4A3GK

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3gK00
3RZDK 5C3EK 5C4XK 4Y7NK 2JA7K 4QIWL 2NVTC 4MEYA 4C3HK 4LK1A 2R93C 2B63K 4G7HA 4A3EK 4A3DK 3M3YK 3GTQC 1BDFA 1IW7A 1I6VA 1I3QK 2PMZD 5IYDC 1WCMC 3HOXK 1R9TK 2PPBA 2VUMK 3GTOC 3S14C 4BBSK 5IYBK 3GTPC 5FJ8K 3GTKK 3S16K 3M4OC 5FLMK 3S2DK 1I50K 3H3VD 5M5YK 4OIOA 5M5XK 2JA6C 3FKIK 5M5WK 2R92C 3S2HK 3HOWK 4XSZA 4BY7K 3K7AK 1SMYA 1TWHC 4QIWD 4Y52C 2NVXK 3HOZK 4C3IK 2JA8K 4A3FK 5IP9K 3PO2C 1SFOC 3S1NC 2E2JK 3HKZD 3H3VL 4LLGA 1Y1WC 4QJVB 2E2IK 2WB1L 3GTJC 3S15C 3I4MK 4A3LC 3S1RC 4A3GK 2BE5A 1HQMA 4C2MK 2NVYK 3H0GK 4XLPA 3S1QC 3GTMC 1I6HC 2A69A 4KN7A 3S17K 3CQZC 4A3IC 3HKZL 3HOUC 1TWAK 1TWFC 2NVQK 1K83K 4A3BK 4A93C 3HOYC 1TWGC 4BBRC 4BXXC 2JA5C 2O5JA 3GTQK 4C3JK 2A68A 5IYDK 3I4NC 2E2HK 2WB1D 4A3MK 3S14K 3GTGC 4A3JC 4A3CK 3M4OK 5IYCK 5C3EC 3RZDC 5C4XC 3GTLK 4OIRA 4XLNA 4A3KC 2B63C 4X6AC 1Y1VK 4OIPA 4BY1K 4Y52K 3M3YC 3PO3K 1I3QC 1R9TC 3HOVC 5IP7K 4BBSC 5C4JC 5IYBC 2YU9K 3RZOK 5FLMC 5C44C 2PA8D 1I50C 3GTJK 3S15K 3S1MK 4MEXA 3HOVK 2Y0SD 1YNNA 3FKIC 4G7ZA 2A6HA 2NVTK 3HOWC 3S2HC 5TMFA 4BY7C 2R93K 1TWCC 4OINA 3HOZC 2R7ZK 4Q5SA 5IP9C 2A6EA 3HOUK 4G7OA 2PA8L 2O5IA 4YFXA 4LK0A 4MQ9A 4KMUA 1WCMK 3WODA 2Y0SL 2E2IC 4OIQA 4XSXA 4BBRK 3GTOK 3HOYK 3GTPK 3I4MC 4A3GC 5M3MK 1ZYRA 4Y7NC 2JA7C 4GZYA 2NVYC 4ZH4A 3I4NK 3GTGK 2WAQD 2JA6K 4A3EC 2R92K 4A3DC 3S17C 4QJVA 4AYBL 5TMCA 1TWAC 1TWHK 2CW0A 3HOXC 4A3KK 2R7ZC 2NVQC 2VUMC 1K83C 3PO2K 4YFNA 4KN4A 1SFOK 3S1NK 4A3BC 4X6AK 3GTKC 3S16C 3S2DC 1Y1WK 2WAQL 4A3LK 3S1RK 2E2HC 4YFKA 4A3MC 5C4JK 4A3CC 5IYCC 5C44K 4YG2A 3S1QK 3K7AC 2NVXC 3GTLC 3GTMK 1I6HK 3EQLA 2JA8C 3CQZK 4A3FC 1XPPA 4A3IK 1Y1VC 2E2JC 1TWFK 4BY1C 4AYBD 4NOIA 2PMZL 4Q4ZA 1TWCK 5M3FK 3PO3C 4A93K 1TWGK 4BXXK 4A3JK 5IP7C 2JA5K 4LJZA 2YU9C 1YNJA 3H0GC 3RZOC 5D4DA 4JK1A 3S1MC 3DXJA
chains in the Genus database with same CATH superfamily
3RZDK 1X31C 2NVTC 4C3HK 2B63K 2JA7A 4KB2A 2VUMK 5IYDC 3G4CA 3S16K 5FJ8K 2R7ZA 1R9TA 3H3VD 5M5YK 5IORA 4G0WA 4XSZA 4Y52C 1IQ0A 5EGEA 3HOZK 1SFOC 3H3VL 4WJ3M 1WIHA 2WB1L 3FOEA 1IBAA 2BE5A 4P9SA 1HQMA 2NVYK 3H0GK 1V5VA 1O25A 3T00A 4A3IC 5E68A 1TWFC 4GFQA 1K83K 3GTQK 2D6FC 2A68A 2GSOA 4A3MK 5C3EC 3GTLK 2E2HA 4WILA 1J6VA 1JQWA 3HOVC 3LAJA 3AH5A 5IYBC 1BGWA 2RH6A 5FLMC 5C44C 1I50C 3S1MK 1YNNA 2YU9A 2A6HA 2NVTK 1JOEA 5TMFA 3JSTA 5IP9C 3HOUK 2ZFZA 2E2IC 4MQ9A 3WODA 3I4MC 3GDZA 2W7VA 4BLAA 4GZYA 4KB4A 3CAGA 3GTOA 1F93A 4C3HC 3I4NK 1IL2A 2WAQD 3G4AA 3OEPA 1PJ7A 4XCHA 4KDDA 1TWAC 2CW0A 1ZBSA 2VUMC 2R92A 1SFOK 3S16C 2WAQL 3GEIA 5C4JK 1INNA 5IYCC 1PJ6A 1VGXA 2GAGC 1JVIA 1RU0A 4A3IK 1TWFK 4BY1C 3GSIA 4AYBD 4NOIA 1TWCK 1XZQA 3CQZA 4KARA 3H0GC 1B4BA 4JK1A 2V6UA 5D4DA 1F7VA 4M1XA 2P8TA 1WOPA 5C3EK 1GE9A 3T02A 3OPFA 2R93C 4G7HA 4A3EK 3TFIA 4A3DK 3A8KA 3Q3QA 3GTQC 3HOXK 3HOVK 2B63A 2PMZD 1WCMC 4GTDA 3NUHA 5IYBK 3GTPC 3GTKK 5FLMK 1I50K 1O24A 4OIOA 3QX3A 1XZPA 2JA6C 1VJEA 1SMYA 1TWHC 2NVXK 2XCQA 2JA8K 4A3FK 5IP9K 3AD9C 2E2JK 1Y1WC 2E2IK 4GTBA 5L46A 3I4MK 3S1RC 1EFWA 1O2BA 3BP8C 3TFJA 3V4GA 3GTMC 4FM9A 2A69A 4KN7A 4O2DA 2NVYA 3H0GA 1YCLA 1TWAK 3HOUC 1YX2A 4KMAA 1USOA 4A93C 1TWGC 3FOFA 5HL8A 1K83A 2FQTA 4KMHA 2WB1D 3S14K 3I4NC 3M4OK 5IYCK 1BS2A 3GTQA 2KWAA 2JA5A 2ZUEA 2Y3PA 3GTLA 4BY1K 3AD7C 1I3QC 4BBSC 1ZXOA 5C4JC 1IS1A 1VRQC 2EBBA 3FKIC 2CFAB 4G7ZA 3S2HC 4BY7C 2R93K 1TWCC 3ERED 3T01A 4Q5SA 2A6EA 1VLOA 4LK0A 4OIQA 1WCMK 3AQPA 1USMA 4BBRK 3GTPK 4A3GC 1WSRA 3LPXA 3TTGA 4P5BA 2JA6K 4GTAA 4A3EC 4A3DC 1TWHK 4KC6A 3HOXC 1O2FB 2NVQC 3SZZA 1J98A 4KN4A 4X6AK 4KM8A 1HI9A 4KAWX 3GTKC 1DD5A 1Y1WK 4G0VA 4C3JC 1SFOA 3S1RK 4GTFA 4AH6A 2PHCB 4YG2A 2NVXC 3GTMK 1ISEA 2JA8C 4A3FC 3AD8C 1Y1VC 2E2JC 2V6TA 5IOTA 4Q4ZA 3PO3C 4KATA 4A93K 1TWGK 1WOOA 1TWFA 1YNJA 4LR2A 1O28A 1WORA 4Y7NK 4QIWL 4MEYA 1F7UA 1G51A 1I3QK 3S14C 4BBSK 4DDQA 3M4OC 3L4KA 4GT9A 3GTKA 5M5XK 3FKIK 5M5WK 3S2HK 1I50A 4BY7K 3K7AK 3MMLB 2NVXA 3HKZD 4A3LC 4A3GK 3A8JA 2E2IA 4XLPA 5CHPA 1I6HC 5JVOA 3HKZL 1VH2A 1ZQ1C 1B4AA 1UV7A 1O26A 5TJ3A 2NVQK 1BJTA 4BLBA 4BBRC 1TWAA 5IOQA 2JA5C 2O5JA 3TFHA 2VUMA 4C3JK 5C4XC 4XLNA 3GEEA 4X6AC 1Y1VK 3M3YC 3OREA 1XXAA 3PO3K 1R9TC 4PAAA 1EQRA 2PA8D 4GTEA 3GTJK 3S15K 1O27A 3AQOA 3SZYA 4MEXA 2Y0SD 1WQFA 1KQ4A 3HOWC 4OINA 4KM9A 1C0AA 2PA8L 2O5IA 2R93A 4YFXA 2Y0SL 4XSXA 3HOYK 5M3MK 1ZYRA 4C2MC 4Y7NC 1WCMA 4ZH4A 4G0UA 3GTGK 3GTPA 3S17C 1J6XA 3FHZA 4RMFA 4A3KK 2JA6A 4A3BC 4YFNA 1J6WA 1TWHA 3HXAA 4A3LK 2E2HC 4KMDA 4A3CC 1Y1WA 4C45A 4FZBA 3K7AC 3N0CA 4J3NA 1I6HK 1XPPA 3GTMA 3BP3A 5IP7C 2JA5K 4LJZA 1EH1A 4KASA 2YU9C 1ZVUA 3RZOC 1TWGA 4KMUA 3DXJA 2GAHC 2V6SA 5C4XK 2JA7K 4WJ4A 5JFEA 4LK1A 3LAPA 3M3YK 3A8IA 4LQYA 1BDFA 1IW7A 1I6VA 1L0WA 1R9TK 2PPBA 2R7ZK 3GTOC 5CJ9A 3S2DK 1I3QA 1XXBA 1XZQB 2R92C 3HOWK 4QIWD 4GTCA 4GTLA 4C3IK 3S0XA 3FKIA 3N3YA 3PO2C 3IPJA 4ILDA 3S1NC 3L4JA 3GIRA 4LLGA 1TWCA 4QJVB 5EGHA 3S15C 3GTJC 2XCOA 2RGRA 1DCOA 4C2MK 3S1QC 3S17K 3CQZC 1DCHA 4PABA 4A3BK 2CFAA 3HOYC 4BXXC 1XZPB 5IOSA 5IYDK 1WQHA 2E2HK 3GTGC 4A3JC 4A3CK 1O29A 3RZDC 4OIRA 1WSVA 1PJ5A 2GSUA 4A3KC 2B63C 1WOSA 4OIPA 3ADAC 4Y52K 2JH3A 1AB4A 1Y1VA 5IP7K 2YU9K 3RZOK 3GTJA 3HOZC 2FQOA 4G7OA 4P5AA 2ZUFA 3GTOK 3GEHA 1EI6A 2JA7C 2NVYC 1WQGA 2R92K 4QJVA 1EK8A 4AYBL 5TMCA 2P5MA 2R7ZC 3GTGA 1K83C 3PO2K 3S1NK 1DCPA 3S2DC 4BKWA 4YFKA 4A3MC 2GSNA 5C44K 3S1QK 3GTLC 1XXCA 3EQLA 4C3IC 3CQZK 2PMZL 5M3FK 1F9NA 3BUEA 4BXXK 2XCRB 3VA7A 1IE0A 1O2AA 4LOWA 3S1MC 3N0BA 4A3JK
chains in the Genus database with same CATH topology
3RZDK 5C3EK 5C4XK 4Y7NK 2JA7K 4QIWL 2NVTC 4MEYA 4C3HK 4LK1A 2R93C 2B63K 4G7HA 4A3EK 4A3DK 3M3YK 3GTQC 1BDFA 1IW7A 1I6VA 1I3QK 2PMZD 5IYDC 1WCMC 3HOXK 1R9TK 2PPBA 2VUMK 3GTOC 3S14C 4BBSK 5IYBK 3GTPC 5FJ8K 3GTKK 3S16K 3M4OC 5FLMK 3S2DK 1I50K 3H3VD 5M5YK 4OIOA 5M5XK 2JA6C 3FKIK 5M5WK 2R92C 3S2HK 3HOWK 4XSZA 4BY7K 3K7AK 1SMYA 1TWHC 4QIWD 4Y52C 2NVXK 3HOZK 4C3IK 2JA8K 4A3FK 5IP9K 3PO2C 1SFOC 3S1NC 2E2JK 3HKZD 3H3VL 4LLGA 1Y1WC 4QJVB 2E2IK 2WB1L 3GTJC 3S15C 3I4MK 4A3LC 3S1RC 4A3GK 2BE5A 1HQMA 4C2MK 2NVYK 3H0GK 4XLPA 3S1QC 3GTMC 1I6HC 2A69A 4KN7A 3S17K 3CQZC 4A3IC 3HKZL 3HOUC 1TWAK 1TWFC 2NVQK 1K83K 4A3BK 4A93C 3HOYC 1TWGC 4BBRC 4BXXC 2JA5C 2O5JA 3GTQK 4C3JK 2A68A 5IYDK 3I4NC 2E2HK 2WB1D 4A3MK 3S14K 3GTGC 4A3JC 4A3CK 3M4OK 5IYCK 5C3EC 3RZDC 5C4XC 3GTLK 4OIRA 4XLNA 4A3KC 2B63C 4X6AC 1Y1VK 4OIPA 4BY1K 4Y52K 3M3YC 3PO3K 1I3QC 1R9TC 3HOVC 5IP7K 4BBSC 5C4JC 5IYBC 2YU9K 3RZOK 5FLMC 5C44C 2PA8D 1I50C 3GTJK 3S15K 3S1MK 4MEXA 3HOVK 2Y0SD 1YNNA 3FKIC 4G7ZA 2A6HA 2NVTK 3HOWC 3S2HC 5TMFA 4BY7C 2R93K 1TWCC 4OINA 3HOZC 2R7ZK 4Q5SA 5IP9C 2A6EA 3HOUK 4G7OA 2PA8L 2O5IA 4YFXA 4LK0A 4MQ9A 4KMUA 1WCMK 3WODA 2Y0SL 2E2IC 4OIQA 4XSXA 4BBRK 3GTOK 3HOYK 3GTPK 3I4MC 4A3GC 5M3MK 1ZYRA 4Y7NC 2JA7C 4GZYA 2NVYC 4ZH4A 3I4NK 3GTGK 2WAQD 2JA6K 4A3EC 2R92K 4A3DC 3S17C 4QJVA 4AYBL 5TMCA 1TWAC 1TWHK 2CW0A 3HOXC 4A3KK 2R7ZC 2NVQC 2VUMC 1K83C 3PO2K 4YFNA 4KN4A 1SFOK 3S1NK 4A3BC 4X6AK 3GTKC 3S16C 3S2DC 1Y1WK 2WAQL 4A3LK 3S1RK 2E2HC 4YFKA 4A3MC 5C4JK 4A3CC 5IYCC 5C44K 4YG2A 3S1QK 3K7AC 2NVXC 3GTLC 3GTMK 1I6HK 3EQLA 2JA8C 3CQZK 4A3FC 1XPPA 4A3IK 1Y1VC 2E2JC 1TWFK 4BY1C 4AYBD 4NOIA 2PMZL 4Q4ZA 1TWCK 5M3FK 3PO3C 4A93K 1TWGK 4BXXK 4A3JK 5IP7C 2JA5K 4LJZA 2YU9C 1YNJA 3H0GC 3RZOC 5D4DA 4JK1A 3S1MC 3DXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD K;  5C3E K;  5C4X K;  4Y7N K;  2JA7 K;  4QIW L;  2NVT C;  4MEY A;  4C3H K;  4LK1 A;  2R93 C;  2B63 K;  4G7H A;  4A3E K;  4A3D K;  3M3Y K;  3GTQ C;  1BDF A;  1IW7 A;  1I6V A;  1I3Q K;  2PMZ D;  5IYD C;  1WCM C;  3HOX K;  1R9T K;  2PPB A;  2VUM K;  3GTO C;  3S14 C;  4BBS K;  5IYB K;  3GTP C;  5FJ8 K;  3GTK K;  3S16 K;  3M4O C;  5FLM K;  3S2D K;  1I50 K;  3H3V D;  5M5Y K;  4OIO A;  5M5X K;  2JA6 C;  3FKI K;  5M5W K;  2R92 C;  3S2H K;  3HOW K;  4XSZ A;  4BY7 K;  3K7A K;  1SMY A;  1TWH C;  4QIW D;  4Y52 C;  2NVX K;  3HOZ K;  4C3I K;  2JA8 K;  4A3F K;  5IP9 K;  3PO2 C;  1SFO C;  3S1N C;  2E2J K;  3HKZ D;  3H3V L;  4LLG A;  1Y1W C;  4QJV B;  2E2I K;  2WB1 L;  3GTJ C;  3S15 C;  3I4M K;  4A3L C;  3S1R C;  4A3G K;  2BE5 A;  1HQM A;  4C2M K;  2NVY K;  3H0G K;  4XLP A;  3S1Q C;  3GTM C;  1I6H C;  2A69 A;  4KN7 A;  3S17 K;  3CQZ C;  4A3I C;  3HKZ L;  3HOU C;  1TWA K;  1TWF C;  2NVQ K;  1K83 K;  4A3B K;  4A93 C;  3HOY C;  1TWG C;  4BBR C;  4BXX C;  2JA5 C;  2O5J A;  3GTQ K;  4C3J K;  2A68 A;  5IYD K;  3I4N C;  2E2H K;  2WB1 D;  4A3M K;  3S14 K;  3GTG C;  4A3J C;  4A3C K;  3M4O K;  5IYC K;  5C3E C;  3RZD C;  5C4X C;  3GTL K;  4OIR A;  4XLN A;  4A3K C;  2B63 C;  4X6A C;  1Y1V K;  4OIP A;  4BY1 K;  4Y52 K;  3M3Y C;  3PO3 K;  1I3Q C;  1R9T C;  3HOV C;  5IP7 K;  4BBS C;  5C4J C;  5IYB C;  2YU9 K;  3RZO K;  5FLM C;  5C44 C;  2PA8 D;  1I50 C;  3GTJ K;  3S15 K;  3S1M K;  4MEX A;  3HOV K;  2Y0S D;  1YNN A;  3FKI C;  4G7Z A;  2A6H A;  2NVT K;  3HOW C;  3S2H C;  5TMF A;  4BY7 C;  2R93 K;  1TWC C;  4OIN A;  3HOZ C;  2R7Z K;  4Q5S A;  5IP9 C;  2A6E A;  3HOU K;  4G7O A;  2PA8 L;  2O5I A;  4YFX A;  4LK0 A;  4MQ9 A;  4KMU A;  1WCM K;  3WOD A;  2Y0S L;  2E2I C;  4OIQ A;  4XSX A;  4BBR K;  3GTO K;  3HOY K;  3GTP K;  3I4M C;  4A3G C;  5M3M K;  1ZYR A;  4Y7N C;  2JA7 C;  4GZY A;  2NVY C;  4ZH4 A;  3I4N K;  3GTG K;  2WAQ D;  2JA6 K;  4A3E C;  2R92 K;  4A3D C;  3S17 C;  4QJV A;  4AYB L;  5TMC A;  1TWA C;  1TWH K;  2CW0 A;  3HOX C;  4A3K K;  2R7Z C;  2NVQ C;  2VUM C;  1K83 C;  3PO2 K;  4YFN A;  4KN4 A;  1SFO K;  3S1N K;  4A3B C;  4X6A K;  3GTK C;  3S16 C;  3S2D C;  1Y1W K;  2WAQ L;  4A3L K;  3S1R K;  2E2H C;  4YFK A;  4A3M C;  5C4J K;  4A3C C;  5IYC C;  5C44 K;  4YG2 A;  3S1Q K;  3K7A C;  2NVX C;  3GTL C;  3GTM K;  1I6H K;  3EQL A;  2JA8 C;  3CQZ K;  4A3F C;  1XPP A;  4A3I K;  1Y1V C;  2E2J C;  1TWF K;  4BY1 C;  4AYB D;  4NOI A;  2PMZ L;  4Q4Z A;  1TWC K;  5M3F K;  3PO3 C;  4A93 K;  1TWG K;  4BXX K;  4A3J K;  5IP7 C;  2JA5 K;  4LJZ A;  2YU9 C;  1YNJ A;  3H0G C;  3RZO C;  5D4D A;  4JK1 A;  3S1M C;  3DXJ A; 
#chains in the Genus database with same CATH topology
 3RZD K;  1X31 C;  2NVT C;  4C3H K;  2B63 K;  2JA7 A;  4KB2 A;  2VUM K;  5IYD C;  3G4C A;  3S16 K;  5FJ8 K;  2R7Z A;  1R9T A;  3H3V D;  5M5Y K;  5IOR A;  4G0W A;  4XSZ A;  4Y52 C;  1IQ0 A;  5EGE A;  3HOZ K;  1SFO C;  3H3V L;  4WJ3 M;  1WIH A;  2WB1 L;  3FOE A;  1IBA A;  2BE5 A;  4P9S A;  1HQM A;  2NVY K;  3H0G K;  1V5V A;  1O25 A;  3T00 A;  4A3I C;  5E68 A;  1TWF C;  4GFQ A;  1K83 K;  3GTQ K;  2D6F C;  2A68 A;  2GSO A;  4A3M K;  5C3E C;  3GTL K;  2E2H A;  4WIL A;  1J6V A;  1JQW A;  3HOV C;  3LAJ A;  3AH5 A;  5IYB C;  1BGW A;  2RH6 A;  5FLM C;  5C44 C;  1I50 C;  3S1M K;  1YNN A;  2YU9 A;  2A6H A;  2NVT K;  1JOE A;  5TMF A;  3JST A;  5IP9 C;  3HOU K;  2ZFZ A;  2E2I C;  4MQ9 A;  3WOD A;  3I4M C;  3GDZ A;  2W7V A;  4BLA A;  4GZY A;  4KB4 A;  3CAG A;  3GTO A;  1F93 A;  4C3H C;  3I4N K;  1IL2 A;  2WAQ D;  3G4A A;  3OEP A;  1PJ7 A;  4XCH A;  4KDD A;  1TWA C;  2CW0 A;  1ZBS A;  2VUM C;  2R92 A;  1SFO K;  3S16 C;  2WAQ L;  3GEI A;  5C4J K;  1INN A;  5IYC C;  1PJ6 A;  1VGX A;  2GAG C;  1JVI A;  1RU0 A;  4A3I K;  1TWF K;  4BY1 C;  3GSI A;  4AYB D;  4NOI A;  1TWC K;  1XZQ A;  3CQZ A;  4KAR A;  3H0G C;  1B4B A;  4JK1 A;  2V6U A;  5D4D A;  1F7V A;  4M1X A;  2P8T A;  1WOP A;  5C3E K;  1GE9 A;  3T02 A;  3OPF A;  2R93 C;  4G7H A;  4A3E K;  3TFI A;  4A3D K;  3A8K A;  3Q3Q A;  3GTQ C;  3HOX K;  3HOV K;  2B63 A;  2PMZ D;  1WCM C;  4GTD A;  3NUH A;  5IYB K;  3GTP C;  3GTK K;  5FLM K;  1I50 K;  1O24 A;  4OIO A;  3QX3 A;  1XZP A;  2JA6 C;  1VJE A;  1SMY A;  1TWH C;  2NVX K;  2XCQ A;  2JA8 K;  4A3F K;  5IP9 K;  3AD9 C;  2E2J K;  1Y1W C;  2E2I K;  4GTB A;  5L46 A;  3I4M K;  3S1R C;  1EFW A;  1O2B A;  3BP8 C;  3TFJ A;  3V4G A;  3GTM C;  4FM9 A;  2A69 A;  4KN7 A;  4O2D A;  2NVY A;  3H0G A;  1YCL A;  1TWA K;  3HOU C;  1YX2 A;  4KMA A;  1USO A;  4A93 C;  1TWG C;  3FOF A;  5HL8 A;  1K83 A;  2FQT A;  4KMH A;  2WB1 D;  3S14 K;  3I4N C;  3M4O K;  5IYC K;  1BS2 A;  3GTQ A;  2KWA A;  2JA5 A;  2ZUE A;  2Y3P A;  3GTL A;  4BY1 K;  3AD7 C;  1I3Q C;  4BBS C;  1ZXO A;  5C4J C;  1IS1 A;  1VRQ C;  2EBB A;  3FKI C;  2CFA B;  4G7Z A;  3S2H C;  4BY7 C;  2R93 K;  1TWC C;  3ERE D;  3T01 A;  4Q5S A;  2A6E A;  1VLO A;  4LK0 A;  4OIQ A;  1WCM K;  3AQP A;  1USM A;  4BBR K;  3GTP K;  4A3G C;  1WSR A;  3LPX A;  3TTG A;  4P5B A;  2JA6 K;  4GTA A;  4A3E C;  4A3D C;  1TWH K;  4KC6 A;  3HOX C;  1O2F B;  2NVQ C;  3SZZ A;  1J98 A;  4KN4 A;  4X6A K;  4KM8 A;  1HI9 A;  4KAW X;  3GTK C;  1DD5 A;  1Y1W K;  4G0V A;  4C3J C;  1SFO A;  3S1R K;  4GTF A;  4AH6 A;  2PHC B;  4YG2 A;  2NVX C;  3GTM K;  1ISE A;  2JA8 C;  4A3F C;  3AD8 C;  1Y1V C;  2E2J C;  2V6T A;  5IOT A;  4Q4Z A;  3PO3 C;  4KAT A;  4A93 K;  1TWG K;  1WOO A;  1TWF A;  1YNJ A;  4LR2 A;  1O28 A;  1WOR A;  4Y7N K;  4QIW L;  4MEY A;  1F7U A;  1G51 A;  1I3Q K;  3S14 C;  4BBS K;  4DDQ A;  3M4O C;  3L4K A;  4GT9 A;  3GTK A;  5M5X K;  3FKI K;  5M5W K;  3S2H K;  1I50 A;  4BY7 K;  3K7A K;  3MML B;  2NVX A;  3HKZ D;  4A3L C;  4A3G K;  3A8J A;  2E2I A;  4XLP A;  5CHP A;  1I6H C;  5JVO A;  3HKZ L;  1VH2 A;  1ZQ1 C;  1B4A A;  1UV7 A;  1O26 A;  5TJ3 A;  2NVQ K;  1BJT A;  4BLB A;  4BBR C;  1TWA A;  5IOQ A;  2JA5 C;  2O5J A;  3TFH A;  2VUM A;  4C3J K;  5C4X C;  4XLN A;  3GEE A;  4X6A C;  1Y1V K;  3M3Y C;  3ORE A;  1XXA A;  3PO3 K;  1R9T C;  4PAA A;  1EQR A;  2PA8 D;  4GTE A;  3GTJ K;  3S15 K;  1O27 A;  3AQO A;  3SZY A;  4MEX A;  2Y0S D;  1WQF A;  1KQ4 A;  3HOW C;  4OIN A;  4KM9 A;  1C0A A;  2PA8 L;  2O5I A;  2R93 A;  4YFX A;  2Y0S L;  4XSX A;  3HOY K;  5M3M K;  1ZYR A;  4C2M C;  4Y7N C;  1WCM A;  4ZH4 A;  4G0U A;  3GTG K;  3GTP A;  3S17 C;  1J6X A;  3FHZ A;  4RMF A;  4A3K K;  2JA6 A;  4A3B C;  4YFN A;  1J6W A;  1TWH A;  3HXA A;  4A3L K;  2E2H C;  4KMD A;  4A3C C;  1Y1W A;  4C45 A;  4FZB A;  3K7A C;  3N0C A;  4J3N A;  1I6H K;  1XPP A;  3GTM A;  3BP3 A;  5IP7 C;  2JA5 K;  4LJZ A;  1EH1 A;  4KAS A;  2YU9 C;  1ZVU A;  3RZO C;  1TWG A;  4KMU A;  3DXJ A;  2GAH C;  2V6S A;  5C4X K;  2JA7 K;  4WJ4 A;  5JFE A;  4LK1 A;  3LAP A;  3M3Y K;  3A8I A;  4LQY A;  1BDF A;  1IW7 A;  1I6V A;  1L0W A;  1R9T K;  2PPB A;  2R7Z K;  3GTO C;  5CJ9 A;  3S2D K;  1I3Q A;  1XXB A;  1XZQ B;  2R92 C;  3HOW K;  4QIW D;  4GTC A;  4GTL A;  4C3I K;  3S0X A;  3FKI A;  3N3Y A;  3PO2 C;  3IPJ A;  4ILD A;  3S1N C;  3L4J A;  3GIR A;  4LLG A;  1TWC A;  4QJV B;  5EGH A;  3S15 C;  3GTJ C;  2XCO A;  2RGR A;  1DCO A;  4C2M K;  3S1Q C;  3S17 K;  3CQZ C;  1DCH A;  4PAB A;  4A3B K;  2CFA A;  3HOY C;  4BXX C;  1XZP B;  5IOS A;  5IYD K;  1WQH A;  2E2H K;  3GTG C;  4A3J C;  4A3C K;  1O29 A;  3RZD C;  4OIR A;  1WSV A;  1PJ5 A;  2GSU A;  4A3K C;  2B63 C;  1WOS A;  4OIP A;  3ADA C;  4Y52 K;  2JH3 A;  1AB4 A;  1Y1V A;  5IP7 K;  2YU9 K;  3RZO K;  3GTJ A;  3HOZ C;  2FQO A;  4G7O A;  4P5A A;  2ZUF A;  3GTO K;  3GEH A;  1EI6 A;  2JA7 C;  2NVY C;  1WQG A;  2R92 K;  4QJV A;  1EK8 A;  4AYB L;  5TMC A;  2P5M A;  2R7Z C;  3GTG A;  1K83 C;  3PO2 K;  3S1N K;  1DCP A;  3S2D C;  4BKW A;  4YFK A;  4A3M C;  2GSN A;  5C44 K;  3S1Q K;  3GTL C;  1XXC A;  3EQL A;  4C3I C;  3CQZ K;  2PMZ L;  5M3F K;  1F9N A;  3BUE A;  4BXX K;  2XCR B;  3VA7 A;  1IE0 A;  1O2A A;  4LOW A;  3S1M C;  3N0B A;  4A3J K; 
#chains in the Genus database with same CATH homology
 3RZD K;  5C3E K;  5C4X K;  4Y7N K;  2JA7 K;  4QIW L;  2NVT C;  4MEY A;  4C3H K;  4LK1 A;  2R93 C;  2B63 K;  4G7H A;  4A3E K;  4A3D K;  3M3Y K;  3GTQ C;  1BDF A;  1IW7 A;  1I6V A;  1I3Q K;  2PMZ D;  5IYD C;  1WCM C;  3HOX K;  1R9T K;  2PPB A;  2VUM K;  3GTO C;  3S14 C;  4BBS K;  5IYB K;  3GTP C;  5FJ8 K;  3GTK K;  3S16 K;  3M4O C;  5FLM K;  3S2D K;  1I50 K;  3H3V D;  5M5Y K;  4OIO A;  5M5X K;  2JA6 C;  3FKI K;  5M5W K;  2R92 C;  3S2H K;  3HOW K;  4XSZ A;  4BY7 K;  3K7A K;  1SMY A;  1TWH C;  4QIW D;  4Y52 C;  2NVX K;  3HOZ K;  4C3I K;  2JA8 K;  4A3F K;  5IP9 K;  3PO2 C;  1SFO C;  3S1N C;  2E2J K;  3HKZ D;  3H3V L;  4LLG A;  1Y1W C;  4QJV B;  2E2I K;  2WB1 L;  3GTJ C;  3S15 C;  3I4M K;  4A3L C;  3S1R C;  4A3G K;  2BE5 A;  1HQM A;  4C2M K;  2NVY K;  3H0G K;  4XLP A;  3S1Q C;  3GTM C;  1I6H C;  2A69 A;  4KN7 A;  3S17 K;  3CQZ C;  4A3I C;  3HKZ L;  3HOU C;  1TWA K;  1TWF C;  2NVQ K;  1K83 K;  4A3B K;  4A93 C;  3HOY C;  1TWG C;  4BBR C;  4BXX C;  2JA5 C;  2O5J A;  3GTQ K;  4C3J K;  2A68 A;  5IYD K;  3I4N C;  2E2H K;  2WB1 D;  4A3M K;  3S14 K;  3GTG C;  4A3J C;  4A3C K;  3M4O K;  5IYC K;  5C3E C;  3RZD C;  5C4X C;  3GTL K;  4OIR A;  4XLN A;  4A3K C;  2B63 C;  4X6A C;  1Y1V K;  4OIP A;  4BY1 K;  4Y52 K;  3M3Y C;  3PO3 K;  1I3Q C;  1R9T C;  3HOV C;  5IP7 K;  4BBS C;  5C4J C;  5IYB C;  2YU9 K;  3RZO K;  5FLM C;  5C44 C;  2PA8 D;  1I50 C;  3GTJ K;  3S15 K;  3S1M K;  4MEX A;  3HOV K;  2Y0S D;  1YNN A;  3FKI C;  4G7Z A;  2A6H A;  2NVT K;  3HOW C;  3S2H C;  5TMF A;  4BY7 C;  2R93 K;  1TWC C;  4OIN A;  3HOZ C;  2R7Z K;  4Q5S A;  5IP9 C;  2A6E A;  3HOU K;  4G7O A;  2PA8 L;  2O5I A;  4YFX A;  4LK0 A;  4MQ9 A;  4KMU A;  1WCM K;  3WOD A;  2Y0S L;  2E2I C;  4OIQ A;  4XSX A;  4BBR K;  3GTO K;  3HOY K;  3GTP K;  3I4M C;  4A3G C;  5M3M K;  1ZYR A;  4Y7N C;  2JA7 C;  4GZY A;  2NVY C;  4ZH4 A;  3I4N K;  3GTG K;  2WAQ D;  2JA6 K;  4A3E C;  2R92 K;  4A3D C;  3S17 C;  4QJV A;  4AYB L;  5TMC A;  1TWA C;  1TWH K;  2CW0 A;  3HOX C;  4A3K K;  2R7Z C;  2NVQ C;  2VUM C;  1K83 C;  3PO2 K;  4YFN A;  4KN4 A;  1SFO K;  3S1N K;  4A3B C;  4X6A K;  3GTK C;  3S16 C;  3S2D C;  1Y1W K;  2WAQ L;  4A3L K;  3S1R K;  2E2H C;  4YFK A;  4A3M C;  5C4J K;  4A3C C;  5IYC C;  5C44 K;  4YG2 A;  3S1Q K;  3K7A C;  2NVX C;  3GTL C;  3GTM K;  1I6H K;  3EQL A;  2JA8 C;  3CQZ K;  4A3F C;  1XPP A;  4A3I K;  1Y1V C;  2E2J C;  1TWF K;  4BY1 C;  4AYB D;  4NOI A;  2PMZ L;  4Q4Z A;  1TWC K;  5M3F K;  3PO3 C;  4A93 K;  1TWG K;  4BXX K;  4A3J K;  5IP7 C;  2JA5 K;  4LJZ A;  2YU9 C;  1YNJ A;  3H0G C;  3RZO C;  5D4D A;  4JK1 A;  3S1M C;  3DXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...