4A3GK

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3gK00
2E2HK 4A3FC 2NVYC 5C44C 4YFXA 3M3YK 3DXJA 3S2HK 5M5WK 3HOXC 1I3QK 3GTOK 4A3DC 1Y1VK 4BBRK 2JA6C 4A3GK 1WCMC 4A3BC 4Y7NK 3H3VD 4OINA 4A93K 1R9TC 3S1MC 4BXXK 4GZYA 4A3MK 4LJZA 2JA8C 4Q5SA 5C4XC 4BY7K 4MEXA 4QJVA 2R92C 4QIWL 1ZYRA 2A69A 2Y0SL 3S16C 2A6EA 2PMZD 3RZDK 4KMUA 4A3CC 3GTJK 1I6VA 2E2JC 3S15K 2WB1L 2B63K 4OIOA 4X6AK 1XPPA 3WODA 1TWAC 4A3EC 3FKIC 2NVXK 2VUMK 3PO2C 2R7ZC 3S2DC 3GTMC 2O5JA 5FLMC 4YFNA 4LK1A 3I4MK 5C4JC 4AYBL 3S16K 4BY7C 2YU9C 4JK1A 3HOUC 3HOZC 1TWGC 1R9TK 3HOVC 5C3EC 3M4OK 3K7AC 5C4XK 2JA7K 1TWHC 4A3MC 2A68A 2R93C 4A3KC 1K83C 3CQZC 2NVQK 3S2HC 3I4MC 4A3DK 3HOWC 3S14C 1Y1VC 3EQLA 2E2HC 4A3CK 4A3LC 5IYBK 3S1NK 4YFKA 1TWAK 4A3EK 1SFOC 3K7AK 2E2JK 2JA7C 3RZDC 4XLPA 2B63C 3GTLK 3S15C 1YNJA 4NOIA 4Q4ZA 1I6HC 1TWGK 2R93K 4XLNA 2NVQC 3M4OC 2E2IK 3RZOK 1Y1WK 2R92K 3GTGK 3H3VL 5FLMK 3HOZK 3CQZK 1K83K 2YU9K 5FJ8K 2A6HA 1TWCC 1TWFC 2O5IA 3PO2K 1BDFA 5C3EK 5C4JK 4G7HA 4KN7A 3H0GC 3I4NK 4KN4A 5IYDK 2BE5A 3HOWK 2R7ZK 3S14K 2WB1D 1SFOK 3PO3K 2PA8L 4C3JK 3S2DK 4BY1C 4QJVB 1SMYA 4A3LK 4A3FK 5IYCC 1TWHK 4C3IK 4A3KK 1I50C 2JA5K 3S17C 3HOVK 2NVTC 3GTQC 3HOYC 4BBSC 1TWCK 3GTPC 4A3GC 4BXXC 4MQ9A 3S1NC 5IP7K 5M3MK 3S1QK 4XSZA 2PMZL 4LLGA 4BBRC 4A3IK 2E2IC 3RZOC 4Y7NC 1YNNA 5IP9K 3S1MK 5M3FK 1I6HK 4X6AC 4G7ZA 4Y52K 3M3YC 1I3QC 4MEYA 3GTLC 1HQMA 1IW7A 1WCMK 5IYBC 2NVYK 5TMFA 5C44K 5TMCA 4A3BK 3S1RK 4OIQA 4A93C 2PA8D 5M5YK 3HOXK 3GTOC 4G7OA 3GTKK 4C3HK 2NVXC 2VUMC 5D4DA 3GTJC 4OIPA 3PO3C 4LK0A 2CW0A 3H0GK 5IYDC 3I4NC 4Y52C 4A3JC 4BBSK 1Y1WC 3GTGC 2JA8K 5IP7C 4C2MK 5M5XK 4A3IC 3HOUK 1TWFK 4AYBD 4YG2A 2NVTK 3GTQK 3HOYK 3HKZL 4QIWD 2JA6K 3S1QC 4ZH4A 2WAQL 2Y0SD 2PPBA 4BY1K 2JA5C 3HKZD 3S17K 3GTPK 2WAQD 4OIRA 5IYCK 4XSXA 3FKIK 4A3JK 3GTKC 1I50K 3GTMK 5IP9C 3S1RC
chains in the Genus database with same CATH superfamily
4A3DC 5M5WK 3HOXC 1I3QK 1JQWA 1WOOA 4A3GK 4A3BC 4Y7NK 4OINA 1F7UA 4Q5SA 1IQ0A 3OEPA 4LR2A 2R92C 3T00A 4QIWL 4C2MC 2YU9A 2PMZD 4A3CC 1TWGA 1I6VA 4DDQA 1WSVA 1XPPA 1TWHA 2VUMK 3AD9C 2R7ZC 3S2DC 2JH3A 3AD8C 5FLMC 1USOA 4FM9A 1PJ7A 4GTLA 4AYBL 3AD7C 4BY7C 5IOSA 1ZQ1C 1VJEA 3GTPA 2A68A 3FHZA 1K83C 2R7ZA 3S2HC 3I4MC 3HOWC 3EQLA 2E2HC 4A3CK 3S1NK 4YFKA 2GSOA 3GTOA 3K7AK 2JA7C 3RZDC 2R93K 1TWGK 4XLNA 1XXAA 2NVQC 1EK8A 1UV7A 3TFHA 3BP3A 3H3VL 5FLMK 3Q3QA 2O5IA 3OPFA 2P5MA 4M1XA 5C4JK 1J98A 2JA5A 2BE5A 3MMLB 4WJ3M 1SMYA 5IYCC 1TWHK 1USMA 5EGHA 4LQYA 2D6FC 2JA6A 1JOEA 1WCMA 3NUHA 4BBSC 1TWCK 4MQ9A 5IP7K 3S1QK 4A3IK 2PMZL 4LLGA 4BBRC 1I6HK 5IP9K 5M3FK 1Y1WA 1J6WA 1HQMA 1X31C 4GTFA 3S1RK 1F7VA 2V6TA 3CAGA 1TWAA 3GTKK 4C3JC 2VUMC 3GTJC 2V6UA 4Y52C 2JA8K 3LAJA 4C3IC 4AYBD 2CFAA 2XCOA 2Y0SD 2VUMA 2WAQD 3G4CA 5IYCK 3GSIA 4LOWA 5CJ9A 2RGRA 2E2HK 1XZPB 1JVIA 4GTCA 1L0WA 3DXJA 3S2HK 3GTOK 4BBRK 1WCMC 3H3VD 4GZYA 1R9TC 5C4XC 3T02A 1F93A 2A69A 3AH5A 2Y0SL 1TWCA 2A6EA 4KMUA 3JSTA 5TJ3A 3GTJK 2ZUFA 3S15K 2WB1L 4OIOA 2GAGC 4A3EC 3FKIC 2NVXK 3PO2C 3GTMC 3N3YA 4YFNA 4LK1A 3I4MK 3HOZC 1DCHA 5C3EC 3M4OK 1TWHC 1WQGA 2R93C 3CQZC 2NVQK 1IS1A 4PABA 4KC6A 4XLPA 1YNJA 3OREA 2E2IK 3RZOK 3FOEA 3S1MC 1Y1VA 4GT9A 1TWFC 3PO2K 1ZVUA 1BDFA 5C3EK 3VA7A 4KN7A 1DD5A 3S0XA 1O2BA 3HOWK 3L4KA 3PO3K 1SFOK 2XCRB 4QJVB 1INNA 1J6VA 4G0UA 1ZBSA 3HOVK 2NVTC 3GTQC 1J6XA 3GTPC 2R93A 4P5BA 1WOSA 1O28A 4XSZA 1O25A 2E2IC 3RZOC 3S1MK 4X6AC 3GTGA 3A8JA 4PAAA 3M3YC 4XCHA 4A93C 2NVYK 5C44K 5TMCA 4OIQA 5M5YK 4G7OA 2NVXC 5D4DA 3PO3C 4OIPA 4LK0A 3GTMA 2CW0A 4GTEA 4BBSK 4O2DA 5JFEA 3GTGC 5M5XK 3T01A 3GDZA 1TWFK 4KMHA 2NVTK 3GTQK 3S1QC 1B4AA 2WAQL 4BY1K 3QX3A 2PHCB 3HKZD 1XZQB 1HI9A 1BJTA 3CQZA 1ZXOA 4GFQA 5IP9C 2GSUA 2W7VA 3N0BA 4A3FC 2NVYC 5C44C 4YFXA 3M3YK 1O24A 4FZBA 1SFOA 2JA6C 3FKIA 3GEIA 4A3MK 4BY7K 4MEXA 4QJVA 1ZYRA 5IOQA 2E2JC 3ERED 5IORA 4G0VA 2B63K 1TWAC 3GIRA 1IL2A 3H0GA 1C0AA 2R92A 3S16K 2V6SA 2E2HA 2YU9C 5E68A 2KWAA 1TWGC 1YX2A 3HOVC 4C45A 2JA7A 3K7AC 1EH1A 5C4XK 2JA7K 5JVOA 4WJ4A 4AH6A 4J3NA 3SZYA 4KMDA 1PJ5A 3S14C 1Y1VC 4A3LC 4KM8A 4A3EK 3GEEA 3S15C 1XZQA 2GSNA 3M4OC 2FQTA 3GTGK 4GTAA 3HOZK 1K83K 5FJ8K 2A6HA 1TWCC 1XXBA 4G7HA 3GTQA 3LPXA 3H0GC 4KAWX 5IYDK 1VH2A 2WB1D 2PA8L 2P8TA 4C3JK 4BLBA 4BY1C 2FQOA 4A3LK 2ZFZA 4KM9A 4A3FK 1TWFA 4A3KK 4RMFA 3S17C 3AQOA 3HOYC 5CHPA 4BXXC 5M3MK 4Y52K 4G0WA 4BKWA 4G7ZA 1RU0A 4MEYA 5IYBC 4A3BK 5TMFA 4GTDA 2ZUEA 2PA8D 3HOXK 4KMAA 4C3HK 4ILDA 3H0GK 4BLAA 5IYDC 2E2IA 1Y1WC 1G51A 4P9SA 3N0CA 5IP7C 4C2MK 4A3IC 3HOUK 1GE9A 3HOYK 4YG2A 1WOPA 3HKZL 4WILA 4ZH4A 1B4BA 2PPBA 3S17K 3GTPK 3TTGA 1K83A 5L46A 4OIRA 1V5VA 3FKIK 4A3JK 3GTKC 1I50K 2RH6A 1EQRA 4X6AK 1XZPA 3S1RC 1DCOA 1WQFA 1EI6A 4KARA 1Y1VK 3TFIA 4A93K 1O27A 1O29A 4BXXK 4LJZA 3FOFA 1O26A 2JA8C 3GTKA 3LAPA 2EBBA 1O2AA 3ADAC 3S16C 2NVYA 4C3HC 3RZDK 1WORA 1VRQC 3A8IA 3A8KA 3TFJA 1F9NA 3V4GA 3WODA 2XCQA 1XXCA 1IBAA 2O5JA 1YCLA 2Y3PA 3G4AA 1KQ4A 4P5AA 5C4JC 4JK1A 3HOUC 1WSRA 1I50A 1R9TK 1WQHA 4KDDA 1WIHA 4A3MC 3L4JA 4A3KC 5HL8A 1BS2A 1PJ6A 4A3DK 3BP8C 5IYBK 1TWAK 2E2JK 1SFOC 1DCPA 2B63C 3GTLK 4NOIA 3IPJA 4Q4ZA 1R9TA 3GTJA 1I6HC 1AB4A 4KASA 1Y1WK 2R92K 3CQZK 2YU9K 1VGXA 1VLOA 2B63A 2GAHC 3I4NK 4KN4A 2R7ZK 3S14K 3S2DK 1O2FB 4C3IK 1I50C 2JA5K 1BGWA 4KB4A 2CFAB 5IOTA 4A3GC 4Y7NC 1YNNA 1I3QC 4GTBA 3GTLC 1IW7A 1WCMK 3SZZA 3S1NC 3GTOC 3I4NC 4A3JC 5EGEA 4KB2A 1I3QA 3GTLA 1EFWA 3HXAA 3AQPA 4QIWD 2JA6K 1ISEA 1IE0A 2JA5C 2NVXA 3GEHA 3BUEA 4XSXA 4KATA 3GTMK
chains in the Genus database with same CATH topology
2E2HK 4A3FC 2NVYC 5C44C 4YFXA 3M3YK 3DXJA 3S2HK 5M5WK 3HOXC 1I3QK 3GTOK 4A3DC 1Y1VK 4BBRK 2JA6C 4A3GK 1WCMC 4A3BC 4Y7NK 3H3VD 4OINA 4A93K 1R9TC 3S1MC 4BXXK 4GZYA 4A3MK 4LJZA 2JA8C 4Q5SA 5C4XC 4BY7K 4MEXA 4QJVA 2R92C 4QIWL 1ZYRA 2A69A 2Y0SL 3S16C 2A6EA 2PMZD 3RZDK 4KMUA 4A3CC 3GTJK 1I6VA 2E2JC 3S15K 2WB1L 2B63K 4OIOA 4X6AK 1XPPA 3WODA 1TWAC 4A3EC 3FKIC 2NVXK 2VUMK 3PO2C 2R7ZC 3S2DC 3GTMC 2O5JA 5FLMC 4YFNA 4LK1A 3I4MK 5C4JC 4AYBL 3S16K 4BY7C 2YU9C 4JK1A 3HOUC 3HOZC 1TWGC 1R9TK 3HOVC 5C3EC 3M4OK 3K7AC 5C4XK 2JA7K 1TWHC 4A3MC 2A68A 2R93C 4A3KC 1K83C 3CQZC 2NVQK 3S2HC 3I4MC 4A3DK 3HOWC 3S14C 1Y1VC 3EQLA 2E2HC 4A3CK 4A3LC 5IYBK 3S1NK 4YFKA 1TWAK 4A3EK 1SFOC 3K7AK 2E2JK 2JA7C 3RZDC 4XLPA 2B63C 3GTLK 3S15C 1YNJA 4NOIA 4Q4ZA 1I6HC 1TWGK 2R93K 4XLNA 2NVQC 3M4OC 2E2IK 3RZOK 1Y1WK 2R92K 3GTGK 3H3VL 5FLMK 3HOZK 3CQZK 1K83K 2YU9K 5FJ8K 2A6HA 1TWCC 1TWFC 2O5IA 3PO2K 1BDFA 5C3EK 5C4JK 4G7HA 4KN7A 3H0GC 3I4NK 4KN4A 5IYDK 2BE5A 3HOWK 2R7ZK 3S14K 2WB1D 1SFOK 3PO3K 2PA8L 4C3JK 3S2DK 4BY1C 4QJVB 1SMYA 4A3LK 4A3FK 5IYCC 1TWHK 4C3IK 4A3KK 1I50C 2JA5K 3S17C 3HOVK 2NVTC 3GTQC 3HOYC 4BBSC 1TWCK 3GTPC 4A3GC 4BXXC 4MQ9A 3S1NC 5IP7K 5M3MK 3S1QK 4XSZA 2PMZL 4LLGA 4BBRC 4A3IK 2E2IC 3RZOC 4Y7NC 1YNNA 5IP9K 3S1MK 5M3FK 1I6HK 4X6AC 4G7ZA 4Y52K 3M3YC 1I3QC 4MEYA 3GTLC 1HQMA 1IW7A 1WCMK 5IYBC 2NVYK 5TMFA 5C44K 5TMCA 4A3BK 3S1RK 4OIQA 4A93C 2PA8D 5M5YK 3HOXK 3GTOC 4G7OA 3GTKK 4C3HK 2NVXC 2VUMC 5D4DA 3GTJC 4OIPA 3PO3C 4LK0A 2CW0A 3H0GK 5IYDC 3I4NC 4Y52C 4A3JC 4BBSK 1Y1WC 3GTGC 2JA8K 5IP7C 4C2MK 5M5XK 4A3IC 3HOUK 1TWFK 4AYBD 4YG2A 2NVTK 3GTQK 3HOYK 3HKZL 4QIWD 2JA6K 3S1QC 4ZH4A 2WAQL 2Y0SD 2PPBA 4BY1K 2JA5C 3HKZD 3S17K 3GTPK 2WAQD 4OIRA 5IYCK 4XSXA 3FKIK 4A3JK 3GTKC 1I50K 3GTMK 5IP9C 3S1RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H K;  4A3F C;  2NVY C;  5C44 C;  4YFX A;  3M3Y K;  3DXJ A;  3S2H K;  5M5W K;  3HOX C;  1I3Q K;  3GTO K;  4A3D C;  1Y1V K;  4BBR K;  2JA6 C;  4A3G K;  1WCM C;  4A3B C;  4Y7N K;  3H3V D;  4OIN A;  4A93 K;  1R9T C;  3S1M C;  4BXX K;  4GZY A;  4A3M K;  4LJZ A;  2JA8 C;  4Q5S A;  5C4X C;  4BY7 K;  4MEX A;  4QJV A;  2R92 C;  4QIW L;  1ZYR A;  2A69 A;  2Y0S L;  3S16 C;  2A6E A;  2PMZ D;  3RZD K;  4KMU A;  4A3C C;  3GTJ K;  1I6V A;  2E2J C;  3S15 K;  2WB1 L;  2B63 K;  4OIO A;  4X6A K;  1XPP A;  3WOD A;  1TWA C;  4A3E C;  3FKI C;  2NVX K;  2VUM K;  3PO2 C;  2R7Z C;  3S2D C;  3GTM C;  2O5J A;  5FLM C;  4YFN A;  4LK1 A;  3I4M K;  5C4J C;  4AYB L;  3S16 K;  4BY7 C;  2YU9 C;  4JK1 A;  3HOU C;  3HOZ C;  1TWG C;  1R9T K;  3HOV C;  5C3E C;  3M4O K;  3K7A C;  5C4X K;  2JA7 K;  1TWH C;  4A3M C;  2A68 A;  2R93 C;  4A3K C;  1K83 C;  3CQZ C;  2NVQ K;  3S2H C;  3I4M C;  4A3D K;  3HOW C;  3S14 C;  1Y1V C;  3EQL A;  2E2H C;  4A3C K;  4A3L C;  5IYB K;  3S1N K;  4YFK A;  1TWA K;  4A3E K;  1SFO C;  3K7A K;  2E2J K;  2JA7 C;  3RZD C;  4XLP A;  2B63 C;  3GTL K;  3S15 C;  1YNJ A;  4NOI A;  4Q4Z A;  1I6H C;  1TWG K;  2R93 K;  4XLN A;  2NVQ C;  3M4O C;  2E2I K;  3RZO K;  1Y1W K;  2R92 K;  3GTG K;  3H3V L;  5FLM K;  3HOZ K;  3CQZ K;  1K83 K;  2YU9 K;  5FJ8 K;  2A6H A;  1TWC C;  1TWF C;  2O5I A;  3PO2 K;  1BDF A;  5C3E K;  5C4J K;  4G7H A;  4KN7 A;  3H0G C;  3I4N K;  4KN4 A;  5IYD K;  2BE5 A;  3HOW K;  2R7Z K;  3S14 K;  2WB1 D;  1SFO K;  3PO3 K;  2PA8 L;  4C3J K;  3S2D K;  4BY1 C;  4QJV B;  1SMY A;  4A3L K;  4A3F K;  5IYC C;  1TWH K;  4C3I K;  4A3K K;  1I50 C;  2JA5 K;  3S17 C;  3HOV K;  2NVT C;  3GTQ C;  3HOY C;  4BBS C;  1TWC K;  3GTP C;  4A3G C;  4BXX C;  4MQ9 A;  3S1N C;  5IP7 K;  5M3M K;  3S1Q K;  4XSZ A;  2PMZ L;  4LLG A;  4BBR C;  4A3I K;  2E2I C;  3RZO C;  4Y7N C;  1YNN A;  5IP9 K;  3S1M K;  5M3F K;  1I6H K;  4X6A C;  4G7Z A;  4Y52 K;  3M3Y C;  1I3Q C;  4MEY A;  3GTL C;  1HQM A;  1IW7 A;  1WCM K;  5IYB C;  2NVY K;  5TMF A;  5C44 K;  5TMC A;  4A3B K;  3S1R K;  4OIQ A;  4A93 C;  2PA8 D;  5M5Y K;  3HOX K;  3GTO C;  4G7O A;  3GTK K;  4C3H K;  2NVX C;  2VUM C;  5D4D A;  3GTJ C;  4OIP A;  3PO3 C;  4LK0 A;  2CW0 A;  3H0G K;  5IYD C;  3I4N C;  4Y52 C;  4A3J C;  4BBS K;  1Y1W C;  3GTG C;  2JA8 K;  5IP7 C;  4C2M K;  5M5X K;  4A3I C;  3HOU K;  1TWF K;  4AYB D;  4YG2 A;  2NVT K;  3GTQ K;  3HOY K;  3HKZ L;  4QIW D;  2JA6 K;  3S1Q C;  4ZH4 A;  2WAQ L;  2Y0S D;  2PPB A;  4BY1 K;  2JA5 C;  3HKZ D;  3S17 K;  3GTP K;  2WAQ D;  4OIR A;  5IYC K;  4XSX A;  3FKI K;  4A3J K;  3GTK C;  1I50 K;  3GTM K;  5IP9 C;  3S1R C; 
#chains in the Genus database with same CATH topology
 4A3D C;  5M5W K;  3HOX C;  1I3Q K;  1JQW A;  1WOO A;  4A3G K;  4A3B C;  4Y7N K;  4OIN A;  1F7U A;  4Q5S A;  1IQ0 A;  3OEP A;  4LR2 A;  2R92 C;  3T00 A;  4QIW L;  4C2M C;  2YU9 A;  2PMZ D;  4A3C C;  1TWG A;  1I6V A;  4DDQ A;  1WSV A;  1XPP A;  1TWH A;  2VUM K;  3AD9 C;  2R7Z C;  3S2D C;  2JH3 A;  3AD8 C;  5FLM C;  1USO A;  4FM9 A;  1PJ7 A;  4GTL A;  4AYB L;  3AD7 C;  4BY7 C;  5IOS A;  1ZQ1 C;  1VJE A;  3GTP A;  2A68 A;  3FHZ A;  1K83 C;  2R7Z A;  3S2H C;  3I4M C;  3HOW C;  3EQL A;  2E2H C;  4A3C K;  3S1N K;  4YFK A;  2GSO A;  3GTO A;  3K7A K;  2JA7 C;  3RZD C;  2R93 K;  1TWG K;  4XLN A;  1XXA A;  2NVQ C;  1EK8 A;  1UV7 A;  3TFH A;  3BP3 A;  3H3V L;  5FLM K;  3Q3Q A;  2O5I A;  3OPF A;  2P5M A;  4M1X A;  5C4J K;  1J98 A;  2JA5 A;  2BE5 A;  3MML B;  4WJ3 M;  1SMY A;  5IYC C;  1TWH K;  1USM A;  5EGH A;  4LQY A;  2D6F C;  2JA6 A;  1JOE A;  1WCM A;  3NUH A;  4BBS C;  1TWC K;  4MQ9 A;  5IP7 K;  3S1Q K;  4A3I K;  2PMZ L;  4LLG A;  4BBR C;  1I6H K;  5IP9 K;  5M3F K;  1Y1W A;  1J6W A;  1HQM A;  1X31 C;  4GTF A;  3S1R K;  1F7V A;  2V6T A;  3CAG A;  1TWA A;  3GTK K;  4C3J C;  2VUM C;  3GTJ C;  2V6U A;  4Y52 C;  2JA8 K;  3LAJ A;  4C3I C;  4AYB D;  2CFA A;  2XCO A;  2Y0S D;  2VUM A;  2WAQ D;  3G4C A;  5IYC K;  3GSI A;  4LOW A;  5CJ9 A;  2RGR A;  2E2H K;  1XZP B;  1JVI A;  4GTC A;  1L0W A;  3DXJ A;  3S2H K;  3GTO K;  4BBR K;  1WCM C;  3H3V D;  4GZY A;  1R9T C;  5C4X C;  3T02 A;  1F93 A;  2A69 A;  3AH5 A;  2Y0S L;  1TWC A;  2A6E A;  4KMU A;  3JST A;  5TJ3 A;  3GTJ K;  2ZUF A;  3S15 K;  2WB1 L;  4OIO A;  2GAG C;  4A3E C;  3FKI C;  2NVX K;  3PO2 C;  3GTM C;  3N3Y A;  4YFN A;  4LK1 A;  3I4M K;  3HOZ C;  1DCH A;  5C3E C;  3M4O K;  1TWH C;  1WQG A;  2R93 C;  3CQZ C;  2NVQ K;  1IS1 A;  4PAB A;  4KC6 A;  4XLP A;  1YNJ A;  3ORE A;  2E2I K;  3RZO K;  3FOE A;  3S1M C;  1Y1V A;  4GT9 A;  1TWF C;  3PO2 K;  1ZVU A;  1BDF A;  5C3E K;  3VA7 A;  4KN7 A;  1DD5 A;  3S0X A;  1O2B A;  3HOW K;  3L4K A;  3PO3 K;  1SFO K;  2XCR B;  4QJV B;  1INN A;  1J6V A;  4G0U A;  1ZBS A;  3HOV K;  2NVT C;  3GTQ C;  1J6X A;  3GTP C;  2R93 A;  4P5B A;  1WOS A;  1O28 A;  4XSZ A;  1O25 A;  2E2I C;  3RZO C;  3S1M K;  4X6A C;  3GTG A;  3A8J A;  4PAA A;  3M3Y C;  4XCH A;  4A93 C;  2NVY K;  5C44 K;  5TMC A;  4OIQ A;  5M5Y K;  4G7O A;  2NVX C;  5D4D A;  3PO3 C;  4OIP A;  4LK0 A;  3GTM A;  2CW0 A;  4GTE A;  4BBS K;  4O2D A;  5JFE A;  3GTG C;  5M5X K;  3T01 A;  3GDZ A;  1TWF K;  4KMH A;  2NVT K;  3GTQ K;  3S1Q C;  1B4A A;  2WAQ L;  4BY1 K;  3QX3 A;  2PHC B;  3HKZ D;  1XZQ B;  1HI9 A;  1BJT A;  3CQZ A;  1ZXO A;  4GFQ A;  5IP9 C;  2GSU A;  2W7V A;  3N0B A;  4A3F C;  2NVY C;  5C44 C;  4YFX A;  3M3Y K;  1O24 A;  4FZB A;  1SFO A;  2JA6 C;  3FKI A;  3GEI A;  4A3M K;  4BY7 K;  4MEX A;  4QJV A;  1ZYR A;  5IOQ A;  2E2J C;  3ERE D;  5IOR A;  4G0V A;  2B63 K;  1TWA C;  3GIR A;  1IL2 A;  3H0G A;  1C0A A;  2R92 A;  3S16 K;  2V6S A;  2E2H A;  2YU9 C;  5E68 A;  2KWA A;  1TWG C;  1YX2 A;  3HOV C;  4C45 A;  2JA7 A;  3K7A C;  1EH1 A;  5C4X K;  2JA7 K;  5JVO A;  4WJ4 A;  4AH6 A;  4J3N A;  3SZY A;  4KMD A;  1PJ5 A;  3S14 C;  1Y1V C;  4A3L C;  4KM8 A;  4A3E K;  3GEE A;  3S15 C;  1XZQ A;  2GSN A;  3M4O C;  2FQT A;  3GTG K;  4GTA A;  3HOZ K;  1K83 K;  5FJ8 K;  2A6H A;  1TWC C;  1XXB A;  4G7H A;  3GTQ A;  3LPX A;  3H0G C;  4KAW X;  5IYD K;  1VH2 A;  2WB1 D;  2PA8 L;  2P8T A;  4C3J K;  4BLB A;  4BY1 C;  2FQO A;  4A3L K;  2ZFZ A;  4KM9 A;  4A3F K;  1TWF A;  4A3K K;  4RMF A;  3S17 C;  3AQO A;  3HOY C;  5CHP A;  4BXX C;  5M3M K;  4Y52 K;  4G0W A;  4BKW A;  4G7Z A;  1RU0 A;  4MEY A;  5IYB C;  4A3B K;  5TMF A;  4GTD A;  2ZUE A;  2PA8 D;  3HOX K;  4KMA A;  4C3H K;  4ILD A;  3H0G K;  4BLA A;  5IYD C;  2E2I A;  1Y1W C;  1G51 A;  4P9S A;  3N0C A;  5IP7 C;  4C2M K;  4A3I C;  3HOU K;  1GE9 A;  3HOY K;  4YG2 A;  1WOP A;  3HKZ L;  4WIL A;  4ZH4 A;  1B4B A;  2PPB A;  3S17 K;  3GTP K;  3TTG A;  1K83 A;  5L46 A;  4OIR A;  1V5V A;  3FKI K;  4A3J K;  3GTK C;  1I50 K;  2RH6 A;  1EQR A;  4X6A K;  1XZP A;  3S1R C;  1DCO A;  1WQF A;  1EI6 A;  4KAR A;  1Y1V K;  3TFI A;  4A93 K;  1O27 A;  1O29 A;  4BXX K;  4LJZ A;  3FOF A;  1O26 A;  2JA8 C;  3GTK A;  3LAP A;  2EBB A;  1O2A A;  3ADA C;  3S16 C;  2NVY A;  4C3H C;  3RZD K;  1WOR A;  1VRQ C;  3A8I A;  3A8K A;  3TFJ A;  1F9N A;  3V4G A;  3WOD A;  2XCQ A;  1XXC A;  1IBA A;  2O5J A;  1YCL A;  2Y3P A;  3G4A A;  1KQ4 A;  4P5A A;  5C4J C;  4JK1 A;  3HOU C;  1WSR A;  1I50 A;  1R9T K;  1WQH A;  4KDD A;  1WIH A;  4A3M C;  3L4J A;  4A3K C;  5HL8 A;  1BS2 A;  1PJ6 A;  4A3D K;  3BP8 C;  5IYB K;  1TWA K;  2E2J K;  1SFO C;  1DCP A;  2B63 C;  3GTL K;  4NOI A;  3IPJ A;  4Q4Z A;  1R9T A;  3GTJ A;  1I6H C;  1AB4 A;  4KAS A;  1Y1W K;  2R92 K;  3CQZ K;  2YU9 K;  1VGX A;  1VLO A;  2B63 A;  2GAH C;  3I4N K;  4KN4 A;  2R7Z K;  3S14 K;  3S2D K;  1O2F B;  4C3I K;  1I50 C;  2JA5 K;  1BGW A;  4KB4 A;  2CFA B;  5IOT A;  4A3G C;  4Y7N C;  1YNN A;  1I3Q C;  4GTB A;  3GTL C;  1IW7 A;  1WCM K;  3SZZ A;  3S1N C;  3GTO C;  3I4N C;  4A3J C;  5EGE A;  4KB2 A;  1I3Q A;  3GTL A;  1EFW A;  3HXA A;  3AQP A;  4QIW D;  2JA6 K;  1ISE A;  1IE0 A;  2JA5 C;  2NVX A;  3GEH A;  3BUE A;  4XSX A;  4KAT A;  3GTM K; 
#chains in the Genus database with same CATH homology
 2E2H K;  4A3F C;  2NVY C;  5C44 C;  4YFX A;  3M3Y K;  3DXJ A;  3S2H K;  5M5W K;  3HOX C;  1I3Q K;  3GTO K;  4A3D C;  1Y1V K;  4BBR K;  2JA6 C;  4A3G K;  1WCM C;  4A3B C;  4Y7N K;  3H3V D;  4OIN A;  4A93 K;  1R9T C;  3S1M C;  4BXX K;  4GZY A;  4A3M K;  4LJZ A;  2JA8 C;  4Q5S A;  5C4X C;  4BY7 K;  4MEX A;  4QJV A;  2R92 C;  4QIW L;  1ZYR A;  2A69 A;  2Y0S L;  3S16 C;  2A6E A;  2PMZ D;  3RZD K;  4KMU A;  4A3C C;  3GTJ K;  1I6V A;  2E2J C;  3S15 K;  2WB1 L;  2B63 K;  4OIO A;  4X6A K;  1XPP A;  3WOD A;  1TWA C;  4A3E C;  3FKI C;  2NVX K;  2VUM K;  3PO2 C;  2R7Z C;  3S2D C;  3GTM C;  2O5J A;  5FLM C;  4YFN A;  4LK1 A;  3I4M K;  5C4J C;  4AYB L;  3S16 K;  4BY7 C;  2YU9 C;  4JK1 A;  3HOU C;  3HOZ C;  1TWG C;  1R9T K;  3HOV C;  5C3E C;  3M4O K;  3K7A C;  5C4X K;  2JA7 K;  1TWH C;  4A3M C;  2A68 A;  2R93 C;  4A3K C;  1K83 C;  3CQZ C;  2NVQ K;  3S2H C;  3I4M C;  4A3D K;  3HOW C;  3S14 C;  1Y1V C;  3EQL A;  2E2H C;  4A3C K;  4A3L C;  5IYB K;  3S1N K;  4YFK A;  1TWA K;  4A3E K;  1SFO C;  3K7A K;  2E2J K;  2JA7 C;  3RZD C;  4XLP A;  2B63 C;  3GTL K;  3S15 C;  1YNJ A;  4NOI A;  4Q4Z A;  1I6H C;  1TWG K;  2R93 K;  4XLN A;  2NVQ C;  3M4O C;  2E2I K;  3RZO K;  1Y1W K;  2R92 K;  3GTG K;  3H3V L;  5FLM K;  3HOZ K;  3CQZ K;  1K83 K;  2YU9 K;  5FJ8 K;  2A6H A;  1TWC C;  1TWF C;  2O5I A;  3PO2 K;  1BDF A;  5C3E K;  5C4J K;  4G7H A;  4KN7 A;  3H0G C;  3I4N K;  4KN4 A;  5IYD K;  2BE5 A;  3HOW K;  2R7Z K;  3S14 K;  2WB1 D;  1SFO K;  3PO3 K;  2PA8 L;  4C3J K;  3S2D K;  4BY1 C;  4QJV B;  1SMY A;  4A3L K;  4A3F K;  5IYC C;  1TWH K;  4C3I K;  4A3K K;  1I50 C;  2JA5 K;  3S17 C;  3HOV K;  2NVT C;  3GTQ C;  3HOY C;  4BBS C;  1TWC K;  3GTP C;  4A3G C;  4BXX C;  4MQ9 A;  3S1N C;  5IP7 K;  5M3M K;  3S1Q K;  4XSZ A;  2PMZ L;  4LLG A;  4BBR C;  4A3I K;  2E2I C;  3RZO C;  4Y7N C;  1YNN A;  5IP9 K;  3S1M K;  5M3F K;  1I6H K;  4X6A C;  4G7Z A;  4Y52 K;  3M3Y C;  1I3Q C;  4MEY A;  3GTL C;  1HQM A;  1IW7 A;  1WCM K;  5IYB C;  2NVY K;  5TMF A;  5C44 K;  5TMC A;  4A3B K;  3S1R K;  4OIQ A;  4A93 C;  2PA8 D;  5M5Y K;  3HOX K;  3GTO C;  4G7O A;  3GTK K;  4C3H K;  2NVX C;  2VUM C;  5D4D A;  3GTJ C;  4OIP A;  3PO3 C;  4LK0 A;  2CW0 A;  3H0G K;  5IYD C;  3I4N C;  4Y52 C;  4A3J C;  4BBS K;  1Y1W C;  3GTG C;  2JA8 K;  5IP7 C;  4C2M K;  5M5X K;  4A3I C;  3HOU K;  1TWF K;  4AYB D;  4YG2 A;  2NVT K;  3GTQ K;  3HOY K;  3HKZ L;  4QIW D;  2JA6 K;  3S1Q C;  4ZH4 A;  2WAQ L;  2Y0S D;  2PPB A;  4BY1 K;  2JA5 C;  3HKZ D;  3S17 K;  3GTP K;  2WAQ D;  4OIR A;  5IYC K;  4XSX A;  3FKI K;  4A3J K;  3GTK C;  1I50 K;  3GTM K;  5IP9 C;  3S1R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...