1F93A

Crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIMERIZATION COFACTOR OF HEPATOCYTE NUCLEAR FACTOR 1-ALPHA
publication title Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
total genus 32
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1f93A00
1DCHA 3HXAA 1RU0A 4WILA 1USOA 3JSTA 2V6UA 1F93A 4LOWA 1DCOA 2V6SA 2V6TA 2EBBA 4C45A 1DCPA 1USMA
chains in the Genus database with same CATH superfamily
3CQZC 1R9TK 5TJ3A 3PO2K 5C3EK 3OEPA 1TWFA 1SFOA 1JVIA 1TWCK 4YFNA 1XXAA 5IP9K 4P5AA 2R93A 3M3YK 4JK1A 2R92K 4OIRA 3LAJA 4BY7K 1Y1VC 3S2HK 1YNNA 1WCMK 3G4AA 1Y1WK 3S1QC 3GTLA 2XCQA 3TFJA 5C4JK 4BBSC 2KWAA 4LQYA 2JA7K 2Y3PA 4QIWD 1O29A 3A8JA 1G51A 3GTOK 4A3FK 2FQOA 2EBBA 1VGXA 3FKIK 3FOEA 1ZXOA 1BGWA 1TWHA 3HOXC 4A3BC 3HOUC 1ZYRA 3GTKA 4Y7NC 2YU9C 3TFHA 4GFQA 4LLGA 3JSTA 2R7ZA 1I6VA 2W7VA 3S15K 2JA8C 3S17K 3TTGA 2ZFZA 1TWFC 2XCRB 4KB4A 4A3JC 2VUMC 3T00A 4C2MC 2R93C 2PPBA 3S1NC 4KATA 1EFWA 1K83K 3A8IA 1IBAA 2E2IK 5IYDC 5FLMC 1F7UA 2JA5C 3N3YA 4O2DA 1Y1WA 3TFIA 1F7VA 1O24A 1VRQC 1XZPB 5IORA 5L46A 2Y0SL 2CW0A 4FM9A 4A3GK 4XCHA 1I3QA 1TWAA 2WAQL 3CQZA 3S14C 3GTPK 4G7OA 3BUEA 1WOPA 3AQPA 3GTKC 4GT9A 3M4OK 1IW7A 5IOSA 3S1RK 4PAAA 4Q4ZA 3GTJC 3RZOC 3H0GK 1BDFA 2A69A 1IS1A 5IP7C 3K7AK 2NVXA 4WJ3M 4XSZA 4BBRC 3SZZA 3L4JA 4WJ4A 2NVQK 1R9TC 3HOVC 3N0CA 2ZUEA 3NUHA 2Y0SD 3PO2C 2CFAB 3GSIA 1DCHA 1XZPA 5C3EC 4LK0A 1TWCC 2O5JA 3S0XA 3SZYA 5IP9C 3M3YC 4FZBA 2R92C 4BY7C 3S2HC 3HKZL 2NVYK 4G0UA 1WCMC 1XZQB 2YU9A 1YCLA 1Y1WC 1ZVUA 2GSUA 3Q3QA 2JA7C 4YFXA 4XLNA 1I3QC 4A3FC 3LPXA 4A3DK 1O25A 1WQFA 4X6AK 1EH1A 4AH6A 2JA6K 3FKIC 3IPJA 3G4CA 3V4GA 4KMHA 3GTMA 4DDQA 2VUMA 4A3IK 3RZDC 5EGEA 3LAPA 1WQGA 2NVXC 4Q5SA 1TWGK 3HKZD 5M5YK 1O2AA 2A6EA 3PO3K 3S15C 2JA5A 3L4KA 1XZQA 3HOYK 5CJ9A 4A3MK 1PJ7A 4BXXK 4BY1K 5M5XK 5FJ8K 4AYBD 1ISEA 3FHZA 4A3EK 4C3IC 3BP8C 2A6HA 1O26A 3S1MK 4M1XA 1PJ5A 1EQRA 1K83C 3GTQA 2E2IC 2WB1L 5C44K 2GSOA 3ERED 3GTJA 1WORA 1L0WA 1INNA 4ILDA 4C3JK 2B63A 4GTCA 1J98A 4GTBA 4A3GC 4KMAA 4KN7A 3GEHA 2GAGC 3GTGA 4BLAA 3GTPC 4G7ZA 1R9TA 3S2DK 2JA6A 2PA8L 3GTMC 3AQOA 3T02A 3FOFA 1O2BA 3GEEA 2JH3A 4MQ9A 4LJZA 3H0GC 3EQLA 4KAWX 1TWCA 4OIPA 5M5WK 1Y1VK 3HOZC 2GAHC 4KMDA 1DD5A 2R92A 2WB1D 4RMFA 3K7AC 5C4XK 1USOA 1I50K 5EGHA 1WCMA 3ADAC 3H3VL 1WOSA 4G0WA 1VJEA 1WQHA 1XXCA 2FQTA 2JA7A 3T01A 3GTOA 1DCPA 3BP3A 3N0BA 3I4NK 4C3HK 2E2HK 4A93K 1SMYA 4XSXA 4A3CC 2PA8D 3FKIA 4G7HA 1F9NA 3GTQC 2NVYC 4OIOA 1DCOA 1KQ4A 2RGRA 2B63C 2E2JC 1HQMA 2O5IA 5IYBC 1J6VA 3GTGC 1BJTA 4GTEA 3H3VD 3AD7C 1RU0A 5M3MK 4A3DC 3S16K 1VLOA 2JA6C 2PMZL 1SFOK 4KMUA 3AD9C 2P8TA 4A3IC 3AH5A 3I4MK 3GTLK 2XCOA 4A3KK 1TWGC 4GTLA 4KARA 2NVTK 1K83A 3PO3C 5D4DA 4KN4A 2E2IA 5C4JC 4Y52K 3HOYC 4BXXC 4BY1C 4YFKA 4AYBL 3GTOC 4QJVB 3QX3A 4C45A 4A3EC 1TWHK 4XLPA 3GTKK 2PMZD 1UV7A 3GTPA 1WIHA 3S1MC 4GTFA 4KDDA 4BLBA 2R7ZK 2CFAA 5C44C 3HOWK 5IP7K 3H0GA 4LR2A 1V5VA 4C3JC 4LOWA 4BBRK 1C0AA 1WOOA 4NOIA 1IE0A 3S17C 1VH2A 3HOVK 4OINA 3S2DC 5IYCK 4A3LK 4QJVA 5JVOA 3OPFA 5TMCA 1XPPA 1F93A 1I6HK 5C4XC 1USMA 3HXAA 2NVYA 1I50C 3GEIA 1YNJA 4MEXA 1I3QK 1TWAK 3CQZK 1O27A 3OREA 4GZYA 3WODA 3MMLB 4GTDA 3I4NC 4C3HC 2E2HC 3M4OC 4A93C 1EK8A 3S1RC 4OIQA 3RZDK 2D6FC 1IL2A 5JFEA 1ZBSA 5M3FK 2NVXK 2P5MA 1WSVA 3GDZA 4BKWA 3S1QK 1TWGA 4BBSK 4GTAA 2NVQC 3S16C 4WILA 1B4AA 1O2FB 5IOQA 4YG2A 1B4BA 1SFOC 4G0VA 1JOEA 4C3IK 1GE9A 5E68A 1XXBA 3HOXK 4A3BK 3HOUK 1ZQ1C 1X31C 4Y7NK 2YU9K 3I4MC 2PHCB 3GTLC 4A3KC 3A8KA 3CAGA 2V6SA 4LK1A 2NVTC 4Y52C 2RH6A 4PABA 1J6WA 2V6TA 5IOTA 1JQWA 1YX2A 1J6XA 2JA8K 4P9SA 2V6UA 4X6AC 1TWHC 4P5BA 4ZH4A 1TWFK 4KC6A 4KM9A 4KM8A 2VUMK 4A3JK 3GTMK 1O28A 4C2MK 3GIRA 2R93K 5CHPA 2R7ZC 3S1NK 4MEYA 3HOWC 3HOZK 1WSRA 5IYDK 3VA7A 5TMFA 5FLMK 4J3NA 1Y1VA 2JA5K 4KASA 1EI6A 1AB4A 4A3MC 1I50A 3DXJA 4KB2A 2A68A 5IYCC 2ZUFA 1IQ0A 2WAQD 3S14K 4A3LC 5HL8A 4A3CK 1BS2A 2BE5A 3GTQK 2E2HA 1PJ6A 3GTJK 3RZOK 1I6HC 2GSNA 2B63K 2E2JK 3AD8C 4QIWL 5IYBK 3GTGK 1TWAC 1HI9A
chains in the Genus database with same CATH topology
1DCHA 3HXAA 1RU0A 4WILA 1USOA 3JSTA 2V6UA 1F93A 4LOWA 1DCOA 2V6SA 2V6TA 2EBBA 4C45A 1DCPA 1USMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCH A;  3HXA A;  1RU0 A;  4WIL A;  1USO A;  3JST A;  2V6U A;  1F93 A;  4LOW A;  1DCO A;  2V6S A;  2V6T A;  2EBB A;  4C45 A;  1DCP A;  1USM A; 
#chains in the Genus database with same CATH topology
 3CQZ C;  1R9T K;  5TJ3 A;  3PO2 K;  5C3E K;  3OEP A;  1TWF A;  1SFO A;  1JVI A;  1TWC K;  4YFN A;  1XXA A;  5IP9 K;  4P5A A;  2R93 A;  3M3Y K;  4JK1 A;  2R92 K;  4OIR A;  3LAJ A;  4BY7 K;  1Y1V C;  3S2H K;  1YNN A;  1WCM K;  3G4A A;  1Y1W K;  3S1Q C;  3GTL A;  2XCQ A;  3TFJ A;  5C4J K;  4BBS C;  2KWA A;  4LQY A;  2JA7 K;  2Y3P A;  4QIW D;  1O29 A;  3A8J A;  1G51 A;  3GTO K;  4A3F K;  2FQO A;  2EBB A;  1VGX A;  3FKI K;  3FOE A;  1ZXO A;  1BGW A;  1TWH A;  3HOX C;  4A3B C;  3HOU C;  1ZYR A;  3GTK A;  4Y7N C;  2YU9 C;  3TFH A;  4GFQ A;  4LLG A;  3JST A;  2R7Z A;  1I6V A;  2W7V A;  3S15 K;  2JA8 C;  3S17 K;  3TTG A;  2ZFZ A;  1TWF C;  2XCR B;  4KB4 A;  4A3J C;  2VUM C;  3T00 A;  4C2M C;  2R93 C;  2PPB A;  3S1N C;  4KAT A;  1EFW A;  1K83 K;  3A8I A;  1IBA A;  2E2I K;  5IYD C;  5FLM C;  1F7U A;  2JA5 C;  3N3Y A;  4O2D A;  1Y1W A;  3TFI A;  1F7V A;  1O24 A;  1VRQ C;  1XZP B;  5IOR A;  5L46 A;  2Y0S L;  2CW0 A;  4FM9 A;  4A3G K;  4XCH A;  1I3Q A;  1TWA A;  2WAQ L;  3CQZ A;  3S14 C;  3GTP K;  4G7O A;  3BUE A;  1WOP A;  3AQP A;  3GTK C;  4GT9 A;  3M4O K;  1IW7 A;  5IOS A;  3S1R K;  4PAA A;  4Q4Z A;  3GTJ C;  3RZO C;  3H0G K;  1BDF A;  2A69 A;  1IS1 A;  5IP7 C;  3K7A K;  2NVX A;  4WJ3 M;  4XSZ A;  4BBR C;  3SZZ A;  3L4J A;  4WJ4 A;  2NVQ K;  1R9T C;  3HOV C;  3N0C A;  2ZUE A;  3NUH A;  2Y0S D;  3PO2 C;  2CFA B;  3GSI A;  1DCH A;  1XZP A;  5C3E C;  4LK0 A;  1TWC C;  2O5J A;  3S0X A;  3SZY A;  5IP9 C;  3M3Y C;  4FZB A;  2R92 C;  4BY7 C;  3S2H C;  3HKZ L;  2NVY K;  4G0U A;  1WCM C;  1XZQ B;  2YU9 A;  1YCL A;  1Y1W C;  1ZVU A;  2GSU A;  3Q3Q A;  2JA7 C;  4YFX A;  4XLN A;  1I3Q C;  4A3F C;  3LPX A;  4A3D K;  1O25 A;  1WQF A;  4X6A K;  1EH1 A;  4AH6 A;  2JA6 K;  3FKI C;  3IPJ A;  3G4C A;  3V4G A;  4KMH A;  3GTM A;  4DDQ A;  2VUM A;  4A3I K;  3RZD C;  5EGE A;  3LAP A;  1WQG A;  2NVX C;  4Q5S A;  1TWG K;  3HKZ D;  5M5Y K;  1O2A A;  2A6E A;  3PO3 K;  3S15 C;  2JA5 A;  3L4K A;  1XZQ A;  3HOY K;  5CJ9 A;  4A3M K;  1PJ7 A;  4BXX K;  4BY1 K;  5M5X K;  5FJ8 K;  4AYB D;  1ISE A;  3FHZ A;  4A3E K;  4C3I C;  3BP8 C;  2A6H A;  1O26 A;  3S1M K;  4M1X A;  1PJ5 A;  1EQR A;  1K83 C;  3GTQ A;  2E2I C;  2WB1 L;  5C44 K;  2GSO A;  3ERE D;  3GTJ A;  1WOR A;  1L0W A;  1INN A;  4ILD A;  4C3J K;  2B63 A;  4GTC A;  1J98 A;  4GTB A;  4A3G C;  4KMA A;  4KN7 A;  3GEH A;  2GAG C;  3GTG A;  4BLA A;  3GTP C;  4G7Z A;  1R9T A;  3S2D K;  2JA6 A;  2PA8 L;  3GTM C;  3AQO A;  3T02 A;  3FOF A;  1O2B A;  3GEE A;  2JH3 A;  4MQ9 A;  4LJZ A;  3H0G C;  3EQL A;  4KAW X;  1TWC A;  4OIP A;  5M5W K;  1Y1V K;  3HOZ C;  2GAH C;  4KMD A;  1DD5 A;  2R92 A;  2WB1 D;  4RMF A;  3K7A C;  5C4X K;  1USO A;  1I50 K;  5EGH A;  1WCM A;  3ADA C;  3H3V L;  1WOS A;  4G0W A;  1VJE A;  1WQH A;  1XXC A;  2FQT A;  2JA7 A;  3T01 A;  3GTO A;  1DCP A;  3BP3 A;  3N0B A;  3I4N K;  4C3H K;  2E2H K;  4A93 K;  1SMY A;  4XSX A;  4A3C C;  2PA8 D;  3FKI A;  4G7H A;  1F9N A;  3GTQ C;  2NVY C;  4OIO A;  1DCO A;  1KQ4 A;  2RGR A;  2B63 C;  2E2J C;  1HQM A;  2O5I A;  5IYB C;  1J6V A;  3GTG C;  1BJT A;  4GTE A;  3H3V D;  3AD7 C;  1RU0 A;  5M3M K;  4A3D C;  3S16 K;  1VLO A;  2JA6 C;  2PMZ L;  1SFO K;  4KMU A;  3AD9 C;  2P8T A;  4A3I C;  3AH5 A;  3I4M K;  3GTL K;  2XCO A;  4A3K K;  1TWG C;  4GTL A;  4KAR A;  2NVT K;  1K83 A;  3PO3 C;  5D4D A;  4KN4 A;  2E2I A;  5C4J C;  4Y52 K;  3HOY C;  4BXX C;  4BY1 C;  4YFK A;  4AYB L;  3GTO C;  4QJV B;  3QX3 A;  4C45 A;  4A3E C;  1TWH K;  4XLP A;  3GTK K;  2PMZ D;  1UV7 A;  3GTP A;  1WIH A;  3S1M C;  4GTF A;  4KDD A;  4BLB A;  2R7Z K;  2CFA A;  5C44 C;  3HOW K;  5IP7 K;  3H0G A;  4LR2 A;  1V5V A;  4C3J C;  4LOW A;  4BBR K;  1C0A A;  1WOO A;  4NOI A;  1IE0 A;  3S17 C;  1VH2 A;  3HOV K;  4OIN A;  3S2D C;  5IYC K;  4A3L K;  4QJV A;  5JVO A;  3OPF A;  5TMC A;  1XPP A;  1F93 A;  1I6H K;  5C4X C;  1USM A;  3HXA A;  2NVY A;  1I50 C;  3GEI A;  1YNJ A;  4MEX A;  1I3Q K;  1TWA K;  3CQZ K;  1O27 A;  3ORE A;  4GZY A;  3WOD A;  3MML B;  4GTD A;  3I4N C;  4C3H C;  2E2H C;  3M4O C;  4A93 C;  1EK8 A;  3S1R C;  4OIQ A;  3RZD K;  2D6F C;  1IL2 A;  5JFE A;  1ZBS A;  5M3F K;  2NVX K;  2P5M A;  1WSV A;  3GDZ A;  4BKW A;  3S1Q K;  1TWG A;  4BBS K;  4GTA A;  2NVQ C;  3S16 C;  4WIL A;  1B4A A;  1O2F B;  5IOQ A;  4YG2 A;  1B4B A;  1SFO C;  4G0V A;  1JOE A;  4C3I K;  1GE9 A;  5E68 A;  1XXB A;  3HOX K;  4A3B K;  3HOU K;  1ZQ1 C;  1X31 C;  4Y7N K;  2YU9 K;  3I4M C;  2PHC B;  3GTL C;  4A3K C;  3A8K A;  3CAG A;  2V6S A;  4LK1 A;  2NVT C;  4Y52 C;  2RH6 A;  4PAB A;  1J6W A;  2V6T A;  5IOT A;  1JQW A;  1YX2 A;  1J6X A;  2JA8 K;  4P9S A;  2V6U A;  4X6A C;  1TWH C;  4P5B A;  4ZH4 A;  1TWF K;  4KC6 A;  4KM9 A;  4KM8 A;  2VUM K;  4A3J K;  3GTM K;  1O28 A;  4C2M K;  3GIR A;  2R93 K;  5CHP A;  2R7Z C;  3S1N K;  4MEY A;  3HOW C;  3HOZ K;  1WSR A;  5IYD K;  3VA7 A;  5TMF A;  5FLM K;  4J3N A;  1Y1V A;  2JA5 K;  4KAS A;  1EI6 A;  1AB4 A;  4A3M C;  1I50 A;  3DXJ A;  4KB2 A;  2A68 A;  5IYC C;  2ZUF A;  1IQ0 A;  2WAQ D;  3S14 K;  4A3L C;  5HL8 A;  4A3C K;  1BS2 A;  2BE5 A;  3GTQ K;  2E2H A;  1PJ6 A;  3GTJ K;  3RZO K;  1I6H C;  2GSN A;  2B63 K;  2E2J K;  3AD8 C;  4QIW L;  5IYB K;  3GTG K;  1TWA C;  1HI9 A; 
#chains in the Genus database with same CATH homology
 1DCH A;  3HXA A;  1RU0 A;  4WIL A;  1USO A;  3JST A;  2V6U A;  1F93 A;  4LOW A;  1DCO A;  2V6S A;  2V6T A;  2EBB A;  4C45 A;  1DCP A;  1USM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...