1RU0A

Crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
b'DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DcoH-like protein DCoHm
publication title Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
total genus 37
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1ru0A00
2V6TA 4WILA 3JSTA 2V6UA 4C45A 1DCOA 1DCHA 1DCPA 1RU0A 1USOA 3HXAA 2EBBA 4LOWA 1USMA 1F93A 2V6SA
chains in the Genus database with same CATH superfamily
1F7VA 4P9SA 1JQWA 1B4AA 1SFOC 1YNNA 4AYBL 1TWAC 2P5MA 3ERED 3HOVC 1YNJA 2GSOA 3PO3K 2W7VA 4AYBD 1K83C 4C2MC 4C45A 3DXJA 3IPJA 5E68A 2O5JA 4KN4A 3HOYK 3OREA 5IOQA 3TTGA 1XXBA 4C3JC 5C3EK 2JA6K 4XLPA 2PHCB 3RZOK 1XPPA 4Y52K 2JA6A 4G0WA 1O2AA 4KMUA 4KM9A 4O2DA 2XCRB 3ADAC 3GTLK 3GEHA 1WQGA 1O26A 1YX2A 3GTLA 5CHPA 1WQFA 3OPFA 4A3LK 4A3KC 1JVIA 3AD7C 4ILDA 2PA8L 3LAJA 4KATA 3HOYC 3S1NK 4C3IK 3TFIA 2PA8D 5C3EC 4YFXA 1RU0A 2RH6A 5EGEA 3A8JA 2JA6C 3RZOC 4A3FK 4Y52C 5D4DA 3S14C 2ZUFA 3A8IA 4ZH4A 1AB4A 1GE9A 3GTMK 3GTLC 1YCLA 1EH1A 2Y0SL 2A68A 3GTMA 4QJVB 2NVTK 2XCOA 2Y0SD 4BBSK 4FZBA 4A3LC 2CW0A 2JA5K 4XCHA 2V6SA 3GTQK 3S17C 1TWHK 4OIOA 3S2HC 2JA5A 3FHZA 3S1NC 3HOXC 4C3IC 3GTQA 1TWHA 1Y1VC 4G7OA 2GAHC 1DCPA 5TMFA 4A3FC 3M4OK 2E2JK 1L0WA 4LK1A 3T02A 1DD5A 3BP8C 4KN7A 1X31C 1VGXA 4XLNA 4BXXK 1F9NA 3I4NK 4NOIA 2R7ZK 5HL8A 1WOPA 1PJ6A 1B4BA 3GTMC 3M3YK 1O27A 3N0CA 5C4JK 5IYBK 4DDQA 2RGRA 4BBSC 3S16K 2JA5C 3T01A 3GTQC 1TWHC 2GAGC 1ZYRA 4WJ3M 4PABA 2FQTA 3GSIA 1J6WA 1WOSA 4GT9A 3LAPA 4GTAA 3M4OC 2E2JC 5IOTA 2KWAA 3K7AK 4YFNA 1IW7A 4BXXC 1XXAA 2JA7C 3N0BA 3T00A 3GTGK 4X6AK 3GTGA 1VRQC 5IOSA 3M3YC 5C4JC 5IYBC 2WB1L 3H0GK 4A3DC 1C0AA 4BLBA 2WB1D 4A3EK 2NVYK 3H0GA 4FM9A 1VJEA 3RZDK 1Y1WK 2NVYA 2GSNA 1USMA 1Y1WA 3FKIK 1DCHA 2EBBA 4KASA 3K7AC 4GTCA 3FKIA 1WORA 4BY7K 4QJVA 1VLOA 3OEPA 3GTGC 4OIPA 3HXAA 1ZQ1C 5IP9K 1IE0A 1F7UA 4KDDA 3A8KA 3GDZA 5M3MK 3PO3C 3H0GC 3S15K 3SZYA 4OIRA 3PO2K 5M5YK 4A3EC 2NVYC 1XZQB 3RZDC 5L46A 1Y1WC 4C3HK 1UV7A 1VH2A 5M5WK 4A3CK 3FKIC 3I4MK 2JA8K 4KB4A 1I6VA 3QX3A 3S1MK 1ZXOA 4BY7C 2XCQA 1BJTA 1PJ7A 5JFEA 1XZPB 4YG2A 5IP9C 1EFWA 4KAWX 3TFHA 5M5XK 1I3QK 2E2IK 2R92K 3GTKK 1I3QA 3EQLA 2E2IA 3S15C 2R92A 4KMDA 3BP3A 3GTKA 3HOUK 1O2FB 3PO2C 3AD9C 2A6EA 3HOWK 4C3HC 3HOZK 2VUMK 1I6HK 4Y7NK 4A3CC 2VUMA 3I4MC 2JH3A 3AD8C 2JA8C 2E2HK 1I50K 4A3JK 3S1QK 1WSVA 3S1MC 2E2HA 1INNA 4BKWA 1I50A 3BUEA 1ISEA 4XSZA 4G7ZA 1WCMK 4Q4ZA 4A93K 4AH6A 2FQOA 3S1RK 1WCMA 5EGHA 4Q5SA 1I3QC 2E2IC 2R92C 1O2BA 3GTPK 2R7ZA 2B63K 3GTKC 3GTPA 4GFQA 3AQOA 2NVTC 3HOUC 2B63A 1ZBSA 1IQ0A 3HOWC 3HOZC 2VUMC 3AQPA 1I6HC 5IORA 4Y7NC 5C4XK 2WAQL 2E2HC 1I50C 2R93K 4A3JC 2D6FC 1G51A 2WAQD 2R93A 2YU9K 1WCMC 4BLAA 3G4CA 4M1XA 1O28A 3S1RC 2ZFZA 2YU9A 3I4NC 4A93C 4KM8A 2R7ZC 1XZQA 4GTDA 3GTPC 2B63C 1EK8A 4A3GK 4LQYA 3L4JA 4KMHA 3S16C 4KC6A 1R9TK 1TWFK 5C4XC 3TFJA 1R9TA 1XZPA 4GTLA 1TWFA 2R93C 1USOA 4G0VA 3S0XA 1F93A 1IBAA 2YU9C 4LLGA 4QIWL 5IYCK 4KARA 3AH5A 2CFAB 2Y3PA 4X6AC 4QIWD 4LK0A 4BBRK 1EI6A 1WOOA 4A3KK 4A3GC 4LR2A 1V5VA 2BE5A 1WIHA 1DCOA 2A69A 2GSUA 1WQHA 1R9TC 1TWCK 4OIQA 3CAGA 3HKZL 1TWFC 1TWCA 4WILA 3S14K 2V6UA 1WSRA 3HKZD 4KMAA 4MEXA 3H3VL 3CQZK 3LPXA 3MMLB 3GEIA 4P5AA 3CQZA 3GTOK 3H3VD 4GTBA 4A3BK 5IYCC 3N3YA 4RMFA 3GTOA 2V6TA 5IYDK 2A6HA 4KB2A 4BBRC 4LJZA 4WJ4A 3S17K 1HQMA 3S2HK 3HOXK 4MEYA 1BDFA 3GTJK 1Y1VK 4A3IK 1TWGK 5TMCA 3FOEA 2ZUEA 4A3MK 1KQ4A 3GTJA 1TWCC 1Y1VA 2P8TA 1TWGA 1ZVUA 2NVQK 4GTFA 4GZYA 1HI9A 3CQZC 4G7HA 1XXCA 4G0UA 2PPBA 1BGWA 3SZZA 1BS2A 3GTOC 4A3BC 4PAAA 3WODA 4YFKA 2PMZL 5C44K 2NVXK 5IYDC 5CJ9A 2O5IA 2NVXA 4BY1K 2PMZD 3L4KA 5FJ8K 3S2DK 1EQRA 5TJ3A 3GTJC 3FOFA 3VA7A 4A3IC 4P5BA 1TWGC 4A3MC 3GEEA 3G4AA 3JSTA 5FLMK 5IP7K 2NVQC 1JOEA 1SMYA 2JA7K 4JK1A 1IS1A 2CFAA 1IL2A 1O25A 3S1QC 2JA7A 4MQ9A 3NUHA 1J98A 1SFOK 4LOWA 1J6XA 1J6VA 1TWAK 3HOVK 4GTEA 2NVXC 5C44C 1SFOA 1TWAA 1K83K 4BY1C 4A3DK 5JVOA 1PJ5A 3S2DC 1K83A 4C2MK 4OINA 3GIRA 4J3NA 5M3FK 5FLMC 1O29A 4C3JK 1O24A 5IP7C 3Q3QA 3V4GA 4XSXA
chains in the Genus database with same CATH topology
2V6TA 4WILA 3JSTA 2V6UA 4C45A 1DCOA 1DCHA 1DCPA 1RU0A 1USOA 3HXAA 2EBBA 4LOWA 1USMA 1F93A 2V6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6T A;  4WIL A;  3JST A;  2V6U A;  4C45 A;  1DCO A;  1DCH A;  1DCP A;  1RU0 A;  1USO A;  3HXA A;  2EBB A;  4LOW A;  1USM A;  1F93 A;  2V6S A; 
#chains in the Genus database with same CATH topology
 1F7V A;  4P9S A;  1JQW A;  1B4A A;  1SFO C;  1YNN A;  4AYB L;  1TWA C;  2P5M A;  3ERE D;  3HOV C;  1YNJ A;  2GSO A;  3PO3 K;  2W7V A;  4AYB D;  1K83 C;  4C2M C;  4C45 A;  3DXJ A;  3IPJ A;  5E68 A;  2O5J A;  4KN4 A;  3HOY K;  3ORE A;  5IOQ A;  3TTG A;  1XXB A;  4C3J C;  5C3E K;  2JA6 K;  4XLP A;  2PHC B;  3RZO K;  1XPP A;  4Y52 K;  2JA6 A;  4G0W A;  1O2A A;  4KMU A;  4KM9 A;  4O2D A;  2XCR B;  3ADA C;  3GTL K;  3GEH A;  1WQG A;  1O26 A;  1YX2 A;  3GTL A;  5CHP A;  1WQF A;  3OPF A;  4A3L K;  4A3K C;  1JVI A;  3AD7 C;  4ILD A;  2PA8 L;  3LAJ A;  4KAT A;  3HOY C;  3S1N K;  4C3I K;  3TFI A;  2PA8 D;  5C3E C;  4YFX A;  1RU0 A;  2RH6 A;  5EGE A;  3A8J A;  2JA6 C;  3RZO C;  4A3F K;  4Y52 C;  5D4D A;  3S14 C;  2ZUF A;  3A8I A;  4ZH4 A;  1AB4 A;  1GE9 A;  3GTM K;  3GTL C;  1YCL A;  1EH1 A;  2Y0S L;  2A68 A;  3GTM A;  4QJV B;  2NVT K;  2XCO A;  2Y0S D;  4BBS K;  4FZB A;  4A3L C;  2CW0 A;  2JA5 K;  4XCH A;  2V6S A;  3GTQ K;  3S17 C;  1TWH K;  4OIO A;  3S2H C;  2JA5 A;  3FHZ A;  3S1N C;  3HOX C;  4C3I C;  3GTQ A;  1TWH A;  1Y1V C;  4G7O A;  2GAH C;  1DCP A;  5TMF A;  4A3F C;  3M4O K;  2E2J K;  1L0W A;  4LK1 A;  3T02 A;  1DD5 A;  3BP8 C;  4KN7 A;  1X31 C;  1VGX A;  4XLN A;  4BXX K;  1F9N A;  3I4N K;  4NOI A;  2R7Z K;  5HL8 A;  1WOP A;  1PJ6 A;  1B4B A;  3GTM C;  3M3Y K;  1O27 A;  3N0C A;  5C4J K;  5IYB K;  4DDQ A;  2RGR A;  4BBS C;  3S16 K;  2JA5 C;  3T01 A;  3GTQ C;  1TWH C;  2GAG C;  1ZYR A;  4WJ3 M;  4PAB A;  2FQT A;  3GSI A;  1J6W A;  1WOS A;  4GT9 A;  3LAP A;  4GTA A;  3M4O C;  2E2J C;  5IOT A;  2KWA A;  3K7A K;  4YFN A;  1IW7 A;  4BXX C;  1XXA A;  2JA7 C;  3N0B A;  3T00 A;  3GTG K;  4X6A K;  3GTG A;  1VRQ C;  5IOS A;  3M3Y C;  5C4J C;  5IYB C;  2WB1 L;  3H0G K;  4A3D C;  1C0A A;  4BLB A;  2WB1 D;  4A3E K;  2NVY K;  3H0G A;  4FM9 A;  1VJE A;  3RZD K;  1Y1W K;  2NVY A;  2GSN A;  1USM A;  1Y1W A;  3FKI K;  1DCH A;  2EBB A;  4KAS A;  3K7A C;  4GTC A;  3FKI A;  1WOR A;  4BY7 K;  4QJV A;  1VLO A;  3OEP A;  3GTG C;  4OIP A;  3HXA A;  1ZQ1 C;  5IP9 K;  1IE0 A;  1F7U A;  4KDD A;  3A8K A;  3GDZ A;  5M3M K;  3PO3 C;  3H0G C;  3S15 K;  3SZY A;  4OIR A;  3PO2 K;  5M5Y K;  4A3E C;  2NVY C;  1XZQ B;  3RZD C;  5L46 A;  1Y1W C;  4C3H K;  1UV7 A;  1VH2 A;  5M5W K;  4A3C K;  3FKI C;  3I4M K;  2JA8 K;  4KB4 A;  1I6V A;  3QX3 A;  3S1M K;  1ZXO A;  4BY7 C;  2XCQ A;  1BJT A;  1PJ7 A;  5JFE A;  1XZP B;  4YG2 A;  5IP9 C;  1EFW A;  4KAW X;  3TFH A;  5M5X K;  1I3Q K;  2E2I K;  2R92 K;  3GTK K;  1I3Q A;  3EQL A;  2E2I A;  3S15 C;  2R92 A;  4KMD A;  3BP3 A;  3GTK A;  3HOU K;  1O2F B;  3PO2 C;  3AD9 C;  2A6E A;  3HOW K;  4C3H C;  3HOZ K;  2VUM K;  1I6H K;  4Y7N K;  4A3C C;  2VUM A;  3I4M C;  2JH3 A;  3AD8 C;  2JA8 C;  2E2H K;  1I50 K;  4A3J K;  3S1Q K;  1WSV A;  3S1M C;  2E2H A;  1INN A;  4BKW A;  1I50 A;  3BUE A;  1ISE A;  4XSZ A;  4G7Z A;  1WCM K;  4Q4Z A;  4A93 K;  4AH6 A;  2FQO A;  3S1R K;  1WCM A;  5EGH A;  4Q5S A;  1I3Q C;  2E2I C;  2R92 C;  1O2B A;  3GTP K;  2R7Z A;  2B63 K;  3GTK C;  3GTP A;  4GFQ A;  3AQO A;  2NVT C;  3HOU C;  2B63 A;  1ZBS A;  1IQ0 A;  3HOW C;  3HOZ C;  2VUM C;  3AQP A;  1I6H C;  5IOR A;  4Y7N C;  5C4X K;  2WAQ L;  2E2H C;  1I50 C;  2R93 K;  4A3J C;  2D6F C;  1G51 A;  2WAQ D;  2R93 A;  2YU9 K;  1WCM C;  4BLA A;  3G4C A;  4M1X A;  1O28 A;  3S1R C;  2ZFZ A;  2YU9 A;  3I4N C;  4A93 C;  4KM8 A;  2R7Z C;  1XZQ A;  4GTD A;  3GTP C;  2B63 C;  1EK8 A;  4A3G K;  4LQY A;  3L4J A;  4KMH A;  3S16 C;  4KC6 A;  1R9T K;  1TWF K;  5C4X C;  3TFJ A;  1R9T A;  1XZP A;  4GTL A;  1TWF A;  2R93 C;  1USO A;  4G0V A;  3S0X A;  1F93 A;  1IBA A;  2YU9 C;  4LLG A;  4QIW L;  5IYC K;  4KAR A;  3AH5 A;  2CFA B;  2Y3P A;  4X6A C;  4QIW D;  4LK0 A;  4BBR K;  1EI6 A;  1WOO A;  4A3K K;  4A3G C;  4LR2 A;  1V5V A;  2BE5 A;  1WIH A;  1DCO A;  2A69 A;  2GSU A;  1WQH A;  1R9T C;  1TWC K;  4OIQ A;  3CAG A;  3HKZ L;  1TWF C;  1TWC A;  4WIL A;  3S14 K;  2V6U A;  1WSR A;  3HKZ D;  4KMA A;  4MEX A;  3H3V L;  3CQZ K;  3LPX A;  3MML B;  3GEI A;  4P5A A;  3CQZ A;  3GTO K;  3H3V D;  4GTB A;  4A3B K;  5IYC C;  3N3Y A;  4RMF A;  3GTO A;  2V6T A;  5IYD K;  2A6H A;  4KB2 A;  4BBR C;  4LJZ A;  4WJ4 A;  3S17 K;  1HQM A;  3S2H K;  3HOX K;  4MEY A;  1BDF A;  3GTJ K;  1Y1V K;  4A3I K;  1TWG K;  5TMC A;  3FOE A;  2ZUE A;  4A3M K;  1KQ4 A;  3GTJ A;  1TWC C;  1Y1V A;  2P8T A;  1TWG A;  1ZVU A;  2NVQ K;  4GTF A;  4GZY A;  1HI9 A;  3CQZ C;  4G7H A;  1XXC A;  4G0U A;  2PPB A;  1BGW A;  3SZZ A;  1BS2 A;  3GTO C;  4A3B C;  4PAA A;  3WOD A;  4YFK A;  2PMZ L;  5C44 K;  2NVX K;  5IYD C;  5CJ9 A;  2O5I A;  2NVX A;  4BY1 K;  2PMZ D;  3L4K A;  5FJ8 K;  3S2D K;  1EQR A;  5TJ3 A;  3GTJ C;  3FOF A;  3VA7 A;  4A3I C;  4P5B A;  1TWG C;  4A3M C;  3GEE A;  3G4A A;  3JST A;  5FLM K;  5IP7 K;  2NVQ C;  1JOE A;  1SMY A;  2JA7 K;  4JK1 A;  1IS1 A;  2CFA A;  1IL2 A;  1O25 A;  3S1Q C;  2JA7 A;  4MQ9 A;  3NUH A;  1J98 A;  1SFO K;  4LOW A;  1J6X A;  1J6V A;  1TWA K;  3HOV K;  4GTE A;  2NVX C;  5C44 C;  1SFO A;  1TWA A;  1K83 K;  4BY1 C;  4A3D K;  5JVO A;  1PJ5 A;  3S2D C;  1K83 A;  4C2M K;  4OIN A;  3GIR A;  4J3N A;  5M3F K;  5FLM C;  1O29 A;  4C3J K;  1O24 A;  5IP7 C;  3Q3Q A;  3V4G A;  4XSX A; 
#chains in the Genus database with same CATH homology
 2V6T A;  4WIL A;  3JST A;  2V6U A;  4C45 A;  1DCO A;  1DCH A;  1DCP A;  1RU0 A;  1USO A;  3HXA A;  2EBB A;  4LOW A;  1USM A;  1F93 A;  2V6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...