5C44K

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c44K00
3HOUC 4G7ZA 3K7AK 5IYCC 3S17C 3HOXK 3S14K 3S1QK 2WAQD 4QJVB 2YU9K 4LK1A 4QJVA 3CQZC 4QIWD 3GTQK 4A93C 4C3IK 2R7ZC 3I4NK 2NVYC 1TWHC 3M3YC 4BY1K 3PO3C 2O5IA 4BXXC 1BDFA 1TWGC 2Y0SL 4LLGA 4Y52C 4G7HA 2VUMK 3GTJC 3HKZD 4A3IC 4JK1A 3GTPC 1K83C 4BBSC 3HOZK 2WB1D 4Y7NK 1Y1VC 2NVXC 1TWAC 3S1RK 5TMCA 3S15K 2E2IC 1I6VA 2JA5K 2JA7K 2PMZL 5IP9C 4MEYA 2R92C 5IP7C 4KN4A 3HOVK 4A3DC 4A3CK 4YFNA 3GTOC 2A69A 2A68A 3H0GK 5FLMK 1R9TC 4A3BC 3RZOK 5M5XK 4A3JK 4MEXA 3HOYK 3S2HK 3DXJA 1WCMC 3H3VD 3GTLC 4A3EK 1I3QC 1Y1WK 2BE5A 2E2HC 1TWCC 2PA8D 3GTKK 5IYDC 2R93K 5M5YK 3EQLA 3S1MK 4A3GC 2B63K 3RZDK 2NVTC 4X6AC 4A3MK 4C3HK 4C2MK 1SFOC 3GTGK 1I50C 3WODA 5C4XK 3HOWC 4BBRK 5C3EC 2JA5C 3K7AC 3I4MC 4C3JK 3S2DK 3HOXC 4A3KK 2NVQK 4BY7K 4QIWL 2JA8K 3S1QC 3GTMK 1TWHK 2YU9C 5C44K 4KN7A 3M4OK 1SMYA 4OINA 3GTQC 5FJ8K 3PO2K 1TWGK 4XLNA 5M3FK 5IYBK 3I4NC 2JA6K 4BY1C 4OIPA 1IW7A 2Y0SD 4YFKA 1TWFK 3HKZL 2PPBA 3GTPK 3S1NK 2E2JK 2VUMC 2WB1L 3FKIK 4AYBD 1TWAK 4Q5SA 4Y7NC 4A3FK 2CW0A 3S1RC 2R92K 4A3DK 1YNNA 3S15C 4A3LC 1I6HK 1YNJA 4YG2A 2PMZD 3HOUK 5IYCK 4XLPA 3HOVC 3S17K 5M3MK 3S16C 5C4JC 4A3CC 4ZH4A 3H0GC 4KMUA 5FLMC 4XSXA 3RZOC 4LK0A 3H3VL 1ZYRA 3HOYC 2WAQL 5D4DA 3CQZK 3S2HC 4A93K 2PA8L 3I4MK 3S14C 2R7ZK 4OIOA 2NVYK 3M3YK 3PO3K 2R93C 4BXXK 3GTKC 3S1MC 4Y52K 2B63C 3RZDC 5M5WK 3HOWK 4A3MC 2O5JA 2A6EA 3GTJK 4MQ9A 3GTGC 4A3IK 1K83K 4BBSK 5C4XC 4BBRC 1Y1VK 3S2DC 4A3KC 2NVQC 2NVXK 4BY7C 4YFXA 2JA8C 3HOZC 3GTMC 2E2IK 5C44C 3M4OC 4G7OA 3PO2C 5IP9K 4OIQA 5IP7K 5IYBC 2JA6C 2A6HA 3GTOK 1HQMA 2JA7C 1R9TK 4A3BK 1TWFC 4AYBL 3S1NC 2E2JC 3FKIC 4OIRA 1WCMK 5TMFA 3GTLK 4A3JC 1I3QK 2E2HK 1TWCK 4A3FC 5IYDK 4A3LK 4GZYA 4A3EC 4Q4ZA 4A3GK 4X6AK 2NVTK 1Y1WC 1SFOK 3S16K 4NOIA 4XSZA 5C4JK 1I6HC 4LJZA 1I50K 1XPPA 5C3EK
chains in the Genus database with same CATH superfamily
5IYCC 5IOTA 4QJVB 3A8IA 4QIWD 4A93C 5EGEA 1WIHA 4BY1K 2RH6A 2R7ZA 4BXXC 4AH6A 2Y0SL 1ZBSA 1USMA 3TFHA 1TWFA 3GTPA 1TWAC 5JFEA 3FKIA 3Q3QA 4WJ4A 4MEYA 4FM9A 1WQFA 4YFNA 4A3CK 2A69A 3H0GK 4J3NA 1R9TC 2V6TA 4GFQA 1XZQA 2GAHC 2XCRB 2BE5A 5IYDC 1VGXA 3S1MK 3EQLA 3CQZA 3RZDK 4C2MK 2NVYA 1SFOC 3GEIA 3WODA 3K7AC 2P5MA 2V6UA 3S2DK 4A3KK 2GSNA 2JA8K 3S1QC 2YU9C 5C44K 3M4OK 3LAJA 1Y1VA 1TWGK 4XLNA 5M3FK 2NVXA 3GTQA 1EK8A 1PJ6A 3BUEA 4OIPA 4YFKA 3HKZL 1X31C 4G0UA 1AB4A 2WB1L 1ZXOA 3LAPA 4Y7NC 4A3FK 4RMFA 4GTBA 1V5VA 4A3DK 1I3QA 1YNJA 2E2HA 4BKWA 5IYCK 3HOVC 4XSXA 3AD8C 3H3VL 1ZYRA 2WAQL 1I50A 3TFJA 3S2HC 1ISEA 4A93K 5IORA 4OIOA 2R93C 4KM8A 4BXXK 3GTKC 3HOWK 2A6EA 4FZBA 3L4KA 4BBRC 1WORA 2VUMA 4WJ3M 3N3YA 3S0XA 3GTMA 4P5AA 1HQMA 1R9TK 1TWFC 4AYBL 2E2JC 3FKIC 4OIRA 1YCLA 5TMFA 3VA7A 2XCOA 3A8KA 4A3LK 5IYDK 3BP8C 1SFOK 5C4JK 3HOUC 3K7AK 4C2MC 3S17C 4KATA 4GTLA 3S1QK 2YU9K 4LK1A 3CQZC 2NVYC 1IE0A 2O5IA 2FQTA 1BDFA 1TWHA 1TWGC 4G7HA 1J98A 4XCHA 4A3IC 2JA6A 3HOZK 4Y7NK 2CFAB 1Y1VC 2NVXC 5E68A 3CAGA 4GTCA 4M1XA 2JA7K 2PMZL 4KB2A 3HOVK 4A3DC 2R92A 4GTFA 3QX3A 4A3BC 4MEXA 3S2HK 3L4JA 4GTDA 1VH2A 1J6VA 1I3QC 1Y1WK 2E2HC 1ZVUA 2PA8D 3GTKK 1XXBA 2R93K 4X6AC 5EGHA 1VRQC 5IOSA 3N0CA 1IS1A 1I50C 3HOWC 4BBRK 3I4MC 1J6WA 1O24A 2GSOA 4QIWL 5JVOA 3I4NC 3GEEA 4KMAA 2Y0SD 4G0WA 1TWFK 2PPBA 3GTPK 3IPJA 2E2JK 2VUMC 3FKIK 1XZPA 4Q5SA 5HL8A 1EQRA 1O2FB 3AH5A 3S1RC 3GTLA 3S15C 1WOOA 4A3LC 1TWCA 3TTGA 3HOUK 3S17K 5C4JC 4ZH4A 5FLMC 3N0BA 3RZOC 4LR2A 3H0GA 4P9SA 5D4DA 3CQZK 3HOYC 2JA5A 4C45A 4BLAA 2Y3PA 2NVYK 1WSVA 2RGRA 1INNA 3GEHA 1VLOA 5M5WK 1IL2A 1F7UA 4C3HC 4A3IK 5C4XC 2PHCB 1Y1VK 1G51A 2NVXK 4BY7C 3HOZC 1B4BA 3TFIA 4G7OA 2JA6C 2GAGC 2JA7C 4A3BK 3S1NC 1I3QK 1BJTA 2E2HK 1JQWA 4GTAA 4X6AK 1Y1WC 1B4AA 3S16K 3LPXA 1I50K 3I4MK 4G7ZA 1RU0A 2B63A 3S14K 3GTGA 2WAQD 4QJVA 2R7ZC 3I4NK 2GSUA 3PO3C 1EFWA 4GT9A 4LLGA 4Y52C 1O27A 4KAWX 2VUMK 4LQYA 3GTPC 1L0WA 4BBSC 3S1RK 5TMCA 1TWAA 3S15K 3FOEA 5IP9C 5FLMK 1JOEA 3RZOK 1PJ5A 5M5XK 5CJ9A 3HOYK 1XZQB 3DXJA 5CHPA 4WILA 4A3EK 3GTLC 2ZFZA 1TWCC 5M5YK 3OEPA 2P8TA 1F9NA 4C3HK 1IBAA 5C4XK 2JA5C 3HOXC 4KC6A 1O28A 4BY7K 3GTJA 1TWHK 5L46A 1K83A 3GTQC 4O2DA 4C3IC 3SZZA 2JA6K 1IW7A 2E2IA 1ZQ1C 3T01A 4LOWA 3S1NK 3GTOA 1WOSA 1DCOA 1WOPA 1WCMA 4KDDA 4KM9A 2R92K 1YNNA 1DCPA 2PMZD 4XLPA 3S16C 5M3MK 2W7VA 4KARA 2PA8L 3S14C 2R7ZK 3PO3K 4KASA 2D6FC 3GDZA 4Y52K 2B63C 2O5JA 4A3MC 3ADAC 3GTGC 4BBSK 1UV7A 4C3JC 1F7VA 2EBBA 2NVQC 3AD9C 3OPFA 3GTMC 3PO2C 5IP9K 1BGWA 5IYBC 2A6HA 1XXAA 3V4GA 3GTLK 2ZUEA 1O26A 3GIRA 1TWCK 1F93A 4A3EC 4Q4ZA 4PAAA 3G4CA 1I6HC 4NOIA 4XSZA 3ERED 4YFXA 1XPPA 2JA5K 3HOXK 3GTQK 4P5BA 4C3IK 1WSRA 3AQOA 1TWHC 3M3YC 3A8JA 4DDQA 1TWGA 1DCHA 3GTJC 3HKZD 4JK1A 1K83C 4KMHA 2WB1D 2CFAA 1USOA 2E2IC 1I6VA 1WQHA 1EI6A 2R92C 1C0AA 5IP7C 4KN4A 3GTOC 2A68A 1VJEA 1YX2A 3FOFA 1O2AA 3AQPA 4ILDA 4A3JK 1WCMC 3H3VD 3NUHA 3AD7C 1O29A 4KB4A 4A3GC 2B63K 2NVTC 4GTEA 4A3MK 3FHZA 3GTGK 4KMDA 3BP3A 5C3EC 4C3JK 2NVQK 4PABA 3G4AA 2KWAA 3GTMK 4KN7A 1SMYA 4OINA 5FJ8K 3PO2K 3OREA 5IYBK 4BY1C 1J6XA 1KQ4A 2V6SA 1EH1A 1JVIA 2ZUFA 1WQGA 1XZPB 2JH3A 4AYBD 1IQ0A 1DD5A 1TWAK 2XCQA 1R9TA 2CW0A 5TJ3A 1I6HK 4YG2A 5IOQA 3HXAA 4A3CC 1HI9A 1BS2A 3H0GC 4KMUA 1SFOA 4LK0A 1O2BA 1GE9A 1O25A 4G0VA 3M3YK 3MMLB 1XXCA 2YU9A 3S1MC 3RZDC 3GTJK 4MQ9A 1K83K 3GSIA 3T02A 3S2DC 4A3KC 3T00A 2JA8C 2E2IK 3JSTA 5C44C 3M4OC 2FQOA 4OIQA 5IP7K 3GTOK 3SZYA 2JA7A 4BLBA 1WCMK 4A3JC 4A3FC 4GZYA 1PJ7A 4A3GK 2NVTK 1Y1WA 2R93A 4LJZA 3GTKA 5C3EK
chains in the Genus database with same CATH topology
3HOUC 4G7ZA 3K7AK 5IYCC 3S17C 3HOXK 3S14K 3S1QK 2WAQD 4QJVB 2YU9K 4LK1A 4QJVA 3CQZC 4QIWD 3GTQK 4A93C 4C3IK 2R7ZC 3I4NK 2NVYC 1TWHC 3M3YC 4BY1K 3PO3C 2O5IA 4BXXC 1BDFA 1TWGC 2Y0SL 4LLGA 4Y52C 4G7HA 2VUMK 3GTJC 3HKZD 4A3IC 4JK1A 3GTPC 1K83C 4BBSC 3HOZK 2WB1D 4Y7NK 1Y1VC 2NVXC 1TWAC 3S1RK 5TMCA 3S15K 2E2IC 1I6VA 2JA5K 2JA7K 2PMZL 5IP9C 4MEYA 2R92C 5IP7C 4KN4A 3HOVK 4A3DC 4A3CK 4YFNA 3GTOC 2A69A 2A68A 3H0GK 5FLMK 1R9TC 4A3BC 3RZOK 5M5XK 4A3JK 4MEXA 3HOYK 3S2HK 3DXJA 1WCMC 3H3VD 3GTLC 4A3EK 1I3QC 1Y1WK 2BE5A 2E2HC 1TWCC 2PA8D 3GTKK 5IYDC 2R93K 5M5YK 3EQLA 3S1MK 4A3GC 2B63K 3RZDK 2NVTC 4X6AC 4A3MK 4C3HK 4C2MK 1SFOC 3GTGK 1I50C 3WODA 5C4XK 3HOWC 4BBRK 5C3EC 2JA5C 3K7AC 3I4MC 4C3JK 3S2DK 3HOXC 4A3KK 2NVQK 4BY7K 4QIWL 2JA8K 3S1QC 3GTMK 1TWHK 2YU9C 5C44K 4KN7A 3M4OK 1SMYA 4OINA 3GTQC 5FJ8K 3PO2K 1TWGK 4XLNA 5M3FK 5IYBK 3I4NC 2JA6K 4BY1C 4OIPA 1IW7A 2Y0SD 4YFKA 1TWFK 3HKZL 2PPBA 3GTPK 3S1NK 2E2JK 2VUMC 2WB1L 3FKIK 4AYBD 1TWAK 4Q5SA 4Y7NC 4A3FK 2CW0A 3S1RC 2R92K 4A3DK 1YNNA 3S15C 4A3LC 1I6HK 1YNJA 4YG2A 2PMZD 3HOUK 5IYCK 4XLPA 3HOVC 3S17K 5M3MK 3S16C 5C4JC 4A3CC 4ZH4A 3H0GC 4KMUA 5FLMC 4XSXA 3RZOC 4LK0A 3H3VL 1ZYRA 3HOYC 2WAQL 5D4DA 3CQZK 3S2HC 4A93K 2PA8L 3I4MK 3S14C 2R7ZK 4OIOA 2NVYK 3M3YK 3PO3K 2R93C 4BXXK 3GTKC 3S1MC 4Y52K 2B63C 3RZDC 5M5WK 3HOWK 4A3MC 2O5JA 2A6EA 3GTJK 4MQ9A 3GTGC 4A3IK 1K83K 4BBSK 5C4XC 4BBRC 1Y1VK 3S2DC 4A3KC 2NVQC 2NVXK 4BY7C 4YFXA 2JA8C 3HOZC 3GTMC 2E2IK 5C44C 3M4OC 4G7OA 3PO2C 5IP9K 4OIQA 5IP7K 5IYBC 2JA6C 2A6HA 3GTOK 1HQMA 2JA7C 1R9TK 4A3BK 1TWFC 4AYBL 3S1NC 2E2JC 3FKIC 4OIRA 1WCMK 5TMFA 3GTLK 4A3JC 1I3QK 2E2HK 1TWCK 4A3FC 5IYDK 4A3LK 4GZYA 4A3EC 4Q4ZA 4A3GK 4X6AK 2NVTK 1Y1WC 1SFOK 3S16K 4NOIA 4XSZA 5C4JK 1I6HC 4LJZA 1I50K 1XPPA 5C3EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU C;  4G7Z A;  3K7A K;  5IYC C;  3S17 C;  3HOX K;  3S14 K;  3S1Q K;  2WAQ D;  4QJV B;  2YU9 K;  4LK1 A;  4QJV A;  3CQZ C;  4QIW D;  3GTQ K;  4A93 C;  4C3I K;  2R7Z C;  3I4N K;  2NVY C;  1TWH C;  3M3Y C;  4BY1 K;  3PO3 C;  2O5I A;  4BXX C;  1BDF A;  1TWG C;  2Y0S L;  4LLG A;  4Y52 C;  4G7H A;  2VUM K;  3GTJ C;  3HKZ D;  4A3I C;  4JK1 A;  3GTP C;  1K83 C;  4BBS C;  3HOZ K;  2WB1 D;  4Y7N K;  1Y1V C;  2NVX C;  1TWA C;  3S1R K;  5TMC A;  3S15 K;  2E2I C;  1I6V A;  2JA5 K;  2JA7 K;  2PMZ L;  5IP9 C;  4MEY A;  2R92 C;  5IP7 C;  4KN4 A;  3HOV K;  4A3D C;  4A3C K;  4YFN A;  3GTO C;  2A69 A;  2A68 A;  3H0G K;  5FLM K;  1R9T C;  4A3B C;  3RZO K;  5M5X K;  4A3J K;  4MEX A;  3HOY K;  3S2H K;  3DXJ A;  1WCM C;  3H3V D;  3GTL C;  4A3E K;  1I3Q C;  1Y1W K;  2BE5 A;  2E2H C;  1TWC C;  2PA8 D;  3GTK K;  5IYD C;  2R93 K;  5M5Y K;  3EQL A;  3S1M K;  4A3G C;  2B63 K;  3RZD K;  2NVT C;  4X6A C;  4A3M K;  4C3H K;  4C2M K;  1SFO C;  3GTG K;  1I50 C;  3WOD A;  5C4X K;  3HOW C;  4BBR K;  5C3E C;  2JA5 C;  3K7A C;  3I4M C;  4C3J K;  3S2D K;  3HOX C;  4A3K K;  2NVQ K;  4BY7 K;  4QIW L;  2JA8 K;  3S1Q C;  3GTM K;  1TWH K;  2YU9 C;  5C44 K;  4KN7 A;  3M4O K;  1SMY A;  4OIN A;  3GTQ C;  5FJ8 K;  3PO2 K;  1TWG K;  4XLN A;  5M3F K;  5IYB K;  3I4N C;  2JA6 K;  4BY1 C;  4OIP A;  1IW7 A;  2Y0S D;  4YFK A;  1TWF K;  3HKZ L;  2PPB A;  3GTP K;  3S1N K;  2E2J K;  2VUM C;  2WB1 L;  3FKI K;  4AYB D;  1TWA K;  4Q5S A;  4Y7N C;  4A3F K;  2CW0 A;  3S1R C;  2R92 K;  4A3D K;  1YNN A;  3S15 C;  4A3L C;  1I6H K;  1YNJ A;  4YG2 A;  2PMZ D;  3HOU K;  5IYC K;  4XLP A;  3HOV C;  3S17 K;  5M3M K;  3S16 C;  5C4J C;  4A3C C;  4ZH4 A;  3H0G C;  4KMU A;  5FLM C;  4XSX A;  3RZO C;  4LK0 A;  3H3V L;  1ZYR A;  3HOY C;  2WAQ L;  5D4D A;  3CQZ K;  3S2H C;  4A93 K;  2PA8 L;  3I4M K;  3S14 C;  2R7Z K;  4OIO A;  2NVY K;  3M3Y K;  3PO3 K;  2R93 C;  4BXX K;  3GTK C;  3S1M C;  4Y52 K;  2B63 C;  3RZD C;  5M5W K;  3HOW K;  4A3M C;  2O5J A;  2A6E A;  3GTJ K;  4MQ9 A;  3GTG C;  4A3I K;  1K83 K;  4BBS K;  5C4X C;  4BBR C;  1Y1V K;  3S2D C;  4A3K C;  2NVQ C;  2NVX K;  4BY7 C;  4YFX A;  2JA8 C;  3HOZ C;  3GTM C;  2E2I K;  5C44 C;  3M4O C;  4G7O A;  3PO2 C;  5IP9 K;  4OIQ A;  5IP7 K;  5IYB C;  2JA6 C;  2A6H A;  3GTO K;  1HQM A;  2JA7 C;  1R9T K;  4A3B K;  1TWF C;  4AYB L;  3S1N C;  2E2J C;  3FKI C;  4OIR A;  1WCM K;  5TMF A;  3GTL K;  4A3J C;  1I3Q K;  2E2H K;  1TWC K;  4A3F C;  5IYD K;  4A3L K;  4GZY A;  4A3E C;  4Q4Z A;  4A3G K;  4X6A K;  2NVT K;  1Y1W C;  1SFO K;  3S16 K;  4NOI A;  4XSZ A;  5C4J K;  1I6H C;  4LJZ A;  1I50 K;  1XPP A;  5C3E K; 
#chains in the Genus database with same CATH topology
 5IYC C;  5IOT A;  4QJV B;  3A8I A;  4QIW D;  4A93 C;  5EGE A;  1WIH A;  4BY1 K;  2RH6 A;  2R7Z A;  4BXX C;  4AH6 A;  2Y0S L;  1ZBS A;  1USM A;  3TFH A;  1TWF A;  3GTP A;  1TWA C;  5JFE A;  3FKI A;  3Q3Q A;  4WJ4 A;  4MEY A;  4FM9 A;  1WQF A;  4YFN A;  4A3C K;  2A69 A;  3H0G K;  4J3N A;  1R9T C;  2V6T A;  4GFQ A;  1XZQ A;  2GAH C;  2XCR B;  2BE5 A;  5IYD C;  1VGX A;  3S1M K;  3EQL A;  3CQZ A;  3RZD K;  4C2M K;  2NVY A;  1SFO C;  3GEI A;  3WOD A;  3K7A C;  2P5M A;  2V6U A;  3S2D K;  4A3K K;  2GSN A;  2JA8 K;  3S1Q C;  2YU9 C;  5C44 K;  3M4O K;  3LAJ A;  1Y1V A;  1TWG K;  4XLN A;  5M3F K;  2NVX A;  3GTQ A;  1EK8 A;  1PJ6 A;  3BUE A;  4OIP A;  4YFK A;  3HKZ L;  1X31 C;  4G0U A;  1AB4 A;  2WB1 L;  1ZXO A;  3LAP A;  4Y7N C;  4A3F K;  4RMF A;  4GTB A;  1V5V A;  4A3D K;  1I3Q A;  1YNJ A;  2E2H A;  4BKW A;  5IYC K;  3HOV C;  4XSX A;  3AD8 C;  3H3V L;  1ZYR A;  2WAQ L;  1I50 A;  3TFJ A;  3S2H C;  1ISE A;  4A93 K;  5IOR A;  4OIO A;  2R93 C;  4KM8 A;  4BXX K;  3GTK C;  3HOW K;  2A6E A;  4FZB A;  3L4K A;  4BBR C;  1WOR A;  2VUM A;  4WJ3 M;  3N3Y A;  3S0X A;  3GTM A;  4P5A A;  1HQM A;  1R9T K;  1TWF C;  4AYB L;  2E2J C;  3FKI C;  4OIR A;  1YCL A;  5TMF A;  3VA7 A;  2XCO A;  3A8K A;  4A3L K;  5IYD K;  3BP8 C;  1SFO K;  5C4J K;  3HOU C;  3K7A K;  4C2M C;  3S17 C;  4KAT A;  4GTL A;  3S1Q K;  2YU9 K;  4LK1 A;  3CQZ C;  2NVY C;  1IE0 A;  2O5I A;  2FQT A;  1BDF A;  1TWH A;  1TWG C;  4G7H A;  1J98 A;  4XCH A;  4A3I C;  2JA6 A;  3HOZ K;  4Y7N K;  2CFA B;  1Y1V C;  2NVX C;  5E68 A;  3CAG A;  4GTC A;  4M1X A;  2JA7 K;  2PMZ L;  4KB2 A;  3HOV K;  4A3D C;  2R92 A;  4GTF A;  3QX3 A;  4A3B C;  4MEX A;  3S2H K;  3L4J A;  4GTD A;  1VH2 A;  1J6V A;  1I3Q C;  1Y1W K;  2E2H C;  1ZVU A;  2PA8 D;  3GTK K;  1XXB A;  2R93 K;  4X6A C;  5EGH A;  1VRQ C;  5IOS A;  3N0C A;  1IS1 A;  1I50 C;  3HOW C;  4BBR K;  3I4M C;  1J6W A;  1O24 A;  2GSO A;  4QIW L;  5JVO A;  3I4N C;  3GEE A;  4KMA A;  2Y0S D;  4G0W A;  1TWF K;  2PPB A;  3GTP K;  3IPJ A;  2E2J K;  2VUM C;  3FKI K;  1XZP A;  4Q5S A;  5HL8 A;  1EQR A;  1O2F B;  3AH5 A;  3S1R C;  3GTL A;  3S15 C;  1WOO A;  4A3L C;  1TWC A;  3TTG A;  3HOU K;  3S17 K;  5C4J C;  4ZH4 A;  5FLM C;  3N0B A;  3RZO C;  4LR2 A;  3H0G A;  4P9S A;  5D4D A;  3CQZ K;  3HOY C;  2JA5 A;  4C45 A;  4BLA A;  2Y3P A;  2NVY K;  1WSV A;  2RGR A;  1INN A;  3GEH A;  1VLO A;  5M5W K;  1IL2 A;  1F7U A;  4C3H C;  4A3I K;  5C4X C;  2PHC B;  1Y1V K;  1G51 A;  2NVX K;  4BY7 C;  3HOZ C;  1B4B A;  3TFI A;  4G7O A;  2JA6 C;  2GAG C;  2JA7 C;  4A3B K;  3S1N C;  1I3Q K;  1BJT A;  2E2H K;  1JQW A;  4GTA A;  4X6A K;  1Y1W C;  1B4A A;  3S16 K;  3LPX A;  1I50 K;  3I4M K;  4G7Z A;  1RU0 A;  2B63 A;  3S14 K;  3GTG A;  2WAQ D;  4QJV A;  2R7Z C;  3I4N K;  2GSU A;  3PO3 C;  1EFW A;  4GT9 A;  4LLG A;  4Y52 C;  1O27 A;  4KAW X;  2VUM K;  4LQY A;  3GTP C;  1L0W A;  4BBS C;  3S1R K;  5TMC A;  1TWA A;  3S15 K;  3FOE A;  5IP9 C;  5FLM K;  1JOE A;  3RZO K;  1PJ5 A;  5M5X K;  5CJ9 A;  3HOY K;  1XZQ B;  3DXJ A;  5CHP A;  4WIL A;  4A3E K;  3GTL C;  2ZFZ A;  1TWC C;  5M5Y K;  3OEP A;  2P8T A;  1F9N A;  4C3H K;  1IBA A;  5C4X K;  2JA5 C;  3HOX C;  4KC6 A;  1O28 A;  4BY7 K;  3GTJ A;  1TWH K;  5L46 A;  1K83 A;  3GTQ C;  4O2D A;  4C3I C;  3SZZ A;  2JA6 K;  1IW7 A;  2E2I A;  1ZQ1 C;  3T01 A;  4LOW A;  3S1N K;  3GTO A;  1WOS A;  1DCO A;  1WOP A;  1WCM A;  4KDD A;  4KM9 A;  2R92 K;  1YNN A;  1DCP A;  2PMZ D;  4XLP A;  3S16 C;  5M3M K;  2W7V A;  4KAR A;  2PA8 L;  3S14 C;  2R7Z K;  3PO3 K;  4KAS A;  2D6F C;  3GDZ A;  4Y52 K;  2B63 C;  2O5J A;  4A3M C;  3ADA C;  3GTG C;  4BBS K;  1UV7 A;  4C3J C;  1F7V A;  2EBB A;  2NVQ C;  3AD9 C;  3OPF A;  3GTM C;  3PO2 C;  5IP9 K;  1BGW A;  5IYB C;  2A6H A;  1XXA A;  3V4G A;  3GTL K;  2ZUE A;  1O26 A;  3GIR A;  1TWC K;  1F93 A;  4A3E C;  4Q4Z A;  4PAA A;  3G4C A;  1I6H C;  4NOI A;  4XSZ A;  3ERE D;  4YFX A;  1XPP A;  2JA5 K;  3HOX K;  3GTQ K;  4P5B A;  4C3I K;  1WSR A;  3AQO A;  1TWH C;  3M3Y C;  3A8J A;  4DDQ A;  1TWG A;  1DCH A;  3GTJ C;  3HKZ D;  4JK1 A;  1K83 C;  4KMH A;  2WB1 D;  2CFA A;  1USO A;  2E2I C;  1I6V A;  1WQH A;  1EI6 A;  2R92 C;  1C0A A;  5IP7 C;  4KN4 A;  3GTO C;  2A68 A;  1VJE A;  1YX2 A;  3FOF A;  1O2A A;  3AQP A;  4ILD A;  4A3J K;  1WCM C;  3H3V D;  3NUH A;  3AD7 C;  1O29 A;  4KB4 A;  4A3G C;  2B63 K;  2NVT C;  4GTE A;  4A3M K;  3FHZ A;  3GTG K;  4KMD A;  3BP3 A;  5C3E C;  4C3J K;  2NVQ K;  4PAB A;  3G4A A;  2KWA A;  3GTM K;  4KN7 A;  1SMY A;  4OIN A;  5FJ8 K;  3PO2 K;  3ORE A;  5IYB K;  4BY1 C;  1J6X A;  1KQ4 A;  2V6S A;  1EH1 A;  1JVI A;  2ZUF A;  1WQG A;  1XZP B;  2JH3 A;  4AYB D;  1IQ0 A;  1DD5 A;  1TWA K;  2XCQ A;  1R9T A;  2CW0 A;  5TJ3 A;  1I6H K;  4YG2 A;  5IOQ A;  3HXA A;  4A3C C;  1HI9 A;  1BS2 A;  3H0G C;  4KMU A;  1SFO A;  4LK0 A;  1O2B A;  1GE9 A;  1O25 A;  4G0V A;  3M3Y K;  3MML B;  1XXC A;  2YU9 A;  3S1M C;  3RZD C;  3GTJ K;  4MQ9 A;  1K83 K;  3GSI A;  3T02 A;  3S2D C;  4A3K C;  3T00 A;  2JA8 C;  2E2I K;  3JST A;  5C44 C;  3M4O C;  2FQO A;  4OIQ A;  5IP7 K;  3GTO K;  3SZY A;  2JA7 A;  4BLB A;  1WCM K;  4A3J C;  4A3F C;  4GZY A;  1PJ7 A;  4A3G K;  2NVT K;  1Y1W A;  2R93 A;  4LJZ A;  3GTK A;  5C3E K; 
#chains in the Genus database with same CATH homology
 3HOU C;  4G7Z A;  3K7A K;  5IYC C;  3S17 C;  3HOX K;  3S14 K;  3S1Q K;  2WAQ D;  4QJV B;  2YU9 K;  4LK1 A;  4QJV A;  3CQZ C;  4QIW D;  3GTQ K;  4A93 C;  4C3I K;  2R7Z C;  3I4N K;  2NVY C;  1TWH C;  3M3Y C;  4BY1 K;  3PO3 C;  2O5I A;  4BXX C;  1BDF A;  1TWG C;  2Y0S L;  4LLG A;  4Y52 C;  4G7H A;  2VUM K;  3GTJ C;  3HKZ D;  4A3I C;  4JK1 A;  3GTP C;  1K83 C;  4BBS C;  3HOZ K;  2WB1 D;  4Y7N K;  1Y1V C;  2NVX C;  1TWA C;  3S1R K;  5TMC A;  3S15 K;  2E2I C;  1I6V A;  2JA5 K;  2JA7 K;  2PMZ L;  5IP9 C;  4MEY A;  2R92 C;  5IP7 C;  4KN4 A;  3HOV K;  4A3D C;  4A3C K;  4YFN A;  3GTO C;  2A69 A;  2A68 A;  3H0G K;  5FLM K;  1R9T C;  4A3B C;  3RZO K;  5M5X K;  4A3J K;  4MEX A;  3HOY K;  3S2H K;  3DXJ A;  1WCM C;  3H3V D;  3GTL C;  4A3E K;  1I3Q C;  1Y1W K;  2BE5 A;  2E2H C;  1TWC C;  2PA8 D;  3GTK K;  5IYD C;  2R93 K;  5M5Y K;  3EQL A;  3S1M K;  4A3G C;  2B63 K;  3RZD K;  2NVT C;  4X6A C;  4A3M K;  4C3H K;  4C2M K;  1SFO C;  3GTG K;  1I50 C;  3WOD A;  5C4X K;  3HOW C;  4BBR K;  5C3E C;  2JA5 C;  3K7A C;  3I4M C;  4C3J K;  3S2D K;  3HOX C;  4A3K K;  2NVQ K;  4BY7 K;  4QIW L;  2JA8 K;  3S1Q C;  3GTM K;  1TWH K;  2YU9 C;  5C44 K;  4KN7 A;  3M4O K;  1SMY A;  4OIN A;  3GTQ C;  5FJ8 K;  3PO2 K;  1TWG K;  4XLN A;  5M3F K;  5IYB K;  3I4N C;  2JA6 K;  4BY1 C;  4OIP A;  1IW7 A;  2Y0S D;  4YFK A;  1TWF K;  3HKZ L;  2PPB A;  3GTP K;  3S1N K;  2E2J K;  2VUM C;  2WB1 L;  3FKI K;  4AYB D;  1TWA K;  4Q5S A;  4Y7N C;  4A3F K;  2CW0 A;  3S1R C;  2R92 K;  4A3D K;  1YNN A;  3S15 C;  4A3L C;  1I6H K;  1YNJ A;  4YG2 A;  2PMZ D;  3HOU K;  5IYC K;  4XLP A;  3HOV C;  3S17 K;  5M3M K;  3S16 C;  5C4J C;  4A3C C;  4ZH4 A;  3H0G C;  4KMU A;  5FLM C;  4XSX A;  3RZO C;  4LK0 A;  3H3V L;  1ZYR A;  3HOY C;  2WAQ L;  5D4D A;  3CQZ K;  3S2H C;  4A93 K;  2PA8 L;  3I4M K;  3S14 C;  2R7Z K;  4OIO A;  2NVY K;  3M3Y K;  3PO3 K;  2R93 C;  4BXX K;  3GTK C;  3S1M C;  4Y52 K;  2B63 C;  3RZD C;  5M5W K;  3HOW K;  4A3M C;  2O5J A;  2A6E A;  3GTJ K;  4MQ9 A;  3GTG C;  4A3I K;  1K83 K;  4BBS K;  5C4X C;  4BBR C;  1Y1V K;  3S2D C;  4A3K C;  2NVQ C;  2NVX K;  4BY7 C;  4YFX A;  2JA8 C;  3HOZ C;  3GTM C;  2E2I K;  5C44 C;  3M4O C;  4G7O A;  3PO2 C;  5IP9 K;  4OIQ A;  5IP7 K;  5IYB C;  2JA6 C;  2A6H A;  3GTO K;  1HQM A;  2JA7 C;  1R9T K;  4A3B K;  1TWF C;  4AYB L;  3S1N C;  2E2J C;  3FKI C;  4OIR A;  1WCM K;  5TMF A;  3GTL K;  4A3J C;  1I3Q K;  2E2H K;  1TWC K;  4A3F C;  5IYD K;  4A3L K;  4GZY A;  4A3E C;  4Q4Z A;  4A3G K;  4X6A K;  2NVT K;  1Y1W C;  1SFO K;  3S16 K;  4NOI A;  4XSZ A;  5C4J K;  1I6H C;  4LJZ A;  1I50 K;  1XPP A;  5C3E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...