1RU0A

Crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DcoH-like protein DCoHm
publication title Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
total genus 37
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1ru0A00
1F93A 1RU0A 2V6SA 2V6UA 3HXAA 3JSTA 1DCPA 1DCHA 1USOA 4LOWA 4WILA 4C45A 2V6TA 2EBBA 1DCOA 1USMA
chains in the Genus database with same CATH superfamily
4OIOA 1F9NA 5CJ9A 4BBRC 3GTGK 1BDFA 2O5IA 2R92C 1R9TC 3AD9C 3CQZC 3S1NC 1TWHC 3GTQK 1VLOA 3S0XA 2A6HA 2A68A 1SFOA 1O24A 2Y3PA 3HOYC 5C4JC 3FKIC 1SMYA 3HOVC 2ZUEA 5IP9K 4Y52C 4YFXA 2B63K 1EI6A 3S1RK 2E2HA 2NVXC 4BBSK 2YU9C 3I4MC 3S15K 5C4XC 2WB1D 3T01A 2NVQC 1O2FB 3GTPK 4A3FK 2JH3A 3N0CA 2JA5K 4Q5SA 1YCLA 3T02A 3M4OK 3I4NC 2V6UA 3GTOK 2WB1L 1O27A 4P5AA 2ZUFA 4GTDA 1O2AA 4A3JC 3TFJA 1TWFA 4KDDA 1O26A 1YNNA 4BBRK 2R92K 1R9TK 3CQZK 3S1NK 1TWHK 3GTQA 4A3LC 2CFAB 3PO3C 3S1QC 1GE9A 4OINA 4G7OA 4KN4A 2NVYC 3HOYK 5C4JK 3TTGA 3FKIK 5FLMC 2V6TA 1WOOA 3HKZD 3GEEA 3HOVK 2CFAA 2JA7K 3NUHA 2B63A 4Y52K 1KQ4A 4OIQA 2KWAA 1Y1WC 5M3FK 2NVXK 1F7VA 2YU9K 3I4MK 4NOIA 4J3NA 5IOSA 5C3EC 2ZFZA 3GTQC 3HKZL 5C4XK 4C3HC 2D6FC 4LQYA 2NVQK 1PJ5A 3HOUC 4BXXC 1RU0A 3GTPA 3MMLB 2E2IC 5CHPA 2JA6C 3I4NK 4XCHA 4OIRA 5HL8A 3DXJA 4XSZA 3GTOA 4A93C 4A3DC 2GAGC 4A3JK 2CW0A 3LAJA 4KMDA 2V6SA 2R92A 4XLPA 3GTPC 1WSVA 3CQZA 4KMUA 1TWHA 2P8TA 4X6AC 4A3LK 4KASA 4M1XA 3PO3K 1IE0A 3S1QK 3S16C 4LOWA 4ILDA 3HOXC 1TWGK 2NVYK 4Y7NC 2E2JC 4FZBA 1J6WA 3M3YC 3FKIA 5FLMK 4LK0A 3GIRA 3TFHA 2WAQD 2JA7A 1DCPA 1XZQB 4MQ9A 5IYBC 3LAPA 1Y1WK 2NVXA 5IYDC 2YU9A 1ZYRA 4C45A 5C3EK 5M3MK 2WAQL 4C3HK 5JFEA 4KMAA 3HOUK 4BXXK 1XZQA 3GTKC 2E2IK 1WQGA 4MEYA 2JA6K 5EGHA 1HI9A 4KC6A 1XXCA 2JA7C 4KM9A 4A93K 1F7UA 1VGXA 3SZZA 4A3DK 1IQ0A 1O25A 1EH1A 4YG2A 1V5VA 4G0VA 1USMA 4Q4ZA 1J98A 2W7VA 4MEXA 1DCHA 3AD7C 3GEIA 1G51A 4WJ3M 4X6AK 3RZOC 3S16K 3HOXK 3S2DC 1TWGA 4O2DA 2NVYA 1ZVUA 1O28A 4Y7NK 2E2JK 4C3IC 3M3YK 1ISEA 3FOFA 2BE5A 2P5MA 3IPJA 1I50C 4P9SA 1J6XA 4GTEA 3L4KA 3HXAA 5IYBK 4FM9A 1Y1WA 5IYDK 4A3BC 4YFNA 3QX3A 1IBAA 4A3CC 1TWGC 2R7ZK 4KM8A 5IP7C 1HQMA 4LLGA 1VRQC 3GTKK 1ZQ1C 2E2IA 1UV7A 2JA6A 4BLAA 5L46A 5TMFA 1WOSA 3GSIA 3GTMC 1ZXOA 1DD5A 4DDQA 2EBBA 4QJVB 4GTFA 4PAAA 4A3MC 3K7AC 1WCMC 4QIWD 3FHZA 3RZOK 4QJVA 4XLNA 1WIHA 3S2DK 5EGEA 1B4AA 1L0WA 4XSXA 1EK8A 4C3IK 1I3QA 1BGWA 4QIWL 1I50K 4LR2A 4OIPA 3AD8C 4GT9A 2R93C 4A3BK 5C44C 1AB4A 1WORA 4A3CK 2R7ZA 5IP7K 2RGRA 3GEHA 2O5JA 3GTKA 2GSOA 2PPBA 4KATA 5FJ8K 1I6VA 3Q3QA 5M5XK 1I3QC 1BS2A 1DCOA 1TWCA 1K83A 3V4GA 3GTMK 1JQWA 5IOQA 2VUMK 4LJZA 3G4AA 3H0GC 4AYBD 2NVTC 5M5YK 3HOZC 1VJEA 1IS1A 4A3MK 3VA7A 4WILA 3S1MK 2R7ZC 3K7AK 1WCMK 4BY7C 1YNJA 1INNA 1WSRA 4AYBL 4PABA 3AH5A 4A3EC 3S2HC 2JA8C 5E68A 1K83C 1TWCC 1JVIA 3CAGA 3PO2C 4KB4A 1I50A 3FOEA 3RZDC 1TWAC 1VH2A 3GTLC 1Y1VC 1X31C 2R93K 3OREA 4C2MC 3LPXA 2FQTA 5C44K 2A6EA 4A3KC 3GTJC 4KMHA 1XZPB 4WJ4A 1XXBA 2XCOA 1I3QK 4GZYA 4A3IC 1IL2A 3H3VD 3HOWC 3GTMA 2VUMA 1XZPA 2FQOA 1ZBSA 3H0GK 3JSTA 2NVTK 5IYCC 2PHCB 1SFOC 3HOZK 3N3YA 3S17C 4G0UA 4KN7A 3H3VL 4KB2A 2XCRB 4BY7K 1WCMA 3OEPA 2E2HC 4A3EK 3S2HK 3L4JA 1WOPA 2PMZD 3BUEA 2JA8K 1TWCK 1K83K 5TMCA 4BLBA 5IOTA 3S14C 5JVOA 3PO2K 4GTAA 4A3GC 2VUMC 3GTGA 2RH6A 3AQPA 4C3JC 1JOEA 1F93A 4ZH4A 3SZYA 3A8IA 1PJ7A 2PMZL 4G7HA 3RZDK 4BY1C 1TWAK 3GTLK 1Y1VK 1XXAA 3S1MC 2R93A 1I6HC 4C2MK 1J6VA 1WQHA 4KARA 3OPFA 3GDZA 3BP8C 4A3KK 3GTJK 1TWFC 2Y0SD 4G7ZA 5IORA 1PJ6A 3GTGC 4RMFA 2GSNA 4BKWA 4KAWX 5D4DA 4A3IK 3HOWK 1C0AA 4GTLA 2GSUA 1USOA 2PA8D 2GAHC 3H0GA 3EQLA 1YX2A 5IYCK 4GFQA 2Y0SL 4JK1A 1O29A 1SFOK 3S17K 2JA5A 1EQRA 3AQOA 4GTCA 2PA8L 5IP9C 2B63C 3A8JA 3S1RC 2E2HK 3N0BA 5M5WK 4LK1A 4BBSC 3S14K 4P5BA 3S15C 4G0WA 4A3GK 1BJTA 2A69A 1R9TA 3WODA 4C3JK 4GTBA 3TFIA 3G4CA 4A3FC 1B4BA 2XCQA 4AH6A 2JA5C 4BY1K 1O2BA 1XPPA 1TWAA 4YFKA 3M4OC 3GTLA 1Y1VA 5TJ3A 3GTOC 1I6HK 1EFWA 3A8KA 1IW7A 3BP3A 3GTJA 3T00A 3ERED 3ADAC 1WQFA 1TWFK
chains in the Genus database with same CATH topology
1F93A 1RU0A 2V6SA 2V6UA 3HXAA 3JSTA 1DCPA 1DCHA 1USOA 4LOWA 4WILA 4C45A 2V6TA 2EBBA 1DCOA 1USMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F93 A;  1RU0 A;  2V6S A;  2V6U A;  3HXA A;  3JST A;  1DCP A;  1DCH A;  1USO A;  4LOW A;  4WIL A;  4C45 A;  2V6T A;  2EBB A;  1DCO A;  1USM A; 
#chains in the Genus database with same CATH topology
 4OIO A;  1F9N A;  5CJ9 A;  4BBR C;  3GTG K;  1BDF A;  2O5I A;  2R92 C;  1R9T C;  3AD9 C;  3CQZ C;  3S1N C;  1TWH C;  3GTQ K;  1VLO A;  3S0X A;  2A6H A;  2A68 A;  1SFO A;  1O24 A;  2Y3P A;  3HOY C;  5C4J C;  3FKI C;  1SMY A;  3HOV C;  2ZUE A;  5IP9 K;  4Y52 C;  4YFX A;  2B63 K;  1EI6 A;  3S1R K;  2E2H A;  2NVX C;  4BBS K;  2YU9 C;  3I4M C;  3S15 K;  5C4X C;  2WB1 D;  3T01 A;  2NVQ C;  1O2F B;  3GTP K;  4A3F K;  2JH3 A;  3N0C A;  2JA5 K;  4Q5S A;  1YCL A;  3T02 A;  3M4O K;  3I4N C;  2V6U A;  3GTO K;  2WB1 L;  1O27 A;  4P5A A;  2ZUF A;  4GTD A;  1O2A A;  4A3J C;  3TFJ A;  1TWF A;  4KDD A;  1O26 A;  1YNN A;  4BBR K;  2R92 K;  1R9T K;  3CQZ K;  3S1N K;  1TWH K;  3GTQ A;  4A3L C;  2CFA B;  3PO3 C;  3S1Q C;  1GE9 A;  4OIN A;  4G7O A;  4KN4 A;  2NVY C;  3HOY K;  5C4J K;  3TTG A;  3FKI K;  5FLM C;  2V6T A;  1WOO A;  3HKZ D;  3GEE A;  3HOV K;  2CFA A;  2JA7 K;  3NUH A;  2B63 A;  4Y52 K;  1KQ4 A;  4OIQ A;  2KWA A;  1Y1W C;  5M3F K;  2NVX K;  1F7V A;  2YU9 K;  3I4M K;  4NOI A;  4J3N A;  5IOS A;  5C3E C;  2ZFZ A;  3GTQ C;  3HKZ L;  5C4X K;  4C3H C;  2D6F C;  4LQY A;  2NVQ K;  1PJ5 A;  3HOU C;  4BXX C;  1RU0 A;  3GTP A;  3MML B;  2E2I C;  5CHP A;  2JA6 C;  3I4N K;  4XCH A;  4OIR A;  5HL8 A;  3DXJ A;  4XSZ A;  3GTO A;  4A93 C;  4A3D C;  2GAG C;  4A3J K;  2CW0 A;  3LAJ A;  4KMD A;  2V6S A;  2R92 A;  4XLP A;  3GTP C;  1WSV A;  3CQZ A;  4KMU A;  1TWH A;  2P8T A;  4X6A C;  4A3L K;  4KAS A;  4M1X A;  3PO3 K;  1IE0 A;  3S1Q K;  3S16 C;  4LOW A;  4ILD A;  3HOX C;  1TWG K;  2NVY K;  4Y7N C;  2E2J C;  4FZB A;  1J6W A;  3M3Y C;  3FKI A;  5FLM K;  4LK0 A;  3GIR A;  3TFH A;  2WAQ D;  2JA7 A;  1DCP A;  1XZQ B;  4MQ9 A;  5IYB C;  3LAP A;  1Y1W K;  2NVX A;  5IYD C;  2YU9 A;  1ZYR A;  4C45 A;  5C3E K;  5M3M K;  2WAQ L;  4C3H K;  5JFE A;  4KMA A;  3HOU K;  4BXX K;  1XZQ A;  3GTK C;  2E2I K;  1WQG A;  4MEY A;  2JA6 K;  5EGH A;  1HI9 A;  4KC6 A;  1XXC A;  2JA7 C;  4KM9 A;  4A93 K;  1F7U A;  1VGX A;  3SZZ A;  4A3D K;  1IQ0 A;  1O25 A;  1EH1 A;  4YG2 A;  1V5V A;  4G0V A;  1USM A;  4Q4Z A;  1J98 A;  2W7V A;  4MEX A;  1DCH A;  3AD7 C;  3GEI A;  1G51 A;  4WJ3 M;  4X6A K;  3RZO C;  3S16 K;  3HOX K;  3S2D C;  1TWG A;  4O2D A;  2NVY A;  1ZVU A;  1O28 A;  4Y7N K;  2E2J K;  4C3I C;  3M3Y K;  1ISE A;  3FOF A;  2BE5 A;  2P5M A;  3IPJ A;  1I50 C;  4P9S A;  1J6X A;  4GTE A;  3L4K A;  3HXA A;  5IYB K;  4FM9 A;  1Y1W A;  5IYD K;  4A3B C;  4YFN A;  3QX3 A;  1IBA A;  4A3C C;  1TWG C;  2R7Z K;  4KM8 A;  5IP7 C;  1HQM A;  4LLG A;  1VRQ C;  3GTK K;  1ZQ1 C;  2E2I A;  1UV7 A;  2JA6 A;  4BLA A;  5L46 A;  5TMF A;  1WOS A;  3GSI A;  3GTM C;  1ZXO A;  1DD5 A;  4DDQ A;  2EBB A;  4QJV B;  4GTF A;  4PAA A;  4A3M C;  3K7A C;  1WCM C;  4QIW D;  3FHZ A;  3RZO K;  4QJV A;  4XLN A;  1WIH A;  3S2D K;  5EGE A;  1B4A A;  1L0W A;  4XSX A;  1EK8 A;  4C3I K;  1I3Q A;  1BGW A;  4QIW L;  1I50 K;  4LR2 A;  4OIP A;  3AD8 C;  4GT9 A;  2R93 C;  4A3B K;  5C44 C;  1AB4 A;  1WOR A;  4A3C K;  2R7Z A;  5IP7 K;  2RGR A;  3GEH A;  2O5J A;  3GTK A;  2GSO A;  2PPB A;  4KAT A;  5FJ8 K;  1I6V A;  3Q3Q A;  5M5X K;  1I3Q C;  1BS2 A;  1DCO A;  1TWC A;  1K83 A;  3V4G A;  3GTM K;  1JQW A;  5IOQ A;  2VUM K;  4LJZ A;  3G4A A;  3H0G C;  4AYB D;  2NVT C;  5M5Y K;  3HOZ C;  1VJE A;  1IS1 A;  4A3M K;  3VA7 A;  4WIL A;  3S1M K;  2R7Z C;  3K7A K;  1WCM K;  4BY7 C;  1YNJ A;  1INN A;  1WSR A;  4AYB L;  4PAB A;  3AH5 A;  4A3E C;  3S2H C;  2JA8 C;  5E68 A;  1K83 C;  1TWC C;  1JVI A;  3CAG A;  3PO2 C;  4KB4 A;  1I50 A;  3FOE A;  3RZD C;  1TWA C;  1VH2 A;  3GTL C;  1Y1V C;  1X31 C;  2R93 K;  3ORE A;  4C2M C;  3LPX A;  2FQT A;  5C44 K;  2A6E A;  4A3K C;  3GTJ C;  4KMH A;  1XZP B;  4WJ4 A;  1XXB A;  2XCO A;  1I3Q K;  4GZY A;  4A3I C;  1IL2 A;  3H3V D;  3HOW C;  3GTM A;  2VUM A;  1XZP A;  2FQO A;  1ZBS A;  3H0G K;  3JST A;  2NVT K;  5IYC C;  2PHC B;  1SFO C;  3HOZ K;  3N3Y A;  3S17 C;  4G0U A;  4KN7 A;  3H3V L;  4KB2 A;  2XCR B;  4BY7 K;  1WCM A;  3OEP A;  2E2H C;  4A3E K;  3S2H K;  3L4J A;  1WOP A;  2PMZ D;  3BUE A;  2JA8 K;  1TWC K;  1K83 K;  5TMC A;  4BLB A;  5IOT A;  3S14 C;  5JVO A;  3PO2 K;  4GTA A;  4A3G C;  2VUM C;  3GTG A;  2RH6 A;  3AQP A;  4C3J C;  1JOE A;  1F93 A;  4ZH4 A;  3SZY A;  3A8I A;  1PJ7 A;  2PMZ L;  4G7H A;  3RZD K;  4BY1 C;  1TWA K;  3GTL K;  1Y1V K;  1XXA A;  3S1M C;  2R93 A;  1I6H C;  4C2M K;  1J6V A;  1WQH A;  4KAR A;  3OPF A;  3GDZ A;  3BP8 C;  4A3K K;  3GTJ K;  1TWF C;  2Y0S D;  4G7Z A;  5IOR A;  1PJ6 A;  3GTG C;  4RMF A;  2GSN A;  4BKW A;  4KAW X;  5D4D A;  4A3I K;  3HOW K;  1C0A A;  4GTL A;  2GSU A;  1USO A;  2PA8 D;  2GAH C;  3H0G A;  3EQL A;  1YX2 A;  5IYC K;  4GFQ A;  2Y0S L;  4JK1 A;  1O29 A;  1SFO K;  3S17 K;  2JA5 A;  1EQR A;  3AQO A;  4GTC A;  2PA8 L;  5IP9 C;  2B63 C;  3A8J A;  3S1R C;  2E2H K;  3N0B A;  5M5W K;  4LK1 A;  4BBS C;  3S14 K;  4P5B A;  3S15 C;  4G0W A;  4A3G K;  1BJT A;  2A69 A;  1R9T A;  3WOD A;  4C3J K;  4GTB A;  3TFI A;  3G4C A;  4A3F C;  1B4B A;  2XCQ A;  4AH6 A;  2JA5 C;  4BY1 K;  1O2B A;  1XPP A;  1TWA A;  4YFK A;  3M4O C;  3GTL A;  1Y1V A;  5TJ3 A;  3GTO C;  1I6H K;  1EFW A;  3A8K A;  1IW7 A;  3BP3 A;  3GTJ A;  3T00 A;  3ERE D;  3ADA C;  1WQF A;  1TWF K; 
#chains in the Genus database with same CATH homology
 1F93 A;  1RU0 A;  2V6S A;  2V6U A;  3HXA A;  3JST A;  1DCP A;  1DCH A;  1USO A;  4LOW A;  4WIL A;  4C45 A;  2V6T A;  2EBB A;  1DCO A;  1USM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...