4A3GK

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4a3gK00
3HKZL 4KN4A 4BBSC 2BE5A 4C3HK 4BY1K 3I4MK 4A3EK 1TWCC 2NVQK 3H3VD 2E2IC 3HOXK 5M5WK 3K7AC 2NVYC 4A3KK 4A3IC 4A3GK 3EQLA 2R92C 1IW7A 4MEYA 2E2HC 4BY7K 2JA5K 3S14K 3S15C 3S1QC 4A3FC 4A3CK 3HOZK 3S2DK 5C4JK 4Y52K 4C3JK 1R9TC 5IYCC 5IYDC 3S1NC 4OIRA 3M3YC 3FKIC 3GTLK 1TWAC 5IP9K 3S1RC 4JK1A 4LK0A 4QIWD 2E2JC 2WAQL 4A3DC 4LK1A 1ZYRA 1I6HC 4Y7NK 4C2MK 5C44K 3HOWK 3GTPK 1TWHC 4BBRK 5M5YK 5IYBK 3CQZC 4A3JC 1Y1VK 4YG2A 2YU9K 3GTGK 4LJZA 3HOYC 1TWGC 4G7ZA 3GTKC 3GTJK 2NVXK 3S16K 3S1MC 5IP7C 4X6AK 1BDFA 3I4NC 2R7ZC 3RZDC 2JA6K 3HOUK 2B63K 2Y0SD 3HOVC 3PO3K 5D4DA 4OIPA 2R93K 1K83C 5FJ8K 2E2IK 1HQMA 3K7AK 1TWFK 2NVYK 2A68A 5TMFA 3H0GC 2WB1L 4MEXA 3S2HC 4A3BC 1YNJA 4A93K 4A3LK 3H3VL 5C4XC 4A3FK 1I50K 1SFOK 1R9TK 2Y0SL 2NVTK 3S1NK 3M3YK 3FKIK 1TWAK 2VUMK 1Y1WK 4C3IK 4A3EC 1I3QC 5FLMK 5M3FK 3S17C 3HOXC 2JA8K 4BXXK 4ZH4A 4A3MK 4A3KC 3PO2K 1WCMK 5M3MK 5C3EK 3M4OK 4G7OA 4YFXA 4A3GC 4QIWL 4XSXA 2JA5C 3GTQK 3RZOK 5TMCA 4A3JK 3HOZC 4A3CC 5C4JC 5M5XK 4OINA 4OIQA 3GTLC 4BBSK 5IP9C 3S1MK 5IP7K 2JA7C 3GTMC 2WB1D 1TWCK 3HKZD 3GTOC 3I4NK 4Y7NC 5C44C 3RZDK 4XLNA 4A3IK 3GTPC 2R92K 3HOVK 2PPBA 5IYBC 2E2HK 1Y1VC 1YNNA 2YU9C 3S15K 3S1QK 3H0GK 5IYCK 3S2HK 5IYDK 3GTJC 2NVXC 4OIOA 4QJVA 4KMUA 4X6AC 3S1RK 5C4XK 2A6HA 2E2JK 4BY1C 2O5IA 3I4MC 2NVQC 4NOIA 1SMYA 4A3DK 2JA6C 3HOUC 4Q5SA 2B63C 1I6HK 4AYBD 3PO3C 4GZYA 4KN7A 2R93C 1TWHK 1I3QK 2A6EA 4MQ9A 3S17K 1XPPA 2WAQD 4LLGA 4BY7C 1TWFC 3DXJA 3CQZK 3S14C 3HOYK 3S2DC 4XSZA 2PA8D 4Y52C 4YFNA 4A93C 3WODA 1TWGK 4XLPA 3GTKK 4A3LC 1I50C 1SFOC 2PMZD 4AYBL 2NVTC 2VUMC 1Y1WC 2R7ZK 4Q4ZA 3HOWC 2CW0A 4YFKA 5FLMC 4BXXC 2JA7K 4BBRC 2JA8C 1K83K 4A3MC 3GTMK 3GTOK 3PO2C 1WCMC 2PA8L 2A69A 5C3EC 3M4OC 3GTGC 2O5JA 3GTQC 4G7HA 3RZOC 4A3BK 1I6VA 3S16C 2PMZL 4QJVB
chains in the Genus database with same CATH superfamily
4KN4A 1RU0A 1YX2A 4BBSC 4C3HK 4BY1K 4A3EK 5IOSA 2GSUA 4A3KK 4A3IC 1IW7A 4LOWA 3L4JA 4A3CK 3GSIA 4C3JK 5IYCC 3M3YC 1ZQ1C 1IE0A 1ZYRA 4Y7NK 4C2MK 3HOWK 1TWHC 3BUEA 4ILDA 1V5VA 3SZYA 3GTKC 2NVXK 5CJ9A 3S1MC 3HXAA 3GEHA 3FOEA 2R7ZC 3RZDC 2NVYA 2Y0SD 2R93K 1JVIA 2E2IK 1HQMA 3K7AK 3ERED 3H0GC 4G0WA 1R9TA 2FQOA 1YNJA 1TWAA 4A3FK 1SFOK 3S1NK 2VUMK 1VGXA 5FLMK 3LAJA 4A3MK 4A3GC 3M4OK 1WQFA 2GSOA 3TTGA 4GTLA 1F7VA 3GIRA 2JA5C 3GTQK 3RZOK 3OEPA 5M5XK 4OIQA 3A8KA 2GSNA 4LQYA 1EFWA 5IP7K 3A8JA 2WB1D 4KB4A 4KMAA 5C44C 2R92K 2PPBA 5IYBC 1IBAA 2E2HK 1Y1VC 2YU9C 5IYDK 5C4XK 1O24A 2E2JK 1XXAA 4NOIA 4A3DK 3HOUC 4Q5SA 2V6SA 1I6HK 3GDZA 4AYBD 1O29A 4KN7A 4GZYA 1I3QK 4MQ9A 4BY7C 3GTKA 3DXJA 3S14C 3HOYK 3S2DC 4Y52C 3N0BA 2R7ZA 4A3LC 1INNA 4GTFA 4C3IC 4Q4ZA 4WJ4A 2XCOA 5HL8A 4YFKA 4BXXC 2JA7K 4GFQA 4BBRC 5C3EC 1F7UA 2NVXA 5TJ3A 1USOA 3FHZA 5TMFA 2WB1L 1JQWA 2R93A 3I4MK 2NVQK 2NVYC 2V6UA 1XZPA 4MEYA 4BLBA 3S15C 3S1QC 3HOZK 5EGHA 1R9TC 1TWAC 1XZQA 4JK1A 4QIWD 3T01A 3AQPA 1O27A 3GTQA 3TFIA 3CQZC 4A3JC 3GTGK 1BS2A 1J6WA 4G7ZA 3GTJK 1JOEA 1BDFA 1YCLA 3I4NC 2JA6K 3GEIA 2B63K 2R92A 2RH6A 3PO3K 1O2AA 2P8TA 2A68A 2XCRB 3S2HC 4A93K 3FKIA 1I50K 1L0WA 4BLAA 3M3YK 4C3HC 1Y1WK 1F9NA 4A3EC 4RMFA 5M3FK 3S17C 4A3KC 1WCMK 5M3MK 4G7OA 3AH5A 4YFXA 4KM8A 3A8IA 4QIWL 4DDQA 1G51A 1DCPA 4A3CC 4C3JC 4FZBA 1VRQC 2Y3PA 3OREA 3G4AA 3S1MK 1TWCK 4Y7NC 4C2MC 3RZDK 3GEEA 5JVOA 4XCHA 4GTEA 4C45A 3H0GK 2XCQA 1WQGA 2NVXC 4QJVA 3S1RK 2GAHC 4GT9A 3V4GA 1J98A 3CQZA 2R93C 2A6EA 2WAQD 1GE9A 4XSZA 1WOOA 1AB4A 4YFNA 2FQTA 1TWGK 3LPXA 1SFOC 3FOFA 3GTMA 1XXCA 3GTOA 2VUMC 3ADAC 2CW0A 3NUHA 5FLMC 1K83K 4A3MC 4KAWX 4P9SA 2PA8L 2A69A 3M4OC 2EBBA 1O26A 4M1XA 3GTQC 4G7HA 3GTJA 3RZOC 4A3BK 1I6VA 2PMZL 3S16C 1EI6A 3BP8C 2B63A 5CHPA 3H3VD 1F93A 3HOXK 2V6TA 5M5WK 1ZXOA 3EQLA 2R92C 2E2HC 4BY7K 3S14K 4GTCA 1I50A 3S2DK 2CFAB 5C4JK 4Y52K 5IYDC 4OIRA 3FKIC 3GTLK 5IP9K 2E2JC 2WAQL 2ZFZA 4A3DC 1I6HC 1WCMA 3GTPK 4BBRK 5M5YK 4GTDA 3T02A 3AD7C 3T00A 4J3NA 4YG2A 1WOPA 2W7VA 4KARA 3HOYC 4X6AK 4PAAA 4P5AA 2E2IA 3HOVC 5D4DA 4OIPA 1XZPB 4KMHA 1TWFK 2NVYK 1SFOA 2VUMA 3H3VL 1ZVUA 1XZQB 3JSTA 1R9TK 2NVTK 1KQ4A 1TWAK 3N3YA 2JA8K 2P5MA 4ZH4A 3PO2K 3LAPA 4LR2A 1VJEA 4G0VA 1TWGA 4XSXA 2JH3A 1O25A 5TMCA 4A3JK 3HOZC 1IQ0A 2PHCB 1VLOA 1O2BA 4KMDA 2GAGC 1B4BA 4BBSK 4AH6A 3GTMC 1IS1A 3HKZD 3GTOC 3I4NK 2E2HA 4XLNA 4A3IK 4P5BA 1J6VA 4GTBA 5IYCK 3S2HK 3GTJC 4OIOA 1XXBA 4KMUA 4BY1C 2O5IA 1EK8A 1DD5A 1O2FB 1I3QA 2JA6C 2B63C 3QX3A 3PO3C 3VA7A 2ZUEA 1TWHK 3S17K 3MMLB 2KWAA 2PA8D 3AD9C 4G0UA 4A93C 3GTLA 3WODA 4GTAA 3GTKK 1I50C 2PMZD 2JA7A 4PABA 4KDDA 2R7ZK 1Y1WC 3HOWC 3GTPA 3CAGA 1B4AA 1J6XA 3AD8C 1WCMC 3TFHA 4KM9A 4WILA 4QJVB 3HKZL 1WOSA 2D6FC 2BE5A 1TWCC 4BKWA 2E2IC 3K7AC 1TWFA 4A3GK 3Q3QA 5JFEA 2RGRA 2JA5K 4A3FC 4KC6A 3S0XA 3S1NC 1PJ6A 3S1RC 4LK0A 4LK1A 3IPJA 1WSVA 5C44K 3GTGA 5IYBK 5E68A 1Y1VK 3BP3A 2YU9K 4LJZA 1WSRA 1TWGC 2JA6A 3SZZA 3S16K 5IP7C 1ZBSA 3HOUK 1K83C 5FJ8K 4MEXA 1EH1A 1X31C 4A3BC 1PJ7A 1Y1WA 4A3LK 5C4XC 3N0CA 2Y0SL 3FKIK 4C3IK 1TWHA 1I3QC 4BXXK 4KASA 3HOXC 1DCHA 5C3EK 4KATA 1O28A 1WQHA 4KB2A 1DCOA 1USMA 5C4JC 4OINA 1TWCA 1BJTA 1ISEA 3GTLC 5IP9C 3AQOA 2CFAA 5IOTA 2JA7C 5EGEA 3L4KA 1VH2A 3H0GA 3GTPC 4FM9A 3HOVK 1C0AA 1YNNA 5IORA 3S15K 1IL2A 3S1QK 1UV7A 4O2DA 5IOQA 4X6AC 1EQRA 2A6HA 3I4MC 2NVQC 1SMYA 1PJ5A 3OPFA 2ZUFA 1XPPA 4LLGA 1TWFC 2JA5A 3CQZK 1HI9A 4WJ3M 4XLPA 3G4CA 3TFJA 4AYBL 1K83A 2NVTC 1WIHA 2JA8C 3GTMK 3GTOK 3PO2C 2O5JA 1Y1VA 2YU9A 3GTGC 5L46A 1WORA 1BGWA
chains in the Genus database with same CATH topology
3HKZL 4KN4A 4BBSC 2BE5A 4C3HK 4BY1K 3I4MK 4A3EK 1TWCC 2NVQK 3H3VD 2E2IC 3HOXK 5M5WK 3K7AC 2NVYC 4A3KK 4A3IC 4A3GK 3EQLA 2R92C 1IW7A 4MEYA 2E2HC 4BY7K 2JA5K 3S14K 3S15C 3S1QC 4A3FC 4A3CK 3HOZK 3S2DK 5C4JK 4Y52K 4C3JK 1R9TC 5IYCC 5IYDC 3S1NC 4OIRA 3M3YC 3FKIC 3GTLK 1TWAC 5IP9K 3S1RC 4JK1A 4LK0A 4QIWD 2E2JC 2WAQL 4A3DC 4LK1A 1ZYRA 1I6HC 4Y7NK 4C2MK 5C44K 3HOWK 3GTPK 1TWHC 4BBRK 5M5YK 5IYBK 3CQZC 4A3JC 1Y1VK 4YG2A 2YU9K 3GTGK 4LJZA 3HOYC 1TWGC 4G7ZA 3GTKC 3GTJK 2NVXK 3S16K 3S1MC 5IP7C 4X6AK 1BDFA 3I4NC 2R7ZC 3RZDC 2JA6K 3HOUK 2B63K 2Y0SD 3HOVC 3PO3K 5D4DA 4OIPA 2R93K 1K83C 5FJ8K 2E2IK 1HQMA 3K7AK 1TWFK 2NVYK 2A68A 5TMFA 3H0GC 2WB1L 4MEXA 3S2HC 4A3BC 1YNJA 4A93K 4A3LK 3H3VL 5C4XC 4A3FK 1I50K 1SFOK 1R9TK 2Y0SL 2NVTK 3S1NK 3M3YK 3FKIK 1TWAK 2VUMK 1Y1WK 4C3IK 4A3EC 1I3QC 5FLMK 5M3FK 3S17C 3HOXC 2JA8K 4BXXK 4ZH4A 4A3MK 4A3KC 3PO2K 1WCMK 5M3MK 5C3EK 3M4OK 4G7OA 4YFXA 4A3GC 4QIWL 4XSXA 2JA5C 3GTQK 3RZOK 5TMCA 4A3JK 3HOZC 4A3CC 5C4JC 5M5XK 4OINA 4OIQA 3GTLC 4BBSK 5IP9C 3S1MK 5IP7K 2JA7C 3GTMC 2WB1D 1TWCK 3HKZD 3GTOC 3I4NK 4Y7NC 5C44C 3RZDK 4XLNA 4A3IK 3GTPC 2R92K 3HOVK 2PPBA 5IYBC 2E2HK 1Y1VC 1YNNA 2YU9C 3S15K 3S1QK 3H0GK 5IYCK 3S2HK 5IYDK 3GTJC 2NVXC 4OIOA 4QJVA 4KMUA 4X6AC 3S1RK 5C4XK 2A6HA 2E2JK 4BY1C 2O5IA 3I4MC 2NVQC 4NOIA 1SMYA 4A3DK 2JA6C 3HOUC 4Q5SA 2B63C 1I6HK 4AYBD 3PO3C 4GZYA 4KN7A 2R93C 1TWHK 1I3QK 2A6EA 4MQ9A 3S17K 1XPPA 2WAQD 4LLGA 4BY7C 1TWFC 3DXJA 3CQZK 3S14C 3HOYK 3S2DC 4XSZA 2PA8D 4Y52C 4YFNA 4A93C 3WODA 1TWGK 4XLPA 3GTKK 4A3LC 1I50C 1SFOC 2PMZD 4AYBL 2NVTC 2VUMC 1Y1WC 2R7ZK 4Q4ZA 3HOWC 2CW0A 4YFKA 5FLMC 4BXXC 2JA7K 4BBRC 2JA8C 1K83K 4A3MC 3GTMK 3GTOK 3PO2C 1WCMC 2PA8L 2A69A 5C3EC 3M4OC 3GTGC 2O5JA 3GTQC 4G7HA 3RZOC 4A3BK 1I6VA 3S16C 2PMZL 4QJVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ L;  4KN4 A;  4BBS C;  2BE5 A;  4C3H K;  4BY1 K;  3I4M K;  4A3E K;  1TWC C;  2NVQ K;  3H3V D;  2E2I C;  3HOX K;  5M5W K;  3K7A C;  2NVY C;  4A3K K;  4A3I C;  4A3G K;  3EQL A;  2R92 C;  1IW7 A;  4MEY A;  2E2H C;  4BY7 K;  2JA5 K;  3S14 K;  3S15 C;  3S1Q C;  4A3F C;  4A3C K;  3HOZ K;  3S2D K;  5C4J K;  4Y52 K;  4C3J K;  1R9T C;  5IYC C;  5IYD C;  3S1N C;  4OIR A;  3M3Y C;  3FKI C;  3GTL K;  1TWA C;  5IP9 K;  3S1R C;  4JK1 A;  4LK0 A;  4QIW D;  2E2J C;  2WAQ L;  4A3D C;  4LK1 A;  1ZYR A;  1I6H C;  4Y7N K;  4C2M K;  5C44 K;  3HOW K;  3GTP K;  1TWH C;  4BBR K;  5M5Y K;  5IYB K;  3CQZ C;  4A3J C;  1Y1V K;  4YG2 A;  2YU9 K;  3GTG K;  4LJZ A;  3HOY C;  1TWG C;  4G7Z A;  3GTK C;  3GTJ K;  2NVX K;  3S16 K;  3S1M C;  5IP7 C;  4X6A K;  1BDF A;  3I4N C;  2R7Z C;  3RZD C;  2JA6 K;  3HOU K;  2B63 K;  2Y0S D;  3HOV C;  3PO3 K;  5D4D A;  4OIP A;  2R93 K;  1K83 C;  5FJ8 K;  2E2I K;  1HQM A;  3K7A K;  1TWF K;  2NVY K;  2A68 A;  5TMF A;  3H0G C;  2WB1 L;  4MEX A;  3S2H C;  4A3B C;  1YNJ A;  4A93 K;  4A3L K;  3H3V L;  5C4X C;  4A3F K;  1I50 K;  1SFO K;  1R9T K;  2Y0S L;  2NVT K;  3S1N K;  3M3Y K;  3FKI K;  1TWA K;  2VUM K;  1Y1W K;  4C3I K;  4A3E C;  1I3Q C;  5FLM K;  5M3F K;  3S17 C;  3HOX C;  2JA8 K;  4BXX K;  4ZH4 A;  4A3M K;  4A3K C;  3PO2 K;  1WCM K;  5M3M K;  5C3E K;  3M4O K;  4G7O A;  4YFX A;  4A3G C;  4QIW L;  4XSX A;  2JA5 C;  3GTQ K;  3RZO K;  5TMC A;  4A3J K;  3HOZ C;  4A3C C;  5C4J C;  5M5X K;  4OIN A;  4OIQ A;  3GTL C;  4BBS K;  5IP9 C;  3S1M K;  5IP7 K;  2JA7 C;  3GTM C;  2WB1 D;  1TWC K;  3HKZ D;  3GTO C;  3I4N K;  4Y7N C;  5C44 C;  3RZD K;  4XLN A;  4A3I K;  3GTP C;  2R92 K;  3HOV K;  2PPB A;  5IYB C;  2E2H K;  1Y1V C;  1YNN A;  2YU9 C;  3S15 K;  3S1Q K;  3H0G K;  5IYC K;  3S2H K;  5IYD K;  3GTJ C;  2NVX C;  4OIO A;  4QJV A;  4KMU A;  4X6A C;  3S1R K;  5C4X K;  2A6H A;  2E2J K;  4BY1 C;  2O5I A;  3I4M C;  2NVQ C;  4NOI A;  1SMY A;  4A3D K;  2JA6 C;  3HOU C;  4Q5S A;  2B63 C;  1I6H K;  4AYB D;  3PO3 C;  4GZY A;  4KN7 A;  2R93 C;  1TWH K;  1I3Q K;  2A6E A;  4MQ9 A;  3S17 K;  1XPP A;  2WAQ D;  4LLG A;  4BY7 C;  1TWF C;  3DXJ A;  3CQZ K;  3S14 C;  3HOY K;  3S2D C;  4XSZ A;  2PA8 D;  4Y52 C;  4YFN A;  4A93 C;  3WOD A;  1TWG K;  4XLP A;  3GTK K;  4A3L C;  1I50 C;  1SFO C;  2PMZ D;  4AYB L;  2NVT C;  2VUM C;  1Y1W C;  2R7Z K;  4Q4Z A;  3HOW C;  2CW0 A;  4YFK A;  5FLM C;  4BXX C;  2JA7 K;  4BBR C;  2JA8 C;  1K83 K;  4A3M C;  3GTM K;  3GTO K;  3PO2 C;  1WCM C;  2PA8 L;  2A69 A;  5C3E C;  3M4O C;  3GTG C;  2O5J A;  3GTQ C;  4G7H A;  3RZO C;  4A3B K;  1I6V A;  3S16 C;  2PMZ L;  4QJV B; 
#chains in the Genus database with same CATH topology
 4KN4 A;  1RU0 A;  1YX2 A;  4BBS C;  4C3H K;  4BY1 K;  4A3E K;  5IOS A;  2GSU A;  4A3K K;  4A3I C;  1IW7 A;  4LOW A;  3L4J A;  4A3C K;  3GSI A;  4C3J K;  5IYC C;  3M3Y C;  1ZQ1 C;  1IE0 A;  1ZYR A;  4Y7N K;  4C2M K;  3HOW K;  1TWH C;  3BUE A;  4ILD A;  1V5V A;  3SZY A;  3GTK C;  2NVX K;  5CJ9 A;  3S1M C;  3HXA A;  3GEH A;  3FOE A;  2R7Z C;  3RZD C;  2NVY A;  2Y0S D;  2R93 K;  1JVI A;  2E2I K;  1HQM A;  3K7A K;  3ERE D;  3H0G C;  4G0W A;  1R9T A;  2FQO A;  1YNJ A;  1TWA A;  4A3F K;  1SFO K;  3S1N K;  2VUM K;  1VGX A;  5FLM K;  3LAJ A;  4A3M K;  4A3G C;  3M4O K;  1WQF A;  2GSO A;  3TTG A;  4GTL A;  1F7V A;  3GIR A;  2JA5 C;  3GTQ K;  3RZO K;  3OEP A;  5M5X K;  4OIQ A;  3A8K A;  2GSN A;  4LQY A;  1EFW A;  5IP7 K;  3A8J A;  2WB1 D;  4KB4 A;  4KMA A;  5C44 C;  2R92 K;  2PPB A;  5IYB C;  1IBA A;  2E2H K;  1Y1V C;  2YU9 C;  5IYD K;  5C4X K;  1O24 A;  2E2J K;  1XXA A;  4NOI A;  4A3D K;  3HOU C;  4Q5S A;  2V6S A;  1I6H K;  3GDZ A;  4AYB D;  1O29 A;  4KN7 A;  4GZY A;  1I3Q K;  4MQ9 A;  4BY7 C;  3GTK A;  3DXJ A;  3S14 C;  3HOY K;  3S2D C;  4Y52 C;  3N0B A;  2R7Z A;  4A3L C;  1INN A;  4GTF A;  4C3I C;  4Q4Z A;  4WJ4 A;  2XCO A;  5HL8 A;  4YFK A;  4BXX C;  2JA7 K;  4GFQ A;  4BBR C;  5C3E C;  1F7U A;  2NVX A;  5TJ3 A;  1USO A;  3FHZ A;  5TMF A;  2WB1 L;  1JQW A;  2R93 A;  3I4M K;  2NVQ K;  2NVY C;  2V6U A;  1XZP A;  4MEY A;  4BLB A;  3S15 C;  3S1Q C;  3HOZ K;  5EGH A;  1R9T C;  1TWA C;  1XZQ A;  4JK1 A;  4QIW D;  3T01 A;  3AQP A;  1O27 A;  3GTQ A;  3TFI A;  3CQZ C;  4A3J C;  3GTG K;  1BS2 A;  1J6W A;  4G7Z A;  3GTJ K;  1JOE A;  1BDF A;  1YCL A;  3I4N C;  2JA6 K;  3GEI A;  2B63 K;  2R92 A;  2RH6 A;  3PO3 K;  1O2A A;  2P8T A;  2A68 A;  2XCR B;  3S2H C;  4A93 K;  3FKI A;  1I50 K;  1L0W A;  4BLA A;  3M3Y K;  4C3H C;  1Y1W K;  1F9N A;  4A3E C;  4RMF A;  5M3F K;  3S17 C;  4A3K C;  1WCM K;  5M3M K;  4G7O A;  3AH5 A;  4YFX A;  4KM8 A;  3A8I A;  4QIW L;  4DDQ A;  1G51 A;  1DCP A;  4A3C C;  4C3J C;  4FZB A;  1VRQ C;  2Y3P A;  3ORE A;  3G4A A;  3S1M K;  1TWC K;  4Y7N C;  4C2M C;  3RZD K;  3GEE A;  5JVO A;  4XCH A;  4GTE A;  4C45 A;  3H0G K;  2XCQ A;  1WQG A;  2NVX C;  4QJV A;  3S1R K;  2GAH C;  4GT9 A;  3V4G A;  1J98 A;  3CQZ A;  2R93 C;  2A6E A;  2WAQ D;  1GE9 A;  4XSZ A;  1WOO A;  1AB4 A;  4YFN A;  2FQT A;  1TWG K;  3LPX A;  1SFO C;  3FOF A;  3GTM A;  1XXC A;  3GTO A;  2VUM C;  3ADA C;  2CW0 A;  3NUH A;  5FLM C;  1K83 K;  4A3M C;  4KAW X;  4P9S A;  2PA8 L;  2A69 A;  3M4O C;  2EBB A;  1O26 A;  4M1X A;  3GTQ C;  4G7H A;  3GTJ A;  3RZO C;  4A3B K;  1I6V A;  2PMZ L;  3S16 C;  1EI6 A;  3BP8 C;  2B63 A;  5CHP A;  3H3V D;  1F93 A;  3HOX K;  2V6T A;  5M5W K;  1ZXO A;  3EQL A;  2R92 C;  2E2H C;  4BY7 K;  3S14 K;  4GTC A;  1I50 A;  3S2D K;  2CFA B;  5C4J K;  4Y52 K;  5IYD C;  4OIR A;  3FKI C;  3GTL K;  5IP9 K;  2E2J C;  2WAQ L;  2ZFZ A;  4A3D C;  1I6H C;  1WCM A;  3GTP K;  4BBR K;  5M5Y K;  4GTD A;  3T02 A;  3AD7 C;  3T00 A;  4J3N A;  4YG2 A;  1WOP A;  2W7V A;  4KAR A;  3HOY C;  4X6A K;  4PAA A;  4P5A A;  2E2I A;  3HOV C;  5D4D A;  4OIP A;  1XZP B;  4KMH A;  1TWF K;  2NVY K;  1SFO A;  2VUM A;  3H3V L;  1ZVU A;  1XZQ B;  3JST A;  1R9T K;  2NVT K;  1KQ4 A;  1TWA K;  3N3Y A;  2JA8 K;  2P5M A;  4ZH4 A;  3PO2 K;  3LAP A;  4LR2 A;  1VJE A;  4G0V A;  1TWG A;  4XSX A;  2JH3 A;  1O25 A;  5TMC A;  4A3J K;  3HOZ C;  1IQ0 A;  2PHC B;  1VLO A;  1O2B A;  4KMD A;  2GAG C;  1B4B A;  4BBS K;  4AH6 A;  3GTM C;  1IS1 A;  3HKZ D;  3GTO C;  3I4N K;  2E2H A;  4XLN A;  4A3I K;  4P5B A;  1J6V A;  4GTB A;  5IYC K;  3S2H K;  3GTJ C;  4OIO A;  1XXB A;  4KMU A;  4BY1 C;  2O5I A;  1EK8 A;  1DD5 A;  1O2F B;  1I3Q A;  2JA6 C;  2B63 C;  3QX3 A;  3PO3 C;  3VA7 A;  2ZUE A;  1TWH K;  3S17 K;  3MML B;  2KWA A;  2PA8 D;  3AD9 C;  4G0U A;  4A93 C;  3GTL A;  3WOD A;  4GTA A;  3GTK K;  1I50 C;  2PMZ D;  2JA7 A;  4PAB A;  4KDD A;  2R7Z K;  1Y1W C;  3HOW C;  3GTP A;  3CAG A;  1B4A A;  1J6X A;  3AD8 C;  1WCM C;  3TFH A;  4KM9 A;  4WIL A;  4QJV B;  3HKZ L;  1WOS A;  2D6F C;  2BE5 A;  1TWC C;  4BKW A;  2E2I C;  3K7A C;  1TWF A;  4A3G K;  3Q3Q A;  5JFE A;  2RGR A;  2JA5 K;  4A3F C;  4KC6 A;  3S0X A;  3S1N C;  1PJ6 A;  3S1R C;  4LK0 A;  4LK1 A;  3IPJ A;  1WSV A;  5C44 K;  3GTG A;  5IYB K;  5E68 A;  1Y1V K;  3BP3 A;  2YU9 K;  4LJZ A;  1WSR A;  1TWG C;  2JA6 A;  3SZZ A;  3S16 K;  5IP7 C;  1ZBS A;  3HOU K;  1K83 C;  5FJ8 K;  4MEX A;  1EH1 A;  1X31 C;  4A3B C;  1PJ7 A;  1Y1W A;  4A3L K;  5C4X C;  3N0C A;  2Y0S L;  3FKI K;  4C3I K;  1TWH A;  1I3Q C;  4BXX K;  4KAS A;  3HOX C;  1DCH A;  5C3E K;  4KAT A;  1O28 A;  1WQH A;  4KB2 A;  1DCO A;  1USM A;  5C4J C;  4OIN A;  1TWC A;  1BJT A;  1ISE A;  3GTL C;  5IP9 C;  3AQO A;  2CFA A;  5IOT A;  2JA7 C;  5EGE A;  3L4K A;  1VH2 A;  3H0G A;  3GTP C;  4FM9 A;  3HOV K;  1C0A A;  1YNN A;  5IOR A;  3S15 K;  1IL2 A;  3S1Q K;  1UV7 A;  4O2D A;  5IOQ A;  4X6A C;  1EQR A;  2A6H A;  3I4M C;  2NVQ C;  1SMY A;  1PJ5 A;  3OPF A;  2ZUF A;  1XPP A;  4LLG A;  1TWF C;  2JA5 A;  3CQZ K;  1HI9 A;  4WJ3 M;  4XLP A;  3G4C A;  3TFJ A;  4AYB L;  1K83 A;  2NVT C;  1WIH A;  2JA8 C;  3GTM K;  3GTO K;  3PO2 C;  2O5J A;  1Y1V A;  2YU9 A;  3GTG C;  5L46 A;  1WOR A;  1BGW A; 
#chains in the Genus database with same CATH homology
 3HKZ L;  4KN4 A;  4BBS C;  2BE5 A;  4C3H K;  4BY1 K;  3I4M K;  4A3E K;  1TWC C;  2NVQ K;  3H3V D;  2E2I C;  3HOX K;  5M5W K;  3K7A C;  2NVY C;  4A3K K;  4A3I C;  4A3G K;  3EQL A;  2R92 C;  1IW7 A;  4MEY A;  2E2H C;  4BY7 K;  2JA5 K;  3S14 K;  3S15 C;  3S1Q C;  4A3F C;  4A3C K;  3HOZ K;  3S2D K;  5C4J K;  4Y52 K;  4C3J K;  1R9T C;  5IYC C;  5IYD C;  3S1N C;  4OIR A;  3M3Y C;  3FKI C;  3GTL K;  1TWA C;  5IP9 K;  3S1R C;  4JK1 A;  4LK0 A;  4QIW D;  2E2J C;  2WAQ L;  4A3D C;  4LK1 A;  1ZYR A;  1I6H C;  4Y7N K;  4C2M K;  5C44 K;  3HOW K;  3GTP K;  1TWH C;  4BBR K;  5M5Y K;  5IYB K;  3CQZ C;  4A3J C;  1Y1V K;  4YG2 A;  2YU9 K;  3GTG K;  4LJZ A;  3HOY C;  1TWG C;  4G7Z A;  3GTK C;  3GTJ K;  2NVX K;  3S16 K;  3S1M C;  5IP7 C;  4X6A K;  1BDF A;  3I4N C;  2R7Z C;  3RZD C;  2JA6 K;  3HOU K;  2B63 K;  2Y0S D;  3HOV C;  3PO3 K;  5D4D A;  4OIP A;  2R93 K;  1K83 C;  5FJ8 K;  2E2I K;  1HQM A;  3K7A K;  1TWF K;  2NVY K;  2A68 A;  5TMF A;  3H0G C;  2WB1 L;  4MEX A;  3S2H C;  4A3B C;  1YNJ A;  4A93 K;  4A3L K;  3H3V L;  5C4X C;  4A3F K;  1I50 K;  1SFO K;  1R9T K;  2Y0S L;  2NVT K;  3S1N K;  3M3Y K;  3FKI K;  1TWA K;  2VUM K;  1Y1W K;  4C3I K;  4A3E C;  1I3Q C;  5FLM K;  5M3F K;  3S17 C;  3HOX C;  2JA8 K;  4BXX K;  4ZH4 A;  4A3M K;  4A3K C;  3PO2 K;  1WCM K;  5M3M K;  5C3E K;  3M4O K;  4G7O A;  4YFX A;  4A3G C;  4QIW L;  4XSX A;  2JA5 C;  3GTQ K;  3RZO K;  5TMC A;  4A3J K;  3HOZ C;  4A3C C;  5C4J C;  5M5X K;  4OIN A;  4OIQ A;  3GTL C;  4BBS K;  5IP9 C;  3S1M K;  5IP7 K;  2JA7 C;  3GTM C;  2WB1 D;  1TWC K;  3HKZ D;  3GTO C;  3I4N K;  4Y7N C;  5C44 C;  3RZD K;  4XLN A;  4A3I K;  3GTP C;  2R92 K;  3HOV K;  2PPB A;  5IYB C;  2E2H K;  1Y1V C;  1YNN A;  2YU9 C;  3S15 K;  3S1Q K;  3H0G K;  5IYC K;  3S2H K;  5IYD K;  3GTJ C;  2NVX C;  4OIO A;  4QJV A;  4KMU A;  4X6A C;  3S1R K;  5C4X K;  2A6H A;  2E2J K;  4BY1 C;  2O5I A;  3I4M C;  2NVQ C;  4NOI A;  1SMY A;  4A3D K;  2JA6 C;  3HOU C;  4Q5S A;  2B63 C;  1I6H K;  4AYB D;  3PO3 C;  4GZY A;  4KN7 A;  2R93 C;  1TWH K;  1I3Q K;  2A6E A;  4MQ9 A;  3S17 K;  1XPP A;  2WAQ D;  4LLG A;  4BY7 C;  1TWF C;  3DXJ A;  3CQZ K;  3S14 C;  3HOY K;  3S2D C;  4XSZ A;  2PA8 D;  4Y52 C;  4YFN A;  4A93 C;  3WOD A;  1TWG K;  4XLP A;  3GTK K;  4A3L C;  1I50 C;  1SFO C;  2PMZ D;  4AYB L;  2NVT C;  2VUM C;  1Y1W C;  2R7Z K;  4Q4Z A;  3HOW C;  2CW0 A;  4YFK A;  5FLM C;  4BXX C;  2JA7 K;  4BBR C;  2JA8 C;  1K83 K;  4A3M C;  3GTM K;  3GTO K;  3PO2 C;  1WCM C;  2PA8 L;  2A69 A;  5C3E C;  3M4O C;  3GTG C;  2O5J A;  3GTQ C;  4G7H A;  3RZO C;  4A3B K;  1I6V A;  3S16 C;  2PMZ L;  4QJV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...