5C44K

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c44K00
2E2HC 4A3IC 2Y0SL 2PPBA 3I4NC 3FKIC 3CQZK 1IW7A 3H0GK 5M5WK 4A3IK 3S1NC 4BBRC 2E2IC 2A6EA 3S2DC 1TWGK 2CW0A 2R92C 3I4MC 3GTLC 1K83C 4BXXK 3HOWK 4Q4ZA 2NVXK 1I6VA 3S1MK 1TWCK 1WCMC 3S17C 2JA8K 4LLGA 4KN4A 5C3EK 3WODA 3GTGC 3HOWC 2VUMK 2WAQL 4A3KC 3HOXK 4LK1A 5C3EC 3HOVK 4YFXA 5IYDK 4YFKA 2O5JA 3EQLA 2A69A 3M3YK 3S1MC 3K7AC 1TWGC 4QIWD 4MEYA 4Y7NC 1K83K 4A3LK 3K7AK 1ZYRA 2A6HA 2PA8L 4A3JK 5FJ8K 3S1NK 4A3CC 4YG2A 3S2HC 1I50C 4QIWL 1TWHC 4Y52K 5M5XK 4NOIA 4A3EK 2JA5C 4OINA 3I4NK 1I6HC 3PO3C 5IYCC 1Y1WK 4A3DC 4C3JK 4LJZA 4Y52C 3S1QK 2A68A 3RZOK 4BBRK 1TWCC 1WCMK 5FLMK 2E2IK 3GTJK 5IP9C 4A3JC 3GTPC 4BBSK 1SFOK 2JA6K 1TWHK 3H3VD 5FLMC 3M4OC 5IP7K 2NVQK 3S15K 1BDFA 2R93K 4G7OA 3GTQC 4XSXA 2E2JK 4QJVA 2JA7C 3HOYK 3GTGK 4OIRA 3H3VL 5C44K 4A3FK 3S2HK 4GZYA 3HOYC 3S14C 3HOZC 1I6HK 5IP7C 4BY1C 4BY7K 2WB1D 3DXJA 4XLNA 4OIPA 1YNJA 4LK0A 5M5YK 4JK1A 4C3HK 5C44C 2BE5A 3PO3K 5C4JK 5M3MK 3GTQK 4A3MK 1Y1VC 3RZDC 4MQ9A 3GTPK 4BBSC 4C3IK 5C4XC 2R92K 3S1QC 4KMUA 4QJVB 1HQMA 2PMZD 1TWAK 2NVYK 4G7HA 2JA5K 2B63C 4AYBL 2O5IA 3GTKC 3GTMK 3S2DK 3S17K 3S14K 1Y1VK 3RZDK 3GTMC 3GTOK 5M3FK 3HKZD 2E2JC 5IYBC 4MEXA 2YU9K 4A3KK 4BY1K 4BY7C 3PO2K 4A3BC 4AYBD 3HOUK 1SFOC 2WAQD 4KN7A 4G7ZA 1TWFK 2JA6C 2NVQC 4A3GC 3M3YC 3RZOC 3H0GC 3FKIK 4BXXC 5C4JC 3S1RC 5IYDC 4OIOA 4A3EC 4A3MC 3HOVC 5IYBK 2YU9C 4A93C 4X6AK 5IYCK 3S15C 4A3DK 4A3CK 3S16K 2PA8D 3CQZC 1SMYA 1I50K 3GTJC 5TMCA 1R9TK 2NVTK 4Y7NK 4A3LC 1I3QC 2R7ZC 3HKZL 1Y1WC 3PO2C 1R9TC 2NVTC 4YFNA 5TMFA 3HOZK 3I4MK 5C4XK 1I3QK 2R7ZK 2NVXC 4Q5SA 3S16C 5D4DA 1TWAC 4A3BK 4C2MK 3S1RK 2E2HK 2WB1L 2JA7K 2VUMC 4ZH4A 4A93K 4XSZA 4X6AC 1XPPA 3HOXC 5IP9K 3GTOC 4A3GK 3M4OK 4A3FC 2PMZL 2Y0SD 2R93C 4XLPA 2JA8C 2NVYC 2B63K 3HOUC 3GTKK 3GTLK 1TWFC 4OIQA 1YNNA
chains in the Genus database with same CATH superfamily
3H0GK 4A3IK 3GTLC 1K83C 3HOWK 1I6VA 3OEPA 1G51A 1WCMC 3G4CA 3TTGA 4KN4A 5L46A 4C45A 2XCOA 5C3EC 1TWHA 1VLOA 3S0XA 2O5JA 3GTLA 3EQLA 4LR2A 2A69A 3M3YK 1L0WA 4QIWD 4OIQA 4A3LK 1K83K 3A8JA 5JFEA 4YG2A 1I50C 4M1XA 3SZYA 4KASA 4NOIA 4BLBA 2A68A 1WCMK 2XCRB 3GTJK 2PHCB 4BBSK 3H3VD 3M4OC 2R93K 1XXBA 1VRQC 4DDQA 1I50A 2ZUFA 5C44K 1EFWA 1WOPA 3AD7C 5EGHA 2GAGC 4KB2A 1Y1VA 4BY7K 3GDZA 4LK0A 4JK1A 5C44C 3SZZA 3PO3K 5M3MK 2V6UA 4A3MK 3QX3A 4BBSC 5C4XC 4G0WA 4PAAA 1TWAK 2NVYK 2B63C 4G0VA 3GTKC 3ERED 3GTMC 2E2JC 3G4AA 5IYBC 1USOA 4BY1K 3GEIA 1SFOC 2WAQD 4KN7A 5IOTA 2JA6C 3M3YC 3AQOA 3GEHA 3LAPA 2RH6A 3S16K 1I50K 4RMFA 1F9NA 3AH5A 5TMCA 4A3LC 2NVTC 3I4MK 4KB4A 3HOZK 2NVXC 3S16C 5D4DA 2VUMC 2JA7K 1XPPA 3GTOC 1I3QA 2XCQA 2R7ZA 4KMHA 4XLPA 1K83A 3HOUC 3GTLK 1PJ6A 4P5AA 1TWFC 4QJVA 1WQHA 4A3IC 2PPBA 2CFAB 1J6WA 1O2FB 3OREA 4BBRC 2A6EA 3S1NC 2V6SA 3FOEA 4BXXK 2NVXK 1TWGA 5TJ3A 1ZXOA 1TWCK 3S17C 3WODA 1C0AA 5IORA 3HOXK 1EH1A 4LK1A 4GT9A 3LPXA 1USMA 4MEYA 3AD9C 3K7AK 2A6HA 4KAWX 4O2DA 3S1NK 2JA5C 3N0BA 4OINA 3I4NK 5IYCC 2JH3A 4Y52C 3N0CA 3T00A 3S1QK 3RZOK 1TWCC 5IP9C 1WORA 3GTPC 5FLMC 3T01A 2NVQK 1O25A 4ILDA 1F7VA 4XSXA 2JA7C 3JSTA 1O27A 1XZPB 4GZYA 3HOYC 3S14C 3V4GA 3HXAA 4KMAA 3HOZC 1F93A 5IP7C 3TFHA 4OIPA 1X31C 1Y1VC 4BKWA 3GTPK 4C3IK 2ZFZA 2R92K 1F7UA 2GSNA 1HQMA 2PMZD 4G7HA 3GTMK 2O5IA 3S17K 3S14K 1Y1VK 2D6FC 1WSRA 1VJEA 3HKZD 1EK8A 2Y3PA 4BY7C 3PO2K 4A3BC 1O29A 1EI6A 3FKIK 4OIOA 4A3MC 2YU9C 4A93C 3GEEA 5IYCK 1JVIA 1WOSA 4C3IC 3Q3QA 1SFOA 2JA6A 1R9TK 1I3QC 2R7ZC 1HI9A 1Y1WC 3PO2C 1JOEA 5C4XK 2YU9A 3BUEA 3FKIA 4LOWA 2WB1L 4ZH4A 4A93K 1ZVUA 5CHPA 3GIRA 4GTFA 3M4OK 2R93C 2PMZL 3ADAC 2R92A 1Y1WA 2CFAA 2NVYC 2B63K 3GTKK 4FZBA 1RU0A 1XZPA 1J6VA 2E2HC 2Y0SL 1TWAA 1IL2A 1IE0A 2E2IC 3S2DC 4LQYA 1O2AA 3N3YA 1XZQB 2CW0A 2R92C 3I4MC 5HL8A 2NVYA 4WILA 1TWFA 3S1MK 2GAHC 3OPFA 5C3EK 3GTGC 3VA7A 2VUMK 4G0UA 4C3HC 3HOVK 5IYDK 1O28A 2JA5A 1DCOA 1PJ7A 3S1MC 2GSOA 1PJ5A 3A8KA 4Y7NC 4GTEA 4FM9A 2ZUEA 2GSUA 2PA8L 4A3JK 5FJ8K 4A3CC 1YCLA 3GTQA 1TWHC 5IOSA 5M5XK 4A3EK 4A3DC 1Y1WK 1YX2A 4LJZA 4C3JK 2V6TA 4BBRK 5FLMK 5JVOA 4A3JC 5EGEA 1SFOK 2JA6K 4AH6A 5IP7K 2E2JK 1DCHA 3HOYK 1IS1A 4KM8A 4OIRA 1WQFA 4XCHA 3S2HK 2FQOA 1ZQ1C 2BE5A 5C4JK 3GTMA 4GTDA 2P5MA 4QJVB 4GTAA 3BP3A 3H0GA 1DD5A 3T02A 4WJ3M 1ZBSA 4MEXA 2YU9K 4A3KK 3CQZA 4AYBD 3HOUK 4G7ZA 1TWFK 1R9TA 3H0GC 4BXXC 3A8IA 4C2MC 5IYDC 3HOVC 4A3EC 4X6AK 4A3DK 3S15C 1BS2A 4A3CK 3CQZC 4GTLA 3IPJA 2NVTK 4Y7NK 4WJ4A 3AD8C 1O2BA 4GTBA 4YFNA 1WOOA 2E2HA 5CJ9A 1TWAC 4A3BK 4C2MK 2E2HK 4X6AC 4XSZA 4GTCA 5IP9K 3L4JA 1UV7A 2Y0SD 1YNNA 3I4NC 3FKIC 3CQZK 1IW7A 4KARA 3FHZA 2VUMA 5M5WK 1J98A 4KATA 3GTOA 1JQWA 1TWGK 1WSVA 4KMDA 4Q4ZA 4P9SA 4BLAA 2JA8K 4LLGA 3HOWC 2FQTA 3LAJA 2WAQL 4A3KC 3TFJA 4YFXA 1VH2A 4YFKA 3K7AC 1TWGC 1WCMA 3GTPA 1ZYRA 3GTGA 2P8TA 3S2HC 3FOFA 2JA7A 4QIWL 4Y52K 1I6HC 3PO3C 1B4BA 1INNA 2E2IK 3AQPA 1IBAA 3S15K 1BDFA 4G7OA 3GTQC 1B4AA 3GTGK 3H3VL 3L4KA 4A3FK 1TWCA 1I6HK 1DCPA 3BP8C 3CAGA 1XXCA 4BY1C 2WB1D 3DXJA 2NVXA 1J6XA 2KWAA 4XLNA 4KDDA 1YNJA 5M5YK 4C3HK 4KC6A 3NUHA 1EQRA 3GTQK 3GSIA 3RZDC 4MQ9A 5IOQA 1XXAA 3S1QC 4KMUA 1ISEA 4P5BA 2JA5K 4AYBL 1GE9A 3S2DK 3RZDK 1VGXA 3GTOK 1AB4A 5M3FK 1XZQA 1BGWA 2NVQC 4A3GC 1WIHA 3RZOC 3GTKA 2B63A 5C4JC 3S1RC 5IYBK 1O26A 3MMLB 2RGRA 2PA8D 1SMYA 3GTJC 1O24A 2W7VA 3HKZL 2R93A 1V5VA 1R9TC 5TMFA 1I3QK 2R7ZK 2EBBA 3TFIA 4Q5SA 3S1RK 1WQGA 1IQ0A 3GTJA 3HOXC 2E2IA 4A3GK 4A3FC 5E68A 2JA8C 1BJTA 4KM9A 4J3NA 4C3JC 4GFQA 4PABA 1KQ4A 1TWHK
chains in the Genus database with same CATH topology
2E2HC 4A3IC 2Y0SL 2PPBA 3I4NC 3FKIC 3CQZK 1IW7A 3H0GK 5M5WK 4A3IK 3S1NC 4BBRC 2E2IC 2A6EA 3S2DC 1TWGK 2CW0A 2R92C 3I4MC 3GTLC 1K83C 4BXXK 3HOWK 4Q4ZA 2NVXK 1I6VA 3S1MK 1TWCK 1WCMC 3S17C 2JA8K 4LLGA 4KN4A 5C3EK 3WODA 3GTGC 3HOWC 2VUMK 2WAQL 4A3KC 3HOXK 4LK1A 5C3EC 3HOVK 4YFXA 5IYDK 4YFKA 2O5JA 3EQLA 2A69A 3M3YK 3S1MC 3K7AC 1TWGC 4QIWD 4MEYA 4Y7NC 1K83K 4A3LK 3K7AK 1ZYRA 2A6HA 2PA8L 4A3JK 5FJ8K 3S1NK 4A3CC 4YG2A 3S2HC 1I50C 4QIWL 1TWHC 4Y52K 5M5XK 4NOIA 4A3EK 2JA5C 4OINA 3I4NK 1I6HC 3PO3C 5IYCC 1Y1WK 4A3DC 4C3JK 4LJZA 4Y52C 3S1QK 2A68A 3RZOK 4BBRK 1TWCC 1WCMK 5FLMK 2E2IK 3GTJK 5IP9C 4A3JC 3GTPC 4BBSK 1SFOK 2JA6K 1TWHK 3H3VD 5FLMC 3M4OC 5IP7K 2NVQK 3S15K 1BDFA 2R93K 4G7OA 3GTQC 4XSXA 2E2JK 4QJVA 2JA7C 3HOYK 3GTGK 4OIRA 3H3VL 5C44K 4A3FK 3S2HK 4GZYA 3HOYC 3S14C 3HOZC 1I6HK 5IP7C 4BY1C 4BY7K 2WB1D 3DXJA 4XLNA 4OIPA 1YNJA 4LK0A 5M5YK 4JK1A 4C3HK 5C44C 2BE5A 3PO3K 5C4JK 5M3MK 3GTQK 4A3MK 1Y1VC 3RZDC 4MQ9A 3GTPK 4BBSC 4C3IK 5C4XC 2R92K 3S1QC 4KMUA 4QJVB 1HQMA 2PMZD 1TWAK 2NVYK 4G7HA 2JA5K 2B63C 4AYBL 2O5IA 3GTKC 3GTMK 3S2DK 3S17K 3S14K 1Y1VK 3RZDK 3GTMC 3GTOK 5M3FK 3HKZD 2E2JC 5IYBC 4MEXA 2YU9K 4A3KK 4BY1K 4BY7C 3PO2K 4A3BC 4AYBD 3HOUK 1SFOC 2WAQD 4KN7A 4G7ZA 1TWFK 2JA6C 2NVQC 4A3GC 3M3YC 3RZOC 3H0GC 3FKIK 4BXXC 5C4JC 3S1RC 5IYDC 4OIOA 4A3EC 4A3MC 3HOVC 5IYBK 2YU9C 4A93C 4X6AK 5IYCK 3S15C 4A3DK 4A3CK 3S16K 2PA8D 3CQZC 1SMYA 1I50K 3GTJC 5TMCA 1R9TK 2NVTK 4Y7NK 4A3LC 1I3QC 2R7ZC 3HKZL 1Y1WC 3PO2C 1R9TC 2NVTC 4YFNA 5TMFA 3HOZK 3I4MK 5C4XK 1I3QK 2R7ZK 2NVXC 4Q5SA 3S16C 5D4DA 1TWAC 4A3BK 4C2MK 3S1RK 2E2HK 2WB1L 2JA7K 2VUMC 4ZH4A 4A93K 4XSZA 4X6AC 1XPPA 3HOXC 5IP9K 3GTOC 4A3GK 3M4OK 4A3FC 2PMZL 2Y0SD 2R93C 4XLPA 2JA8C 2NVYC 2B63K 3HOUC 3GTKK 3GTLK 1TWFC 4OIQA 1YNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H C;  4A3I C;  2Y0S L;  2PPB A;  3I4N C;  3FKI C;  3CQZ K;  1IW7 A;  3H0G K;  5M5W K;  4A3I K;  3S1N C;  4BBR C;  2E2I C;  2A6E A;  3S2D C;  1TWG K;  2CW0 A;  2R92 C;  3I4M C;  3GTL C;  1K83 C;  4BXX K;  3HOW K;  4Q4Z A;  2NVX K;  1I6V A;  3S1M K;  1TWC K;  1WCM C;  3S17 C;  2JA8 K;  4LLG A;  4KN4 A;  5C3E K;  3WOD A;  3GTG C;  3HOW C;  2VUM K;  2WAQ L;  4A3K C;  3HOX K;  4LK1 A;  5C3E C;  3HOV K;  4YFX A;  5IYD K;  4YFK A;  2O5J A;  3EQL A;  2A69 A;  3M3Y K;  3S1M C;  3K7A C;  1TWG C;  4QIW D;  4MEY A;  4Y7N C;  1K83 K;  4A3L K;  3K7A K;  1ZYR A;  2A6H A;  2PA8 L;  4A3J K;  5FJ8 K;  3S1N K;  4A3C C;  4YG2 A;  3S2H C;  1I50 C;  4QIW L;  1TWH C;  4Y52 K;  5M5X K;  4NOI A;  4A3E K;  2JA5 C;  4OIN A;  3I4N K;  1I6H C;  3PO3 C;  5IYC C;  1Y1W K;  4A3D C;  4C3J K;  4LJZ A;  4Y52 C;  3S1Q K;  2A68 A;  3RZO K;  4BBR K;  1TWC C;  1WCM K;  5FLM K;  2E2I K;  3GTJ K;  5IP9 C;  4A3J C;  3GTP C;  4BBS K;  1SFO K;  2JA6 K;  1TWH K;  3H3V D;  5FLM C;  3M4O C;  5IP7 K;  2NVQ K;  3S15 K;  1BDF A;  2R93 K;  4G7O A;  3GTQ C;  4XSX A;  2E2J K;  4QJV A;  2JA7 C;  3HOY K;  3GTG K;  4OIR A;  3H3V L;  5C44 K;  4A3F K;  3S2H K;  4GZY A;  3HOY C;  3S14 C;  3HOZ C;  1I6H K;  5IP7 C;  4BY1 C;  4BY7 K;  2WB1 D;  3DXJ A;  4XLN A;  4OIP A;  1YNJ A;  4LK0 A;  5M5Y K;  4JK1 A;  4C3H K;  5C44 C;  2BE5 A;  3PO3 K;  5C4J K;  5M3M K;  3GTQ K;  4A3M K;  1Y1V C;  3RZD C;  4MQ9 A;  3GTP K;  4BBS C;  4C3I K;  5C4X C;  2R92 K;  3S1Q C;  4KMU A;  4QJV B;  1HQM A;  2PMZ D;  1TWA K;  2NVY K;  4G7H A;  2JA5 K;  2B63 C;  4AYB L;  2O5I A;  3GTK C;  3GTM K;  3S2D K;  3S17 K;  3S14 K;  1Y1V K;  3RZD K;  3GTM C;  3GTO K;  5M3F K;  3HKZ D;  2E2J C;  5IYB C;  4MEX A;  2YU9 K;  4A3K K;  4BY1 K;  4BY7 C;  3PO2 K;  4A3B C;  4AYB D;  3HOU K;  1SFO C;  2WAQ D;  4KN7 A;  4G7Z A;  1TWF K;  2JA6 C;  2NVQ C;  4A3G C;  3M3Y C;  3RZO C;  3H0G C;  3FKI K;  4BXX C;  5C4J C;  3S1R C;  5IYD C;  4OIO A;  4A3E C;  4A3M C;  3HOV C;  5IYB K;  2YU9 C;  4A93 C;  4X6A K;  5IYC K;  3S15 C;  4A3D K;  4A3C K;  3S16 K;  2PA8 D;  3CQZ C;  1SMY A;  1I50 K;  3GTJ C;  5TMC A;  1R9T K;  2NVT K;  4Y7N K;  4A3L C;  1I3Q C;  2R7Z C;  3HKZ L;  1Y1W C;  3PO2 C;  1R9T C;  2NVT C;  4YFN A;  5TMF A;  3HOZ K;  3I4M K;  5C4X K;  1I3Q K;  2R7Z K;  2NVX C;  4Q5S A;  3S16 C;  5D4D A;  1TWA C;  4A3B K;  4C2M K;  3S1R K;  2E2H K;  2WB1 L;  2JA7 K;  2VUM C;  4ZH4 A;  4A93 K;  4XSZ A;  4X6A C;  1XPP A;  3HOX C;  5IP9 K;  3GTO C;  4A3G K;  3M4O K;  4A3F C;  2PMZ L;  2Y0S D;  2R93 C;  4XLP A;  2JA8 C;  2NVY C;  2B63 K;  3HOU C;  3GTK K;  3GTL K;  1TWF C;  4OIQ A;  1YNN A; 
#chains in the Genus database with same CATH topology
 3H0G K;  4A3I K;  3GTL C;  1K83 C;  3HOW K;  1I6V A;  3OEP A;  1G51 A;  1WCM C;  3G4C A;  3TTG A;  4KN4 A;  5L46 A;  4C45 A;  2XCO A;  5C3E C;  1TWH A;  1VLO A;  3S0X A;  2O5J A;  3GTL A;  3EQL A;  4LR2 A;  2A69 A;  3M3Y K;  1L0W A;  4QIW D;  4OIQ A;  4A3L K;  1K83 K;  3A8J A;  5JFE A;  4YG2 A;  1I50 C;  4M1X A;  3SZY A;  4KAS A;  4NOI A;  4BLB A;  2A68 A;  1WCM K;  2XCR B;  3GTJ K;  2PHC B;  4BBS K;  3H3V D;  3M4O C;  2R93 K;  1XXB A;  1VRQ C;  4DDQ A;  1I50 A;  2ZUF A;  5C44 K;  1EFW A;  1WOP A;  3AD7 C;  5EGH A;  2GAG C;  4KB2 A;  1Y1V A;  4BY7 K;  3GDZ A;  4LK0 A;  4JK1 A;  5C44 C;  3SZZ A;  3PO3 K;  5M3M K;  2V6U A;  4A3M K;  3QX3 A;  4BBS C;  5C4X C;  4G0W A;  4PAA A;  1TWA K;  2NVY K;  2B63 C;  4G0V A;  3GTK C;  3ERE D;  3GTM C;  2E2J C;  3G4A A;  5IYB C;  1USO A;  4BY1 K;  3GEI A;  1SFO C;  2WAQ D;  4KN7 A;  5IOT A;  2JA6 C;  3M3Y C;  3AQO A;  3GEH A;  3LAP A;  2RH6 A;  3S16 K;  1I50 K;  4RMF A;  1F9N A;  3AH5 A;  5TMC A;  4A3L C;  2NVT C;  3I4M K;  4KB4 A;  3HOZ K;  2NVX C;  3S16 C;  5D4D A;  2VUM C;  2JA7 K;  1XPP A;  3GTO C;  1I3Q A;  2XCQ A;  2R7Z A;  4KMH A;  4XLP A;  1K83 A;  3HOU C;  3GTL K;  1PJ6 A;  4P5A A;  1TWF C;  4QJV A;  1WQH A;  4A3I C;  2PPB A;  2CFA B;  1J6W A;  1O2F B;  3ORE A;  4BBR C;  2A6E A;  3S1N C;  2V6S A;  3FOE A;  4BXX K;  2NVX K;  1TWG A;  5TJ3 A;  1ZXO A;  1TWC K;  3S17 C;  3WOD A;  1C0A A;  5IOR A;  3HOX K;  1EH1 A;  4LK1 A;  4GT9 A;  3LPX A;  1USM A;  4MEY A;  3AD9 C;  3K7A K;  2A6H A;  4KAW X;  4O2D A;  3S1N K;  2JA5 C;  3N0B A;  4OIN A;  3I4N K;  5IYC C;  2JH3 A;  4Y52 C;  3N0C A;  3T00 A;  3S1Q K;  3RZO K;  1TWC C;  5IP9 C;  1WOR A;  3GTP C;  5FLM C;  3T01 A;  2NVQ K;  1O25 A;  4ILD A;  1F7V A;  4XSX A;  2JA7 C;  3JST A;  1O27 A;  1XZP B;  4GZY A;  3HOY C;  3S14 C;  3V4G A;  3HXA A;  4KMA A;  3HOZ C;  1F93 A;  5IP7 C;  3TFH A;  4OIP A;  1X31 C;  1Y1V C;  4BKW A;  3GTP K;  4C3I K;  2ZFZ A;  2R92 K;  1F7U A;  2GSN A;  1HQM A;  2PMZ D;  4G7H A;  3GTM K;  2O5I A;  3S17 K;  3S14 K;  1Y1V K;  2D6F C;  1WSR A;  1VJE A;  3HKZ D;  1EK8 A;  2Y3P A;  4BY7 C;  3PO2 K;  4A3B C;  1O29 A;  1EI6 A;  3FKI K;  4OIO A;  4A3M C;  2YU9 C;  4A93 C;  3GEE A;  5IYC K;  1JVI A;  1WOS A;  4C3I C;  3Q3Q A;  1SFO A;  2JA6 A;  1R9T K;  1I3Q C;  2R7Z C;  1HI9 A;  1Y1W C;  3PO2 C;  1JOE A;  5C4X K;  2YU9 A;  3BUE A;  3FKI A;  4LOW A;  2WB1 L;  4ZH4 A;  4A93 K;  1ZVU A;  5CHP A;  3GIR A;  4GTF A;  3M4O K;  2R93 C;  2PMZ L;  3ADA C;  2R92 A;  1Y1W A;  2CFA A;  2NVY C;  2B63 K;  3GTK K;  4FZB A;  1RU0 A;  1XZP A;  1J6V A;  2E2H C;  2Y0S L;  1TWA A;  1IL2 A;  1IE0 A;  2E2I C;  3S2D C;  4LQY A;  1O2A A;  3N3Y A;  1XZQ B;  2CW0 A;  2R92 C;  3I4M C;  5HL8 A;  2NVY A;  4WIL A;  1TWF A;  3S1M K;  2GAH C;  3OPF A;  5C3E K;  3GTG C;  3VA7 A;  2VUM K;  4G0U A;  4C3H C;  3HOV K;  5IYD K;  1O28 A;  2JA5 A;  1DCO A;  1PJ7 A;  3S1M C;  2GSO A;  1PJ5 A;  3A8K A;  4Y7N C;  4GTE A;  4FM9 A;  2ZUE A;  2GSU A;  2PA8 L;  4A3J K;  5FJ8 K;  4A3C C;  1YCL A;  3GTQ A;  1TWH C;  5IOS A;  5M5X K;  4A3E K;  4A3D C;  1Y1W K;  1YX2 A;  4LJZ A;  4C3J K;  2V6T A;  4BBR K;  5FLM K;  5JVO A;  4A3J C;  5EGE A;  1SFO K;  2JA6 K;  4AH6 A;  5IP7 K;  2E2J K;  1DCH A;  3HOY K;  1IS1 A;  4KM8 A;  4OIR A;  1WQF A;  4XCH A;  3S2H K;  2FQO A;  1ZQ1 C;  2BE5 A;  5C4J K;  3GTM A;  4GTD A;  2P5M A;  4QJV B;  4GTA A;  3BP3 A;  3H0G A;  1DD5 A;  3T02 A;  4WJ3 M;  1ZBS A;  4MEX A;  2YU9 K;  4A3K K;  3CQZ A;  4AYB D;  3HOU K;  4G7Z A;  1TWF K;  1R9T A;  3H0G C;  4BXX C;  3A8I A;  4C2M C;  5IYD C;  3HOV C;  4A3E C;  4X6A K;  4A3D K;  3S15 C;  1BS2 A;  4A3C K;  3CQZ C;  4GTL A;  3IPJ A;  2NVT K;  4Y7N K;  4WJ4 A;  3AD8 C;  1O2B A;  4GTB A;  4YFN A;  1WOO A;  2E2H A;  5CJ9 A;  1TWA C;  4A3B K;  4C2M K;  2E2H K;  4X6A C;  4XSZ A;  4GTC A;  5IP9 K;  3L4J A;  1UV7 A;  2Y0S D;  1YNN A;  3I4N C;  3FKI C;  3CQZ K;  1IW7 A;  4KAR A;  3FHZ A;  2VUM A;  5M5W K;  1J98 A;  4KAT A;  3GTO A;  1JQW A;  1TWG K;  1WSV A;  4KMD A;  4Q4Z A;  4P9S A;  4BLA A;  2JA8 K;  4LLG A;  3HOW C;  2FQT A;  3LAJ A;  2WAQ L;  4A3K C;  3TFJ A;  4YFX A;  1VH2 A;  4YFK A;  3K7A C;  1TWG C;  1WCM A;  3GTP A;  1ZYR A;  3GTG A;  2P8T A;  3S2H C;  3FOF A;  2JA7 A;  4QIW L;  4Y52 K;  1I6H C;  3PO3 C;  1B4B A;  1INN A;  2E2I K;  3AQP A;  1IBA A;  3S15 K;  1BDF A;  4G7O A;  3GTQ C;  1B4A A;  3GTG K;  3H3V L;  3L4K A;  4A3F K;  1TWC A;  1I6H K;  1DCP A;  3BP8 C;  3CAG A;  1XXC A;  4BY1 C;  2WB1 D;  3DXJ A;  2NVX A;  1J6X A;  2KWA A;  4XLN A;  4KDD A;  1YNJ A;  5M5Y K;  4C3H K;  4KC6 A;  3NUH A;  1EQR A;  3GTQ K;  3GSI A;  3RZD C;  4MQ9 A;  5IOQ A;  1XXA A;  3S1Q C;  4KMU A;  1ISE A;  4P5B A;  2JA5 K;  4AYB L;  1GE9 A;  3S2D K;  3RZD K;  1VGX A;  3GTO K;  1AB4 A;  5M3F K;  1XZQ A;  1BGW A;  2NVQ C;  4A3G C;  1WIH A;  3RZO C;  3GTK A;  2B63 A;  5C4J C;  3S1R C;  5IYB K;  1O26 A;  3MML B;  2RGR A;  2PA8 D;  1SMY A;  3GTJ C;  1O24 A;  2W7V A;  3HKZ L;  2R93 A;  1V5V A;  1R9T C;  5TMF A;  1I3Q K;  2R7Z K;  2EBB A;  3TFI A;  4Q5S A;  3S1R K;  1WQG A;  1IQ0 A;  3GTJ A;  3HOX C;  2E2I A;  4A3G K;  4A3F C;  5E68 A;  2JA8 C;  1BJT A;  4KM9 A;  4J3N A;  4C3J C;  4GFQ A;  4PAB A;  1KQ4 A;  1TWH K; 
#chains in the Genus database with same CATH homology
 2E2H C;  4A3I C;  2Y0S L;  2PPB A;  3I4N C;  3FKI C;  3CQZ K;  1IW7 A;  3H0G K;  5M5W K;  4A3I K;  3S1N C;  4BBR C;  2E2I C;  2A6E A;  3S2D C;  1TWG K;  2CW0 A;  2R92 C;  3I4M C;  3GTL C;  1K83 C;  4BXX K;  3HOW K;  4Q4Z A;  2NVX K;  1I6V A;  3S1M K;  1TWC K;  1WCM C;  3S17 C;  2JA8 K;  4LLG A;  4KN4 A;  5C3E K;  3WOD A;  3GTG C;  3HOW C;  2VUM K;  2WAQ L;  4A3K C;  3HOX K;  4LK1 A;  5C3E C;  3HOV K;  4YFX A;  5IYD K;  4YFK A;  2O5J A;  3EQL A;  2A69 A;  3M3Y K;  3S1M C;  3K7A C;  1TWG C;  4QIW D;  4MEY A;  4Y7N C;  1K83 K;  4A3L K;  3K7A K;  1ZYR A;  2A6H A;  2PA8 L;  4A3J K;  5FJ8 K;  3S1N K;  4A3C C;  4YG2 A;  3S2H C;  1I50 C;  4QIW L;  1TWH C;  4Y52 K;  5M5X K;  4NOI A;  4A3E K;  2JA5 C;  4OIN A;  3I4N K;  1I6H C;  3PO3 C;  5IYC C;  1Y1W K;  4A3D C;  4C3J K;  4LJZ A;  4Y52 C;  3S1Q K;  2A68 A;  3RZO K;  4BBR K;  1TWC C;  1WCM K;  5FLM K;  2E2I K;  3GTJ K;  5IP9 C;  4A3J C;  3GTP C;  4BBS K;  1SFO K;  2JA6 K;  1TWH K;  3H3V D;  5FLM C;  3M4O C;  5IP7 K;  2NVQ K;  3S15 K;  1BDF A;  2R93 K;  4G7O A;  3GTQ C;  4XSX A;  2E2J K;  4QJV A;  2JA7 C;  3HOY K;  3GTG K;  4OIR A;  3H3V L;  5C44 K;  4A3F K;  3S2H K;  4GZY A;  3HOY C;  3S14 C;  3HOZ C;  1I6H K;  5IP7 C;  4BY1 C;  4BY7 K;  2WB1 D;  3DXJ A;  4XLN A;  4OIP A;  1YNJ A;  4LK0 A;  5M5Y K;  4JK1 A;  4C3H K;  5C44 C;  2BE5 A;  3PO3 K;  5C4J K;  5M3M K;  3GTQ K;  4A3M K;  1Y1V C;  3RZD C;  4MQ9 A;  3GTP K;  4BBS C;  4C3I K;  5C4X C;  2R92 K;  3S1Q C;  4KMU A;  4QJV B;  1HQM A;  2PMZ D;  1TWA K;  2NVY K;  4G7H A;  2JA5 K;  2B63 C;  4AYB L;  2O5I A;  3GTK C;  3GTM K;  3S2D K;  3S17 K;  3S14 K;  1Y1V K;  3RZD K;  3GTM C;  3GTO K;  5M3F K;  3HKZ D;  2E2J C;  5IYB C;  4MEX A;  2YU9 K;  4A3K K;  4BY1 K;  4BY7 C;  3PO2 K;  4A3B C;  4AYB D;  3HOU K;  1SFO C;  2WAQ D;  4KN7 A;  4G7Z A;  1TWF K;  2JA6 C;  2NVQ C;  4A3G C;  3M3Y C;  3RZO C;  3H0G C;  3FKI K;  4BXX C;  5C4J C;  3S1R C;  5IYD C;  4OIO A;  4A3E C;  4A3M C;  3HOV C;  5IYB K;  2YU9 C;  4A93 C;  4X6A K;  5IYC K;  3S15 C;  4A3D K;  4A3C K;  3S16 K;  2PA8 D;  3CQZ C;  1SMY A;  1I50 K;  3GTJ C;  5TMC A;  1R9T K;  2NVT K;  4Y7N K;  4A3L C;  1I3Q C;  2R7Z C;  3HKZ L;  1Y1W C;  3PO2 C;  1R9T C;  2NVT C;  4YFN A;  5TMF A;  3HOZ K;  3I4M K;  5C4X K;  1I3Q K;  2R7Z K;  2NVX C;  4Q5S A;  3S16 C;  5D4D A;  1TWA C;  4A3B K;  4C2M K;  3S1R K;  2E2H K;  2WB1 L;  2JA7 K;  2VUM C;  4ZH4 A;  4A93 K;  4XSZ A;  4X6A C;  1XPP A;  3HOX C;  5IP9 K;  3GTO C;  4A3G K;  3M4O K;  4A3F C;  2PMZ L;  2Y0S D;  2R93 C;  4XLP A;  2JA8 C;  2NVY C;  2B63 K;  3HOU C;  3GTK K;  3GTL K;  1TWF C;  4OIQ A;  1YNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...