1RU0A

Crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
DAQWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKAAASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2
pubmed doi rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords DcoH-like protein DCoHm
total genus 37
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1ru0A00
3JSTA 4WILA 1RU0A 2V6TA 1USOA 4LOWA 2V6UA 4C45A 3HXAA 2EBBA 1DCPA 1USMA 2V6SA 1DCOA 1DCHA 1F93A
chains in the Genus database with same CATH superfamily
4QIWD 5IYBC 1BGWA 3AQPA 2VUMA 4XSXA 3GTGK 4LK1A 5C3EC 1TWCA 5HL8A 3SZZA 3HOYC 1GE9A 4KARA 4BBSC 1XXBA 1I3QK 4GTAA 3S16K 1R9TK 1WOPA 3Q3QA 3GTMA 5IORA 3BUEA 3PO3C 5C4JK 5IP9C 3S1QK 2PA8L 4XCHA 2GAGC 2NVYC 3HKZD 1DCPA 1SFOK 3GTMC 3QX3A 3A8IA 1TWFK 4WJ3M 3H0GC 3GEIA 4M1XA 4MEYA 5IOTA 2A6HA 4A3MK 1SFOA 3AD8C 3ADAC 3S1MK 3AD9C 2ZFZA 1XZQB 1XZPB 1XXCA 2JA5C 3HOUK 1R9TA 3AD7C 1KQ4A 3GTPC 1TWAA 1TWGK 3HOZC 4G0WA 4Y52K 3GTGA 1TWCK 4C2MK 4PAAA 4DDQA 3G4AA 4LQYA 3I4MK 4A3BC 1IE0A 3CQZC 4BY1K 4BLBA 1IQ0A 1PJ6A 3JSTA 4KM8A 3GEHA 4GZYA 1HI9A 3PO3K 3OREA 3RZDC 3LAJA 1VJEA 1DCHA 4MQ9A 4P5AA 1IW7A 2FQOA 3FKIA 4A3CC 3GTLC 2VUMC 2JA7C 5JVOA 1I6HK 3LPXA 2R7ZC 2R7ZA 4C45A 4G7ZA 4GT9A 1VH2A 3HOWK 3HOXK 3MMLB 1J98A 4YFKA 1G51A 4KC6A 3PO2K 4C3JC 5IYCK 4A3GC 1WCMC 4QJVA 4LJZA 4BXXK 1TWFC 1ZXOA 3S15C 4P9SA 3N0CA 4A93C 4A3FC 1IL2A 4A3LC 4G0VA 3CQZA 4GFQA 2JA6C 4A3DK 2JA7A 1Y1WC 3CQZK 4BY1C 3SZYA 1IS1A 2A6EA 5CHPA 2NVXC 4YFNA 3GTJC 3I4NK 3H3VL 3S17C 5M5YK 4NOIA 3FHZA 4XLNA 2GSOA 5IYDC 2A69A 1I6HC 1TWCC 1WCMK 1I50C 4WILA 1WSVA 4BBRK 5EGHA 3HOVC 5IYBK 1INNA 3HOXC 1WQGA 2YU9C 1BS2A 3S14C 1ZVUA 1K83C 2GSNA 2R92A 1VLOA 3OPFA 2E2IK 4YG2A 1YCLA 1I3QC 1B4BA 4KMUA 1O2FB 4Y7NK 1R9TC 3A8JA 4YFXA 1RU0A 5IOQA 2A68A 3RZOC 3HOYK 1BJTA 4A3JK 5IYCC 1TWHA 3S17K 2R7ZK 3GIRA 4C3HC 4X6AC 4P5BA 5IP7C 5IYDK 3PO2C 1O2BA 3HKZL 4LR2A 2JH3A 3S2HK 2XCRB 2PPBA 1TWHK 3GSIA 4KDDA 4KMDA 3L4KA 2R92K 3HXAA 3BP3A 2B63K 4ILDA 4AYBL 4A3DC 2FQTA 4J3NA 2R93A 1WSRA 1C0AA 2O5JA 2E2JC 4OIQA 1WOOA 1SFOC 5C4XK 2RH6A 4G0UA 4KN7A 4Y52C 4KM9A 4OIOA 2V6TA 3GTPK 4GTDA 4G7OA 4GTCA 4ZH4A 3L4JA 3GTMK 2WAQD 3NUHA 4QJVB 1K83K 2CFAB 4OIPA 1O24A 2YU9K 5TMFA 2JA5K 3HOUC 1DD5A 4A3EC 3GTOC 3T00A 5M3FK 3S1MC 2R93K 5E68A 3GDZA 4A3IK 2CW0A 3M4OK 3FOEA 4KMAA 5EGEA 4X6AK 3IPJA 2V6SA 1ISEA 5C44C 1O26A 1O27A 3GTLA 4GTBA 1O25A 1PJ7A 4XLPA 2E2JK 1XZQA 2PA8D 2JA6A 1I6VA 1I3QA 3OEPA 3AQOA 3GTQA 2JA6K 4BXXC 3GTGC 2KWAA 5JFEA 2PMZD 2V6UA 4KN4A 5C4XC 5C3EK 1I50A 3S0XA 4GTEA 4C3IK 2E2IA 3HOWC 2WB1L 2E2HK 2Y0SL 3H0GA 2JA8K 3GTOK 3S1NC 4C3JK 2JA7K 4A3GK 1F7VA 3TFJA 4JK1A 1TWFA 2BE5A 5C4JC 5IP9K 4O2DA 3GTQK 1WCMA 3H3VD 2XCOA 2NVYK 1F9NA 3GTJK 2YU9A 5M3MK 4GTLA 1J6WA 1O28A 1SMYA 1ZBSA 2PHCB 3S1QC 4LK0A 3HOVK 1Y1WA 1WIHA 2B63A 2P5MA 3BP8C 2D6FC 4BBSK 4A3FK 3S16C 4A3MC 3WODA 4A3KK 4KASA 5C44K 3I4NC 3GTJA 1XXAA 3G4CA 3LAPA 3FOFA 3TFIA 3M4OC 1YNJA 1L0WA 4A3JC 1XZPA 4FZBA 2E2IC 2JA5A 3CAGA 4Y7NC 3HOZK 1USMA 4BY7C 2E2HA 3S2DC 1EH1A 3S14K 1EI6A 2O5IA 3K7AK 1I50K 1O2AA 3M3YC 5TJ3A 1PJ5A 1Y1VA 5CJ9A 3ERED 5IP7K 2Y0SD 3I4MC 4A3BK 4KAWX 2R92C 3GEEA 5M5WK 4OIRA 3GTKC 1EQRA 3S2HC 1O29A 2RGRA 3S1RK 1VGXA 4KATA 5FLMC 3S1NK 2NVYA 1JVIA 3FKIK 2NVTK 1JQWA 1BDFA 4LLGA 4C3HK 1HQMA 2Y3PA 1TWGC 3GTLK 3RZOK 1DCOA 1J6VA 2VUMK 1Y1VK 1USOA 1F7UA 1WORA 2NVQC 3V4GA 3RZDK 3N0BA 4AH6A 5IOSA 5M5XK 4MEXA 4BY7K 2B63C 3T02A 1TWGA 4Q4ZA 5TMCA 1TWHC 4A93K 1UV7A 4RMFA 4PABA 3TTGA 3VA7A 1TWAK 2WB1D 2EBBA 5D4DA 1ZQ1C 3S1RC 3GTKA 4A3KC 5FLMK 4Q5SA 3FKIC 3GTPA 1K83A 1EFWA 3GTKK 4A3IC 1X31C 1EK8A 3DXJA 2NVXK 1IBAA 4KB4A 4A3CK 3S2DK 2P8TA 1Y1WK 3K7AC 2WAQL 4XSZA 4BLAA 2ZUFA 3M3YK 3TFHA 4OINA 4WJ4A 2GSUA 3S15K 2W7VA 3T01A 1JOEA 2XCQA 1F93A 1ZYRA 4A3LK 4FM9A 3H0GK 1J6XA 3GTOA 2NVXA 1TWAC 2GAHC 4KB2A 1VRQC 1B4AA 4A3EK 4LOWA 3EQLA 4BKWA 2NVTC 4AYBD 2R93C 4C3IC 4QIWL 5L46A 2ZUEA 1V5VA 1YNNA 1AB4A 5FJ8K 4G7HA 1YX2A 1XPPA 3A8KA 4KMHA 4GTFA 1Y1VC 1WQHA 1WOSA 3N3YA 2NVQK 1WQFA 4BBRC 3AH5A 3GTQC 2E2HC 2JA8C 2CFAA 2PMZL 4C2MC
chains in the Genus database with same CATH topology
3JSTA 4WILA 1RU0A 2V6TA 1USOA 4LOWA 2V6UA 4C45A 3HXAA 2EBBA 1DCPA 1USMA 2V6SA 1DCOA 1DCHA 1F93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JST A;  4WIL A;  1RU0 A;  2V6T A;  1USO A;  4LOW A;  2V6U A;  4C45 A;  3HXA A;  2EBB A;  1DCP A;  1USM A;  2V6S A;  1DCO A;  1DCH A;  1F93 A; 
#chains in the Genus database with same CATH topology
 4QIW D;  5IYB C;  1BGW A;  3AQP A;  2VUM A;  4XSX A;  3GTG K;  4LK1 A;  5C3E C;  1TWC A;  5HL8 A;  3SZZ A;  3HOY C;  1GE9 A;  4KAR A;  4BBS C;  1XXB A;  1I3Q K;  4GTA A;  3S16 K;  1R9T K;  1WOP A;  3Q3Q A;  3GTM A;  5IOR A;  3BUE A;  3PO3 C;  5C4J K;  5IP9 C;  3S1Q K;  2PA8 L;  4XCH A;  2GAG C;  2NVY C;  3HKZ D;  1DCP A;  1SFO K;  3GTM C;  3QX3 A;  3A8I A;  1TWF K;  4WJ3 M;  3H0G C;  3GEI A;  4M1X A;  4MEY A;  5IOT A;  2A6H A;  4A3M K;  1SFO A;  3AD8 C;  3ADA C;  3S1M K;  3AD9 C;  2ZFZ A;  1XZQ B;  1XZP B;  1XXC A;  2JA5 C;  3HOU K;  1R9T A;  3AD7 C;  1KQ4 A;  3GTP C;  1TWA A;  1TWG K;  3HOZ C;  4G0W A;  4Y52 K;  3GTG A;  1TWC K;  4C2M K;  4PAA A;  4DDQ A;  3G4A A;  4LQY A;  3I4M K;  4A3B C;  1IE0 A;  3CQZ C;  4BY1 K;  4BLB A;  1IQ0 A;  1PJ6 A;  3JST A;  4KM8 A;  3GEH A;  4GZY A;  1HI9 A;  3PO3 K;  3ORE A;  3RZD C;  3LAJ A;  1VJE A;  1DCH A;  4MQ9 A;  4P5A A;  1IW7 A;  2FQO A;  3FKI A;  4A3C C;  3GTL C;  2VUM C;  2JA7 C;  5JVO A;  1I6H K;  3LPX A;  2R7Z C;  2R7Z A;  4C45 A;  4G7Z A;  4GT9 A;  1VH2 A;  3HOW K;  3HOX K;  3MML B;  1J98 A;  4YFK A;  1G51 A;  4KC6 A;  3PO2 K;  4C3J C;  5IYC K;  4A3G C;  1WCM C;  4QJV A;  4LJZ A;  4BXX K;  1TWF C;  1ZXO A;  3S15 C;  4P9S A;  3N0C A;  4A93 C;  4A3F C;  1IL2 A;  4A3L C;  4G0V A;  3CQZ A;  4GFQ A;  2JA6 C;  4A3D K;  2JA7 A;  1Y1W C;  3CQZ K;  4BY1 C;  3SZY A;  1IS1 A;  2A6E A;  5CHP A;  2NVX C;  4YFN A;  3GTJ C;  3I4N K;  3H3V L;  3S17 C;  5M5Y K;  4NOI A;  3FHZ A;  4XLN A;  2GSO A;  5IYD C;  2A69 A;  1I6H C;  1TWC C;  1WCM K;  1I50 C;  4WIL A;  1WSV A;  4BBR K;  5EGH A;  3HOV C;  5IYB K;  1INN A;  3HOX C;  1WQG A;  2YU9 C;  1BS2 A;  3S14 C;  1ZVU A;  1K83 C;  2GSN A;  2R92 A;  1VLO A;  3OPF A;  2E2I K;  4YG2 A;  1YCL A;  1I3Q C;  1B4B A;  4KMU A;  1O2F B;  4Y7N K;  1R9T C;  3A8J A;  4YFX A;  1RU0 A;  5IOQ A;  2A68 A;  3RZO C;  3HOY K;  1BJT A;  4A3J K;  5IYC C;  1TWH A;  3S17 K;  2R7Z K;  3GIR A;  4C3H C;  4X6A C;  4P5B A;  5IP7 C;  5IYD K;  3PO2 C;  1O2B A;  3HKZ L;  4LR2 A;  2JH3 A;  3S2H K;  2XCR B;  2PPB A;  1TWH K;  3GSI A;  4KDD A;  4KMD A;  3L4K A;  2R92 K;  3HXA A;  3BP3 A;  2B63 K;  4ILD A;  4AYB L;  4A3D C;  2FQT A;  4J3N A;  2R93 A;  1WSR A;  1C0A A;  2O5J A;  2E2J C;  4OIQ A;  1WOO A;  1SFO C;  5C4X K;  2RH6 A;  4G0U A;  4KN7 A;  4Y52 C;  4KM9 A;  4OIO A;  2V6T A;  3GTP K;  4GTD A;  4G7O A;  4GTC A;  4ZH4 A;  3L4J A;  3GTM K;  2WAQ D;  3NUH A;  4QJV B;  1K83 K;  2CFA B;  4OIP A;  1O24 A;  2YU9 K;  5TMF A;  2JA5 K;  3HOU C;  1DD5 A;  4A3E C;  3GTO C;  3T00 A;  5M3F K;  3S1M C;  2R93 K;  5E68 A;  3GDZ A;  4A3I K;  2CW0 A;  3M4O K;  3FOE A;  4KMA A;  5EGE A;  4X6A K;  3IPJ A;  2V6S A;  1ISE A;  5C44 C;  1O26 A;  1O27 A;  3GTL A;  4GTB A;  1O25 A;  1PJ7 A;  4XLP A;  2E2J K;  1XZQ A;  2PA8 D;  2JA6 A;  1I6V A;  1I3Q A;  3OEP A;  3AQO A;  3GTQ A;  2JA6 K;  4BXX C;  3GTG C;  2KWA A;  5JFE A;  2PMZ D;  2V6U A;  4KN4 A;  5C4X C;  5C3E K;  1I50 A;  3S0X A;  4GTE A;  4C3I K;  2E2I A;  3HOW C;  2WB1 L;  2E2H K;  2Y0S L;  3H0G A;  2JA8 K;  3GTO K;  3S1N C;  4C3J K;  2JA7 K;  4A3G K;  1F7V A;  3TFJ A;  4JK1 A;  1TWF A;  2BE5 A;  5C4J C;  5IP9 K;  4O2D A;  3GTQ K;  1WCM A;  3H3V D;  2XCO A;  2NVY K;  1F9N A;  3GTJ K;  2YU9 A;  5M3M K;  4GTL A;  1J6W A;  1O28 A;  1SMY A;  1ZBS A;  2PHC B;  3S1Q C;  4LK0 A;  3HOV K;  1Y1W A;  1WIH A;  2B63 A;  2P5M A;  3BP8 C;  2D6F C;  4BBS K;  4A3F K;  3S16 C;  4A3M C;  3WOD A;  4A3K K;  4KAS A;  5C44 K;  3I4N C;  3GTJ A;  1XXA A;  3G4C A;  3LAP A;  3FOF A;  3TFI A;  3M4O C;  1YNJ A;  1L0W A;  4A3J C;  1XZP A;  4FZB A;  2E2I C;  2JA5 A;  3CAG A;  4Y7N C;  3HOZ K;  1USM A;  4BY7 C;  2E2H A;  3S2D C;  1EH1 A;  3S14 K;  1EI6 A;  2O5I A;  3K7A K;  1I50 K;  1O2A A;  3M3Y C;  5TJ3 A;  1PJ5 A;  1Y1V A;  5CJ9 A;  3ERE D;  5IP7 K;  2Y0S D;  3I4M C;  4A3B K;  4KAW X;  2R92 C;  3GEE A;  5M5W K;  4OIR A;  3GTK C;  1EQR A;  3S2H C;  1O29 A;  2RGR A;  3S1R K;  1VGX A;  4KAT A;  5FLM C;  3S1N K;  2NVY A;  1JVI A;  3FKI K;  2NVT K;  1JQW A;  1BDF A;  4LLG A;  4C3H K;  1HQM A;  2Y3P A;  1TWG C;  3GTL K;  3RZO K;  1DCO A;  1J6V A;  2VUM K;  1Y1V K;  1USO A;  1F7U A;  1WOR A;  2NVQ C;  3V4G A;  3RZD K;  3N0B A;  4AH6 A;  5IOS A;  5M5X K;  4MEX A;  4BY7 K;  2B63 C;  3T02 A;  1TWG A;  4Q4Z A;  5TMC A;  1TWH C;  4A93 K;  1UV7 A;  4RMF A;  4PAB A;  3TTG A;  3VA7 A;  1TWA K;  2WB1 D;  2EBB A;  5D4D A;  1ZQ1 C;  3S1R C;  3GTK A;  4A3K C;  5FLM K;  4Q5S A;  3FKI C;  3GTP A;  1K83 A;  1EFW A;  3GTK K;  4A3I C;  1X31 C;  1EK8 A;  3DXJ A;  2NVX K;  1IBA A;  4KB4 A;  4A3C K;  3S2D K;  2P8T A;  1Y1W K;  3K7A C;  2WAQ L;  4XSZ A;  4BLA A;  2ZUF A;  3M3Y K;  3TFH A;  4OIN A;  4WJ4 A;  2GSU A;  3S15 K;  2W7V A;  3T01 A;  1JOE A;  2XCQ A;  1F93 A;  1ZYR A;  4A3L K;  4FM9 A;  3H0G K;  1J6X A;  3GTO A;  2NVX A;  1TWA C;  2GAH C;  4KB2 A;  1VRQ C;  1B4A A;  4A3E K;  4LOW A;  3EQL A;  4BKW A;  2NVT C;  4AYB D;  2R93 C;  4C3I C;  4QIW L;  5L46 A;  2ZUE A;  1V5V A;  1YNN A;  1AB4 A;  5FJ8 K;  4G7H A;  1YX2 A;  1XPP A;  3A8K A;  4KMH A;  4GTF A;  1Y1V C;  1WQH A;  1WOS A;  3N3Y A;  2NVQ K;  1WQF A;  4BBR C;  3AH5 A;  3GTQ C;  2E2H C;  2JA8 C;  2CFA A;  2PMZ L;  4C2M C; 
#chains in the Genus database with same CATH homology
 3JST A;  4WIL A;  1RU0 A;  2V6T A;  1USO A;  4LOW A;  2V6U A;  4C45 A;  3HXA A;  2EBB A;  1DCP A;  1USM A;  2V6S A;  1DCO A;  1DCH A;  1F93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...