1F93A

Crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DIMERIZATION COFACTOR OF HEPATOCYTE NUCLEAR FACTOR 1-ALPHA
publication title Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 32
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1f93A00
2V6TA 4LOWA 3HXAA 4C45A 2V6UA 1DCOA 2EBBA 1F93A 1USOA 1DCHA 1DCPA 1RU0A 2V6SA 4WILA 3JSTA 1USMA
chains in the Genus database with same CATH superfamily
3QX3A 1PJ5A 1YCLA 4GTFA 4JK1A 4NOIA 1WSVA 5M5WK 1PJ7A 2E2JC 3M3YC 1VH2A 3I4MK 1ZBSA 2YU9C 1HQMA 1VRQC 1F9NA 1WQFA 1YX2A 4A3CK 2JA5A 1IS1A 2VUMK 3BP8C 3AQPA 2V6UA 3S0XA 3CQZK 4FM9A 1O24A 1WQGA 3G4AA 4Y52K 4C3HC 4YFKA 3HKZL 3T01A 5HL8A 1EH1A 1RU0A 2P5MA 4FZBA 5IP9K 3S2DC 4KATA 5IP7C 4A3MK 3GTLA 5TMCA 2VUMA 1WSRA 3S16K 4Y7NC 1SFOC 3H3VL 3CQZA 1ZYRA 4P5AA 4A3IC 3S1NK 1AB4A 3S1MK 1TWCC 4KMAA 3FHZA 1R9TK 3DXJA 4KM8A 4AH6A 3S1QK 5EGEA 1I50A 5JVOA 1V5VA 3GTJK 5C3EK 2PMZL 4G0WA 4KMHA 3CAGA 3OPFA 1Y1VC 2RH6A 1XXAA 2NVXK 3TFJA 2Y0SD 3A8IA 5E68A 4OIQA 3AH5A 4QJVB 2R7ZA 2W7VA 1PJ6A 4J3NA 1Y1WC 5C44K 5IOQA 3S15K 2CFAB 1WCMK 4ZH4A 3A8KA 5IOSA 1J6WA 3K7AC 4KASA 3I4NC 2CW0A 3HOYC 2E2JK 3M3YK 1F93A 2D6FC 3GDZA 1TWHC 3HOXC 4WJ4A 1I6VA 1ZVUA 2NVYC 2ZUFA 1G51A 4C45A 2RGRA 3GTKC 2YU9K 3AD8C 2E2HC 4G7ZA 5M3FK 2R92A 3T02A 1O25A 4M1XA 1J98A 4A3GC 1EI6A 3L4KA 1ZQ1C 1JVIA 3A8JA 3S2HC 5JFEA 2GSUA 3FOFA 1DD5A 4C3HK 3GTPC 2P8TA 3HOUC 4G0VA 3LPXA 1O29A 4X6AC 2WAQL 3S2DK 5IP7K 3S17C 2JA7A 4WJ3M 1TWAA 2R93C 3GTQK 1HI9A 3H0GC 1TWGC 3OREA 1K83A 1GE9A 2EBBA 1O2AA 4Y7NK 1SFOK 2O5IA 4A3IK 3JSTA 1WIHA 2PA8L 1TWCK 1BS2A 4KN7A 3PO3C 3GTOC 1O27A 4P9SA 1ISEA 3GEHA 3S1RC 1VLOA 4YFXA 1XZQB 4C3JC 4MQ9A 3RZOC 1Y1VK 3GTQA 1Y1WK 3OEPA 1USOA 3FKIC 4LJZA 1L0WA 4GTLA 4G7HA 1IBAA 3GTGC 3NUHA 1I3QC 3K7AK 2V6TA 3I4NK 3HOYK 4DDQA 1TWFC 2WB1L 5CHPA 1TWHK 3HOXK 2NVYK 2XCQA 4XCHA 3GTKK 4KB2A 2E2HK 4OINA 4A3KC 2B63C 1C0AA 3GTMC 1WOPA 4LLGA 4A3GK 1WOSA 4XLPA 3S2HK 4AYBD 3HOWC 4KDDA 3HXAA 3HOUK 2JH3A 4A3DC 4A3JC 4BXXC 3HOZC 3GEEA 4X6AK 4BBSC 3S17K 2JA5C 3GTKA 1DCHA 4QJVA 2E2HA 2R93K 3H0GK 5M5YK 1TWGK 5M3MK 1WQHA 2CFAA 1R9TA 4GZYA 3HOVC 3LAPA 4MEYA 2GSNA 5C4JC 3GTOK 4A3EC 5M5XK 3PO3K 2E2IC 3GTJA 1USMA 4KARA 3S1RK 5IYBC 4PABA 4GT9A 1SMYA 4KAWX 4C3JK 4QIWD 3RZOK 5TJ3A 3GTLC 2NVXA 3IPJA 3H0GA 2ZUEA 3M4OC 4KMDA 5IORA 4BY1C 2JA8C 3SZZA 3FKIK 3TFHA 1I50C 1VGXA 1WCMA 4LR2A 5TMFA 4A3FC 3FOEA 4C2MC 1BJTA 3GEIA 4XSXA 3GTOA 3GTGK 1I3QK 2NVTC 4LOWA 1TWFK 1O28A 1IQ0A 2PPBA 4C3IC 5EGHA 5D4DA 1B4AA 2YU9A 4OIOA 1YNJA 2R7ZC 3ERED 1I6HC 4XLNA 2Y0SL 5L46A 1XZPB 1WORA 4KMUA 4A3KK 2B63K 4KM9A 3GTMK 5IYDC 5FLMC 1F7UA 3HKZD 1O2BA 4YFNA 4BLBA 4BLAA 3RZDC 3GTGA 3HOWK 1O2FB 3S14C 4GTDA 2JA6C 4O2DA 1F7VA 3PO2C 4GFQA 2BE5A 1XZQA 2PHCB 4A3DK 4A3JK 4BXXK 4BY7C 3HOZK 3H3VD 4BBSK 2JA5K 1UV7A 2V6SA 4GTBA 2R92C 3N0CA 5C4XC 1SFOA 1XXCA 1TWCA 3GSIA 2PMZD 3HOVK 1VJEA 1J6VA 4XSZA 2FQOA 4BBRC 5C4JK 4A3EK 2E2IK 5IYBK 4LK0A 1IL2A 1XPPA 1Y1VA 3GTLK 2JA7C 1TWAC 1K83C 3M4OK 2O5JA 1Y1WA 2GSOA 4BY1K 3N0BA 2JA8K 3GIRA 2A6HA 2ZFZA 1I50K 4P5BA 5IYCC 4A3FK 1DCOA 4C2MK 2NVQC 2E2IA 3GTPK 4A93C 4GTAA 2NVTK 1WOOA 1BGWA 5FJ8K 3V4GA 2XCRB 1YNNA 1TWHA 1EFWA 2NVYA 3GTQC 4C3IK 2A68A 4GTCA 2R7ZK 4Q4ZA 1I6HK 1XXBA 3AD9C 3MMLB 4A3BC 4A3LC 5CJ9A 5IYDK 1EQRA 5FLMK 3G4CA 4OIPA 2FQTA 3RZDK 3GTPA 2WAQD 1X31C 3S14K 2JA6K 1IE0A 2A6EA 4RMFA 3PO2K 2XCOA 3N3YA 3I4MC 3TTGA 4BY7K 3VA7A 4A3CC 1IW7A 4GTEA 4BKWA 2R93A 2VUMC 2PA8D 4YG2A 2R92K 1TWGA 4OIRA 3CQZC 4G7OA 5C4XK 3WODA 3Q3QA 4LQYA 4Y52C 3BUEA 3AQOA 2A69A 4BBRK 2JA6A 4AYBL 3LAJA 2Y3PA 1BDFA 5IP9C 4KN4A 4PAAA 1DCPA 4ILDA 4A3MC 4KB4A 3AD7C 2JA7K 1JQWA 1TWAK 1ZXOA 3S16C 2GAGC 2KWAA 1XZPA 1K83K 1EK8A 3EQLA 3S1NC 3S1MC 1R9TC 4WILA 1J6XA 3FKIA 3ADAC 3S1QC 4Q5SA 3L4JA 3TFIA 5IYCK 2WB1D 3GTJC 5C3EC 2NVQK 1I3QA 4A93K 1JOEA 1TWFA 3BP3A 2NVXC 4G0UA 4LK1A 2GAHC 1INNA 3SZYA 4QIWL 3T00A 1O26A 5C44C 1B4BA 5IOTA 3S15C 2B63A 3GTMA 4MEXA 4A3BK 4A3LK 1KQ4A 1WCMC 4KC6A
chains in the Genus database with same CATH topology
2V6TA 4LOWA 3HXAA 4C45A 2V6UA 1DCOA 2EBBA 1F93A 1USOA 1DCHA 1DCPA 1RU0A 2V6SA 4WILA 3JSTA 1USMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6T A;  4LOW A;  3HXA A;  4C45 A;  2V6U A;  1DCO A;  2EBB A;  1F93 A;  1USO A;  1DCH A;  1DCP A;  1RU0 A;  2V6S A;  4WIL A;  3JST A;  1USM A; 
#chains in the Genus database with same CATH topology
 3QX3 A;  1PJ5 A;  1YCL A;  4GTF A;  4JK1 A;  4NOI A;  1WSV A;  5M5W K;  1PJ7 A;  2E2J C;  3M3Y C;  1VH2 A;  3I4M K;  1ZBS A;  2YU9 C;  1HQM A;  1VRQ C;  1F9N A;  1WQF A;  1YX2 A;  4A3C K;  2JA5 A;  1IS1 A;  2VUM K;  3BP8 C;  3AQP A;  2V6U A;  3S0X A;  3CQZ K;  4FM9 A;  1O24 A;  1WQG A;  3G4A A;  4Y52 K;  4C3H C;  4YFK A;  3HKZ L;  3T01 A;  5HL8 A;  1EH1 A;  1RU0 A;  2P5M A;  4FZB A;  5IP9 K;  3S2D C;  4KAT A;  5IP7 C;  4A3M K;  3GTL A;  5TMC A;  2VUM A;  1WSR A;  3S16 K;  4Y7N C;  1SFO C;  3H3V L;  3CQZ A;  1ZYR A;  4P5A A;  4A3I C;  3S1N K;  1AB4 A;  3S1M K;  1TWC C;  4KMA A;  3FHZ A;  1R9T K;  3DXJ A;  4KM8 A;  4AH6 A;  3S1Q K;  5EGE A;  1I50 A;  5JVO A;  1V5V A;  3GTJ K;  5C3E K;  2PMZ L;  4G0W A;  4KMH A;  3CAG A;  3OPF A;  1Y1V C;  2RH6 A;  1XXA A;  2NVX K;  3TFJ A;  2Y0S D;  3A8I A;  5E68 A;  4OIQ A;  3AH5 A;  4QJV B;  2R7Z A;  2W7V A;  1PJ6 A;  4J3N A;  1Y1W C;  5C44 K;  5IOQ A;  3S15 K;  2CFA B;  1WCM K;  4ZH4 A;  3A8K A;  5IOS A;  1J6W A;  3K7A C;  4KAS A;  3I4N C;  2CW0 A;  3HOY C;  2E2J K;  3M3Y K;  1F93 A;  2D6F C;  3GDZ A;  1TWH C;  3HOX C;  4WJ4 A;  1I6V A;  1ZVU A;  2NVY C;  2ZUF A;  1G51 A;  4C45 A;  2RGR A;  3GTK C;  2YU9 K;  3AD8 C;  2E2H C;  4G7Z A;  5M3F K;  2R92 A;  3T02 A;  1O25 A;  4M1X A;  1J98 A;  4A3G C;  1EI6 A;  3L4K A;  1ZQ1 C;  1JVI A;  3A8J A;  3S2H C;  5JFE A;  2GSU A;  3FOF A;  1DD5 A;  4C3H K;  3GTP C;  2P8T A;  3HOU C;  4G0V A;  3LPX A;  1O29 A;  4X6A C;  2WAQ L;  3S2D K;  5IP7 K;  3S17 C;  2JA7 A;  4WJ3 M;  1TWA A;  2R93 C;  3GTQ K;  1HI9 A;  3H0G C;  1TWG C;  3ORE A;  1K83 A;  1GE9 A;  2EBB A;  1O2A A;  4Y7N K;  1SFO K;  2O5I A;  4A3I K;  3JST A;  1WIH A;  2PA8 L;  1TWC K;  1BS2 A;  4KN7 A;  3PO3 C;  3GTO C;  1O27 A;  4P9S A;  1ISE A;  3GEH A;  3S1R C;  1VLO A;  4YFX A;  1XZQ B;  4C3J C;  4MQ9 A;  3RZO C;  1Y1V K;  3GTQ A;  1Y1W K;  3OEP A;  1USO A;  3FKI C;  4LJZ A;  1L0W A;  4GTL A;  4G7H A;  1IBA A;  3GTG C;  3NUH A;  1I3Q C;  3K7A K;  2V6T A;  3I4N K;  3HOY K;  4DDQ A;  1TWF C;  2WB1 L;  5CHP A;  1TWH K;  3HOX K;  2NVY K;  2XCQ A;  4XCH A;  3GTK K;  4KB2 A;  2E2H K;  4OIN A;  4A3K C;  2B63 C;  1C0A A;  3GTM C;  1WOP A;  4LLG A;  4A3G K;  1WOS A;  4XLP A;  3S2H K;  4AYB D;  3HOW C;  4KDD A;  3HXA A;  3HOU K;  2JH3 A;  4A3D C;  4A3J C;  4BXX C;  3HOZ C;  3GEE A;  4X6A K;  4BBS C;  3S17 K;  2JA5 C;  3GTK A;  1DCH A;  4QJV A;  2E2H A;  2R93 K;  3H0G K;  5M5Y K;  1TWG K;  5M3M K;  1WQH A;  2CFA A;  1R9T A;  4GZY A;  3HOV C;  3LAP A;  4MEY A;  2GSN A;  5C4J C;  3GTO K;  4A3E C;  5M5X K;  3PO3 K;  2E2I C;  3GTJ A;  1USM A;  4KAR A;  3S1R K;  5IYB C;  4PAB A;  4GT9 A;  1SMY A;  4KAW X;  4C3J K;  4QIW D;  3RZO K;  5TJ3 A;  3GTL C;  2NVX A;  3IPJ A;  3H0G A;  2ZUE A;  3M4O C;  4KMD A;  5IOR A;  4BY1 C;  2JA8 C;  3SZZ A;  3FKI K;  3TFH A;  1I50 C;  1VGX A;  1WCM A;  4LR2 A;  5TMF A;  4A3F C;  3FOE A;  4C2M C;  1BJT A;  3GEI A;  4XSX A;  3GTO A;  3GTG K;  1I3Q K;  2NVT C;  4LOW A;  1TWF K;  1O28 A;  1IQ0 A;  2PPB A;  4C3I C;  5EGH A;  5D4D A;  1B4A A;  2YU9 A;  4OIO A;  1YNJ A;  2R7Z C;  3ERE D;  1I6H C;  4XLN A;  2Y0S L;  5L46 A;  1XZP B;  1WOR A;  4KMU A;  4A3K K;  2B63 K;  4KM9 A;  3GTM K;  5IYD C;  5FLM C;  1F7U A;  3HKZ D;  1O2B A;  4YFN A;  4BLB A;  4BLA A;  3RZD C;  3GTG A;  3HOW K;  1O2F B;  3S14 C;  4GTD A;  2JA6 C;  4O2D A;  1F7V A;  3PO2 C;  4GFQ A;  2BE5 A;  1XZQ A;  2PHC B;  4A3D K;  4A3J K;  4BXX K;  4BY7 C;  3HOZ K;  3H3V D;  4BBS K;  2JA5 K;  1UV7 A;  2V6S A;  4GTB A;  2R92 C;  3N0C A;  5C4X C;  1SFO A;  1XXC A;  1TWC A;  3GSI A;  2PMZ D;  3HOV K;  1VJE A;  1J6V A;  4XSZ A;  2FQO A;  4BBR C;  5C4J K;  4A3E K;  2E2I K;  5IYB K;  4LK0 A;  1IL2 A;  1XPP A;  1Y1V A;  3GTL K;  2JA7 C;  1TWA C;  1K83 C;  3M4O K;  2O5J A;  1Y1W A;  2GSO A;  4BY1 K;  3N0B A;  2JA8 K;  3GIR A;  2A6H A;  2ZFZ A;  1I50 K;  4P5B A;  5IYC C;  4A3F K;  1DCO A;  4C2M K;  2NVQ C;  2E2I A;  3GTP K;  4A93 C;  4GTA A;  2NVT K;  1WOO A;  1BGW A;  5FJ8 K;  3V4G A;  2XCR B;  1YNN A;  1TWH A;  1EFW A;  2NVY A;  3GTQ C;  4C3I K;  2A68 A;  4GTC A;  2R7Z K;  4Q4Z A;  1I6H K;  1XXB A;  3AD9 C;  3MML B;  4A3B C;  4A3L C;  5CJ9 A;  5IYD K;  1EQR A;  5FLM K;  3G4C A;  4OIP A;  2FQT A;  3RZD K;  3GTP A;  2WAQ D;  1X31 C;  3S14 K;  2JA6 K;  1IE0 A;  2A6E A;  4RMF A;  3PO2 K;  2XCO A;  3N3Y A;  3I4M C;  3TTG A;  4BY7 K;  3VA7 A;  4A3C C;  1IW7 A;  4GTE A;  4BKW A;  2R93 A;  2VUM C;  2PA8 D;  4YG2 A;  2R92 K;  1TWG A;  4OIR A;  3CQZ C;  4G7O A;  5C4X K;  3WOD A;  3Q3Q A;  4LQY A;  4Y52 C;  3BUE A;  3AQO A;  2A69 A;  4BBR K;  2JA6 A;  4AYB L;  3LAJ A;  2Y3P A;  1BDF A;  5IP9 C;  4KN4 A;  4PAA A;  1DCP A;  4ILD A;  4A3M C;  4KB4 A;  3AD7 C;  2JA7 K;  1JQW A;  1TWA K;  1ZXO A;  3S16 C;  2GAG C;  2KWA A;  1XZP A;  1K83 K;  1EK8 A;  3EQL A;  3S1N C;  3S1M C;  1R9T C;  4WIL A;  1J6X A;  3FKI A;  3ADA C;  3S1Q C;  4Q5S A;  3L4J A;  3TFI A;  5IYC K;  2WB1 D;  3GTJ C;  5C3E C;  2NVQ K;  1I3Q A;  4A93 K;  1JOE A;  1TWF A;  3BP3 A;  2NVX C;  4G0U A;  4LK1 A;  2GAH C;  1INN A;  3SZY A;  4QIW L;  3T00 A;  1O26 A;  5C44 C;  1B4B A;  5IOT A;  3S15 C;  2B63 A;  3GTM A;  4MEX A;  4A3B K;  4A3L K;  1KQ4 A;  1WCM C;  4KC6 A; 
#chains in the Genus database with same CATH homology
 2V6T A;  4LOW A;  3HXA A;  4C45 A;  2V6U A;  1DCO A;  2EBB A;  1F93 A;  1USO A;  1DCH A;  1DCP A;  1RU0 A;  2V6S A;  4WIL A;  3JST A;  1USM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...