1RU0A

Crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords DcoH-like protein DCoHm
total genus 37
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1ru0A00
1USOA 1DCPA 1USMA 2V6UA 2V6SA 3HXAA 2EBBA 1DCHA 4C45A 1RU0A 2V6TA 4WILA 4LOWA 3JSTA 1F93A 1DCOA
chains in the Genus database with same CATH superfamily
4J3NA 1WSRA 1TWAC 4A93C 1TWGK 3AD7C 2NVXA 4KASA 1BJTA 4G0WA 3RZDC 4GZYA 1Y1WC 5C3EC 3GEHA 3GTJC 3QX3A 2CFAA 2JA7C 3TFIA 4A3JK 4FZBA 3EQLA 3GTPA 4C2MC 3GTOC 3LPXA 4OIRA 1JOEA 3S15K 1WCMK 5IP9C 3GTKA 1IL2A 2O5JA 4A3LC 4Y52C 2WAQL 4YG2A 2YU9K 3AH5A 3M4OC 1YNJA 3N0BA 3BP8C 2ZUFA 5CHPA 4A3MC 1EQRA 2B63K 2NVYC 1K83K 4BY1C 2GSUA 4BLBA 4G0VA 2E2IA 1V5VA 3GTMK 1JQWA 2VUMK 4WILA 4A3JC 3ERED 4X6AK 3PO2C 4GTDA 1VJEA 4C3JC 4GT9A 3S16C 3AQOA 3LAPA 1UV7A 4NOIA 1BGWA 4OIPA 4A3FC 1XZQA 4MEXA 2Y0SL 2E2HK 1I50K 1WOOA 4LR2A 1TWCA 4XLPA 1USOA 1XZPA 1VLOA 2O5IA 1C0AA 3H0GA 2JA7K 2PA8L 3AD9C 1O2AA 3CQZC 2R7ZA 1TWFC 5TJ3A 1WCMC 3FKIK 4LOWA 4KMUA 1O2BA 3GTQK 3GTQA 5D4DA 4WJ4A 3CAGA 4A3FK 2A6EA 3M4OK 1YCLA 3FHZA 1R9TC 1IBAA 1DCHA 3MMLB 1BDFA 4AH6A 4G7ZA 5IYCK 5EGEA 4KATA 1XZPB 1EH1A 2B63C 3GEEA 1SFOA 3RZDK 3GTJA 3GTLA 2R93A 2NVQK 1F7VA 2V6SA 4LLGA 3S1NC 2RGRA 1J98A 4C2MK 3GTOK 4GTBA 1I3QC 4Y52K 1XZQB 1J6XA 4GTLA 4X6AC 1O26A 4LQYA 3HOUC 2PMZL 4GTCA 5M3MK 1J6VA 3L4KA 3TTGA 1XXBA 2E2JK 1USMA 3WODA 3HOVK 4C3HK 5C44K 3BP3A 2NVYK 4OINA 2JA5K 3S14C 1O29A 4BY7K 3S0XA 3I4MK 1KQ4A 1RU0A 1WORA 4BXXK 4A3DC 1TWHA 1VH2A 1EK8A 1ZQ1C 4A3IK 5FLMK 3PO2K 4BBRC 2XCQA 2EBBA 1J6WA 4BKWA 2FQTA 3GTKC 4A3CK 3VA7A 2R92C 3S2DK 4GTAA 3V4GA 4C3HC 3GEIA 1PJ7A 2A68A 1PJ6A 4XSZA 1VGXA 3ADAC 1TWFK 4KB4A 4Y7NK 1Y1WA 1JVIA 1L0WA 1Y1WK 2Y3PA 4A3DK 1XXAA 3SZZA 2R93K 3S1RK 5C4JC 3GTOA 4BBRK 3FKIC 1HI9A 4PAAA 4KAWX 1O25A 3S1MC 2NVTC 3HOVC 4KN4A 3I4NK 1WQGA 4XCHA 2KWAA 1X31C 4A3KK 4QIWD 1I6HC 3GTGC 4WJ3M 2NVYA 2JA5A 4YFXA 3BUEA 2NVXK 1DCPA 2B63A 1IW7A 5IYDK 1O24A 3JSTA 3I4MC 1WOPA 3H0GC 5M5YK 4C3IK 4XSXA 1TWHK 5JFEA 1ZBSA 3S16K 3IPJA 1WCMA 3GTKK 1IQ0A 4A3CC 4RMFA 1WQHA 2WB1D 5FLMC 4LK0A 2NVTK 1I6VA 5TMFA 2YU9A 2GSNA 5IOTA 5C44C 4C45A 4A3LK 2GAGC 3H3VD 2E2JC 3L4JA 1I6HK 1DCOA 3K7AK 5C4XC 3PO3K 1Y1VC 1BS2A 2NVXC 5C3EK 3TFJA 1TWFA 3S2HC 4O2DA 3A8IA 4LK1A 3GTMA 2WAQD 3H0GK 2JA7A 3GTPC 2Y0SD 4A3IC 2GSOA 3S1MK 3S2DC 1I3QA 4A3EK 1O28A 1PJ5A 2JA6C 2CFAB 1GE9A 5M3FK 3K7AC 5M5WK 2A69A 4A3GK 4MEYA 1TWCK 4KM8A 3HOZC 4Q5SA 1TWGA 4KM9A 4XLNA 3GIRA 1TWAK 2R93C 1SMYA 2NVQC 5CJ9A 3GDZA 3FKIA 2E2IK 3GTLK 3CQZA 4MQ9A 3FOFA 3CQZK 3H3VL 5EGHA 5FJ8K 2WB1L 1B4AA 4KB2A 1O27A 3HOYK 3S17C 3GTQC 1ZYRA 4KARA 3HOXC 4G0UA 1R9TA 1G51A 3GTGK 1R9TK 2E2HA 1F9NA 1ZVUA 4BLAA 2JA8C 1O2FB 5IOSA 4KDDA 4YFKA 1EI6A 5L46A 1EFWA 1WSVA 2PMZD 2PHCB 1K83C 4BY1K 2P5MA 5IORA 3HOWK 4C3IC 1F7UA 2W7VA 1TWHC 2A6HA 3NUHA 3T00A 4BBSK 3G4CA 4Q4ZA 1SFOC 3OREA 4PABA 2VUMC 4A3EC 5IOQA 3FOEA 1I3QK 4A3GC 4ZH4A 1I50A 3M3YK 4KMHA 1WOSA 3T01A 1Y1VA 1B4BA 4LJZA 3GSIA 4G7HA 4FM9A 1TWCC 1HQMA 4GTEA 3A8JA 2P8TA 3GTLC 2R7ZK 1TWAA 5HL8A 5IYDC 4BY7C 4A93K 4YFNA 3S1RC 2V6TA 4OIQA 1XPPA 4C3JK 3Q3QA 4BXXC 4AYBL 3S15C 5IP7C 3S1QC 3HOUK 4A3BC 1WQFA 3I4NC 3M3YC 3LAJA 1F93A 4KMAA 3AQPA 3GTGA 3HOXK 2XCOA 3AD8C 2XCRB 5IYCC 3PO3C 3DXJA 4JK1A 2R7ZC 5M5XK 1SFOK 1IE0A 3GTJK 3OPFA 1AB4A 3HKZL 3S2HK 2E2IC 5IYBK 2FQOA 3S1NK 4KC6A 5E68A 3N0CA 3GTPK 3HOYC 2ZFZA 4G7OA 4GTFA 3N3YA 4QIWL 1ZXOA 2YU9C 4P5BA 1DD5A 5IP9K 3RZOC 4A3MK 2ZUEA 1YNNA 5C4XK 1WIHA 1Y1VK 2PPBA 2JA8K 1XXCA 5TMCA 1IS1A 4Y7NC 2V6UA 1K83A 3HOWC 2BE5A 4A3KC 4KMDA 3HKZD 4P9SA 3GTMC 1TWGC 1ISEA 5C4JK 3TFHA 4DDQA 2VUMA 5IYBC 2CW0A 4GFQA 4BBSC 3HXAA 3S1QK 3OEPA 1INNA 5JVOA 1VRQC 4QJVB 4QJVA 4M1XA 4OIOA 1I50C 2JA6A 3S17K 1YX2A 2JA6K 5IP7K 2JH3A 2RH6A 4P5AA 3RZOK 4A3BK 4KN7A 2R92K 3SZYA 2PA8D 2R92A 2GAHC 3A8KA 4ILDA 2JA5C 4AYBD 3S14K 3G4AA 2D6FC 3HOZK 3T02A 2E2HC
chains in the Genus database with same CATH topology
1USOA 1DCPA 1USMA 2V6UA 2V6SA 3HXAA 2EBBA 1DCHA 4C45A 1RU0A 2V6TA 4WILA 4LOWA 3JSTA 1F93A 1DCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USO A;  1DCP A;  1USM A;  2V6U A;  2V6S A;  3HXA A;  2EBB A;  1DCH A;  4C45 A;  1RU0 A;  2V6T A;  4WIL A;  4LOW A;  3JST A;  1F93 A;  1DCO A; 
#chains in the Genus database with same CATH topology
 4J3N A;  1WSR A;  1TWA C;  4A93 C;  1TWG K;  3AD7 C;  2NVX A;  4KAS A;  1BJT A;  4G0W A;  3RZD C;  4GZY A;  1Y1W C;  5C3E C;  3GEH A;  3GTJ C;  3QX3 A;  2CFA A;  2JA7 C;  3TFI A;  4A3J K;  4FZB A;  3EQL A;  3GTP A;  4C2M C;  3GTO C;  3LPX A;  4OIR A;  1JOE A;  3S15 K;  1WCM K;  5IP9 C;  3GTK A;  1IL2 A;  2O5J A;  4A3L C;  4Y52 C;  2WAQ L;  4YG2 A;  2YU9 K;  3AH5 A;  3M4O C;  1YNJ A;  3N0B A;  3BP8 C;  2ZUF A;  5CHP A;  4A3M C;  1EQR A;  2B63 K;  2NVY C;  1K83 K;  4BY1 C;  2GSU A;  4BLB A;  4G0V A;  2E2I A;  1V5V A;  3GTM K;  1JQW A;  2VUM K;  4WIL A;  4A3J C;  3ERE D;  4X6A K;  3PO2 C;  4GTD A;  1VJE A;  4C3J C;  4GT9 A;  3S16 C;  3AQO A;  3LAP A;  1UV7 A;  4NOI A;  1BGW A;  4OIP A;  4A3F C;  1XZQ A;  4MEX A;  2Y0S L;  2E2H K;  1I50 K;  1WOO A;  4LR2 A;  1TWC A;  4XLP A;  1USO A;  1XZP A;  1VLO A;  2O5I A;  1C0A A;  3H0G A;  2JA7 K;  2PA8 L;  3AD9 C;  1O2A A;  3CQZ C;  2R7Z A;  1TWF C;  5TJ3 A;  1WCM C;  3FKI K;  4LOW A;  4KMU A;  1O2B A;  3GTQ K;  3GTQ A;  5D4D A;  4WJ4 A;  3CAG A;  4A3F K;  2A6E A;  3M4O K;  1YCL A;  3FHZ A;  1R9T C;  1IBA A;  1DCH A;  3MML B;  1BDF A;  4AH6 A;  4G7Z A;  5IYC K;  5EGE A;  4KAT A;  1XZP B;  1EH1 A;  2B63 C;  3GEE A;  1SFO A;  3RZD K;  3GTJ A;  3GTL A;  2R93 A;  2NVQ K;  1F7V A;  2V6S A;  4LLG A;  3S1N C;  2RGR A;  1J98 A;  4C2M K;  3GTO K;  4GTB A;  1I3Q C;  4Y52 K;  1XZQ B;  1J6X A;  4GTL A;  4X6A C;  1O26 A;  4LQY A;  3HOU C;  2PMZ L;  4GTC A;  5M3M K;  1J6V A;  3L4K A;  3TTG A;  1XXB A;  2E2J K;  1USM A;  3WOD A;  3HOV K;  4C3H K;  5C44 K;  3BP3 A;  2NVY K;  4OIN A;  2JA5 K;  3S14 C;  1O29 A;  4BY7 K;  3S0X A;  3I4M K;  1KQ4 A;  1RU0 A;  1WOR A;  4BXX K;  4A3D C;  1TWH A;  1VH2 A;  1EK8 A;  1ZQ1 C;  4A3I K;  5FLM K;  3PO2 K;  4BBR C;  2XCQ A;  2EBB A;  1J6W A;  4BKW A;  2FQT A;  3GTK C;  4A3C K;  3VA7 A;  2R92 C;  3S2D K;  4GTA A;  3V4G A;  4C3H C;  3GEI A;  1PJ7 A;  2A68 A;  1PJ6 A;  4XSZ A;  1VGX A;  3ADA C;  1TWF K;  4KB4 A;  4Y7N K;  1Y1W A;  1JVI A;  1L0W A;  1Y1W K;  2Y3P A;  4A3D K;  1XXA A;  3SZZ A;  2R93 K;  3S1R K;  5C4J C;  3GTO A;  4BBR K;  3FKI C;  1HI9 A;  4PAA A;  4KAW X;  1O25 A;  3S1M C;  2NVT C;  3HOV C;  4KN4 A;  3I4N K;  1WQG A;  4XCH A;  2KWA A;  1X31 C;  4A3K K;  4QIW D;  1I6H C;  3GTG C;  4WJ3 M;  2NVY A;  2JA5 A;  4YFX A;  3BUE A;  2NVX K;  1DCP A;  2B63 A;  1IW7 A;  5IYD K;  1O24 A;  3JST A;  3I4M C;  1WOP A;  3H0G C;  5M5Y K;  4C3I K;  4XSX A;  1TWH K;  5JFE A;  1ZBS A;  3S16 K;  3IPJ A;  1WCM A;  3GTK K;  1IQ0 A;  4A3C C;  4RMF A;  1WQH A;  2WB1 D;  5FLM C;  4LK0 A;  2NVT K;  1I6V A;  5TMF A;  2YU9 A;  2GSN A;  5IOT A;  5C44 C;  4C45 A;  4A3L K;  2GAG C;  3H3V D;  2E2J C;  3L4J A;  1I6H K;  1DCO A;  3K7A K;  5C4X C;  3PO3 K;  1Y1V C;  1BS2 A;  2NVX C;  5C3E K;  3TFJ A;  1TWF A;  3S2H C;  4O2D A;  3A8I A;  4LK1 A;  3GTM A;  2WAQ D;  3H0G K;  2JA7 A;  3GTP C;  2Y0S D;  4A3I C;  2GSO A;  3S1M K;  3S2D C;  1I3Q A;  4A3E K;  1O28 A;  1PJ5 A;  2JA6 C;  2CFA B;  1GE9 A;  5M3F K;  3K7A C;  5M5W K;  2A69 A;  4A3G K;  4MEY A;  1TWC K;  4KM8 A;  3HOZ C;  4Q5S A;  1TWG A;  4KM9 A;  4XLN A;  3GIR A;  1TWA K;  2R93 C;  1SMY A;  2NVQ C;  5CJ9 A;  3GDZ A;  3FKI A;  2E2I K;  3GTL K;  3CQZ A;  4MQ9 A;  3FOF A;  3CQZ K;  3H3V L;  5EGH A;  5FJ8 K;  2WB1 L;  1B4A A;  4KB2 A;  1O27 A;  3HOY K;  3S17 C;  3GTQ C;  1ZYR A;  4KAR A;  3HOX C;  4G0U A;  1R9T A;  1G51 A;  3GTG K;  1R9T K;  2E2H A;  1F9N A;  1ZVU A;  4BLA A;  2JA8 C;  1O2F B;  5IOS A;  4KDD A;  4YFK A;  1EI6 A;  5L46 A;  1EFW A;  1WSV A;  2PMZ D;  2PHC B;  1K83 C;  4BY1 K;  2P5M A;  5IOR A;  3HOW K;  4C3I C;  1F7U A;  2W7V A;  1TWH C;  2A6H A;  3NUH A;  3T00 A;  4BBS K;  3G4C A;  4Q4Z A;  1SFO C;  3ORE A;  4PAB A;  2VUM C;  4A3E C;  5IOQ A;  3FOE A;  1I3Q K;  4A3G C;  4ZH4 A;  1I50 A;  3M3Y K;  4KMH A;  1WOS A;  3T01 A;  1Y1V A;  1B4B A;  4LJZ A;  3GSI A;  4G7H A;  4FM9 A;  1TWC C;  1HQM A;  4GTE A;  3A8J A;  2P8T A;  3GTL C;  2R7Z K;  1TWA A;  5HL8 A;  5IYD C;  4BY7 C;  4A93 K;  4YFN A;  3S1R C;  2V6T A;  4OIQ A;  1XPP A;  4C3J K;  3Q3Q A;  4BXX C;  4AYB L;  3S15 C;  5IP7 C;  3S1Q C;  3HOU K;  4A3B C;  1WQF A;  3I4N C;  3M3Y C;  3LAJ A;  1F93 A;  4KMA A;  3AQP A;  3GTG A;  3HOX K;  2XCO A;  3AD8 C;  2XCR B;  5IYC C;  3PO3 C;  3DXJ A;  4JK1 A;  2R7Z C;  5M5X K;  1SFO K;  1IE0 A;  3GTJ K;  3OPF A;  1AB4 A;  3HKZ L;  3S2H K;  2E2I C;  5IYB K;  2FQO A;  3S1N K;  4KC6 A;  5E68 A;  3N0C A;  3GTP K;  3HOY C;  2ZFZ A;  4G7O A;  4GTF A;  3N3Y A;  4QIW L;  1ZXO A;  2YU9 C;  4P5B A;  1DD5 A;  5IP9 K;  3RZO C;  4A3M K;  2ZUE A;  1YNN A;  5C4X K;  1WIH A;  1Y1V K;  2PPB A;  2JA8 K;  1XXC A;  5TMC A;  1IS1 A;  4Y7N C;  2V6U A;  1K83 A;  3HOW C;  2BE5 A;  4A3K C;  4KMD A;  3HKZ D;  4P9S A;  3GTM C;  1TWG C;  1ISE A;  5C4J K;  3TFH A;  4DDQ A;  2VUM A;  5IYB C;  2CW0 A;  4GFQ A;  4BBS C;  3HXA A;  3S1Q K;  3OEP A;  1INN A;  5JVO A;  1VRQ C;  4QJV B;  4QJV A;  4M1X A;  4OIO A;  1I50 C;  2JA6 A;  3S17 K;  1YX2 A;  2JA6 K;  5IP7 K;  2JH3 A;  2RH6 A;  4P5A A;  3RZO K;  4A3B K;  4KN7 A;  2R92 K;  3SZY A;  2PA8 D;  2R92 A;  2GAH C;  3A8K A;  4ILD A;  2JA5 C;  4AYB D;  3S14 K;  3G4A A;  2D6F C;  3HOZ K;  3T02 A;  2E2H C; 
#chains in the Genus database with same CATH homology
 1USO A;  1DCP A;  1USM A;  2V6U A;  2V6S A;  3HXA A;  2EBB A;  1DCH A;  4C45 A;  1RU0 A;  2V6T A;  4WIL A;  4LOW A;  3JST A;  1F93 A;  1DCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...