1F93A

Crystal structure of a complex between the dimerization domain of hnf-1 alpha and the coactivator dcoh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
103
structure length
103
Chain Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transcription
molecule keywords DIMERIZATION COFACTOR OF HEPATOCYTE NUCLEAR FACTOR 1-ALPHA
total genus 32
structure length 103
sequence length 103
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2000-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 1f93A00
1USMA 2V6SA 3HXAA 3JSTA 1RU0A 1DCPA 1DCOA 4LOWA 1USOA 4C45A 2EBBA 1F93A 2V6UA 4WILA 1DCHA 2V6TA
chains in the Genus database with same CATH superfamily
4DDQA 1HI9A 4LK0A 1J98A 3GTJK 3HOYC 3GTLK 2R93A 3HOZK 2D6FC 5IOTA 3S1QC 1F7UA 4XCHA 3GTOA 1WSRA 2YU9C 4BLAA 4ILDA 3OEPA 3AD8C 3GEIA 4G7ZA 1WQGA 2EBBA 3S2DK 3GTMA 1SFOK 1WCMC 1I50A 1I3QK 4A3JC 4G7OA 3HOVC 4MEXA 4A3JK 4Y7NK 1I50K 1SFOC 5D4DA 3S2DC 4P9SA 5FLMC 2ZUEA 2YU9K 3HKZD 4C3HK 4QIWL 3IPJA 1C0AA 3S1QK 4XLPA 3HOZC 1V5VA 4KM8A 1XZPA 3GTJC 4GTFA 4C3HC 1TWAA 4P5AA 2JA6A 2PPBA 2R7ZA 5TMFA 2A6EA 4A3MC 3TFJA 5FLMK 4KAWX 3GTJA 2O5IA 1L0WA 2GAHC 1I50C 1WCMA 1J6VA 4Y7NC 3HOVK 2XCRB 3AD7C 4C3JC 1TWFA 1I3QC 2VUMC 1VLOA 1WCMK 3LAPA 5IYDK 2E2JK 4ZH4A 5IYCC 1XXBA 2WB1D 3T01A 5C44C 1AB4A 4A3DC 1VGXA 2CW0A 2FQTA 4KB2A 3AQOA 4P5BA 2Y0SL 3GTLC 4BY1C 2ZFZA 3HOYK 3S1NC 4A3GC 1BDFA 5EGEA 3GTPK 4A3EC 3I4NK 2GSOA 1O25A 1ZXOA 5C4XC 2RH6A 4A3LK 5HL8A 1BJTA 1O26A 3LPXA 1HQMA 3K7AC 1F93A 1Y1WA 1DCHA 3T02A 2B63C 4A3KC 3S2HC 1O2BA 1G51A 1XZPB 1TWCA 2ZUFA 2JA8C 2JA6K 1ZYRA 3BUEA 3NUHA 2R92C 3M4OK 3T00A 2NVXC 1XXCA 1IL2A 3N0CA 3DXJA 4G0VA 4NOIA 2Y0SD 3M3YC 2CFAA 5TMCA 3GDZA 1WOPA 2CFAB 4KB4A 1YX2A 4BBSC 3FKIK 3H0GK 4A3BC 1F7VA 3L4KA 3CAGA 4A3FC 2NVTC 2VUMA 3S1MK 3PO2K 4A3IK 4LLGA 3A8IA 3S15K 4OIPA 1TWCC 3LAJA 1O28A 4YG2A 2E2IC 4BY7C 4J3NA 2V6TA 2E2HC 4BLBA 1VRQC 2NVQC 4KN7A 3VA7A 3S14K 4KDDA 4WILA 5M3FK 1TWHK 2E2HA 3G4AA 3GTLA 1Y1WK 5CHPA 4KMHA 4AYBL 3N0BA 1O2FB 3GIRA 5C3EK 2GSUA 4X6AC 3CQZK 4Y52C 3I4MK 1ZVUA 2JA5A 2A6HA 4GTLA 4XLNA 3FOFA 1GE9A 4WJ3M 4LR2A 1I6VA 3HOXK 4G0UA 3GSIA 4LK1A 1WIHA 3GEEA 4KN4A 2XCQA 1WORA 4BXXC 4LJZA 1TWFC 2WAQL 4BBRC 4RMFA 4OINA 4A93C 5CJ9A 3GTGK 2P8TA 3ERED 1EK8A 3OREA 3HOWC 1K83C 5TJ3A 4KASA 1I6HC 3GTGA 2NVXA 1TWAC 5IP9C 1J6WA 4C3IC 2NVYC 2R93K 1TWGA 1R9TC 3HOUK 3RZDK 4Q5SA 2A69A 2R7ZK 3FOEA 1Y1VK 3V4GA 3AD9C 1B4BA 1IQ0A 3GTOK 4MQ9A 3Q3QA 3GTKA 3S16K 1XXAA 1UV7A 3S0XA 2JA7C 3GTMK 1F9NA 3CQZA 4AH6A 1DCOA 2JA5K 5IYBK 4C2MC 4C45A 5C4JK 3S1RK 3TFHA 5IP7K 3S17C 3PO3K 4KARA 4QJVB 1INNA 3A8JA 4MEYA 3RZOK 4A3CC 3GTKC 3PO3C 5EGHA 5IP7C 1SMYA 1I3QA 5C4JC 4YFXA 4YFNA 3QX3A 5IYBC 3BP3A 3HXAA 2PA8L 2JA5C 1DD5A 1JQWA 4KM9A 1TWGC 1R9TA 3GTQK 1VH2A 2WB1L 3G4CA 2JA7K 4XSZA 3S16C 2Y3PA 4JK1A 1O27A 3FHZA 4GFQA 2JA7A 1IW7A 1Y1VC 2KWAA 3TFIA 2R7ZC 3HOUC 1TWGK 2BE5A 3GTQC 2R93C 2NVYK 2JH3A 1TWAK 4KMDA 1PJ5A 4KATA 3GTKK 2PA8D 1I6HK 1USMA 4A3CK 1ISEA 3RZOC 1YNNA 1K83K 3HOWK 4PAAA 5L46A 3S17K 3S1RC 4C2MK 4LQYA 1EQRA 4A93K 3OPFA 1DCPA 1XZQA 1K83A 1TWFK 4BBRK 5IORA 2FQOA 1SFOA 1ZBSA 4BXXK 1WOOA 3H3VD 3GTMC 3JSTA 4KMUA 1J6XA 1RU0A 1WOSA 3TTGA 4OIQA 3N3YA 4QJVA 3HOXC 3GTOC 3H3VL 3RZDC 2R92A 1R9TK 2PHCB 3GTQA 5IOSA 4AYBD 5M3MK 1USOA 1EI6A 1XZQB 5C3EC 4C3IK 4GTDA 5IP9K 3SZYA 3ADAC 1Y1WC 2RGRA 4PABA 1JOEA 4FM9A 3S14C 3GTGC 2NVQK 3WODA 4BY7K 2NVYA 2GSNA 1EH1A 1O24A 5M5YK 5JFEA 1TWCK 1IS1A 4GTBA 3S15C 3PO2C 5M5WK 2V6UA 3S1MC 1O2AA 4G7HA 2O5JA 4OIRA 3FKIC 3H0GC 4A3BK 3I4MC 1YNJA 3CQZC 4GTAA 4X6AK 4Y52K 1IE0A 2GAGC 3EQLA 1YCLA 3M3YK 5E68A 3FKIA 1PJ6A 3H0GA 1BS2A 1O29A 3HKZL 1TWHC 1BGWA 1WQFA 2NVXK 3GEHA 1WQHA 4GZYA 3GTPA 3M4OC 4QIWD 2R92K 5JVOA 2E2HK 4Q4ZA 5M5XK 5FJ8K 1B4AA 1ZQ1C 4FZBA 2E2IK 4M1XA 2JA8K 4A3KK 3S2HK 1X31C 1EFWA 4KC6A 3BP8C 3K7AK 4LOWA 4A3IC 2E2IA 2NVTK 4GT9A 4A3FK 1TWHA 4XSXA 2P5MA 5C4XK 3I4NC 4A3EK 3MMLB 4BBSK 1XPPA 3GTPC 4GTCA 3AQPA 3S1NK 4A3GK 4BY1K 4OIOA 3L4JA 1PJ7A 2V6SA 4KMAA 3SZZA 5C44K 4A3DK 4WJ4A 3A8KA 4O2DA 2WAQD 5IYCK 2E2JC 5IYDC 2YU9A 3AH5A 2VUMK 2JA6C 4BKWA 2W7VA 4C3JK 2PMZL 2B63K 4YFKA 2PMZD 4G0WA 4GTEA 1VJEA 2A68A 1KQ4A 2XCOA 5IOQA 1Y1VA 4A3LC 2B63A 4A3MK 1IBAA 1JVIA 1WSVA
chains in the Genus database with same CATH topology
1USMA 2V6SA 3HXAA 3JSTA 1RU0A 1DCPA 1DCOA 4LOWA 1USOA 4C45A 2EBBA 1F93A 2V6UA 4WILA 1DCHA 2V6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USM A;  2V6S A;  3HXA A;  3JST A;  1RU0 A;  1DCP A;  1DCO A;  4LOW A;  1USO A;  4C45 A;  2EBB A;  1F93 A;  2V6U A;  4WIL A;  1DCH A;  2V6T A; 
#chains in the Genus database with same CATH topology
 4DDQ A;  1HI9 A;  4LK0 A;  1J98 A;  3GTJ K;  3HOY C;  3GTL K;  2R93 A;  3HOZ K;  2D6F C;  5IOT A;  3S1Q C;  1F7U A;  4XCH A;  3GTO A;  1WSR A;  2YU9 C;  4BLA A;  4ILD A;  3OEP A;  3AD8 C;  3GEI A;  4G7Z A;  1WQG A;  2EBB A;  3S2D K;  3GTM A;  1SFO K;  1WCM C;  1I50 A;  1I3Q K;  4A3J C;  4G7O A;  3HOV C;  4MEX A;  4A3J K;  4Y7N K;  1I50 K;  1SFO C;  5D4D A;  3S2D C;  4P9S A;  5FLM C;  2ZUE A;  2YU9 K;  3HKZ D;  4C3H K;  4QIW L;  3IPJ A;  1C0A A;  3S1Q K;  4XLP A;  3HOZ C;  1V5V A;  4KM8 A;  1XZP A;  3GTJ C;  4GTF A;  4C3H C;  1TWA A;  4P5A A;  2JA6 A;  2PPB A;  2R7Z A;  5TMF A;  2A6E A;  4A3M C;  3TFJ A;  5FLM K;  4KAW X;  3GTJ A;  2O5I A;  1L0W A;  2GAH C;  1I50 C;  1WCM A;  1J6V A;  4Y7N C;  3HOV K;  2XCR B;  3AD7 C;  4C3J C;  1TWF A;  1I3Q C;  2VUM C;  1VLO A;  1WCM K;  3LAP A;  5IYD K;  2E2J K;  4ZH4 A;  5IYC C;  1XXB A;  2WB1 D;  3T01 A;  5C44 C;  1AB4 A;  4A3D C;  1VGX A;  2CW0 A;  2FQT A;  4KB2 A;  3AQO A;  4P5B A;  2Y0S L;  3GTL C;  4BY1 C;  2ZFZ A;  3HOY K;  3S1N C;  4A3G C;  1BDF A;  5EGE A;  3GTP K;  4A3E C;  3I4N K;  2GSO A;  1O25 A;  1ZXO A;  5C4X C;  2RH6 A;  4A3L K;  5HL8 A;  1BJT A;  1O26 A;  3LPX A;  1HQM A;  3K7A C;  1F93 A;  1Y1W A;  1DCH A;  3T02 A;  2B63 C;  4A3K C;  3S2H C;  1O2B A;  1G51 A;  1XZP B;  1TWC A;  2ZUF A;  2JA8 C;  2JA6 K;  1ZYR A;  3BUE A;  3NUH A;  2R92 C;  3M4O K;  3T00 A;  2NVX C;  1XXC A;  1IL2 A;  3N0C A;  3DXJ A;  4G0V A;  4NOI A;  2Y0S D;  3M3Y C;  2CFA A;  5TMC A;  3GDZ A;  1WOP A;  2CFA B;  4KB4 A;  1YX2 A;  4BBS C;  3FKI K;  3H0G K;  4A3B C;  1F7V A;  3L4K A;  3CAG A;  4A3F C;  2NVT C;  2VUM A;  3S1M K;  3PO2 K;  4A3I K;  4LLG A;  3A8I A;  3S15 K;  4OIP A;  1TWC C;  3LAJ A;  1O28 A;  4YG2 A;  2E2I C;  4BY7 C;  4J3N A;  2V6T A;  2E2H C;  4BLB A;  1VRQ C;  2NVQ C;  4KN7 A;  3VA7 A;  3S14 K;  4KDD A;  4WIL A;  5M3F K;  1TWH K;  2E2H A;  3G4A A;  3GTL A;  1Y1W K;  5CHP A;  4KMH A;  4AYB L;  3N0B A;  1O2F B;  3GIR A;  5C3E K;  2GSU A;  4X6A C;  3CQZ K;  4Y52 C;  3I4M K;  1ZVU A;  2JA5 A;  2A6H A;  4GTL A;  4XLN A;  3FOF A;  1GE9 A;  4WJ3 M;  4LR2 A;  1I6V A;  3HOX K;  4G0U A;  3GSI A;  4LK1 A;  1WIH A;  3GEE A;  4KN4 A;  2XCQ A;  1WOR A;  4BXX C;  4LJZ A;  1TWF C;  2WAQ L;  4BBR C;  4RMF A;  4OIN A;  4A93 C;  5CJ9 A;  3GTG K;  2P8T A;  3ERE D;  1EK8 A;  3ORE A;  3HOW C;  1K83 C;  5TJ3 A;  4KAS A;  1I6H C;  3GTG A;  2NVX A;  1TWA C;  5IP9 C;  1J6W A;  4C3I C;  2NVY C;  2R93 K;  1TWG A;  1R9T C;  3HOU K;  3RZD K;  4Q5S A;  2A69 A;  2R7Z K;  3FOE A;  1Y1V K;  3V4G A;  3AD9 C;  1B4B A;  1IQ0 A;  3GTO K;  4MQ9 A;  3Q3Q A;  3GTK A;  3S16 K;  1XXA A;  1UV7 A;  3S0X A;  2JA7 C;  3GTM K;  1F9N A;  3CQZ A;  4AH6 A;  1DCO A;  2JA5 K;  5IYB K;  4C2M C;  4C45 A;  5C4J K;  3S1R K;  3TFH A;  5IP7 K;  3S17 C;  3PO3 K;  4KAR A;  4QJV B;  1INN A;  3A8J A;  4MEY A;  3RZO K;  4A3C C;  3GTK C;  3PO3 C;  5EGH A;  5IP7 C;  1SMY A;  1I3Q A;  5C4J C;  4YFX A;  4YFN A;  3QX3 A;  5IYB C;  3BP3 A;  3HXA A;  2PA8 L;  2JA5 C;  1DD5 A;  1JQW A;  4KM9 A;  1TWG C;  1R9T A;  3GTQ K;  1VH2 A;  2WB1 L;  3G4C A;  2JA7 K;  4XSZ A;  3S16 C;  2Y3P A;  4JK1 A;  1O27 A;  3FHZ A;  4GFQ A;  2JA7 A;  1IW7 A;  1Y1V C;  2KWA A;  3TFI A;  2R7Z C;  3HOU C;  1TWG K;  2BE5 A;  3GTQ C;  2R93 C;  2NVY K;  2JH3 A;  1TWA K;  4KMD A;  1PJ5 A;  4KAT A;  3GTK K;  2PA8 D;  1I6H K;  1USM A;  4A3C K;  1ISE A;  3RZO C;  1YNN A;  1K83 K;  3HOW K;  4PAA A;  5L46 A;  3S17 K;  3S1R C;  4C2M K;  4LQY A;  1EQR A;  4A93 K;  3OPF A;  1DCP A;  1XZQ A;  1K83 A;  1TWF K;  4BBR K;  5IOR A;  2FQO A;  1SFO A;  1ZBS A;  4BXX K;  1WOO A;  3H3V D;  3GTM C;  3JST A;  4KMU A;  1J6X A;  1RU0 A;  1WOS A;  3TTG A;  4OIQ A;  3N3Y A;  4QJV A;  3HOX C;  3GTO C;  3H3V L;  3RZD C;  2R92 A;  1R9T K;  2PHC B;  3GTQ A;  5IOS A;  4AYB D;  5M3M K;  1USO A;  1EI6 A;  1XZQ B;  5C3E C;  4C3I K;  4GTD A;  5IP9 K;  3SZY A;  3ADA C;  1Y1W C;  2RGR A;  4PAB A;  1JOE A;  4FM9 A;  3S14 C;  3GTG C;  2NVQ K;  3WOD A;  4BY7 K;  2NVY A;  2GSN A;  1EH1 A;  1O24 A;  5M5Y K;  5JFE A;  1TWC K;  1IS1 A;  4GTB A;  3S15 C;  3PO2 C;  5M5W K;  2V6U A;  3S1M C;  1O2A A;  4G7H A;  2O5J A;  4OIR A;  3FKI C;  3H0G C;  4A3B K;  3I4M C;  1YNJ A;  3CQZ C;  4GTA A;  4X6A K;  4Y52 K;  1IE0 A;  2GAG C;  3EQL A;  1YCL A;  3M3Y K;  5E68 A;  3FKI A;  1PJ6 A;  3H0G A;  1BS2 A;  1O29 A;  3HKZ L;  1TWH C;  1BGW A;  1WQF A;  2NVX K;  3GEH A;  1WQH A;  4GZY A;  3GTP A;  3M4O C;  4QIW D;  2R92 K;  5JVO A;  2E2H K;  4Q4Z A;  5M5X K;  5FJ8 K;  1B4A A;  1ZQ1 C;  4FZB A;  2E2I K;  4M1X A;  2JA8 K;  4A3K K;  3S2H K;  1X31 C;  1EFW A;  4KC6 A;  3BP8 C;  3K7A K;  4LOW A;  4A3I C;  2E2I A;  2NVT K;  4GT9 A;  4A3F K;  1TWH A;  4XSX A;  2P5M A;  5C4X K;  3I4N C;  4A3E K;  3MML B;  4BBS K;  1XPP A;  3GTP C;  4GTC A;  3AQP A;  3S1N K;  4A3G K;  4BY1 K;  4OIO A;  3L4J A;  1PJ7 A;  2V6S A;  4KMA A;  3SZZ A;  5C44 K;  4A3D K;  4WJ4 A;  3A8K A;  4O2D A;  2WAQ D;  5IYC K;  2E2J C;  5IYD C;  2YU9 A;  3AH5 A;  2VUM K;  2JA6 C;  4BKW A;  2W7V A;  4C3J K;  2PMZ L;  2B63 K;  4YFK A;  2PMZ D;  4G0W A;  4GTE A;  1VJE A;  2A68 A;  1KQ4 A;  2XCO A;  5IOQ A;  1Y1V A;  4A3L C;  2B63 A;  4A3M K;  1IBA A;  1JVI A;  1WSV A; 
#chains in the Genus database with same CATH homology
 1USM A;  2V6S A;  3HXA A;  3JST A;  1RU0 A;  1DCP A;  1DCO A;  4LOW A;  1USO A;  4C45 A;  2EBB A;  1F93 A;  2V6U A;  4WIL A;  1DCH A;  2V6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...