX3 A;  2JA7 C;  2V6T A;  4BXX K;  2NVX A;  3GTG K;  1BJT A;  2GAH C;  3TFJ A;  1WSR A;  4MEX A;  4BY1 K;  3GTP A;  4A3J C;  4LLG A;  4Y52 K;  3S16 K;  3K7A K;  2E2H K;  2ZUF A;  4A3K K;  4NOI A;  1Y1V C;  1PJ5 A;  4GTF A;  1TWF C;  3GTL K;  4A3L K;  3S2D C;  5TMC A;  1XZQ A;  5C4J C;  2R92 K;  1SFO A;  2R7Z A;  4P9S A;  3S2H K;  4OIP A;  1JVI A;  2WAQ L;  4LR2 A;  2JA5 A;  4GTA A;  3GTO A;  2WB1 D;  3HOZ K;  2CW0 A;  4C3J K;  4Q5S A;  4X6A C;  2W7V A;  4PAB A;  5IYC K;  1SMY A;  1TWA K;  2R93 A;  2NVX C;  2Y0S D;  3GTP C;  4WJ3 M;  2PPB A;  4FM9 A;  1I3Q C;  3I4N K;  2B63 K;  3H0G K;  1Y1W K;  1SFO C;  1TWF K;  3FHZ A;  3AD8 C;  3HKZ D;  3S1Q K;  4ILD A;  3ORE A;  3ADA C;  3GTO C;  3N0B A;  3HOX C;  4AYB L;  4GTC A;  2R93 C;  3GTK A;  2YU9 A;  1IBA A;  3FKI A;  5L46 A;  2GAG C;  4OIO A;  1X31 C;  3M3Y K;  4GTD A;  5FJ8 K;  3S1R C;  5IOQ A;  4QJV B;  4QIW D;  3IPJ A;  4KB2 A;  2O5J A;  5IOT A;  4XCH A;  4C2M C;  2PA8 D;  5JVO A;  4GTB A;  3GEI A;  5TMF A;  1VGX A;  1ZYR A;  4GTE A;  2E2J K;  2YU9 C;  1O2A A;  2WB1 L;  2D6F C;  5IYD C;  4KAW X;  2RH6 A;  2NVY C;  5IP7 C;  3PO3 C;  1F9N A;  3A8J A;  2Y0S L;  1I6V A;  1ZQ1 C;  3WOD A;  5C3E C;  4KN7 A;  3GTQ K;  3HOV K;  4BKW A;  2JA8 C;  1WQG A;  3A8K A;  1TWG K;  4A3F C;  3HOW K;  3L4K A;  2VUM A;  4A3E C;  1WOO A;  2E2H A;  3HKZ L;  3RZO K;  1K83 C;  4KAT A;  1PJ7 A;  4LK0 A;  1WQH A;  4YFK A;  4YFX A;  1R9T K;  2Y3P A;  3GTJ A;  4A3M C;  1WCM K;  3I4M K;  1J6X A;  1I50 C;  4OIR A;  4BBS C;  4OIN A;  4KAR A;  4QIW L;  1XZP B;  2O5I A;  4KN4 A;  3S17 C;  2VUM C;  4J3N A;  3S1N C;  2NVT C;  1USM A;  4A3F K;  3VA7 A;  1DCH A;  4BLA A;  1VRQ C;  2E2I A;  4M1X A;  2GSU A;  4A3D K;  4BLB A;  1O2F B;  2PA8 L;  1IS1 A;  3MML B;  4P5B A;  3OPF A;  4BBR C;  1TWH A;  2PHC B;  4KM8 A;  3HOY K;  1J98 A;  1BS2 A;  4LOW A;  4KMA A;  3GTJ C;  3G4C A;  1O29 A;  1XZP A;  4YG2 A;  4C45 A;  1XXC A;  3S1M C;  2GSO A;  1I50 K;  4C3H K;  3CQZ A;  1F7V A;  5TJ3 A;  4A3C K;  5D4D A;  1YNJ A;  3T01 A;  2E2I C;  1TWC C;  5FLM K;  1EQR A;  3TFH A;  4A93 K;  1BDF A;  1TWH C;  3S15 C;  3SZZ A;  2JA7 K;  2V6S A;  4A3J K;  1DCO A;  2ZFZ A;  5IYB C;  2A6E A;  1EI6 A;  1Y1V K;  3S2D K;  1VH2 A;  4XSZ A;  5C4J K;  2R7Z C;  2V6U A;  3AD7 C;  3CQZ C;  2JA5 C;  2ZUE A;  4KMH A;  4Y7N C;  1WSV A;  3T02 A;  1IE0 A;  3M4O C;  2JA6 A;  4X6A K;  1AB4 A;  1C0A A;  1IL2 A;  2NVQ C;  2NVX K;  3GSI A;  3L4J A;  3GTP K;  5C4X C;  1I3Q K;  5IYB K;  4KB4 A;  4G7O A;  4G7H A;  3PO2 C;  4A3B C;  1SFO K;  3JST A;  2A6H A;  4RMF A;  5M3F K;  1J6W A;  3V4G A;  3AD9 C;  3TTG A;  3LAP A;  1R9T A;  1I6H C;  3GTK C;  3GTO K;  3HOX K;  4G0V A;  4FZB A;  2JA6 C;  1YX2 A;  2XCQ A;  3FKI C;  3HXA A;  2R93 K;  5IOR A;  4QJV A;  1ZBS A;  3BP3 A;  1EK8 A;  1VJE A;  3S14 C;  3GTM A;  5IP9 C;  3S1R K;  4KMU A;  1INN A;  1O27 A;  4KMD A;  2BE5 A;  3S0X A;  3HOU C;  1VLO A;  3GTG A;  4WJ4 A;  4A3B K;  3RZD C;  4BY7 C;  2CFA B;  5M5Y K;  4C2M K;  4XLN A;  5E68 A;  3N0C A;  3GTL A;  5EGE A;  1IW7 A;  2R92 A;  1I6H K;  1J6V A;  4A3I C;  2YU9 K;  5IYD K;  4MQ9 A;  1WOP A;  2NVY K;  5IP7 K;  5C44 C;  3PO3 K;  3GTM C;  1GE9 A;  1WIH A;  4PAA A;  4GFQ A;  5C3E K;  4G0W A;  1O28 A;  1TWA A;  2CFA A;  4BXX C;  3GTG C;  2JA8 K;  4BY1 C;  4Y52 C;  3S16 C;  3K7A C;  2E2H C;  3HOU K;  2JA7 A;  4A3K C;  4A3E K;  3GTL C;  4A3L C;  1RU0 A;  1B4B A;  2XCO A;  2B63 A;  1O25 A;  3H0G A;  2KWA A;  2R92 C;  1Y1W A;  4G7Z A;  4DDQ A;  1K83 K;  3EQL A;  1TWF A;  1WOS A;  3H3V D;  1F93 A;  3S2H C;  3HOZ C;  3AH5 A;  4ZH4 A;  4C3J C;  4A3M K;  4A3G C;  5IYC C;  1YNN A;  1TWA C;  2FQO A;  4BBS K;  1ZVU A;  1L0W A;  1IQ0 A;  3LPX A;  1O26 A;  3S17 K;  2VUM K;  3I4N C;  1YCL A;  3OEP A;  2P8T A;  3S1N K;  2NVT K;  3GEH A;  2B63 C;  3DXJ A;  3H0G C;  1I3Q A;  1Y1W C;  3TFI A;  3GIR A;  5IOS A;  3SZY A;  4BBR K;  3S1Q C;  4GT9 A;  3BUE A;  1HQM A;  4AH6 A;  3AQO A;  3GDZ A;  3GTJ K;  3S1M K;  1O2B A;  4A3G K;  2FQT A;  5JFE A;  3FOE A;  3M3Y C;  5M5W K;  2E2I K;  3CAG A;  1TWC K;  4XSX A;  3GTQ A;  3A8I A;  5HL8 A;  1TWG A;  1F7U A;  1TWH K;  3S15 K;  1EH1 A;  3ERE D;  3H3V L;  2A68 A;  5CHP A;  2XCR B;  5M3M K;  1G51 A;  3NUH A;  2PMZ D;  2E2J C;  1WOR A;  2R7Z K;  3LAJ A;  2P5M A;  4KDD A;  3CQZ K;  2JA5 K; 
#chains in the Genus database with same CATH homology
 4C45 A;  1RU0 A;  2V6S A;  2EBB A;  1F93 A;  1DCO A;  1USM A;  4LOW A;  1DCH A;  1USO A;  4WIL A;  2V6U A;  1DCP A;  3HXA A;  3JST A;  2V6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...