4A3GK

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3gK00
5IYBC 3S14K 4AYBD 2R92C 4A3DK 5M5XK 4A3EC 2R93C 1I50K 3S1RK 1I3QK 3HOUC 3S1NK 3I4NC 4BY7K 5IP9C 2NVTC 3GTJC 3GTPK 4Q5SA 4C3IK 4LJZA 2A68A 2E2HC 3S1QC 2YU9K 2YU9C 2PA8D 3S14C 5M5WK 3HKZD 4A3DC 2WAQL 5TMFA 4KN7A 4OINA 2JA8K 4XLNA 1Y1WK 4OIOA 2B63C 1TWGK 3S1RC 1I3QC 4G7ZA 2PPBA 3H3VD 3M3YC 4A3JC 3S1NC 4OIPA 3GTPC 4BY7C 4A3GK 3RZOK 5M3MK 5IYBK 3HOZK 4MEYA 4GZYA 2A69A 2VUMK 2JA8C 3S2HK 1YNJA 2PA8L 5IP7K 1Y1WC 5M3FK 4LLGA 3FKIK 2Y0SD 4BXXK 4A3GC 2PMZD 1BDFA 3I4MK 3S16K 4A3BK 3S1QK 3H0GK 5M5YK 2E2JC 2O5IA 3RZOC 3HOZC 4G7HA 1I6HK 3HOWC 5C4JK 5TMCA 1Y1VK 3DXJA 4YFXA 2NVYK 2VUMC 2B63K 3PO3K 3S2HC 5IP7C 4OIRA 4A3LK 4A3JK 4XSXA 3FKIC 4YFNA 4BXXC 3I4MC 3S16C 3K7AK 4A3MK 3H0GC 4A3BC 2Y0SL 4LK1A 5IYCK 2A6EA 2PMZL 4X6AC 1I6HC 3EQLA 5C4JC 1TWFK 1Y1VC 3S17K 2JA7K 2NVYC 3S2DK 4BBSK 3PO3C 4A3LC 4BY1K 4XLPA 2E2JK 3GTKK 3K7AC 4A3MC 5IYCC 5FLMK 3HOWK 4QIWD 4YFKA 1TWCK 1YNNA 1TWFC 3S2DC 1TWHK 2JA7C 3S17C 4BBSC 2JA5K 4BY1C 3GTLK 3HOVK 4LK0A 4G7OA 4X6AK 2R7ZK 1SFOC 3GTKC 3GTMK 3M4OK 4NOIA 5FLMC 3WODA 1WCMK 4C3HK 1TWCC 1K83K 1TWHC 4QIWL 2WB1D 2JA6K 4MQ9A 5FJ8K 2E2IK 3S1MK 2JA5C 3GTLC 3HOVC 1TWAK 2R7ZC 3M3YK 4A3IK 3GTMC 4KN4A 3M4OC 3RZDK 2A6HA 1XPPA 1WCMC 5D4DA 5IYDK 3GTQK 1K83C 4XSZA 1R9TK 4JK1A 3HOXK 5C44K 2JA6C 2E2IC 3S1MC 2WB1L 1SFOK 1ZYRA 4Q4ZA 2E2HK 1TWAC 3GTGK 2NVQK 1SMYA 5C4XK 4A3IC 4OIQA 4C3JK 3HOYK 3RZDC 3PO2K 4Y52C 5IYDC 4KMUA 3GTQC 3S15K 1R9TC 4A3CK 3HOXC 5C44C 2O5JA 1IW7A 2NVXK 3GTGC 3HOYC 5C3EK 4Y7NK 4A3FC 2NVQC 4A3KK 1HQMA 3PO2C 3CQZK 5C4XC 4C2MK 4ZH4A 3S15C 4A3CC 4AYBL 4QJVA 2BE5A 4YG2A 4BBRK 1I50C 4A93K 4MEXA 2NVXC 3GTOK 4QJVB 5C3EC 4Y7NC 4A3KC 2R92K 4Y52K 3CQZC 4A3EK 2R93K 3HOUK 3I4NK 3HKZL 4BBRC 5IP9K 2NVTK 1I6VA 1TWGC 3GTJK 4A93C 2CW0A 4A3FK 3GTOC 3H3VL 2WAQD
chains in the Genus database with same CATH superfamily
5IYBC 2PHCB 4A3DK 3GDZA 4PAAA 1PJ7A 3S1RK 3HOUC 4BY7K 1PJ5A 2YU9C 3HKZD 3Q3QA 4OINA 1Y1WK 1SFOA 1WQHA 4G7ZA 4A3GK 1JOEA 5M3MK 5IYBK 4GZYA 3G4CA 4GTAA 1VLOA 1WQGA 2R7ZA 4G0WA 4LLGA 3GTMA 1ZXOA 1WCMA 4GTDA 3CQZA 4A3BK 3HOWC 1Y1VK 3DXJA 1INNA 3PO3K 5IP7C 4A3LK 4XSXA 3LAPA 3FKIC 4BXXC 4LQYA 3S16C 3H0GC 4LK1A 4WILA 3T00A 1I6HC 4J3NA 5C4JC 1TWFK 1J6WA 1C0AA 2JH3A 4FZBA 5EGHA 2E2HA 3K7AC 4RMFA 5IYCC 3HOWK 1USOA 3JSTA 2V6SA 4BBSC 2NVXA 4G7OA 4LK0A 1PJ6A 3GEHA 1SFOC 5FLMC 1WQFA 4C3HK 3FOEA 4G0VA 2WB1D 2CFAA 5FJ8K 3GSIA 2XCRB 2R92A 2CFAB 2R7ZC 3M3YK 3GTMC 3RZDK 2R93A 1XZQA 1AB4A 1WCMC 1WIHA 4KARA 1R9TK 1XZQB 2E2IC 1SFOK 1WSVA 4Q4ZA 3ERED 2NVQK 1KQ4A 3PO2K 3V4GA 3GTQC 4A3CK 3HOXC 3CAGA 2RH6A 2RGRA 3AQPA 3HOYC 5C4XC 4A3KK 1Y1WA 3CQZK 1VRQC 1BS2A 4ZH4A 3S15C 4AYBL 5EGEA 3G4AA 4BBRK 1O2BA 1XZPA 2NVXC 1TWHA 3A8JA 3I4NK 1ZVUA 5IP9K 2NVTK 3GTJK 2E2HK 3H3VL 3S14K 2R92C 4FM9A 3L4JA 5M5XK 3T02A 3VA7A 2R93C 3IPJA 1I3QK 4KM8A 3AD7C 4DDQA 2FQTA 2Y3PA 4LJZA 1J6VA 1TWFA 2P5MA 5M5WK 2GSOA 4A3DC 5TMFA 4GTFA 1X31C 4BLBA 3S1RC 2PPBA 4BY7C 4GT9A 4A3JC 4OIPA 1ZBSA 3RZOK 4GTEA 1YX2A 3S2HK 1Y1WC 1USMA 5JVOA 4O2DA 4A3GC 1XXAA 1HI9A 2E2JC 3TFIA 4KAWX 5TMCA 4YFXA 4OIRA 4A3JK 4A3BC 4GTBA 2PMZL 1R9TA 3EQLA 1EI6A 1Y1VC 3S17K 3S2DK 4KM9A 3PO3C 1IBAA 4A3LC 2E2JK 3GTKK 5IOSA 1YCLA 3BP8C 2GAHC 1I50A 1YNNA 1TWFC 1O28A 1TWHK 3MMLB 2JA5K 4C45A 3M4OK 4NOIA 3N3YA 5HL8A 3S1MK 4KMDA 1F7UA 4A3IK 4KN4A 4BKWA 4P5AA 2A6HA 1WOSA 4C3HC 5D4DA 5IYDK 3GTJA 4KB4A 1VH2A 1ZYRA 4LOWA 3GTGK 3M3YC 5CJ9A 4OIQA 2NVYA 3RZDC 2B63A 1I3QA 1R9TC 1JVIA 2O5JA 1O29A 5C3EK 2NVQC 2ZFZA 3PO2C 4KMAA 3AH5A 2XCQA 4A3CC 4QJVA 4YG2A 1I50C 4MEXA 3GTOK 4QJVB 3L4KA 4A3KC 3CQZC 1JQWA 4A3EK 3HKZL 3T01A 4BBRC 3TTGA 2FQOA 1WORA 1F93A 4P9SA 2JA6A 1I50K 3I4NC 3S1NK 5IP9C 2NVTC 1ZQ1C 3GTJC 3GTPK 4Q5SA 1O26A 1EFWA 2E2HC 3S1QC 4P5BA 3S14C 2EBBA 5CHPA 2JA8K 4KN7A 1BGWA 2B63C 3GTKA 1I3QC 3HOZK 1XZPB 4MEYA 1IQ0A 2VUMK 2JA5A 1DCPA 1YNJA 2KWAA 2PA8L 5M3FK 2PMZD 4GTCA 1BDFA 3I4MK 3S1QK 3RZOC 4G0UA 1RU0A 2O5IA 2V6TA 4G7HA 3HXAA 1DCHA 2NVYK 3S2HC 2B63K 4YFNA 3TFHA 4A3MK 2Y0SL 2A6EA 1VGXA 2JA7K 3GTGA 4BY1K 4PABA 4XLPA 1WOOA 1O25A 4M1XA 1TWCK 3S2DC 3S17C 3LPXA 3GTLK 1F7VA 3HOVK 1O24A 3GTKC 4KC6A 3FOFA 3WODA 1TWGA 1K83K 1TWHC 4QIWL 3GTOA 2JA6K 4MQ9A 3BUEA 2JA5C 1IL2A 4KASA 1TWAK 4AH6A 3M4OC 4WJ3M 5TJ3A 3FHZA 1WSRA 3FKIA 4XSZA 3GEIA 5C44K 1O27A 3S1MC 1B4AA 1SMYA 4A3IC 3BP3A 4Y52C 5IYDC 3GTPA 4KMUA 3ADAC 1IW7A 3GTGC 4Y7NK 4A3FC 1HQMA 1B4BA 2GSNA 3NUHA 4A93K 5IOQA 1IE0A 4C3IC 2VUMA 5C3EC 4Y52K 3HOUK 1J6XA 1I6VA 1TWGC 4WJ4A 3SZZA 4A3FK 3GTOC 2YU9K 2GAGC 4AYBD 2E2IA 4A3EC 4GTLA 4KB2A 3OEPA 4C3IK 2A68A 2JA7A 2PA8D 3GTQA 3TFJA 2WAQL 4XLNA 2ZUEA 4OIOA 1TWGK 3H3VD 3S1NC 3GTPC 1TWCA 3QX3A 2A69A 2XCOA 2JA8C 3GTLA 3OPFA 5IP7K 3FKIK 2Y0SD 4BXXK 3S16K 1DCOA 3H0GK 5M5YK 3S0XA 5IOTA 3LAJA 1K83A 3HOZC 1I6HK 5C4JK 2VUMC 1EQRA 1TWAA 3AD8C 2W7VA 3A8IA 4KDDA 2ZUFA 1J98A 3I4MC 3K7AK 4X6AC 5IYCK 1O2AA 1GE9A 4BBSK 2NVYC 2V6UA 4KATA 4GFQA 4A3MC 4KMHA 5FLMK 4YFKA 4QIWD 3AQOA 3GEEA 2D6FC 2JA7C 1G51A 2P8TA 4BY1C 4X6AK 1XXCA 4XCHA 2R7ZK 3GTMK 1WCMK 4C3JC 1TWCC 1BJTA 2E2IK 3GTLC 3HOVC 5JFEA 1V5VA 3OREA 4LR2A 1ISEA 1XPPA 2GSUA 1L0WA 4BLAA 3GTQK 4C2MC 1K83C 4JK1A 3HOXK 2JA6C 2YU9A 1F9NA 1IS1A 2WB1L 5IORA 1TWAC 3HOYK 1DD5A 5C4XK 1Y1VA 4C3JK 4ILDA 3S15K 5C44C 1UV7A 2NVXK 1EH1A 3SZYA 1VJEA 3A8KA 1WOPA 1O2FB 4C2MK 3GIRA 5L46A 2BE5A 3N0CA 5E68A 3N0BA 4Y7NC 2R92K 3AD9C 2R93K 3H0GA 4A93C 1EK8A 1XXBA 2CW0A 2WAQD
chains in the Genus database with same CATH topology
5IYBC 3S14K 4AYBD 2R92C 4A3DK 5M5XK 4A3EC 2R93C 1I50K 3S1RK 1I3QK 3HOUC 3S1NK 3I4NC 4BY7K 5IP9C 2NVTC 3GTJC 3GTPK 4Q5SA 4C3IK 4LJZA 2A68A 2E2HC 3S1QC 2YU9K 2YU9C 2PA8D 3S14C 5M5WK 3HKZD 4A3DC 2WAQL 5TMFA 4KN7A 4OINA 2JA8K 4XLNA 1Y1WK 4OIOA 2B63C 1TWGK 3S1RC 1I3QC 4G7ZA 2PPBA 3H3VD 3M3YC 4A3JC 3S1NC 4OIPA 3GTPC 4BY7C 4A3GK 3RZOK 5M3MK 5IYBK 3HOZK 4MEYA 4GZYA 2A69A 2VUMK 2JA8C 3S2HK 1YNJA 2PA8L 5IP7K 1Y1WC 5M3FK 4LLGA 3FKIK 2Y0SD 4BXXK 4A3GC 2PMZD 1BDFA 3I4MK 3S16K 4A3BK 3S1QK 3H0GK 5M5YK 2E2JC 2O5IA 3RZOC 3HOZC 4G7HA 1I6HK 3HOWC 5C4JK 5TMCA 1Y1VK 3DXJA 4YFXA 2NVYK 2VUMC 2B63K 3PO3K 3S2HC 5IP7C 4OIRA 4A3LK 4A3JK 4XSXA 3FKIC 4YFNA 4BXXC 3I4MC 3S16C 3K7AK 4A3MK 3H0GC 4A3BC 2Y0SL 4LK1A 5IYCK 2A6EA 2PMZL 4X6AC 1I6HC 3EQLA 5C4JC 1TWFK 1Y1VC 3S17K 2JA7K 2NVYC 3S2DK 4BBSK 3PO3C 4A3LC 4BY1K 4XLPA 2E2JK 3GTKK 3K7AC 4A3MC 5IYCC 5FLMK 3HOWK 4QIWD 4YFKA 1TWCK 1YNNA 1TWFC 3S2DC 1TWHK 2JA7C 3S17C 4BBSC 2JA5K 4BY1C 3GTLK 3HOVK 4LK0A 4G7OA 4X6AK 2R7ZK 1SFOC 3GTKC 3GTMK 3M4OK 4NOIA 5FLMC 3WODA 1WCMK 4C3HK 1TWCC 1K83K 1TWHC 4QIWL 2WB1D 2JA6K 4MQ9A 5FJ8K 2E2IK 3S1MK 2JA5C 3GTLC 3HOVC 1TWAK 2R7ZC 3M3YK 4A3IK 3GTMC 4KN4A 3M4OC 3RZDK 2A6HA 1XPPA 1WCMC 5D4DA 5IYDK 3GTQK 1K83C 4XSZA 1R9TK 4JK1A 3HOXK 5C44K 2JA6C 2E2IC 3S1MC 2WB1L 1SFOK 1ZYRA 4Q4ZA 2E2HK 1TWAC 3GTGK 2NVQK 1SMYA 5C4XK 4A3IC 4OIQA 4C3JK 3HOYK 3RZDC 3PO2K 4Y52C 5IYDC 4KMUA 3GTQC 3S15K 1R9TC 4A3CK 3HOXC 5C44C 2O5JA 1IW7A 2NVXK 3GTGC 3HOYC 5C3EK 4Y7NK 4A3FC 2NVQC 4A3KK 1HQMA 3PO2C 3CQZK 5C4XC 4C2MK 4ZH4A 3S15C 4A3CC 4AYBL 4QJVA 2BE5A 4YG2A 4BBRK 1I50C 4A93K 4MEXA 2NVXC 3GTOK 4QJVB 5C3EC 4Y7NC 4A3KC 2R92K 4Y52K 3CQZC 4A3EK 2R93K 3HOUK 3I4NK 3HKZL 4BBRC 5IP9K 2NVTK 1I6VA 1TWGC 3GTJK 4A93C 2CW0A 4A3FK 3GTOC 3H3VL 2WAQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB C;  3S14 K;  4AYB D;  2R92 C;  4A3D K;  5M5X K;  4A3E C;  2R93 C;  1I50 K;  3S1R K;  1I3Q K;  3HOU C;  3S1N K;  3I4N C;  4BY7 K;  5IP9 C;  2NVT C;  3GTJ C;  3GTP K;  4Q5S A;  4C3I K;  4LJZ A;  2A68 A;  2E2H C;  3S1Q C;  2YU9 K;  2YU9 C;  2PA8 D;  3S14 C;  5M5W K;  3HKZ D;  4A3D C;  2WAQ L;  5TMF A;  4KN7 A;  4OIN A;  2JA8 K;  4XLN A;  1Y1W K;  4OIO A;  2B63 C;  1TWG K;  3S1R C;  1I3Q C;  4G7Z A;  2PPB A;  3H3V D;  3M3Y C;  4A3J C;  3S1N C;  4OIP A;  3GTP C;  4BY7 C;  4A3G K;  3RZO K;  5M3M K;  5IYB K;  3HOZ K;  4MEY A;  4GZY A;  2A69 A;  2VUM K;  2JA8 C;  3S2H K;  1YNJ A;  2PA8 L;  5IP7 K;  1Y1W C;  5M3F K;  4LLG A;  3FKI K;  2Y0S D;  4BXX K;  4A3G C;  2PMZ D;  1BDF A;  3I4M K;  3S16 K;  4A3B K;  3S1Q K;  3H0G K;  5M5Y K;  2E2J C;  2O5I A;  3RZO C;  3HOZ C;  4G7H A;  1I6H K;  3HOW C;  5C4J K;  5TMC A;  1Y1V K;  3DXJ A;  4YFX A;  2NVY K;  2VUM C;  2B63 K;  3PO3 K;  3S2H C;  5IP7 C;  4OIR A;  4A3L K;  4A3J K;  4XSX A;  3FKI C;  4YFN A;  4BXX C;  3I4M C;  3S16 C;  3K7A K;  4A3M K;  3H0G C;  4A3B C;  2Y0S L;  4LK1 A;  5IYC K;  2A6E A;  2PMZ L;  4X6A C;  1I6H C;  3EQL A;  5C4J C;  1TWF K;  1Y1V C;  3S17 K;  2JA7 K;  2NVY C;  3S2D K;  4BBS K;  3PO3 C;  4A3L C;  4BY1 K;  4XLP A;  2E2J K;  3GTK K;  3K7A C;  4A3M C;  5IYC C;  5FLM K;  3HOW K;  4QIW D;  4YFK A;  1TWC K;  1YNN A;  1TWF C;  3S2D C;  1TWH K;  2JA7 C;  3S17 C;  4BBS C;  2JA5 K;  4BY1 C;  3GTL K;  3HOV K;  4LK0 A;  4G7O A;  4X6A K;  2R7Z K;  1SFO C;  3GTK C;  3GTM K;  3M4O K;  4NOI A;  5FLM C;  3WOD A;  1WCM K;  4C3H K;  1TWC C;  1K83 K;  1TWH C;  4QIW L;  2WB1 D;  2JA6 K;  4MQ9 A;  5FJ8 K;  2E2I K;  3S1M K;  2JA5 C;  3GTL C;  3HOV C;  1TWA K;  2R7Z C;  3M3Y K;  4A3I K;  3GTM C;  4KN4 A;  3M4O C;  3RZD K;  2A6H A;  1XPP A;  1WCM C;  5D4D A;  5IYD K;  3GTQ K;  1K83 C;  4XSZ A;  1R9T K;  4JK1 A;  3HOX K;  5C44 K;  2JA6 C;  2E2I C;  3S1M C;  2WB1 L;  1SFO K;  1ZYR A;  4Q4Z A;  2E2H K;  1TWA C;  3GTG K;  2NVQ K;  1SMY A;  5C4X K;  4A3I C;  4OIQ A;  4C3J K;  3HOY K;  3RZD C;  3PO2 K;  4Y52 C;  5IYD C;  4KMU A;  3GTQ C;  3S15 K;  1R9T C;  4A3C K;  3HOX C;  5C44 C;  2O5J A;  1IW7 A;  2NVX K;  3GTG C;  3HOY C;  5C3E K;  4Y7N K;  4A3F C;  2NVQ C;  4A3K K;  1HQM A;  3PO2 C;  3CQZ K;  5C4X C;  4C2M K;  4ZH4 A;  3S15 C;  4A3C C;  4AYB L;  4QJV A;  2BE5 A;  4YG2 A;  4BBR K;  1I50 C;  4A93 K;  4MEX A;  2NVX C;  3GTO K;  4QJV B;  5C3E C;  4Y7N C;  4A3K C;  2R92 K;  4Y52 K;  3CQZ C;  4A3E K;  2R93 K;  3HOU K;  3I4N K;  3HKZ L;  4BBR C;  5IP9 K;  2NVT K;  1I6V A;  1TWG C;  3GTJ K;  4A93 C;  2CW0 A;  4A3F K;  3GTO C;  3H3V L;  2WAQ D; 
#chains in the Genus database with same CATH topology
 5IYB C;  2PHC B;  4A3D K;  3GDZ A;  4PAA A;  1PJ7 A;  3S1R K;  3HOU C;  4BY7 K;  1PJ5 A;  2YU9 C;  3HKZ D;  3Q3Q A;  4OIN A;  1Y1W K;  1SFO A;  1WQH A;  4G7Z A;  4A3G K;  1JOE A;  5M3M K;  5IYB K;  4GZY A;  3G4C A;  4GTA A;  1VLO A;  1WQG A;  2R7Z A;  4G0W A;  4LLG A;  3GTM A;  1ZXO A;  1WCM A;  4GTD A;  3CQZ A;  4A3B K;  3HOW C;  1Y1V K;  3DXJ A;  1INN A;  3PO3 K;  5IP7 C;  4A3L K;  4XSX A;  3LAP A;  3FKI C;  4BXX C;  4LQY A;  3S16 C;  3H0G C;  4LK1 A;  4WIL A;  3T00 A;  1I6H C;  4J3N A;  5C4J C;  1TWF K;  1J6W A;  1C0A A;  2JH3 A;  4FZB A;  5EGH A;  2E2H A;  3K7A C;  4RMF A;  5IYC C;  3HOW K;  1USO A;  3JST A;  2V6S A;  4BBS C;  2NVX A;  4G7O A;  4LK0 A;  1PJ6 A;  3GEH A;  1SFO C;  5FLM C;  1WQF A;  4C3H K;  3FOE A;  4G0V A;  2WB1 D;  2CFA A;  5FJ8 K;  3GSI A;  2XCR B;  2R92 A;  2CFA B;  2R7Z C;  3M3Y K;  3GTM C;  3RZD K;  2R93 A;  1XZQ A;  1AB4 A;  1WCM C;  1WIH A;  4KAR A;  1R9T K;  1XZQ B;  2E2I C;  1SFO K;  1WSV A;  4Q4Z A;  3ERE D;  2NVQ K;  1KQ4 A;  3PO2 K;  3V4G A;  3GTQ C;  4A3C K;  3HOX C;  3CAG A;  2RH6 A;  2RGR A;  3AQP A;  3HOY C;  5C4X C;  4A3K K;  1Y1W A;  3CQZ K;  1VRQ C;  1BS2 A;  4ZH4 A;  3S15 C;  4AYB L;  5EGE A;  3G4A A;  4BBR K;  1O2B A;  1XZP A;  2NVX C;  1TWH A;  3A8J A;  3I4N K;  1ZVU A;  5IP9 K;  2NVT K;  3GTJ K;  2E2H K;  3H3V L;  3S14 K;  2R92 C;  4FM9 A;  3L4J A;  5M5X K;  3T02 A;  3VA7 A;  2R93 C;  3IPJ A;  1I3Q K;  4KM8 A;  3AD7 C;  4DDQ A;  2FQT A;  2Y3P A;  4LJZ A;  1J6V A;  1TWF A;  2P5M A;  5M5W K;  2GSO A;  4A3D C;  5TMF A;  4GTF A;  1X31 C;  4BLB A;  3S1R C;  2PPB A;  4BY7 C;  4GT9 A;  4A3J C;  4OIP A;  1ZBS A;  3RZO K;  4GTE A;  1YX2 A;  3S2H K;  1Y1W C;  1USM A;  5JVO A;  4O2D A;  4A3G C;  1XXA A;  1HI9 A;  2E2J C;  3TFI A;  4KAW X;  5TMC A;  4YFX A;  4OIR A;  4A3J K;  4A3B C;  4GTB A;  2PMZ L;  1R9T A;  3EQL A;  1EI6 A;  1Y1V C;  3S17 K;  3S2D K;  4KM9 A;  3PO3 C;  1IBA A;  4A3L C;  2E2J K;  3GTK K;  5IOS A;  1YCL A;  3BP8 C;  2GAH C;  1I50 A;  1YNN A;  1TWF C;  1O28 A;  1TWH K;  3MML B;  2JA5 K;  4C45 A;  3M4O K;  4NOI A;  3N3Y A;  5HL8 A;  3S1M K;  4KMD A;  1F7U A;  4A3I K;  4KN4 A;  4BKW A;  4P5A A;  2A6H A;  1WOS A;  4C3H C;  5D4D A;  5IYD K;  3GTJ A;  4KB4 A;  1VH2 A;  1ZYR A;  4LOW A;  3GTG K;  3M3Y C;  5CJ9 A;  4OIQ A;  2NVY A;  3RZD C;  2B63 A;  1I3Q A;  1R9T C;  1JVI A;  2O5J A;  1O29 A;  5C3E K;  2NVQ C;  2ZFZ A;  3PO2 C;  4KMA A;  3AH5 A;  2XCQ A;  4A3C C;  4QJV A;  4YG2 A;  1I50 C;  4MEX A;  3GTO K;  4QJV B;  3L4K A;  4A3K C;  3CQZ C;  1JQW A;  4A3E K;  3HKZ L;  3T01 A;  4BBR C;  3TTG A;  2FQO A;  1WOR A;  1F93 A;  4P9S A;  2JA6 A;  1I50 K;  3I4N C;  3S1N K;  5IP9 C;  2NVT C;  1ZQ1 C;  3GTJ C;  3GTP K;  4Q5S A;  1O26 A;  1EFW A;  2E2H C;  3S1Q C;  4P5B A;  3S14 C;  2EBB A;  5CHP A;  2JA8 K;  4KN7 A;  1BGW A;  2B63 C;  3GTK A;  1I3Q C;  3HOZ K;  1XZP B;  4MEY A;  1IQ0 A;  2VUM K;  2JA5 A;  1DCP A;  1YNJ A;  2KWA A;  2PA8 L;  5M3F K;  2PMZ D;  4GTC A;  1BDF A;  3I4M K;  3S1Q K;  3RZO C;  4G0U A;  1RU0 A;  2O5I A;  2V6T A;  4G7H A;  3HXA A;  1DCH A;  2NVY K;  3S2H C;  2B63 K;  4YFN A;  3TFH A;  4A3M K;  2Y0S L;  2A6E A;  1VGX A;  2JA7 K;  3GTG A;  4BY1 K;  4PAB A;  4XLP A;  1WOO A;  1O25 A;  4M1X A;  1TWC K;  3S2D C;  3S17 C;  3LPX A;  3GTL K;  1F7V A;  3HOV K;  1O24 A;  3GTK C;  4KC6 A;  3FOF A;  3WOD A;  1TWG A;  1K83 K;  1TWH C;  4QIW L;  3GTO A;  2JA6 K;  4MQ9 A;  3BUE A;  2JA5 C;  1IL2 A;  4KAS A;  1TWA K;  4AH6 A;  3M4O C;  4WJ3 M;  5TJ3 A;  3FHZ A;  1WSR A;  3FKI A;  4XSZ A;  3GEI A;  5C44 K;  1O27 A;  3S1M C;  1B4A A;  1SMY A;  4A3I C;  3BP3 A;  4Y52 C;  5IYD C;  3GTP A;  4KMU A;  3ADA C;  1IW7 A;  3GTG C;  4Y7N K;  4A3F C;  1HQM A;  1B4B A;  2GSN A;  3NUH A;  4A93 K;  5IOQ A;  1IE0 A;  4C3I C;  2VUM A;  5C3E C;  4Y52 K;  3HOU K;  1J6X A;  1I6V A;  1TWG C;  4WJ4 A;  3SZZ A;  4A3F K;  3GTO C;  2YU9 K;  2GAG C;  4AYB D;  2E2I A;  4A3E C;  4GTL A;  4KB2 A;  3OEP A;  4C3I K;  2A68 A;  2JA7 A;  2PA8 D;  3GTQ A;  3TFJ A;  2WAQ L;  4XLN A;  2ZUE A;  4OIO A;  1TWG K;  3H3V D;  3S1N C;  3GTP C;  1TWC A;  3QX3 A;  2A69 A;  2XCO A;  2JA8 C;  3GTL A;  3OPF A;  5IP7 K;  3FKI K;  2Y0S D;  4BXX K;  3S16 K;  1DCO A;  3H0G K;  5M5Y K;  3S0X A;  5IOT A;  3LAJ A;  1K83 A;  3HOZ C;  1I6H K;  5C4J K;  2VUM C;  1EQR A;  1TWA A;  3AD8 C;  2W7V A;  3A8I A;  4KDD A;  2ZUF A;  1J98 A;  3I4M C;  3K7A K;  4X6A C;  5IYC K;  1O2A A;  1GE9 A;  4BBS K;  2NVY C;  2V6U A;  4KAT A;  4GFQ A;  4A3M C;  4KMH A;  5FLM K;  4YFK A;  4QIW D;  3AQO A;  3GEE A;  2D6F C;  2JA7 C;  1G51 A;  2P8T A;  4BY1 C;  4X6A K;  1XXC A;  4XCH A;  2R7Z K;  3GTM K;  1WCM K;  4C3J C;  1TWC C;  1BJT A;  2E2I K;  3GTL C;  3HOV C;  5JFE A;  1V5V A;  3ORE A;  4LR2 A;  1ISE A;  1XPP A;  2GSU A;  1L0W A;  4BLA A;  3GTQ K;  4C2M C;  1K83 C;  4JK1 A;  3HOX K;  2JA6 C;  2YU9 A;  1F9N A;  1IS1 A;  2WB1 L;  5IOR A;  1TWA C;  3HOY K;  1DD5 A;  5C4X K;  1Y1V A;  4C3J K;  4ILD A;  3S15 K;  5C44 C;  1UV7 A;  2NVX K;  1EH1 A;  3SZY A;  1VJE A;  3A8K A;  1WOP A;  1O2F B;  4C2M K;  3GIR A;  5L46 A;  2BE5 A;  3N0C A;  5E68 A;  3N0B A;  4Y7N C;  2R92 K;  3AD9 C;  2R93 K;  3H0G A;  4A93 C;  1EK8 A;  1XXB A;  2CW0 A;  2WAQ D; 
#chains in the Genus database with same CATH homology
 5IYB C;  3S14 K;  4AYB D;  2R92 C;  4A3D K;  5M5X K;  4A3E C;  2R93 C;  1I50 K;  3S1R K;  1I3Q K;  3HOU C;  3S1N K;  3I4N C;  4BY7 K;  5IP9 C;  2NVT C;  3GTJ C;  3GTP K;  4Q5S A;  4C3I K;  4LJZ A;  2A68 A;  2E2H C;  3S1Q C;  2YU9 K;  2YU9 C;  2PA8 D;  3S14 C;  5M5W K;  3HKZ D;  4A3D C;  2WAQ L;  5TMF A;  4KN7 A;  4OIN A;  2JA8 K;  4XLN A;  1Y1W K;  4OIO A;  2B63 C;  1TWG K;  3S1R C;  1I3Q C;  4G7Z A;  2PPB A;  3H3V D;  3M3Y C;  4A3J C;  3S1N C;  4OIP A;  3GTP C;  4BY7 C;  4A3G K;  3RZO K;  5M3M K;  5IYB K;  3HOZ K;  4MEY A;  4GZY A;  2A69 A;  2VUM K;  2JA8 C;  3S2H K;  1YNJ A;  2PA8 L;  5IP7 K;  1Y1W C;  5M3F K;  4LLG A;  3FKI K;  2Y0S D;  4BXX K;  4A3G C;  2PMZ D;  1BDF A;  3I4M K;  3S16 K;  4A3B K;  3S1Q K;  3H0G K;  5M5Y K;  2E2J C;  2O5I A;  3RZO C;  3HOZ C;  4G7H A;  1I6H K;  3HOW C;  5C4J K;  5TMC A;  1Y1V K;  3DXJ A;  4YFX A;  2NVY K;  2VUM C;  2B63 K;  3PO3 K;  3S2H C;  5IP7 C;  4OIR A;  4A3L K;  4A3J K;  4XSX A;  3FKI C;  4YFN A;  4BXX C;  3I4M C;  3S16 C;  3K7A K;  4A3M K;  3H0G C;  4A3B C;  2Y0S L;  4LK1 A;  5IYC K;  2A6E A;  2PMZ L;  4X6A C;  1I6H C;  3EQL A;  5C4J C;  1TWF K;  1Y1V C;  3S17 K;  2JA7 K;  2NVY C;  3S2D K;  4BBS K;  3PO3 C;  4A3L C;  4BY1 K;  4XLP A;  2E2J K;  3GTK K;  3K7A C;  4A3M C;  5IYC C;  5FLM K;  3HOW K;  4QIW D;  4YFK A;  1TWC K;  1YNN A;  1TWF C;  3S2D C;  1TWH K;  2JA7 C;  3S17 C;  4BBS C;  2JA5 K;  4BY1 C;  3GTL K;  3HOV K;  4LK0 A;  4G7O A;  4X6A K;  2R7Z K;  1SFO C;  3GTK C;  3GTM K;  3M4O K;  4NOI A;  5FLM C;  3WOD A;  1WCM K;  4C3H K;  1TWC C;  1K83 K;  1TWH C;  4QIW L;  2WB1 D;  2JA6 K;  4MQ9 A;  5FJ8 K;  2E2I K;  3S1M K;  2JA5 C;  3GTL C;  3HOV C;  1TWA K;  2R7Z C;  3M3Y K;  4A3I K;  3GTM C;  4KN4 A;  3M4O C;  3RZD K;  2A6H A;  1XPP A;  1WCM C;  5D4D A;  5IYD K;  3GTQ K;  1K83 C;  4XSZ A;  1R9T K;  4JK1 A;  3HOX K;  5C44 K;  2JA6 C;  2E2I C;  3S1M C;  2WB1 L;  1SFO K;  1ZYR A;  4Q4Z A;  2E2H K;  1TWA C;  3GTG K;  2NVQ K;  1SMY A;  5C4X K;  4A3I C;  4OIQ A;  4C3J K;  3HOY K;  3RZD C;  3PO2 K;  4Y52 C;  5IYD C;  4KMU A;  3GTQ C;  3S15 K;  1R9T C;  4A3C K;  3HOX C;  5C44 C;  2O5J A;  1IW7 A;  2NVX K;  3GTG C;  3HOY C;  5C3E K;  4Y7N K;  4A3F C;  2NVQ C;  4A3K K;  1HQM A;  3PO2 C;  3CQZ K;  5C4X C;  4C2M K;  4ZH4 A;  3S15 C;  4A3C C;  4AYB L;  4QJV A;  2BE5 A;  4YG2 A;  4BBR K;  1I50 C;  4A93 K;  4MEX A;  2NVX C;  3GTO K;  4QJV B;  5C3E C;  4Y7N C;  4A3K C;  2R92 K;  4Y52 K;  3CQZ C;  4A3E K;  2R93 K;  3HOU K;  3I4N K;  3HKZ L;  4BBR C;  5IP9 K;  2NVT K;  1I6V A;  1TWG C;  3GTJ K;  4A93 C;  2CW0 A;  4A3F K;  3GTO C;  3H3V L;  2WAQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...