1RU0A

Crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords DcoH-like protein DCoHm
publication title Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1ru0A00
2V6TA 1RU0A 1USMA 2EBBA 4WILA 4C45A 1DCPA 1DCHA 1USOA 1DCOA 3HXAA 1F93A 2V6UA 3JSTA 4LOWA 2V6SA
chains in the Genus database with same CATH superfamily
1F7VA 1INNA 4PAAA 1TWFC 1I50A 3S1RC 5EGEA 2V6SA 1IBAA 3I4MC 1WCMC 1WORA 3GTOA 4Q4ZA 3GTLK 4NOIA 1JQWA 4LK0A 3MMLB 5IYBC 4A3DC 2P8TA 4LR2A 4BLAA 4JK1A 1O27A 2R7ZA 2R92C 4YFNA 1B4AA 3RZDC 3GTQC 3PO2K 1XZQB 3GEEA 4G0WA 1O29A 1YX2A 3K7AC 1DD5A 1IW7A 3M4OC 2JA6C 3GTGA 4GT9A 3GTMK 4WJ4A 4LLGA 2NVXK 3HOZC 4GTDA 1EH1A 1VH2A 2YU9A 2D6FC 2XCQA 3S0XA 4XCHA 1UV7A 3S1NK 4GZYA 2E2HK 2VUMA 1C0AA 3SZYA 4WJ3M 1Y1VK 3I4NC 2PMZL 4BY1K 2NVQC 1IQ0A 2P5MA 1R9TC 2PPBA 1TWHK 2WAQD 1F9NA 3HOWK 4A3BK 3GTKK 2R93K 1WOOA 5IYDK 4C3IK 1I3QC 2E2IA 1I50C 2PA8D 2Y0SD 4A3EK 1SMYA 1GE9A 4BY7K 3HOXK 3S1MK 5FJ8K 5IP7C 3GTPK 5C44C 3GEHA 3H0GA 2GSUA 4LJZA 1TWAK 4Y52K 3S1QK 1VGXA 3HOYK 3CAGA 2JA5K 4X6AC 4A3IK 5C4XC 1WQHA 2XCRB 4G0VA 4A3GC 1ISEA 4A3KC 3S2DC 4GTBA 4YFXA 2KWAA 3GTGC 3GTKA 3S14C 1ZYRA 1USMA 3N0BA 4GTLA 2YU9C 1Y1WK 4RMFA 1TWGK 1F93A 4A3CK 4LOWA 4A3LK 3GTJK 1WIHA 1J6WA 3A8JA 2VUMC 1VLOA 1JOEA 3JSTA 1I6HC 4KM9A 3Q3QA 3HXAA 1BDFA 2GAGC 1XZQA 3TFHA 4Y7NK 3CQZK 4ZH4A 2JA7K 1I3QA 4G0UA 1PJ7A 2E2IC 1O26A 4A3JK 3TTGA 1G51A 5L46A 1DCPA 4C45A 5TJ3A 2B63A 4BXXK 4A3MC 1SFOK 3H0GC 4P5BA 1XZPB 2E2JK 2JA8K 4GTCA 3FKIA 3LAJA 4BBRK 1O24A 4DDQA 1EI6A 1RU0A 4XLPA 4AYBD 3GSIA 2CW0A 2O5IA 4KDDA 1K83A 1TWHC 3N0CA 4A3BC 3GTKC 2JA7A 4BLBA 1IL2A 4C3IC 3AQPA 5C3EK 4C2MK 4XLNA 3PO3C 4A93C 2GSOA 4OIQA 3BP8C 3GTLA 3LAPA 1PJ5A 4KARA 1BS2A 3EQLA 3S2HK 4MEXA 4XSXA 1X31C 1TWAC 2A6HA 4J3NA 1IS1A 1TWFK 4BBSK 1WSRA 3AQOA 1YNNA 3I4MK 1WCMK 2NVYK 2ZUFA 1ZBSA 2W7VA 4KC6A 3QX3A 5IYCC 4A3DK 3OEPA 5C4JC 3GTMA 1BJTA 3M3YC 2CFAB 2NVXA 1WSVA 3ADAC 5IP9K 2R92K 3A8KA 5IORA 3RZDK 3GTQK 4WILA 2WAQL 2B63C 1L0WA 3GTJC 3K7AK 2E2HA 4LQYA 3M4OK 5FLMC 3FKIC 2JA6K 3AD9C 4M1XA 2Y0SL 3ERED 1Y1VA 2GAHC 3H3VD 3HOZK 3G4AA 3HKZD 4O2DA 4GTFA 3AH5A 3SZZA 1J6XA 1K83C 1TWHA 2WB1D 4Q5SA 2R93A 2JA7C 1HQMA 2EBBA 3HOUK 3HOVK 3I4NK 5E68A 3GTLC 2RH6A 3TFJA 1ZQ1C 1YNJA 3GTPA 4KMDA 1TWCK 2GSNA 4BXXC 3AD7C 4KB4A 1R9TK 1TWAA 1IE0A 3AD8C 3FOFA 2V6TA 1XZPA 1I50K 4QIWD 2JA5A 4KMAA 3PO2C 5D4DA 4A3FK 4PABA 3GTOK 5M5YK 1JVIA 1B4BA 2O5JA 4C3HK 5IP7K 5C44K 5EGHA 4MEYA 3L4KA 2ZUEA 3GTMC 4FZBA 2NVXC 2R7ZK 1XXBA 1EQRA 1Y1WA 5M5XK 1TWGA 3G4CA 4ILDA 3OREA 3BUEA 1XXCA 1O28A 3GTJA 3S15K 4A3GK 3IPJA 4A3KK 3S1NC 1TWCA 2NVTK 2E2HC 3S2DK 3GTGK 2A68A 1Y1VC 1VJEA 4C3JK 3GDZA 3S14K 4BBSC 1V5VA 5HL8A 5TMFA 4BY1C 4XSZA 2YU9K 4AH6A 3N3YA 4KB2A 1O2FB 1WQFA 2NVYC 3HOWC 1O2BA 2R93C 3CQZA 5IOQA 5IYDC 3L4JA 3TFIA 1YCLA 3GEIA 4OIOA 4G7ZA 1O2AA 1J98A 5JFEA 2VUMK 3VA7A 4AYBL 1PJ6A 5IP9C 4A3EC 4BY7C 3HOXC 2CFAA 4P5AA 3S1MC 1I6HK 1J6VA 4QJVB 3RZOK 1I6VA 3GTPC 3S17K 1KQ4A 3S16K 1SFOA 1ZXOA 1O25A 4KN4A 1DCOA 4MQ9A 4Y52C 3S1QC 3FHZA 3HOYC 2FQOA 2E2IK 3S1RK 2JA5C 4KAWX 4A3IC 2A69A 3WODA 4FM9A 2PMZD 1ZVUA 1XPPA 5CJ9A 3V4GA 5IYBK 4A3MK 3H0GK 2BE5A 3BP3A 1EK8A 4KN7A 3T02A 3FOEA 2JH3A 3HOUC 4G7OA 3GIRA 1WOSA 1Y1WC 3HOVC 1TWGC 4OIPA 1DCHA 4A3CC 2ZFZA 4A3LC 4KM8A 4BKWA 1TWCC 1EFWA 3T01A 4KASA 2PA8L 2FQTA 4KATA 1TWFA 3OPFA 1VRQC 3PO3K 1WCMA 4A3FC 4LK1A 1XXAA 4A93K 3GTOC 4GFQA 2NVYA 5TMCA 4C3HC 4Y7NC 5JVOA 3CQZC 4G7HA 5CHPA 3LPXA 1USOA 5IOSA 4P9SA 4A3JC 3H3VL 2V6UA 3HKZL 2R7ZC 3NUHA 1AB4A 1WQGA 2R92A 4GTAA 1BGWA 3GTQA 1HI9A 2NVQK 2WB1L 1SFOC 3S15C 4OIRA 2E2JC 2NVTC 1F7UA 2JA8C 2JA6A 5IYCK 4BBRC 1I3QK 4YG2A 5C4JK 2A6EA 4GTEA 2RGRA 2PHCB 3M3YK 3A8IA 4C3JC 2XCOA 4KMUA 1WOPA 2B63K 5M3FK 4KMHA 5IOTA 3DXJA 2Y3PA 5M5WK 4QIWL 5FLMK 3FKIK 5M3MK 5C3EC 4C2MC 4YFKA 4OINA 4X6AK 5C4XK 3RZOC 3S17C 3S16C 1R9TA 3S2HC 1K83K 3T00A 4QJVA
chains in the Genus database with same CATH topology
2V6TA 1RU0A 1USMA 2EBBA 4WILA 4C45A 1DCPA 1DCHA 1USOA 1DCOA 3HXAA 1F93A 2V6UA 3JSTA 4LOWA 2V6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6T A;  1RU0 A;  1USM A;  2EBB A;  4WIL A;  4C45 A;  1DCP A;  1DCH A;  1USO A;  1DCO A;  3HXA A;  1F93 A;  2V6U A;  3JST A;  4LOW A;  2V6S A; 
#chains in the Genus database with same CATH topology
 1F7V A;  1INN A;  4PAA A;  1TWF C;  1I50 A;  3S1R C;  5EGE A;  2V6S A;  1IBA A;  3I4M C;  1WCM C;  1WOR A;  3GTO A;  4Q4Z A;  3GTL K;  4NOI A;  1JQW A;  4LK0 A;  3MML B;  5IYB C;  4A3D C;  2P8T A;  4LR2 A;  4BLA A;  4JK1 A;  1O27 A;  2R7Z A;  2R92 C;  4YFN A;  1B4A A;  3RZD C;  3GTQ C;  3PO2 K;  1XZQ B;  3GEE A;  4G0W A;  1O29 A;  1YX2 A;  3K7A C;  1DD5 A;  1IW7 A;  3M4O C;  2JA6 C;  3GTG A;  4GT9 A;  3GTM K;  4WJ4 A;  4LLG A;  2NVX K;  3HOZ C;  4GTD A;  1EH1 A;  1VH2 A;  2YU9 A;  2D6F C;  2XCQ A;  3S0X A;  4XCH A;  1UV7 A;  3S1N K;  4GZY A;  2E2H K;  2VUM A;  1C0A A;  3SZY A;  4WJ3 M;  1Y1V K;  3I4N C;  2PMZ L;  4BY1 K;  2NVQ C;  1IQ0 A;  2P5M A;  1R9T C;  2PPB A;  1TWH K;  2WAQ D;  1F9N A;  3HOW K;  4A3B K;  3GTK K;  2R93 K;  1WOO A;  5IYD K;  4C3I K;  1I3Q C;  2E2I A;  1I50 C;  2PA8 D;  2Y0S D;  4A3E K;  1SMY A;  1GE9 A;  4BY7 K;  3HOX K;  3S1M K;  5FJ8 K;  5IP7 C;  3GTP K;  5C44 C;  3GEH A;  3H0G A;  2GSU A;  4LJZ A;  1TWA K;  4Y52 K;  3S1Q K;  1VGX A;  3HOY K;  3CAG A;  2JA5 K;  4X6A C;  4A3I K;  5C4X C;  1WQH A;  2XCR B;  4G0V A;  4A3G C;  1ISE A;  4A3K C;  3S2D C;  4GTB A;  4YFX A;  2KWA A;  3GTG C;  3GTK A;  3S14 C;  1ZYR A;  1USM A;  3N0B A;  4GTL A;  2YU9 C;  1Y1W K;  4RMF A;  1TWG K;  1F93 A;  4A3C K;  4LOW A;  4A3L K;  3GTJ K;  1WIH A;  1J6W A;  3A8J A;  2VUM C;  1VLO A;  1JOE A;  3JST A;  1I6H C;  4KM9 A;  3Q3Q A;  3HXA A;  1BDF A;  2GAG C;  1XZQ A;  3TFH A;  4Y7N K;  3CQZ K;  4ZH4 A;  2JA7 K;  1I3Q A;  4G0U A;  1PJ7 A;  2E2I C;  1O26 A;  4A3J K;  3TTG A;  1G51 A;  5L46 A;  1DCP A;  4C45 A;  5TJ3 A;  2B63 A;  4BXX K;  4A3M C;  1SFO K;  3H0G C;  4P5B A;  1XZP B;  2E2J K;  2JA8 K;  4GTC A;  3FKI A;  3LAJ A;  4BBR K;  1O24 A;  4DDQ A;  1EI6 A;  1RU0 A;  4XLP A;  4AYB D;  3GSI A;  2CW0 A;  2O5I A;  4KDD A;  1K83 A;  1TWH C;  3N0C A;  4A3B C;  3GTK C;  2JA7 A;  4BLB A;  1IL2 A;  4C3I C;  3AQP A;  5C3E K;  4C2M K;  4XLN A;  3PO3 C;  4A93 C;  2GSO A;  4OIQ A;  3BP8 C;  3GTL A;  3LAP A;  1PJ5 A;  4KAR A;  1BS2 A;  3EQL A;  3S2H K;  4MEX A;  4XSX A;  1X31 C;  1TWA C;  2A6H A;  4J3N A;  1IS1 A;  1TWF K;  4BBS K;  1WSR A;  3AQO A;  1YNN A;  3I4M K;  1WCM K;  2NVY K;  2ZUF A;  1ZBS A;  2W7V A;  4KC6 A;  3QX3 A;  5IYC C;  4A3D K;  3OEP A;  5C4J C;  3GTM A;  1BJT A;  3M3Y C;  2CFA B;  2NVX A;  1WSV A;  3ADA C;  5IP9 K;  2R92 K;  3A8K A;  5IOR A;  3RZD K;  3GTQ K;  4WIL A;  2WAQ L;  2B63 C;  1L0W A;  3GTJ C;  3K7A K;  2E2H A;  4LQY A;  3M4O K;  5FLM C;  3FKI C;  2JA6 K;  3AD9 C;  4M1X A;  2Y0S L;  3ERE D;  1Y1V A;  2GAH C;  3H3V D;  3HOZ K;  3G4A A;  3HKZ D;  4O2D A;  4GTF A;  3AH5 A;  3SZZ A;  1J6X A;  1K83 C;  1TWH A;  2WB1 D;  4Q5S A;  2R93 A;  2JA7 C;  1HQM A;  2EBB A;  3HOU K;  3HOV K;  3I4N K;  5E68 A;  3GTL C;  2RH6 A;  3TFJ A;  1ZQ1 C;  1YNJ A;  3GTP A;  4KMD A;  1TWC K;  2GSN A;  4BXX C;  3AD7 C;  4KB4 A;  1R9T K;  1TWA A;  1IE0 A;  3AD8 C;  3FOF A;  2V6T A;  1XZP A;  1I50 K;  4QIW D;  2JA5 A;  4KMA A;  3PO2 C;  5D4D A;  4A3F K;  4PAB A;  3GTO K;  5M5Y K;  1JVI A;  1B4B A;  2O5J A;  4C3H K;  5IP7 K;  5C44 K;  5EGH A;  4MEY A;  3L4K A;  2ZUE A;  3GTM C;  4FZB A;  2NVX C;  2R7Z K;  1XXB A;  1EQR A;  1Y1W A;  5M5X K;  1TWG A;  3G4C A;  4ILD A;  3ORE A;  3BUE A;  1XXC A;  1O28 A;  3GTJ A;  3S15 K;  4A3G K;  3IPJ A;  4A3K K;  3S1N C;  1TWC A;  2NVT K;  2E2H C;  3S2D K;  3GTG K;  2A68 A;  1Y1V C;  1VJE A;  4C3J K;  3GDZ A;  3S14 K;  4BBS C;  1V5V A;  5HL8 A;  5TMF A;  4BY1 C;  4XSZ A;  2YU9 K;  4AH6 A;  3N3Y A;  4KB2 A;  1O2F B;  1WQF A;  2NVY C;  3HOW C;  1O2B A;  2R93 C;  3CQZ A;  5IOQ A;  5IYD C;  3L4J A;  3TFI A;  1YCL A;  3GEI A;  4OIO A;  4G7Z A;  1O2A A;  1J98 A;  5JFE A;  2VUM K;  3VA7 A;  4AYB L;  1PJ6 A;  5IP9 C;  4A3E C;  4BY7 C;  3HOX C;  2CFA A;  4P5A A;  3S1M C;  1I6H K;  1J6V A;  4QJV B;  3RZO K;  1I6V A;  3GTP C;  3S17 K;  1KQ4 A;  3S16 K;  1SFO A;  1ZXO A;  1O25 A;  4KN4 A;  1DCO A;  4MQ9 A;  4Y52 C;  3S1Q C;  3FHZ A;  3HOY C;  2FQO A;  2E2I K;  3S1R K;  2JA5 C;  4KAW X;  4A3I C;  2A69 A;  3WOD A;  4FM9 A;  2PMZ D;  1ZVU A;  1XPP A;  5CJ9 A;  3V4G A;  5IYB K;  4A3M K;  3H0G K;  2BE5 A;  3BP3 A;  1EK8 A;  4KN7 A;  3T02 A;  3FOE A;  2JH3 A;  3HOU C;  4G7O A;  3GIR A;  1WOS A;  1Y1W C;  3HOV C;  1TWG C;  4OIP A;  1DCH A;  4A3C C;  2ZFZ A;  4A3L C;  4KM8 A;  4BKW A;  1TWC C;  1EFW A;  3T01 A;  4KAS A;  2PA8 L;  2FQT A;  4KAT A;  1TWF A;  3OPF A;  1VRQ C;  3PO3 K;  1WCM A;  4A3F C;  4LK1 A;  1XXA A;  4A93 K;  3GTO C;  4GFQ A;  2NVY A;  5TMC A;  4C3H C;  4Y7N C;  5JVO A;  3CQZ C;  4G7H A;  5CHP A;  3LPX A;  1USO A;  5IOS A;  4P9S A;  4A3J C;  3H3V L;  2V6U A;  3HKZ L;  2R7Z C;  3NUH A;  1AB4 A;  1WQG A;  2R92 A;  4GTA A;  1BGW A;  3GTQ A;  1HI9 A;  2NVQ K;  2WB1 L;  1SFO C;  3S15 C;  4OIR A;  2E2J C;  2NVT C;  1F7U A;  2JA8 C;  2JA6 A;  5IYC K;  4BBR C;  1I3Q K;  4YG2 A;  5C4J K;  2A6E A;  4GTE A;  2RGR A;  2PHC B;  3M3Y K;  3A8I A;  4C3J C;  2XCO A;  4KMU A;  1WOP A;  2B63 K;  5M3F K;  4KMH A;  5IOT A;  3DXJ A;  2Y3P A;  5M5W K;  4QIW L;  5FLM K;  3FKI K;  5M3M K;  5C3E C;  4C2M C;  4YFK A;  4OIN A;  4X6A K;  5C4X K;  3RZO C;  3S17 C;  3S16 C;  1R9T A;  3S2H C;  1K83 K;  3T00 A;  4QJV A; 
#chains in the Genus database with same CATH homology
 2V6T A;  1RU0 A;  1USM A;  2EBB A;  4WIL A;  4C45 A;  1DCP A;  1DCH A;  1USO A;  1DCO A;  3HXA A;  1F93 A;  2V6U A;  3JST A;  4LOW A;  2V6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...