1F93A

Crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
b'AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIMERIZATION COFACTOR OF HEPATOCYTE NUCLEAR FACTOR 1-ALPHA
publication title Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
total genus 32
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1f93A00
1DCPA 2V6SA 1RU0A 3HXAA 2V6TA 1DCOA 1USMA 4LOWA 4C45A 1DCHA 2V6UA 4WILA 1F93A 1USOA 2EBBA 3JSTA
chains in the Genus database with same CATH superfamily
3LAPA 2P5MA 3M3YC 5HL8A 2WAQL 4M1XA 3GTGA 2O5JA 3I4NK 2GAGC 4KAWX 2YU9A 4XLNA 5EGEA 3H3VL 1EQRA 4A3IK 1F7UA 4BBRC 1TWHK 5M5WK 1IBAA 1BDFA 5M5XK 4C2MK 5M5YK 1WSVA 3AH5A 4KDDA 3GTMA 2Y0SD 5C3EC 1DCOA 3RZDC 1EH1A 2B63A 2XCOA 2WB1D 4QIWD 4GTEA 5IYBC 4GZYA 3HOWC 1IL2A 1JVIA 5JVOA 3NUHA 1X31C 3H0GC 4BY1K 1IQ0A 5EGHA 3TTGA 2XCRB 3GTKC 4GTCA 1EFWA 3S1QK 1G51A 1I3QA 4GTBA 2JA5K 5TMFA 3GTLK 1XXAA 5IP9K 1O24A 4AYBD 1Y1VA 5IOSA 3QX3A 4LLGA 3GTMK 4LK1A 4O2DA 1BJTA 2R7ZA 4A3JK 4KM8A 1UV7A 4YG2A 1B4BA 1XZPA 4A3FK 1SFOK 4LJZA 3S1MC 2PA8L 1PJ5A 3A8IA 3GTOA 3GDZA 1O29A 4C3JC 3AD8C 3CQZK 2GSOA 3GSIA 1R9TA 2KWAA 1K83K 4A3KK 3HOUK 3AD7C 4G7OA 4Y52C 2JA6A 5D4DA 3BP3A 1WSRA 3HOXK 3M3YK 3FOFA 5TMCA 2JA7C 1BS2A 4C3HC 5IYCK 5M3FK 1DCPA 3AQPA 1PJ6A 4KMAA 3GIRA 3L4KA 1XZQB 4OIQA 2ZUFA 3HXAA 3S1RK 1WOSA 4QJVB 4PABA 1DD5A 4LR2A 3FKIC 1J6XA 3PO3C 3PO2C 1R9TK 5IORA 4KB2A 2RH6A 5C3EK 2A69A 4BY7C 2A6EA 1BGWA 1XPPA 1USOA 2E2HC 1TWHA 4A3LC 3RZDK 4PAAA 3HKZD 1TWFA 2JA6K 3S2DC 2GSUA 1KQ4A 5CHPA 3ERED 1I6HC 1WIHA 5IOQA 3VA7A 5FLMC 1YNJA 1TWAA 5L46A 5IYBK 3HOWK 4A3CC 1RU0A 1ZVUA 1J6VA 3H0GK 1PJ7A 4RMFA 1WOOA 3G4CA 3GTKK 5TJ3A 2VUMC 1TWCC 5C44K 2R93C 1Y1WC 4BXXC 4G0UA 3S14C 3ADAC 2NVYC 1AB4A 3HKZL 2R92C 2JA5A 3GTLA 1TWFK 1WOPA 3S1MK 4KM9A 3M4OC 1TWAK 5IOTA 2CFAA 1O26A 1O28A 4C3JK 2ZUEA 4Y7NK 2EBBA 3TFJA 2BE5A 1SFOA 2PA8D 1TWGC 4OIRA 3GEEA 1VGXA 1WQHA 3CQZA 3WODA 3S16C 2V6UA 2JA8C 2E2IA 3S1NC 3IPJA 1YNNA 1WCMC 1K83A 1YX2A 1XZPB 4ILDA 4GTLA 2JA7K 1WQGA 4KC6A 3GEIA 4C3HK 1YCLA 2FQOA 2PHCB 4GTDA 1I50C 3LAJA 4A3DC 1J98A 2VUMA 2P8TA 4XSXA 2PMZL 3FKIK 3N0BA 4J3NA 3PO2K 2RGRA 4WJ4A 4YFKA 2V6SA 1IS1A 4KN4A 1ZBSA 2E2IK 4X6AC 4A3LK 3GTJC 1I6HK 1JOEA 5FLMK 3RZOC 1VLOA 5IP7C 1WORA 4A3CK 5IYDC 3K7AC 2GSNA 1JQWA 3S15C 4OINA 2ZFZA 3Q3QA 3TFIA 3GTPC 2NVTC 3SZYA 1O2AA 2VUMK 4KMUA 4A3EC 2R93K 3OEPA 1Y1WK 4BXXK 3H0GA 3DXJA 4LQYA 3GTGC 4MQ9A 3BUEA 3GTKA 4G0WA 4KMDA 4BBRK 2YU9C 4XLPA 1B4AA 4KN7A 1HI9A 4A3MC 2E2JC 3S2HC 1VRQC 4DDQA 3GEHA 3I4MC 4BLBA 3GTQC 1ZYRA 3GTMC 1GE9A 4FZBA 4A3GC 4XSZA 4ZH4A 4A3JC 3T02A 2B63C 4LK0A 2NVXC 4AH6A 2Y3PA 4A3BC 1USMA 4BBSC 5JFEA 2JA8K 3S1NK 4A93C 5M3MK 3GTJA 1WCMK 2XCQA 1XZQA 3OPFA 2O5IA 4FM9A 4QJVA 4MEXA 1I3QC 5C4JC 1Y1VC 1I50K 1HQMA 2JA7A 3OREA 1DCHA 1O2BA 2R7ZC 3HOZC 4NOIA 4C45A 3FHZA 3G4AA 5IYCC 5C4XC 3MMLB 4P5BA 3GTOC 2W7VA 4X6AK 3FKIA 4MEYA 4Q5SA 2PMZD 3S1RC 1F9NA 3GTJK 4GTFA 4P5AA 4WILA 3RZOK 1ZXOA 1R9TC 3HOVC 1C0AA 5IP7K 2E2HA 3GTQA 1O25A 3HOYC 3BP8C 4Y52K 5IYDK 3K7AK 3T00A 3S15K 4KATA 5E68A 3GTPK 2PPBA 2NVTK 2JA6C 1F7VA 3S17C 2NVXA 3AD9C 4A3EK 1VH2A 2FQTA 1IE0A 4JK1A 2NVQC 3FOEA 3GTGK 5FJ8K 4C3IC 1INNA 1TWCA 4KMHA 2YU9K 3PO3K 2R93A 4KASA 1I6VA 1Y1WA 4Q4ZA 5C44C 3I4NC 4A3MK 2E2JK 3S2HK 2NVYA 4BY7K 4G7ZA 2JH3A 3I4MK 3S0XA 3JSTA 2E2HK 3GTQK 2R92A 2Y0SL 3S2DK 4GFQA 4A3IC 4A3GK 1ZQ1C 1TWHC 4C2MC 2V6TA 1TWFC 2B63K 1ISEA 2NVXK 1WQFA 2WB1L 4QIWL 3TFHA 4A3BK 4BBSK 2CW0A 1TWAC 4YFNA 3V4GA 4A93K 1TWGA 3T01A 4Y7NC 1TWCK 2A6HA 4BLAA 1IW7A 1VJEA 4KARA 4KB4A 4OIPA 1I3QK 1SMYA 4LOWA 4BKWA 5C4JK 4AYBL 1EK8A 1WCMA 3S14K 2NVYK 1Y1VK 4BY1C 2R92K 1XXBA 3N3YA 2R7ZK 1L0WA 4G0VA 3HOZK 3S1QC 2JA5C 3L4JA 3M4OK 1O27A 1J6WA 3GTLC 5IP9C 1I50A 5C4XK 4XCHA 3GTOK 3LPXA 4GTAA 4G7HA 1F93A 1TWGK 3A8JA 2WAQD 4OIOA 4A3FC 1SFOC 3S16K 3CAGA 3HOVK 5CJ9A 2D6FC 3HOYK 1EI6A 2A68A 3CQZC 4GT9A 3H3VD 2E2IC 4P9SA 4YFXA 3EQLA 4WJ3M 1XXCA 3S17K 3AQOA 2CFAB 1K83C 3N0CA 3A8KA 3SZZA 4A3KC 3HOUC 1V5VA 1O2FB 3GTPA 2NVQK 4A3DK 4C3IK 2GAHC 3HOXC
chains in the Genus database with same CATH topology
1DCPA 2V6SA 1RU0A 3HXAA 2V6TA 1DCOA 1USMA 4LOWA 4C45A 1DCHA 2V6UA 4WILA 1F93A 1USOA 2EBBA 3JSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  2V6S A;  1RU0 A;  3HXA A;  2V6T A;  1DCO A;  1USM A;  4LOW A;  4C45 A;  1DCH A;  2V6U A;  4WIL A;  1F93 A;  1USO A;  2EBB A;  3JST A; 
#chains in the Genus database with same CATH topology
 3LAP A;  2P5M A;  3M3Y C;  5HL8 A;  2WAQ L;  4M1X A;  3GTG A;  2O5J A;  3I4N K;  2GAG C;  4KAW X;  2YU9 A;  4XLN A;  5EGE A;  3H3V L;  1EQR A;  4A3I K;  1F7U A;  4BBR C;  1TWH K;  5M5W K;  1IBA A;  1BDF A;  5M5X K;  4C2M K;  5M5Y K;  1WSV A;  3AH5 A;  4KDD A;  3GTM A;  2Y0S D;  5C3E C;  1DCO A;  3RZD C;  1EH1 A;  2B63 A;  2XCO A;  2WB1 D;  4QIW D;  4GTE A;  5IYB C;  4GZY A;  3HOW C;  1IL2 A;  1JVI A;  5JVO A;  3NUH A;  1X31 C;  3H0G C;  4BY1 K;  1IQ0 A;  5EGH A;  3TTG A;  2XCR B;  3GTK C;  4GTC A;  1EFW A;  3S1Q K;  1G51 A;  1I3Q A;  4GTB A;  2JA5 K;  5TMF A;  3GTL K;  1XXA A;  5IP9 K;  1O24 A;  4AYB D;  1Y1V A;  5IOS A;  3QX3 A;  4LLG A;  3GTM K;  4LK1 A;  4O2D A;  1BJT A;  2R7Z A;  4A3J K;  4KM8 A;  1UV7 A;  4YG2 A;  1B4B A;  1XZP A;  4A3F K;  1SFO K;  4LJZ A;  3S1M C;  2PA8 L;  1PJ5 A;  3A8I A;  3GTO A;  3GDZ A;  1O29 A;  4C3J C;  3AD8 C;  3CQZ K;  2GSO A;  3GSI A;  1R9T A;  2KWA A;  1K83 K;  4A3K K;  3HOU K;  3AD7 C;  4G7O A;  4Y52 C;  2JA6 A;  5D4D A;  3BP3 A;  1WSR A;  3HOX K;  3M3Y K;  3FOF A;  5TMC A;  2JA7 C;  1BS2 A;  4C3H C;  5IYC K;  5M3F K;  1DCP A;  3AQP A;  1PJ6 A;  4KMA A;  3GIR A;  3L4K A;  1XZQ B;  4OIQ A;  2ZUF A;  3HXA A;  3S1R K;  1WOS A;  4QJV B;  4PAB A;  1DD5 A;  4LR2 A;  3FKI C;  1J6X A;  3PO3 C;  3PO2 C;  1R9T K;  5IOR A;  4KB2 A;  2RH6 A;  5C3E K;  2A69 A;  4BY7 C;  2A6E A;  1BGW A;  1XPP A;  1USO A;  2E2H C;  1TWH A;  4A3L C;  3RZD K;  4PAA A;  3HKZ D;  1TWF A;  2JA6 K;  3S2D C;  2GSU A;  1KQ4 A;  5CHP A;  3ERE D;  1I6H C;  1WIH A;  5IOQ A;  3VA7 A;  5FLM C;  1YNJ A;  1TWA A;  5L46 A;  5IYB K;  3HOW K;  4A3C C;  1RU0 A;  1ZVU A;  1J6V A;  3H0G K;  1PJ7 A;  4RMF A;  1WOO A;  3G4C A;  3GTK K;  5TJ3 A;  2VUM C;  1TWC C;  5C44 K;  2R93 C;  1Y1W C;  4BXX C;  4G0U A;  3S14 C;  3ADA C;  2NVY C;  1AB4 A;  3HKZ L;  2R92 C;  2JA5 A;  3GTL A;  1TWF K;  1WOP A;  3S1M K;  4KM9 A;  3M4O C;  1TWA K;  5IOT A;  2CFA A;  1O26 A;  1O28 A;  4C3J K;  2ZUE A;  4Y7N K;  2EBB A;  3TFJ A;  2BE5 A;  1SFO A;  2PA8 D;  1TWG C;  4OIR A;  3GEE A;  1VGX A;  1WQH A;  3CQZ A;  3WOD A;  3S16 C;  2V6U A;  2JA8 C;  2E2I A;  3S1N C;  3IPJ A;  1YNN A;  1WCM C;  1K83 A;  1YX2 A;  1XZP B;  4ILD A;  4GTL A;  2JA7 K;  1WQG A;  4KC6 A;  3GEI A;  4C3H K;  1YCL A;  2FQO A;  2PHC B;  4GTD A;  1I50 C;  3LAJ A;  4A3D C;  1J98 A;  2VUM A;  2P8T A;  4XSX A;  2PMZ L;  3FKI K;  3N0B A;  4J3N A;  3PO2 K;  2RGR A;  4WJ4 A;  4YFK A;  2V6S A;  1IS1 A;  4KN4 A;  1ZBS A;  2E2I K;  4X6A C;  4A3L K;  3GTJ C;  1I6H K;  1JOE A;  5FLM K;  3RZO C;  1VLO A;  5IP7 C;  1WOR A;  4A3C K;  5IYD C;  3K7A C;  2GSN A;  1JQW A;  3S15 C;  4OIN A;  2ZFZ A;  3Q3Q A;  3TFI A;  3GTP C;  2NVT C;  3SZY A;  1O2A A;  2VUM K;  4KMU A;  4A3E C;  2R93 K;  3OEP A;  1Y1W K;  4BXX K;  3H0G A;  3DXJ A;  4LQY A;  3GTG C;  4MQ9 A;  3BUE A;  3GTK A;  4G0W A;  4KMD A;  4BBR K;  2YU9 C;  4XLP A;  1B4A A;  4KN7 A;  1HI9 A;  4A3M C;  2E2J C;  3S2H C;  1VRQ C;  4DDQ A;  3GEH A;  3I4M C;  4BLB A;  3GTQ C;  1ZYR A;  3GTM C;  1GE9 A;  4FZB A;  4A3G C;  4XSZ A;  4ZH4 A;  4A3J C;  3T02 A;  2B63 C;  4LK0 A;  2NVX C;  4AH6 A;  2Y3P A;  4A3B C;  1USM A;  4BBS C;  5JFE A;  2JA8 K;  3S1N K;  4A93 C;  5M3M K;  3GTJ A;  1WCM K;  2XCQ A;  1XZQ A;  3OPF A;  2O5I A;  4FM9 A;  4QJV A;  4MEX A;  1I3Q C;  5C4J C;  1Y1V C;  1I50 K;  1HQM A;  2JA7 A;  3ORE A;  1DCH A;  1O2B A;  2R7Z C;  3HOZ C;  4NOI A;  4C45 A;  3FHZ A;  3G4A A;  5IYC C;  5C4X C;  3MML B;  4P5B A;  3GTO C;  2W7V A;  4X6A K;  3FKI A;  4MEY A;  4Q5S A;  2PMZ D;  3S1R C;  1F9N A;  3GTJ K;  4GTF A;  4P5A A;  4WIL A;  3RZO K;  1ZXO A;  1R9T C;  3HOV C;  1C0A A;  5IP7 K;  2E2H A;  3GTQ A;  1O25 A;  3HOY C;  3BP8 C;  4Y52 K;  5IYD K;  3K7A K;  3T00 A;  3S15 K;  4KAT A;  5E68 A;  3GTP K;  2PPB A;  2NVT K;  2JA6 C;  1F7V A;  3S17 C;  2NVX A;  3AD9 C;  4A3E K;  1VH2 A;  2FQT A;  1IE0 A;  4JK1 A;  2NVQ C;  3FOE A;  3GTG K;  5FJ8 K;  4C3I C;  1INN A;  1TWC A;  4KMH A;  2YU9 K;  3PO3 K;  2R93 A;  4KAS A;  1I6V A;  1Y1W A;  4Q4Z A;  5C44 C;  3I4N C;  4A3M K;  2E2J K;  3S2H K;  2NVY A;  4BY7 K;  4G7Z A;  2JH3 A;  3I4M K;  3S0X A;  3JST A;  2E2H K;  3GTQ K;  2R92 A;  2Y0S L;  3S2D K;  4GFQ A;  4A3I C;  4A3G K;  1ZQ1 C;  1TWH C;  4C2M C;  2V6T A;  1TWF C;  2B63 K;  1ISE A;  2NVX K;  1WQF A;  2WB1 L;  4QIW L;  3TFH A;  4A3B K;  4BBS K;  2CW0 A;  1TWA C;  4YFN A;  3V4G A;  4A93 K;  1TWG A;  3T01 A;  4Y7N C;  1TWC K;  2A6H A;  4BLA A;  1IW7 A;  1VJE A;  4KAR A;  4KB4 A;  4OIP A;  1I3Q K;  1SMY A;  4LOW A;  4BKW A;  5C4J K;  4AYB L;  1EK8 A;  1WCM A;  3S14 K;  2NVY K;  1Y1V K;  4BY1 C;  2R92 K;  1XXB A;  3N3Y A;  2R7Z K;  1L0W A;  4G0V A;  3HOZ K;  3S1Q C;  2JA5 C;  3L4J A;  3M4O K;  1O27 A;  1J6W A;  3GTL C;  5IP9 C;  1I50 A;  5C4X K;  4XCH A;  3GTO K;  3LPX A;  4GTA A;  4G7H A;  1F93 A;  1TWG K;  3A8J A;  2WAQ D;  4OIO A;  4A3F C;  1SFO C;  3S16 K;  3CAG A;  3HOV K;  5CJ9 A;  2D6F C;  3HOY K;  1EI6 A;  2A68 A;  3CQZ C;  4GT9 A;  3H3V D;  2E2I C;  4P9S A;  4YFX A;  3EQL A;  4WJ3 M;  1XXC A;  3S17 K;  3AQO A;  2CFA B;  1K83 C;  3N0C A;  3A8K A;  3SZZ A;  4A3K C;  3HOU C;  1V5V A;  1O2F B;  3GTP A;  2NVQ K;  4A3D K;  4C3I K;  2GAH C;  3HOX C; 
#chains in the Genus database with same CATH homology
 1DCP A;  2V6S A;  1RU0 A;  3HXA A;  2V6T A;  1DCO A;  1USM A;  4LOW A;  4C45 A;  1DCH A;  2V6U A;  4WIL A;  1F93 A;  1USO A;  2EBB A;  3JST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...