5C44K

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c44K00
1HQMA 5M5YK 3PO2C 2B63K 1TWGK 3M3YK 2BE5A 2E2JC 1I50K 3S15C 4BBRC 4Y7NK 4Y52K 2VUMK 3S17K 4XSZA 3GTQK 1TWHK 2E2IC 4C3JK 4A93C 2E2HC 4BBSK 3EQLA 5FJ8K 4YFXA 2A6EA 3S1RK 4OIOA 1TWCK 4A3KK 2JA6C 4LK0A 2NVXK 3PO3K 2WAQD 2JA7C 4YFKA 1TWAC 3WODA 2WAQL 5IP7C 5C44K 3GTKK 2R93C 4X6AC 3S16K 2R7ZK 5IP9C 2NVYC 3M4OC 4BXXC 1XPPA 3HOZC 1WCMC 4Q4ZA 3GTPC 3RZOK 4AYBD 5IYBC 4A3JK 2PPBA 1ZYRA 4AYBL 2NVQC 4A3MC 4A3DC 4YG2A 2CW0A 4QJVA 3RZDC 4MEXA 3S2DC 3GTOC 2B63C 1TWGC 4KN7A 3HOWK 3HOYK 5IYCK 4A3BK 3S1MK 2JA8C 4OINA 3DXJA 2Y0SD 4MQ9A 4A3GK 1TWHC 2Y0SL 3HOUK 1K83K 4A3FK 1Y1WK 5M5WK 2YU9C 4C3IK 2WB1D 3FKIK 4C2MK 3I4NK 5M3MK 3GTLC 1SFOK 4BY7K 2WB1L 1I6VA 3S1NK 1YNJA 1I6HK 3H3VD 2PMZD 4A3EC 5TMFA 4Q5SA 1SMYA 3K7AK 2PMZL 3H3VL 1R9TC 3GTJC 2JA5C 5C4JC 3GTGK 3GTMK 1TWFC 5C44C 2R92K 5C3EC 3S14C 4LJZA 3H0GK 1R9TK 3S16C 1Y1VK 2O5IA 2O5JA 1BDFA 3I4MC 3S15K 4BBRK 4A3IC 4A3JC 3HOXK 3HOVC 4KMUA 3S2HK 4A3CC 1I3QC 4BY1K 2A6HA 4A3LC 4A93K 2E2HK 5TMCA 4G7HA 3M3YC 1I50C 4A3BC 4Y7NC 4Y52C 2VUMC 3S1QK 2JA6K 3S17C 3GTQC 4XLNA 4XSXA 1TWAK 1K83C 4BBSC 2R93K 3S1RC 3I4NC 4X6AK 4G7ZA 1TWCC 4A3KC 5IYDK 4QIWD 5IP9K 2NVXC 1IW7A 5FLMK 3HOZK 5M5XK 1WCMK 2NVTK 4MEYA 3GTPK 4BXXK 3CQZK 3PO3C 5C4XK 5IYBK 3GTGC 3GTKC 2R92C 2A69A 2NVQK 4A3MK 4A3DK 2R7ZC 3S2DK 5M3FK 3GTOK 3PO2K 3RZOC 2E2JK 4ZH4A 1Y1VC 4A3LK 3HOXC 2JA8K 3S2HC 4YFNA 2E2IK 4BY1C 4OIQA 2YU9K 3HOYC 2A68A 3HOWC 5IYCC 4OIRA 3GTLK 4OIPA 3S1MC 1YNNA 3S1QC 4A3EK 4A3GC 2JA7K 3HOUC 4LLGA 4A3FC 1Y1WC 2JA5K 3GTJK 5IP7K 5C4JK 4G7OA 3S14K 1TWFK 3FKIC 5C3EK 4QJVB 4BY7C 4C3HK 1SFOC 3S1NC 2PA8D 1I6HC 5IYDC 2NVYK 2PA8L 4XLPA 3M4OK 4GZYA 4QIWL 3K7AC 4LK1A 5FLMC 4KN4A 2NVTC 3GTMC 3I4MK 3CQZC 3HKZD 4A3IK 5C4XC 3HOVK 4NOIA 3HKZL 4A3CK 1I3QK 3H0GC 3RZDK 5D4DA 4JK1A
chains in the Genus database with same CATH superfamily
2EBBA 3A8JA 3AQPA 3S15C 1I50K 1WOPA 3GTPA 2XCRB 1JOEA 2E2HC 5EGEA 1XZQB 5FJ8K 3S1RK 4OIOA 4A3KK 1ZQ1C 4WJ4A 1VGXA 4WILA 2WAQD 2P5MA 4WJ3M 1F7VA 3GEHA 1VRQC 4GTLA 4ILDA 2R7ZK 4BXXC 3GTPC 2JA6A 3RZOK 1O26A 4AYBD 5IYBC 2PPBA 1IS1A 1ZYRA 1WSRA 4GTAA 4A3MC 3GTJA 4YG2A 2CW0A 1IQ0A 1TWGC 3HOYK 2NVYA 5IYCK 3L4KA 2JA8C 4LOWA 4OINA 2Y0SD 4A3FK 3VA7A 4C3IK 1V5VA 2WB1D 3FKIK 4C2MK 1I6VA 2PMZD 4Q5SA 5TMFA 3K7AK 3GTJC 3PO3K 5C4JC 4C3HC 1R9TK 1DCPA 1ZVUA 3S16C 2ZUEA 2PHCB 2O5IA 2O5JA 1TWCA 2XCOA 3S15K 2GSNA 3HOXK 4KMHA 4KMUA 1B4AA 2JA5A 3AD9C 4A3LC 3FOEA 2E2HK 3M3YC 4GFQA 3S1QK 3S17C 4GTBA 4XSXA 4C3JC 1K83C 4BBSC 3T02A 1O28A 1TWCC 4GTFA 3GEIA 1I50A 1IW7A 5FLMK 4BXXK 3GTPK 3OPFA 5C4XK 5IYBK 1DD5A 1VH2A 3TTGA 4A3MK 1XXAA 3LPXA 3BP8C 4ZH4A 2JA8K 3S2HC 3OEPA 3GTGA 4BY1C 2R92A 1Y1VA 2RH6A 3HOWC 4OIRA 3S1MC 1EI6A 3HOUC 4LLGA 1WORA 3GTJK 5IP7K 5C4JK 2W7VA 4C3HK 2P8TA 5IYDC 2NVYK 1WQGA 1X31C 4LK1A 1IE0A 1J6WA 4KN4A 3N3YA 1O2AA 3HKZL 3H0GC 3RZDK 3QX3A 3FKIA 1Y1VC 4A3LK 1ISEA 3PO2C 3M3YK 2E2JC 1USOA 3IPJA 3S17K 4LQYA 2E2IC 4C3JK 1R9TA 4A93C 4BBSK 5CJ9A 2V6UA 3GEEA 4YFXA 1TWCK 2D6FC 1TWAC 2Y3PA 4X6AC 2E2HA 1UV7A 2YU9A 5IP9C 1XPPA 4KB2A 1EK8A 3Q3QA 4FZBA 4A3JK 3NUHA 3G4AA 1F9NA 3TFJA 4QJVA 5IOSA 2B63C 3GSIA 4KN7A 3HOWK 1ZBSA 3S1MK 1YX2A 1XZPB 1TWHC 3HOUK 1I3QA 3GIRA 2YU9C 1EQRA 1EFWA 5M3MK 3ADAC 4G0VA 1TWGA 4A3EC 4GTDA 3A8IA 1XXBA 3GTGK 3GTQA 5C44C 2R92K 5C3EC 1WOSA 3H0GK 1Y1VK 5IOQA 1IBAA 1I3QC 2A6HA 3GTKA 4A93K 4A3BC 1YCLA 4Y7NC 1J98A 1PJ7A 3GTQC 1TWAK 1O2FB 4X6AK 3I4NC 4KMAA 1O29A 4QIWD 5IP9K 3AQOA 1GE9A 4MEYA 1L0WA 1EH1A 3GTKC 1ZXOA 1K83A 4PAAA 2FQTA 2ZUFA 3HXAA 3AH5A 2YU9K 2KWAA 4OIPA 3LAJA 2ZFZA 4GTCA 3TFHA 4A3EK 4A3GC 4FM9A 1Y1WC 5C3EK 4BY7C 1SFOC 3S1NC 4BLAA 4XLPA 2PA8L 2CFAB 4QIWL 4KM8A 2NVTC 4GTEA 3FHZA 3CQZC 3HKZD 4NOIA 1I3QK 5D4DA 1IL2A 1XXCA 1O24A 5M5YK 4DDQA 1TWGK 4BBRC 4Y7NK 1BS2A 4LR2A 4XSZA 3GTQK 3H0GA 5EGHA 4KC6A 4LK0A 2JA7C 4YFKA 3WODA 3ERED 2E2IA 3GTKK 3S16K 1F7UA 5CHPA 1WQHA 5TJ3A 1WQFA 3T01A 5JVOA 3OREA 3M4OC 3GTLA 3HOZC 4Q4ZA 4P9SA 1WSVA 3S0XA 1DCHA 4O2DA 1TWAA 4A3DC 4MEXA 3N0BA 3DXJA 3V4GA 4A3GK 1O2BA 1K83K 1Y1WK 4KARA 1SFOK 3GTLC 3S1NK 4BY7K 1YNJA 2B63A 4KAWX 2VUMA 1SMYA 3AD7C 3H3VL 1XZPA 1HI9A 1TWHA 3CAGA 3LAPA 3JSTA 1XZQA 4LJZA 1BDFA 1G51A 4BBRK 4A3IC 2NVXA 3S2HK 4J3NA 4A3CC 4BY1K 4RMFA 4BKWA 4G7HA 2RGRA 1VJEA 4Y52C 2VUMC 4C2MC 4G7ZA 5IYDK 2NVXC 3HOZK 5M5XK 4KATA 3PO3C 4A3DK 4P5AA 5M3FK 1RU0A 3PO2K 2E2JK 3HOXC 3GTMA 4YFNA 2E2IK 4OIQA 1O25A 2A68A 3GTLK 3S1QC 1B4BA 1JQWA 1F93A 4QJVB 2PA8D 1I6HC 1PJ5A 5IORA 5FLMC 3GTMC 4A3IK 5C4XC 4A3CK 1Y1WA 3G4CA 4PABA 4GZYA 1HQMA 2R93A 1SFOA 4M1XA 2B63K 2CFAA 2BE5A 4Y52K 2VUMK 1WCMA 3CQZA 2V6TA 2V6SA 1TWHK 1INNA 2JH3A 3EQLA 2A6EA 3TFIA 5HL8A 3GTOA 4C45A 1USMA 5E68A 2JA6C 2GSUA 2NVXK 2WAQL 5IP7C 5C44K 1JVIA 2R93C 2NVYC 4GT9A 1WCMC 2JA7A 4AYBL 2FQOA 2NVQC 3T00A 3RZDC 1TWFA 3S2DC 3GTOC 4A3BK 3A8KA 3GDZA 4MQ9A 4G0UA 2Y0SL 5M5WK 1BGWA 3I4NK 4KMDA 2WB1L 1I6HK 4G0WA 3H3VD 2PMZL 2JA5C 3GTMK 3S14C 1TWFC 1VLOA 3I4MC 4A3JC 3HOVC 2GSOA 4XCHA 3FOFA 5TMCA 1KQ4A 1I50C 1PJ6A 5IOTA 2R7ZA 2JA6K 3BUEA 3N0CA 4XLNA 1C0AA 1DCOA 3SZZA 1AB4A 3S1RC 2R93K 4A3KC 2GAGC 1WCMK 2NVTK 3CQZK 1BJTA 1J6XA 3GTGC 4P5BA 2R92C 1WIHA 1WOOA 2A69A 2NVQK 2GAHC 4KM9A 3AD8C 4KDDA 2R7ZC 3S2DK 3GTOK 3L4JA 3RZOC 3SZYA 1O27A 5L46A 4BLBA 3HOYC 5IYCC 1YNNA 4AH6A 2JA7K 4G7OA 4A3FC 2JA5K 4C3IC 1TWFK 3S14K 3FKIC 4KASA 3M4OK 3BP3A 4KB4A 3K7AC 3I4MK 3MMLB 5JFEA 1J6VA 2XCQA 3HOVK 1R9TC 4JK1A
chains in the Genus database with same CATH topology
1HQMA 5M5YK 3PO2C 2B63K 1TWGK 3M3YK 2BE5A 2E2JC 1I50K 3S15C 4BBRC 4Y7NK 4Y52K 2VUMK 3S17K 4XSZA 3GTQK 1TWHK 2E2IC 4C3JK 4A93C 2E2HC 4BBSK 3EQLA 5FJ8K 4YFXA 2A6EA 3S1RK 4OIOA 1TWCK 4A3KK 2JA6C 4LK0A 2NVXK 3PO3K 2WAQD 2JA7C 4YFKA 1TWAC 3WODA 2WAQL 5IP7C 5C44K 3GTKK 2R93C 4X6AC 3S16K 2R7ZK 5IP9C 2NVYC 3M4OC 4BXXC 1XPPA 3HOZC 1WCMC 4Q4ZA 3GTPC 3RZOK 4AYBD 5IYBC 4A3JK 2PPBA 1ZYRA 4AYBL 2NVQC 4A3MC 4A3DC 4YG2A 2CW0A 4QJVA 3RZDC 4MEXA 3S2DC 3GTOC 2B63C 1TWGC 4KN7A 3HOWK 3HOYK 5IYCK 4A3BK 3S1MK 2JA8C 4OINA 3DXJA 2Y0SD 4MQ9A 4A3GK 1TWHC 2Y0SL 3HOUK 1K83K 4A3FK 1Y1WK 5M5WK 2YU9C 4C3IK 2WB1D 3FKIK 4C2MK 3I4NK 5M3MK 3GTLC 1SFOK 4BY7K 2WB1L 1I6VA 3S1NK 1YNJA 1I6HK 3H3VD 2PMZD 4A3EC 5TMFA 4Q5SA 1SMYA 3K7AK 2PMZL 3H3VL 1R9TC 3GTJC 2JA5C 5C4JC 3GTGK 3GTMK 1TWFC 5C44C 2R92K 5C3EC 3S14C 4LJZA 3H0GK 1R9TK 3S16C 1Y1VK 2O5IA 2O5JA 1BDFA 3I4MC 3S15K 4BBRK 4A3IC 4A3JC 3HOXK 3HOVC 4KMUA 3S2HK 4A3CC 1I3QC 4BY1K 2A6HA 4A3LC 4A93K 2E2HK 5TMCA 4G7HA 3M3YC 1I50C 4A3BC 4Y7NC 4Y52C 2VUMC 3S1QK 2JA6K 3S17C 3GTQC 4XLNA 4XSXA 1TWAK 1K83C 4BBSC 2R93K 3S1RC 3I4NC 4X6AK 4G7ZA 1TWCC 4A3KC 5IYDK 4QIWD 5IP9K 2NVXC 1IW7A 5FLMK 3HOZK 5M5XK 1WCMK 2NVTK 4MEYA 3GTPK 4BXXK 3CQZK 3PO3C 5C4XK 5IYBK 3GTGC 3GTKC 2R92C 2A69A 2NVQK 4A3MK 4A3DK 2R7ZC 3S2DK 5M3FK 3GTOK 3PO2K 3RZOC 2E2JK 4ZH4A 1Y1VC 4A3LK 3HOXC 2JA8K 3S2HC 4YFNA 2E2IK 4BY1C 4OIQA 2YU9K 3HOYC 2A68A 3HOWC 5IYCC 4OIRA 3GTLK 4OIPA 3S1MC 1YNNA 3S1QC 4A3EK 4A3GC 2JA7K 3HOUC 4LLGA 4A3FC 1Y1WC 2JA5K 3GTJK 5IP7K 5C4JK 4G7OA 3S14K 1TWFK 3FKIC 5C3EK 4QJVB 4BY7C 4C3HK 1SFOC 3S1NC 2PA8D 1I6HC 5IYDC 2NVYK 2PA8L 4XLPA 3M4OK 4GZYA 4QIWL 3K7AC 4LK1A 5FLMC 4KN4A 2NVTC 3GTMC 3I4MK 3CQZC 3HKZD 4A3IK 5C4XC 3HOVK 4NOIA 3HKZL 4A3CK 1I3QK 3H0GC 3RZDK 5D4DA 4JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM A;  5M5Y K;  3PO2 C;  2B63 K;  1TWG K;  3M3Y K;  2BE5 A;  2E2J C;  1I50 K;  3S15 C;  4BBR C;  4Y7N K;  4Y52 K;  2VUM K;  3S17 K;  4XSZ A;  3GTQ K;  1TWH K;  2E2I C;  4C3J K;  4A93 C;  2E2H C;  4BBS K;  3EQL A;  5FJ8 K;  4YFX A;  2A6E A;  3S1R K;  4OIO A;  1TWC K;  4A3K K;  2JA6 C;  4LK0 A;  2NVX K;  3PO3 K;  2WAQ D;  2JA7 C;  4YFK A;  1TWA C;  3WOD A;  2WAQ L;  5IP7 C;  5C44 K;  3GTK K;  2R93 C;  4X6A C;  3S16 K;  2R7Z K;  5IP9 C;  2NVY C;  3M4O C;  4BXX C;  1XPP A;  3HOZ C;  1WCM C;  4Q4Z A;  3GTP C;  3RZO K;  4AYB D;  5IYB C;  4A3J K;  2PPB A;  1ZYR A;  4AYB L;  2NVQ C;  4A3M C;  4A3D C;  4YG2 A;  2CW0 A;  4QJV A;  3RZD C;  4MEX A;  3S2D C;  3GTO C;  2B63 C;  1TWG C;  4KN7 A;  3HOW K;  3HOY K;  5IYC K;  4A3B K;  3S1M K;  2JA8 C;  4OIN A;  3DXJ A;  2Y0S D;  4MQ9 A;  4A3G K;  1TWH C;  2Y0S L;  3HOU K;  1K83 K;  4A3F K;  1Y1W K;  5M5W K;  2YU9 C;  4C3I K;  2WB1 D;  3FKI K;  4C2M K;  3I4N K;  5M3M K;  3GTL C;  1SFO K;  4BY7 K;  2WB1 L;  1I6V A;  3S1N K;  1YNJ A;  1I6H K;  3H3V D;  2PMZ D;  4A3E C;  5TMF A;  4Q5S A;  1SMY A;  3K7A K;  2PMZ L;  3H3V L;  1R9T C;  3GTJ C;  2JA5 C;  5C4J C;  3GTG K;  3GTM K;  1TWF C;  5C44 C;  2R92 K;  5C3E C;  3S14 C;  4LJZ A;  3H0G K;  1R9T K;  3S16 C;  1Y1V K;  2O5I A;  2O5J A;  1BDF A;  3I4M C;  3S15 K;  4BBR K;  4A3I C;  4A3J C;  3HOX K;  3HOV C;  4KMU A;  3S2H K;  4A3C C;  1I3Q C;  4BY1 K;  2A6H A;  4A3L C;  4A93 K;  2E2H K;  5TMC A;  4G7H A;  3M3Y C;  1I50 C;  4A3B C;  4Y7N C;  4Y52 C;  2VUM C;  3S1Q K;  2JA6 K;  3S17 C;  3GTQ C;  4XLN A;  4XSX A;  1TWA K;  1K83 C;  4BBS C;  2R93 K;  3S1R C;  3I4N C;  4X6A K;  4G7Z A;  1TWC C;  4A3K C;  5IYD K;  4QIW D;  5IP9 K;  2NVX C;  1IW7 A;  5FLM K;  3HOZ K;  5M5X K;  1WCM K;  2NVT K;  4MEY A;  3GTP K;  4BXX K;  3CQZ K;  3PO3 C;  5C4X K;  5IYB K;  3GTG C;  3GTK C;  2R92 C;  2A69 A;  2NVQ K;  4A3M K;  4A3D K;  2R7Z C;  3S2D K;  5M3F K;  3GTO K;  3PO2 K;  3RZO C;  2E2J K;  4ZH4 A;  1Y1V C;  4A3L K;  3HOX C;  2JA8 K;  3S2H C;  4YFN A;  2E2I K;  4BY1 C;  4OIQ A;  2YU9 K;  3HOY C;  2A68 A;  3HOW C;  5IYC C;  4OIR A;  3GTL K;  4OIP A;  3S1M C;  1YNN A;  3S1Q C;  4A3E K;  4A3G C;  2JA7 K;  3HOU C;  4LLG A;  4A3F C;  1Y1W C;  2JA5 K;  3GTJ K;  5IP7 K;  5C4J K;  4G7O A;  3S14 K;  1TWF K;  3FKI C;  5C3E K;  4QJV B;  4BY7 C;  4C3H K;  1SFO C;  3S1N C;  2PA8 D;  1I6H C;  5IYD C;  2NVY K;  2PA8 L;  4XLP A;  3M4O K;  4GZY A;  4QIW L;  3K7A C;  4LK1 A;  5FLM C;  4KN4 A;  2NVT C;  3GTM C;  3I4M K;  3CQZ C;  3HKZ D;  4A3I K;  5C4X C;  3HOV K;  4NOI A;  3HKZ L;  4A3C K;  1I3Q K;  3H0G C;  3RZD K;  5D4D A;  4JK1 A; 
#chains in the Genus database with same CATH topology
 2EBB A;  3A8J A;  3AQP A;  3S15 C;  1I50 K;  1WOP A;  3GTP A;  2XCR B;  1JOE A;  2E2H C;  5EGE A;  1XZQ B;  5FJ8 K;  3S1R K;  4OIO A;  4A3K K;  1ZQ1 C;  4WJ4 A;  1VGX A;  4WIL A;  2WAQ D;  2P5M A;  4WJ3 M;  1F7V A;  3GEH A;  1VRQ C;  4GTL A;  4ILD A;  2R7Z K;  4BXX C;  3GTP C;  2JA6 A;  3RZO K;  1O26 A;  4AYB D;  5IYB C;  2PPB A;  1IS1 A;  1ZYR A;  1WSR A;  4GTA A;  4A3M C;  3GTJ A;  4YG2 A;  2CW0 A;  1IQ0 A;  1TWG C;  3HOY K;  2NVY A;  5IYC K;  3L4K A;  2JA8 C;  4LOW A;  4OIN A;  2Y0S D;  4A3F K;  3VA7 A;  4C3I K;  1V5V A;  2WB1 D;  3FKI K;  4C2M K;  1I6V A;  2PMZ D;  4Q5S A;  5TMF A;  3K7A K;  3GTJ C;  3PO3 K;  5C4J C;  4C3H C;  1R9T K;  1DCP A;  1ZVU A;  3S16 C;  2ZUE A;  2PHC B;  2O5I A;  2O5J A;  1TWC A;  2XCO A;  3S15 K;  2GSN A;  3HOX K;  4KMH A;  4KMU A;  1B4A A;  2JA5 A;  3AD9 C;  4A3L C;  3FOE A;  2E2H K;  3M3Y C;  4GFQ A;  3S1Q K;  3S17 C;  4GTB A;  4XSX A;  4C3J C;  1K83 C;  4BBS C;  3T02 A;  1O28 A;  1TWC C;  4GTF A;  3GEI A;  1I50 A;  1IW7 A;  5FLM K;  4BXX K;  3GTP K;  3OPF A;  5C4X K;  5IYB K;  1DD5 A;  1VH2 A;  3TTG A;  4A3M K;  1XXA A;  3LPX A;  3BP8 C;  4ZH4 A;  2JA8 K;  3S2H C;  3OEP A;  3GTG A;  4BY1 C;  2R92 A;  1Y1V A;  2RH6 A;  3HOW C;  4OIR A;  3S1M C;  1EI6 A;  3HOU C;  4LLG A;  1WOR A;  3GTJ K;  5IP7 K;  5C4J K;  2W7V A;  4C3H K;  2P8T A;  5IYD C;  2NVY K;  1WQG A;  1X31 C;  4LK1 A;  1IE0 A;  1J6W A;  4KN4 A;  3N3Y A;  1O2A A;  3HKZ L;  3H0G C;  3RZD K;  3QX3 A;  3FKI A;  1Y1V C;  4A3L K;  1ISE A;  3PO2 C;  3M3Y K;  2E2J C;  1USO A;  3IPJ A;  3S17 K;  4LQY A;  2E2I C;  4C3J K;  1R9T A;  4A93 C;  4BBS K;  5CJ9 A;  2V6U A;  3GEE A;  4YFX A;  1TWC K;  2D6F C;  1TWA C;  2Y3P A;  4X6A C;  2E2H A;  1UV7 A;  2YU9 A;  5IP9 C;  1XPP A;  4KB2 A;  1EK8 A;  3Q3Q A;  4FZB A;  4A3J K;  3NUH A;  3G4A A;  1F9N A;  3TFJ A;  4QJV A;  5IOS A;  2B63 C;  3GSI A;  4KN7 A;  3HOW K;  1ZBS A;  3S1M K;  1YX2 A;  1XZP B;  1TWH C;  3HOU K;  1I3Q A;  3GIR A;  2YU9 C;  1EQR A;  1EFW A;  5M3M K;  3ADA C;  4G0V A;  1TWG A;  4A3E C;  4GTD A;  3A8I A;  1XXB A;  3GTG K;  3GTQ A;  5C44 C;  2R92 K;  5C3E C;  1WOS A;  3H0G K;  1Y1V K;  5IOQ A;  1IBA A;  1I3Q C;  2A6H A;  3GTK A;  4A93 K;  4A3B C;  1YCL A;  4Y7N C;  1J98 A;  1PJ7 A;  3GTQ C;  1TWA K;  1O2F B;  4X6A K;  3I4N C;  4KMA A;  1O29 A;  4QIW D;  5IP9 K;  3AQO A;  1GE9 A;  4MEY A;  1L0W A;  1EH1 A;  3GTK C;  1ZXO A;  1K83 A;  4PAA A;  2FQT A;  2ZUF A;  3HXA A;  3AH5 A;  2YU9 K;  2KWA A;  4OIP A;  3LAJ A;  2ZFZ A;  4GTC A;  3TFH A;  4A3E K;  4A3G C;  4FM9 A;  1Y1W C;  5C3E K;  4BY7 C;  1SFO C;  3S1N C;  4BLA A;  4XLP A;  2PA8 L;  2CFA B;  4QIW L;  4KM8 A;  2NVT C;  4GTE A;  3FHZ A;  3CQZ C;  3HKZ D;  4NOI A;  1I3Q K;  5D4D A;  1IL2 A;  1XXC A;  1O24 A;  5M5Y K;  4DDQ A;  1TWG K;  4BBR C;  4Y7N K;  1BS2 A;  4LR2 A;  4XSZ A;  3GTQ K;  3H0G A;  5EGH A;  4KC6 A;  4LK0 A;  2JA7 C;  4YFK A;  3WOD A;  3ERE D;  2E2I A;  3GTK K;  3S16 K;  1F7U A;  5CHP A;  1WQH A;  5TJ3 A;  1WQF A;  3T01 A;  5JVO A;  3ORE A;  3M4O C;  3GTL A;  3HOZ C;  4Q4Z A;  4P9S A;  1WSV A;  3S0X A;  1DCH A;  4O2D A;  1TWA A;  4A3D C;  4MEX A;  3N0B A;  3DXJ A;  3V4G A;  4A3G K;  1O2B A;  1K83 K;  1Y1W K;  4KAR A;  1SFO K;  3GTL C;  3S1N K;  4BY7 K;  1YNJ A;  2B63 A;  4KAW X;  2VUM A;  1SMY A;  3AD7 C;  3H3V L;  1XZP A;  1HI9 A;  1TWH A;  3CAG A;  3LAP A;  3JST A;  1XZQ A;  4LJZ A;  1BDF A;  1G51 A;  4BBR K;  4A3I C;  2NVX A;  3S2H K;  4J3N A;  4A3C C;  4BY1 K;  4RMF A;  4BKW A;  4G7H A;  2RGR A;  1VJE A;  4Y52 C;  2VUM C;  4C2M C;  4G7Z A;  5IYD K;  2NVX C;  3HOZ K;  5M5X K;  4KAT A;  3PO3 C;  4A3D K;  4P5A A;  5M3F K;  1RU0 A;  3PO2 K;  2E2J K;  3HOX C;  3GTM A;  4YFN A;  2E2I K;  4OIQ A;  1O25 A;  2A68 A;  3GTL K;  3S1Q C;  1B4B A;  1JQW A;  1F93 A;  4QJV B;  2PA8 D;  1I6H C;  1PJ5 A;  5IOR A;  5FLM C;  3GTM C;  4A3I K;  5C4X C;  4A3C K;  1Y1W A;  3G4C A;  4PAB A;  4GZY A;  1HQM A;  2R93 A;  1SFO A;  4M1X A;  2B63 K;  2CFA A;  2BE5 A;  4Y52 K;  2VUM K;  1WCM A;  3CQZ A;  2V6T A;  2V6S A;  1TWH K;  1INN A;  2JH3 A;  3EQL A;  2A6E A;  3TFI A;  5HL8 A;  3GTO A;  4C45 A;  1USM A;  5E68 A;  2JA6 C;  2GSU A;  2NVX K;  2WAQ L;  5IP7 C;  5C44 K;  1JVI A;  2R93 C;  2NVY C;  4GT9 A;  1WCM C;  2JA7 A;  4AYB L;  2FQO A;  2NVQ C;  3T00 A;  3RZD C;  1TWF A;  3S2D C;  3GTO C;  4A3B K;  3A8K A;  3GDZ A;  4MQ9 A;  4G0U A;  2Y0S L;  5M5W K;  1BGW A;  3I4N K;  4KMD A;  2WB1 L;  1I6H K;  4G0W A;  3H3V D;  2PMZ L;  2JA5 C;  3GTM K;  3S14 C;  1TWF C;  1VLO A;  3I4M C;  4A3J C;  3HOV C;  2GSO A;  4XCH A;  3FOF A;  5TMC A;  1KQ4 A;  1I50 C;  1PJ6 A;  5IOT A;  2R7Z A;  2JA6 K;  3BUE A;  3N0C A;  4XLN A;  1C0A A;  1DCO A;  3SZZ A;  1AB4 A;  3S1R C;  2R93 K;  4A3K C;  2GAG C;  1WCM K;  2NVT K;  3CQZ K;  1BJT A;  1J6X A;  3GTG C;  4P5B A;  2R92 C;  1WIH A;  1WOO A;  2A69 A;  2NVQ K;  2GAH C;  4KM9 A;  3AD8 C;  4KDD A;  2R7Z C;  3S2D K;  3GTO K;  3L4J A;  3RZO C;  3SZY A;  1O27 A;  5L46 A;  4BLB A;  3HOY C;  5IYC C;  1YNN A;  4AH6 A;  2JA7 K;  4G7O A;  4A3F C;  2JA5 K;  4C3I C;  1TWF K;  3S14 K;  3FKI C;  4KAS A;  3M4O K;  3BP3 A;  4KB4 A;  3K7A C;  3I4M K;  3MML B;  5JFE A;  1J6V A;  2XCQ A;  3HOV K;  1R9T C;  4JK1 A; 
#chains in the Genus database with same CATH homology
 1HQM A;  5M5Y K;  3PO2 C;  2B63 K;  1TWG K;  3M3Y K;  2BE5 A;  2E2J C;  1I50 K;  3S15 C;  4BBR C;  4Y7N K;  4Y52 K;  2VUM K;  3S17 K;  4XSZ A;  3GTQ K;  1TWH K;  2E2I C;  4C3J K;  4A93 C;  2E2H C;  4BBS K;  3EQL A;  5FJ8 K;  4YFX A;  2A6E A;  3S1R K;  4OIO A;  1TWC K;  4A3K K;  2JA6 C;  4LK0 A;  2NVX K;  3PO3 K;  2WAQ D;  2JA7 C;  4YFK A;  1TWA C;  3WOD A;  2WAQ L;  5IP7 C;  5C44 K;  3GTK K;  2R93 C;  4X6A C;  3S16 K;  2R7Z K;  5IP9 C;  2NVY C;  3M4O C;  4BXX C;  1XPP A;  3HOZ C;  1WCM C;  4Q4Z A;  3GTP C;  3RZO K;  4AYB D;  5IYB C;  4A3J K;  2PPB A;  1ZYR A;  4AYB L;  2NVQ C;  4A3M C;  4A3D C;  4YG2 A;  2CW0 A;  4QJV A;  3RZD C;  4MEX A;  3S2D C;  3GTO C;  2B63 C;  1TWG C;  4KN7 A;  3HOW K;  3HOY K;  5IYC K;  4A3B K;  3S1M K;  2JA8 C;  4OIN A;  3DXJ A;  2Y0S D;  4MQ9 A;  4A3G K;  1TWH C;  2Y0S L;  3HOU K;  1K83 K;  4A3F K;  1Y1W K;  5M5W K;  2YU9 C;  4C3I K;  2WB1 D;  3FKI K;  4C2M K;  3I4N K;  5M3M K;  3GTL C;  1SFO K;  4BY7 K;  2WB1 L;  1I6V A;  3S1N K;  1YNJ A;  1I6H K;  3H3V D;  2PMZ D;  4A3E C;  5TMF A;  4Q5S A;  1SMY A;  3K7A K;  2PMZ L;  3H3V L;  1R9T C;  3GTJ C;  2JA5 C;  5C4J C;  3GTG K;  3GTM K;  1TWF C;  5C44 C;  2R92 K;  5C3E C;  3S14 C;  4LJZ A;  3H0G K;  1R9T K;  3S16 C;  1Y1V K;  2O5I A;  2O5J A;  1BDF A;  3I4M C;  3S15 K;  4BBR K;  4A3I C;  4A3J C;  3HOX K;  3HOV C;  4KMU A;  3S2H K;  4A3C C;  1I3Q C;  4BY1 K;  2A6H A;  4A3L C;  4A93 K;  2E2H K;  5TMC A;  4G7H A;  3M3Y C;  1I50 C;  4A3B C;  4Y7N C;  4Y52 C;  2VUM C;  3S1Q K;  2JA6 K;  3S17 C;  3GTQ C;  4XLN A;  4XSX A;  1TWA K;  1K83 C;  4BBS C;  2R93 K;  3S1R C;  3I4N C;  4X6A K;  4G7Z A;  1TWC C;  4A3K C;  5IYD K;  4QIW D;  5IP9 K;  2NVX C;  1IW7 A;  5FLM K;  3HOZ K;  5M5X K;  1WCM K;  2NVT K;  4MEY A;  3GTP K;  4BXX K;  3CQZ K;  3PO3 C;  5C4X K;  5IYB K;  3GTG C;  3GTK C;  2R92 C;  2A69 A;  2NVQ K;  4A3M K;  4A3D K;  2R7Z C;  3S2D K;  5M3F K;  3GTO K;  3PO2 K;  3RZO C;  2E2J K;  4ZH4 A;  1Y1V C;  4A3L K;  3HOX C;  2JA8 K;  3S2H C;  4YFN A;  2E2I K;  4BY1 C;  4OIQ A;  2YU9 K;  3HOY C;  2A68 A;  3HOW C;  5IYC C;  4OIR A;  3GTL K;  4OIP A;  3S1M C;  1YNN A;  3S1Q C;  4A3E K;  4A3G C;  2JA7 K;  3HOU C;  4LLG A;  4A3F C;  1Y1W C;  2JA5 K;  3GTJ K;  5IP7 K;  5C4J K;  4G7O A;  3S14 K;  1TWF K;  3FKI C;  5C3E K;  4QJV B;  4BY7 C;  4C3H K;  1SFO C;  3S1N C;  2PA8 D;  1I6H C;  5IYD C;  2NVY K;  2PA8 L;  4XLP A;  3M4O K;  4GZY A;  4QIW L;  3K7A C;  4LK1 A;  5FLM C;  4KN4 A;  2NVT C;  3GTM C;  3I4M K;  3CQZ C;  3HKZ D;  4A3I K;  5C4X C;  3HOV K;  4NOI A;  3HKZ L;  4A3C K;  1I3Q K;  3H0G C;  3RZD K;  5D4D A;  4JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...