1F93A

Crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
molecule keywords DIMERIZATION COFACTOR OF HEPATOCYTE NUCLEAR FACTOR 1-ALPHA
total genus 32
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1f93A00
1DCPA 1F93A 3JSTA 4C45A 1USMA 1USOA 4LOWA 1RU0A 2V6UA 2EBBA 2V6SA 3HXAA 2V6TA 4WILA 1DCHA 1DCOA
chains in the Genus database with same CATH superfamily
2WB1L 1DCPA 3RZOC 2Y0SL 4M1XA 4A3DC 3AQOA 3H0GC 1WORA 4A3EK 3HOWK 3RZDC 2E2IC 1BJTA 1PJ7A 5TJ3A 2WB1D 1WCMK 1O28A 1EI6A 4MEYA 3T00A 4P5AA 4A3MC 2Y0SD 4C3JC 3S17C 2B63A 2VUMC 4A3JK 1SFOC 4KDDA 3AD8C 2PPBA 3I4NK 3S2HC 2O5JA 4O2DA 1XZQB 4KM9A 1Y1WA 1WSVA 4P9SA 1TWHA 3GTLC 3CQZA 3GTOC 1WQFA 2WAQL 4BLBA 2R93C 4A3IK 4RMFA 1TWAA 3GSIA 5IP7C 2JA7A 4A3KK 1BS2A 2NVXK 3GTMC 2EBBA 5M3MK 4BXXK 2R7ZC 3AD9C 4KAWX 4XSZA 3GDZA 1EFWA 4NOIA 5TMFA 3HXAA 2XCRB 1I6HK 5C4XC 3PO3C 1F9NA 4A3BC 4JK1A 2P5MA 2GAGC 1I3QC 4C45A 3GEEA 2PMZL 3S14C 1PJ5A 1IQ0A 3A8KA 3HOZC 4KMHA 3A8JA 1RU0A 3S1MC 3FOFA 1J6XA 3GTGC 2VUMA 1JOEA 1TWFA 3IPJA 2JA6C 1JVIA 1EK8A 1HQMA 3T02A 1Y1VK 1IL2A 4A3FC 3HOUC 2B63K 4YFKA 1DCOA 2A6EA 4QJVB 4KASA 1R9TC 3VA7A 4LR2A 2A68A 3GTPK 3GTQC 4G7HA 3S16K 5HL8A 2A6HA 3N0BA 5IYCC 4BY7K 2CFAB 4A93K 1VH2A 2PA8L 4X6AC 1TWGC 3AQPA 4LK1A 1K83K 1XPPA 1WQGA 4QIWL 3GTPC 1O27A 3SZZA 2V6TA 1O2BA 2PA8D 1TWHK 3S2DK 3M3YC 1WOOA 1I6VA 4KMDA 4C3HK 3PO2C 3FOEA 2JA5K 1ZBSA 2GSUA 1B4BA 3N3YA 4A3FK 1SFOA 2GSOA 2KWAA 2NVTC 3GTGK 1Y1WC 1WQHA 4GTEA 4Y7NC 1BGWA 3GTOA 2GSNA 3K7AK 3GTJC 1WOPA 1C0AA 2R93A 4Y52K 1ZVUA 4LLGA 3K7AC 3GTJK 1EH1A 4XLPA 3CAGA 3HOXK 1Y1WK 1I3QK 1L0WA 5FJ8K 2PMZD 4GTBA 4C2MK 3S1QC 4Q5SA 3GEHA 5IOTA 1ZXOA 5C4XK 5M5WK 5JFEA 2JA5C 1BDFA 4C3HC 3PO2K 2NVYA 5IYDK 3GTQA 3BP8C 3S2DC 4A3CC 5FLMC 4A3CK 4GFQA 4BXXC 3GIRA 3GTMK 1WCMA 4C3IK 5IP7K 1K83C 1TWGA 1ZQ1C 5IYCK 4BY7C 2JA7K 1PJ6A 4MQ9A 1KQ4A 3L4KA 3MMLB 3S16C 3S15C 3OEPA 3S2HK 2V6UA 4KN4A 4BBRC 5EGHA 4ILDA 4KN7A 4Y7NK 3BUEA 1ISEA 1YNJA 3N0CA 3Q3QA 2NVTK 1V5VA 4C3JK 1ZYRA 1G51A 1XZPA 3M3YK 3S1MK 2YU9A 3GTKA 1TWHC 1I50A 3H0GK 4BBRK 3S15K 3TFHA 4AYBD 4GZYA 2Y3PA 4LK0A 3RZOK 1TWCA 1TWGK 4X6AK 4OIPA 1VGXA 1WOSA 2R92C 1XXBA 2JA7C 3JSTA 5L46A 3M4OK 1I50K 4LQYA 2E2IA 3WODA 5TMCA 3GTQK 4C3IC 4FZBA 4PABA 1R9TK 4OIOA 5FLMK 1WIHA 4KMUA 1AB4A 1XXCA 2B63C 5IYDC 4QIWD 1YCLA 5M3FK 3FKIC 1Y1VC 4J3NA 4YFXA 1F93A 2JA6K 4C2MC 3S1QK 5EGEA 3HOXC 3G4AA 4KB4A 2JH3A 4Y52C 2FQOA 3HOZK 3I4NC 4ZH4A 3LAPA 4AYBL 1F7UA 4KC6A 1WCMC 4KARA 3RZDK 2E2IK 1DCHA 4XCHA 2XCQA 3S0XA 3FHZA 4A3DK 1I3QA 5CJ9A 1DD5A 1O26A 4PAAA 4WILA 3AD7C 1TWCK 2R7ZA 4A3IC 5CHPA 4A93C 3GTPA 3QX3A 1GE9A 3GTOK 4GT9A 4OIQA 1O25A 1XZPB 4KB2A 1SMYA 4KMAA 1VLOA 4Q4ZA 2NVQC 3HOVC 5IOQA 1O24A 1O2FB 4WJ3M 1SFOK 4A3LC 3HOUK 4BY1C 3S17K 2YU9C 3HKZL 5C3EC 3HOYC 3GTLA 4G7ZA 3AH5A 3A8IA 3V4GA 4GTCA 1O29A 1WSRA 4DDQA 2GAHC 3TFJA 1TWAC 2CFAA 5D4DA 3S1RC 2BE5A 4XSXA 2E2JC 3DXJA 3S14K 1IS1A 1R9TA 2NVYC 4QJVA 2WAQD 1O2AA 4A3BK 5C4JK 3PO3K 1I6HC 2E2HC 5E68A 2XCOA 1J6VA 1Y1VA 4LJZA 1K83A 4G0UA 1TWAK 2R7ZK 3H3VD 2NVXC 3OREA 4A3KC 2V6SA 4BLAA 4A3GC 3H0GA 3GTJA 3L4JA 1X31C 2R93K 5C3EK 1IW7A 3TTGA 2ZFZA 2JA6A 3S1NK 4AH6A 3GTLK 5IP9K 4GTDA 5IORA 1J6WA 2JA8C 4LOWA 5IP9C 4YG2A 3S1NC 1YNNA 2JA5A 4A3JC 2VUMK 5C44K 4A3MK 5M5YK 3GTKC 4A3GK 2RGRA 3I4MC 4WJ4A 2A69A 4A3EC 3HOWC 3GEIA 3EQLA 3T01A 3I4MK 3HKZD 4XLNA 4KM8A 1B4AA 3GTKK 2E2HA 1XZQA 1HI9A 1IBAA 2RH6A 5C44C 3SZYA 2FQTA 2PHCB 1VJEA 2JA8K 4BBSK 2NVXA 4BKWA 2E2JK 1EQRA 3G4CA 3FKIA 3S1RK 5IYBC 4P5BA 4FM9A 1TWFK 4MEXA 4G0WA 5JVOA 2ZUEA 4OINA 4OIRA 2W7VA 2CW0A 3CQZK 1JQWA 1YX2A 1USMA 1INNA 3CQZC 2D6FC 4G0VA 3NUHA 3FKIK 4GTLA 2YU9K 2ZUFA 3HOYK 4BY1K 3BP3A 3GTGA 1IE0A 4A3LK 1TWFC 1F7VA 4G7OA 5M5XK 5IYBK 3H3VL 3TFIA 4KATA 3ERED 2O5IA 2R92A 4GTAA 4GTFA 3HOVK 3GTMA 4BBSC 2NVQK 2E2HK 3LPXA 5C4JC 1I50C 1XXAA 3M4OC 4YFNA 1J98A 3ADAC 2NVYK 2R92K 2P8TA 3LAJA 1USOA 1TWCC 1UV7A 3OPFA 1VRQC 5IOSA
chains in the Genus database with same CATH topology
1DCPA 1F93A 3JSTA 4C45A 1USMA 1USOA 4LOWA 1RU0A 2V6UA 2EBBA 2V6SA 3HXAA 2V6TA 4WILA 1DCHA 1DCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  1F93 A;  3JST A;  4C45 A;  1USM A;  1USO A;  4LOW A;  1RU0 A;  2V6U A;  2EBB A;  2V6S A;  3HXA A;  2V6T A;  4WIL A;  1DCH A;  1DCO A; 
#chains in the Genus database with same CATH topology
 2WB1 L;  1DCP A;  3RZO C;  2Y0S L;  4M1X A;  4A3D C;  3AQO A;  3H0G C;  1WOR A;  4A3E K;  3HOW K;  3RZD C;  2E2I C;  1BJT A;  1PJ7 A;  5TJ3 A;  2WB1 D;  1WCM K;  1O28 A;  1EI6 A;  4MEY A;  3T00 A;  4P5A A;  4A3M C;  2Y0S D;  4C3J C;  3S17 C;  2B63 A;  2VUM C;  4A3J K;  1SFO C;  4KDD A;  3AD8 C;  2PPB A;  3I4N K;  3S2H C;  2O5J A;  4O2D A;  1XZQ B;  4KM9 A;  1Y1W A;  1WSV A;  4P9S A;  1TWH A;  3GTL C;  3CQZ A;  3GTO C;  1WQF A;  2WAQ L;  4BLB A;  2R93 C;  4A3I K;  4RMF A;  1TWA A;  3GSI A;  5IP7 C;  2JA7 A;  4A3K K;  1BS2 A;  2NVX K;  3GTM C;  2EBB A;  5M3M K;  4BXX K;  2R7Z C;  3AD9 C;  4KAW X;  4XSZ A;  3GDZ A;  1EFW A;  4NOI A;  5TMF A;  3HXA A;  2XCR B;  1I6H K;  5C4X C;  3PO3 C;  1F9N A;  4A3B C;  4JK1 A;  2P5M A;  2GAG C;  1I3Q C;  4C45 A;  3GEE A;  2PMZ L;  3S14 C;  1PJ5 A;  1IQ0 A;  3A8K A;  3HOZ C;  4KMH A;  3A8J A;  1RU0 A;  3S1M C;  3FOF A;  1J6X A;  3GTG C;  2VUM A;  1JOE A;  1TWF A;  3IPJ A;  2JA6 C;  1JVI A;  1EK8 A;  1HQM A;  3T02 A;  1Y1V K;  1IL2 A;  4A3F C;  3HOU C;  2B63 K;  4YFK A;  1DCO A;  2A6E A;  4QJV B;  4KAS A;  1R9T C;  3VA7 A;  4LR2 A;  2A68 A;  3GTP K;  3GTQ C;  4G7H A;  3S16 K;  5HL8 A;  2A6H A;  3N0B A;  5IYC C;  4BY7 K;  2CFA B;  4A93 K;  1VH2 A;  2PA8 L;  4X6A C;  1TWG C;  3AQP A;  4LK1 A;  1K83 K;  1XPP A;  1WQG A;  4QIW L;  3GTP C;  1O27 A;  3SZZ A;  2V6T A;  1O2B A;  2PA8 D;  1TWH K;  3S2D K;  3M3Y C;  1WOO A;  1I6V A;  4KMD A;  4C3H K;  3PO2 C;  3FOE A;  2JA5 K;  1ZBS A;  2GSU A;  1B4B A;  3N3Y A;  4A3F K;  1SFO A;  2GSO A;  2KWA A;  2NVT C;  3GTG K;  1Y1W C;  1WQH A;  4GTE A;  4Y7N C;  1BGW A;  3GTO A;  2GSN A;  3K7A K;  3GTJ C;  1WOP A;  1C0A A;  2R93 A;  4Y52 K;  1ZVU A;  4LLG A;  3K7A C;  3GTJ K;  1EH1 A;  4XLP A;  3CAG A;  3HOX K;  1Y1W K;  1I3Q K;  1L0W A;  5FJ8 K;  2PMZ D;  4GTB A;  4C2M K;  3S1Q C;  4Q5S A;  3GEH A;  5IOT A;  1ZXO A;  5C4X K;  5M5W K;  5JFE A;  2JA5 C;  1BDF A;  4C3H C;  3PO2 K;  2NVY A;  5IYD K;  3GTQ A;  3BP8 C;  3S2D C;  4A3C C;  5FLM C;  4A3C K;  4GFQ A;  4BXX C;  3GIR A;  3GTM K;  1WCM A;  4C3I K;  5IP7 K;  1K83 C;  1TWG A;  1ZQ1 C;  5IYC K;  4BY7 C;  2JA7 K;  1PJ6 A;  4MQ9 A;  1KQ4 A;  3L4K A;  3MML B;  3S16 C;  3S15 C;  3OEP A;  3S2H K;  2V6U A;  4KN4 A;  4BBR C;  5EGH A;  4ILD A;  4KN7 A;  4Y7N K;  3BUE A;  1ISE A;  1YNJ A;  3N0C A;  3Q3Q A;  2NVT K;  1V5V A;  4C3J K;  1ZYR A;  1G51 A;  1XZP A;  3M3Y K;  3S1M K;  2YU9 A;  3GTK A;  1TWH C;  1I50 A;  3H0G K;  4BBR K;  3S15 K;  3TFH A;  4AYB D;  4GZY A;  2Y3P A;  4LK0 A;  3RZO K;  1TWC A;  1TWG K;  4X6A K;  4OIP A;  1VGX A;  1WOS A;  2R92 C;  1XXB A;  2JA7 C;  3JST A;  5L46 A;  3M4O K;  1I50 K;  4LQY A;  2E2I A;  3WOD A;  5TMC A;  3GTQ K;  4C3I C;  4FZB A;  4PAB A;  1R9T K;  4OIO A;  5FLM K;  1WIH A;  4KMU A;  1AB4 A;  1XXC A;  2B63 C;  5IYD C;  4QIW D;  1YCL A;  5M3F K;  3FKI C;  1Y1V C;  4J3N A;  4YFX A;  1F93 A;  2JA6 K;  4C2M C;  3S1Q K;  5EGE A;  3HOX C;  3G4A A;  4KB4 A;  2JH3 A;  4Y52 C;  2FQO A;  3HOZ K;  3I4N C;  4ZH4 A;  3LAP A;  4AYB L;  1F7U A;  4KC6 A;  1WCM C;  4KAR A;  3RZD K;  2E2I K;  1DCH A;  4XCH A;  2XCQ A;  3S0X A;  3FHZ A;  4A3D K;  1I3Q A;  5CJ9 A;  1DD5 A;  1O26 A;  4PAA A;  4WIL A;  3AD7 C;  1TWC K;  2R7Z A;  4A3I C;  5CHP A;  4A93 C;  3GTP A;  3QX3 A;  1GE9 A;  3GTO K;  4GT9 A;  4OIQ A;  1O25 A;  1XZP B;  4KB2 A;  1SMY A;  4KMA A;  1VLO A;  4Q4Z A;  2NVQ C;  3HOV C;  5IOQ A;  1O24 A;  1O2F B;  4WJ3 M;  1SFO K;  4A3L C;  3HOU K;  4BY1 C;  3S17 K;  2YU9 C;  3HKZ L;  5C3E C;  3HOY C;  3GTL A;  4G7Z A;  3AH5 A;  3A8I A;  3V4G A;  4GTC A;  1O29 A;  1WSR A;  4DDQ A;  2GAH C;  3TFJ A;  1TWA C;  2CFA A;  5D4D A;  3S1R C;  2BE5 A;  4XSX A;  2E2J C;  3DXJ A;  3S14 K;  1IS1 A;  1R9T A;  2NVY C;  4QJV A;  2WAQ D;  1O2A A;  4A3B K;  5C4J K;  3PO3 K;  1I6H C;  2E2H C;  5E68 A;  2XCO A;  1J6V A;  1Y1V A;  4LJZ A;  1K83 A;  4G0U A;  1TWA K;  2R7Z K;  3H3V D;  2NVX C;  3ORE A;  4A3K C;  2V6S A;  4BLA A;  4A3G C;  3H0G A;  3GTJ A;  3L4J A;  1X31 C;  2R93 K;  5C3E K;  1IW7 A;  3TTG A;  2ZFZ A;  2JA6 A;  3S1N K;  4AH6 A;  3GTL K;  5IP9 K;  4GTD A;  5IOR A;  1J6W A;  2JA8 C;  4LOW A;  5IP9 C;  4YG2 A;  3S1N C;  1YNN A;  2JA5 A;  4A3J C;  2VUM K;  5C44 K;  4A3M K;  5M5Y K;  3GTK C;  4A3G K;  2RGR A;  3I4M C;  4WJ4 A;  2A69 A;  4A3E C;  3HOW C;  3GEI A;  3EQL A;  3T01 A;  3I4M K;  3HKZ D;  4XLN A;  4KM8 A;  1B4A A;  3GTK K;  2E2H A;  1XZQ A;  1HI9 A;  1IBA A;  2RH6 A;  5C44 C;  3SZY A;  2FQT A;  2PHC B;  1VJE A;  2JA8 K;  4BBS K;  2NVX A;  4BKW A;  2E2J K;  1EQR A;  3G4C A;  3FKI A;  3S1R K;  5IYB C;  4P5B A;  4FM9 A;  1TWF K;  4MEX A;  4G0W A;  5JVO A;  2ZUE A;  4OIN A;  4OIR A;  2W7V A;  2CW0 A;  3CQZ K;  1JQW A;  1YX2 A;  1USM A;  1INN A;  3CQZ C;  2D6F C;  4G0V A;  3NUH A;  3FKI K;  4GTL A;  2YU9 K;  2ZUF A;  3HOY K;  4BY1 K;  3BP3 A;  3GTG A;  1IE0 A;  4A3L K;  1TWF C;  1F7V A;  4G7O A;  5M5X K;  5IYB K;  3H3V L;  3TFI A;  4KAT A;  3ERE D;  2O5I A;  2R92 A;  4GTA A;  4GTF A;  3HOV K;  3GTM A;  4BBS C;  2NVQ K;  2E2H K;  3LPX A;  5C4J C;  1I50 C;  1XXA A;  3M4O C;  4YFN A;  1J98 A;  3ADA C;  2NVY K;  2R92 K;  2P8T A;  3LAJ A;  1USO A;  1TWC C;  1UV7 A;  3OPF A;  1VRQ C;  5IOS A; 
#chains in the Genus database with same CATH homology
 1DCP A;  1F93 A;  3JST A;  4C45 A;  1USM A;  1USO A;  4LOW A;  1RU0 A;  2V6U A;  2EBB A;  2V6S A;  3HXA A;  2V6T A;  4WIL A;  1DCH A;  1DCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...