5C44K

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c44K00
1I6VA 4KN4A 4NOIA 4YFXA 3HOWC 2JA7C 1BDFA 3HOYC 3S16C 4A3CC 3S1RC 5M3FK 2NVTK 2E2HC 5C4JC 5FJ8K 1Y1WC 4QIWL 4C3HK 2JA6K 3H3VD 3HOXC 5M5WK 4Q5SA 2A69A 4LLGA 5IYCC 2VUMK 3GTPC 3HOZC 4A3GK 2R93C 5IP7K 3S1NK 1TWHC 3HKZL 3S2DC 4BY1K 3GTOC 3RZOC 1TWCC 4LK1A 4YFKA 2JA5K 5IYDC 2PPBA 4BXXC 3HOVK 1K83K 4A3DK 5C4XK 1R9TK 2PMZD 3K7AC 4OIQA 4A3EC 4A3JC 3GTKK 3GTJK 3M3YK 4LK0A 3PO2K 2R7ZK 1HQMA 3WODA 3M4OC 4A3LC 3H0GC 3S15K 4G7OA 3S1MC 2WB1L 1Y1VC 2CW0A 4A3IC 5TMFA 5TMCA 5IP9K 5C44C 2NVXC 3GTQC 4BBSC 4Y52K 1TWFC 4A3MK 1TWAC 1WCMC 3S2HC 4GZYA 4A3FC 4Y7NC 3S14K 1IW7A 3RZDC 2JA8C 1YNNA 2NVYC 5C3EC 3HOWK 3HOYK 4A3CK 1I50C 4YFNA 3S1RK 2YU9K 2E2HK 5C4JK 3H3VL 1I3QC 2Y0SD 1Y1WK 1SFOC 4A3KC 4XLPA 2NVQK 1XPPA 3S1QC 3I4NC 3GTMC 5IYCK 4BBRC 2B63C 3HOZK 2E2IC 4X6AC 3DXJA 1TWHK 2PA8D 5M5XK 2R92K 3S2DK 2E2JC 3GTLC 1TWCK 3RZOK 5IYDK 4OIPA 5FLMC 4KMUA 4BXXK 3S17C 4QIWD 4A3JK 3EQLA 4AYBL 3PO3C 3HKZD 4QJVB 2JA5C 3M4OK 3H0GK 1TWGC 4JK1A 3HOVC 5IYBC 1SMYA 4Q4ZA 4G7HA 4A3DC 2O5IA 3FKIC 3GTGC 3I4MC 4A3BC 4A93K 2A6EA 2NVXK 2JA7K 3GTQK 5M3MK 3S16K 4BY7C 1TWFK 2WAQD 4BBSK 2A6HA 4Y7NK 3S15C 3RZDK 3HOUC 2JA8K 3HOXK 2NVYK 2O5JA 4MEXA 3GTPK 2WB1D 4XSXA 1I6HC 3CQZC 2R93K 2Y0SL 4YG2A 4OINA 2A68A 3GTOK 4QJVA 4XSZA 4C2MK 2NVTC 3I4NK 3S14C 2B63K 2JA6C 2PMZL 2E2IK 4X6AK 3K7AK 1ZYRA 2E2JK 2VUMC 4A3EK 3GTLK 2YU9C 4A3GC 4MEYA 5IP7C 5FLMK 3S1NC 4LJZA 4OIOA 4C3IK 5M5YK 4XLNA 4BY1C 4A3LK 2NVQC 3S17K 3S1MK 1Y1VK 1K83C 4MQ9A 1R9TC 4A3IK 5C4XC 2R92C 3PO3K 3GTKC 3M3YC 5C44K 4KN7A 1TWGK 3GTJC 3PO2C 3S2HK 1TWAK 1WCMK 2R7ZC 5IYBK 4A3FK 4OIRA 3FKIK 3GTGK 3I4MK 4A3BK 5C3EK 2WAQL 4BY7K 1I50K 4AYBD 5D4DA 5IP9C 4ZH4A 1I3QK 4Y52C 1SFOK 4A3MC 4G7ZA 4A3KK 3HOUK 1YNJA 4C3JK 3S1QK 2BE5A 3GTMK 4BBRK 1I6HK 3CQZK 2PA8L 4A93C
chains in the Genus database with same CATH superfamily
2P5MA 1I6VA 3HOYC 2NVTK 4KM8A 2GAHC 4C3HK 3HOXC 2A69A 3OPFA 5IYCC 2VUMK 3S1NK 2VUMA 4BY1K 3RZOC 1J6WA 4LK1A 4YFKA 5IYDC 4BXXC 4A3DK 1R9TK 1F7VA 1R9TA 4OIQA 1VJEA 3CAGA 5CHPA 1YCLA 1J6XA 1V5VA 3WODA 3M4OC 4A3LC 3H0GC 3S15K 4G7OA 3AD9C 4ILDA 4A3IC 4KMAA 3FOFA 2V6SA 4G0WA 1XZQA 4P9SA 1B4BA 1WCMC 1WSRA 3S14K 3TFJA 1I50C 1O24A 1ZBSA 5C4JK 2E2HK 2Y0SD 2E2HA 2W7VA 4XLPA 1WORA 3S1QC 3I4NC 3GTMC 4C45A 4X6AC 2R92K 4AH6A 2R92A 1XXBA 1VLOA 1EQRA 1BS2A 1WOSA 2JA5C 2ZUFA 5IYBC 3GEIA 4Q4ZA 3FKIC 3GTGC 1UV7A 2A6EA 2XCQA 2NVXK 4KB2A 4GTDA 4GTCA 2NVXA 4LQYA 3V4GA 3RZDK 3HOUC 2JA8K 1XXAA 1IE0A 3HOXK 5CJ9A 4MEXA 5JVOA 2WB1D 4XSXA 5EGHA 2Y0SL 3TFHA 4OINA 4QJVA 4XSZA 4C2MK 2NVTC 2PMZL 4C3HC 5E68A 4FZBA 1ZYRA 2E2JK 2VUMC 4MEYA 4G0UA 5FLMK 4KAWX 3S1NC 4LJZA 5HL8A 4OIOA 4BY1C 3G4AA 4A3LK 1R9TC 4A3IK 4WJ3M 3AD7C 4KN7A 1WCMK 1AB4A 1WCMA 2ZUEA 4A3BK 4PABA 5EGEA 4BY7K 1I50K 4AYBD 3IPJA 5D4DA 1I50A 4LR2A 1WIHA 3S1QK 2BE5A 3GTMK 4GTAA 1I6HK 3CQZK 3GTMA 4NOIA 3CQZA 3LAPA 3T02A 5M3FK 1PJ5A 5C4JC 2E2HC 5FJ8K 2JA6K 3BP8C 3H3VD 1O26A 2JA6A 1PJ7A 2R93C 3GTOC 2JA5K 3ERED 1IL2A 1XZPA 2PPBA 2JA5A 3GEEA 5C4XK 3A8JA 4KDDA 2PHCB 1Y1VC 3VA7A 1DCHA 3L4KA 3OEPA 2NVXC 4Y52K 1J6VA 4A3MK 3S2HC 1G51A 4GZYA 4A3FC 4KASA 1L0WA 3RZDC 2JA8C 4GTFA 4KB4A 1C0AA 3S1RK 3H3VL 1I3QC 1Y1WK 1SFOC 2CFAB 1DD5A 4C2MC 1Y1WA 4BBRC 2PA8D 2E2JC 1JQWA 5FLMC 4KMUA 4KMHA 2KWAA 4QIWD 2FQTA 3GIRA 3AQOA 3HKZD 3HOVC 4A3BC 4KMDA 4BY7C 4BBSK 1TWFK 3JSTA 1TWFA 1WQGA 1I6HC 3CQZC 2R93K 4YG2A 2R93A 3GTOK 5IORA 3GTOA 2B63K 2JA6C 2E2IK 2B63A 4G0VA 1O2BA 2E2IA 1EFWA 2YU9C 1VGXA 2NVQC 4GTEA 1Y1VK 4GT9A 5C4XC 1Y1VA 5IOQA 2RGRA 1F7UA 3S2HK 4A3FK 1JVIA 4KARA 1I3QK 3G4CA 4Y52C 1SFOK 1IS1A 4A3MC 1I3QA 1YNJA 1SFOA 1BJTA 4BBRK 3A8IA 3NUHA 2JA7C 3S1RC 1Y1WC 1USOA 1INNA 3GTPC 4A3GK 5IOSA 5IP7K 1XZQB 2V6UA 4XCHA 2P8TA 3HOVK 5TJ3A 1K83K 1K83A 3L4JA 1ZVUA 3GTKK 3GTJK 4LK0A 2JH3A 3GTKA 3GTJA 1BGWA 3S1MC 2WB1L 2CW0A 2XCOA 5TMFA 5TMCA 1VH2A 4BBSC 1TWFC 1TWAC 5L46A 3HOWK 4A3CK 4GFQA 4YFNA 4KATA 2YU9K 1PJ6A 2YU9A 1IBAA 4KC6A 2NVQK 1WOOA 2B63C 3HOZK 2E2IC 3DXJA 1TWHK 5M5XK 3S2DK 1TWCK 1TWHA 1TWCA 1EH1A 4A3JK 1O2FB 3AH5A 3EQLA 4AYBL 4QJVB 4FM9A 1O28A 4G7HA 1J98A 4J3NA 2JA7K 3GTQK 5M3MK 3ADAC 2JA7A 3GTQA 1WSVA 2A6HA 1DCOA 4Y7NK 2NVYK 2O5JA 3GTPK 2NVYA 3BP3A 3GTPA 3TFIA 4DDQA 1RU0A 4A3GC 3GTLK 5IP7C 3GTLA 4GTBA 5M5YK 3S17K 3S1MK 1K83C 4MQ9A 3PO3K 4GTLA 1JOEA 2FQOA 3GTKC 3GTJC 1TWGK 1ISEA 1TWAK 1TWGA 5IOTA 1YX2A 1WOPA 1TWAA 3FOEA 1X31C 3I4MK 4BLAA 1O29A 1O27A 4M1XA 1XZPB 3BUEA 1VRQC 2PA8L 4A93C 4KN4A 4YFXA 3HOWC 1BDFA 1XXCA 3S16C 4A3CC 3N3YA 1ZQ1C 4QIWL 3FHZA 5M5WK 4Q5SA 4LLGA 3HOZC 1GE9A 1TWHC 3HKZL 3S2DC 1TWCC 3SZYA 3TTGA 2GAGC 2PMZD 3K7AC 4RMFA 4A3EC 4A3JC 3S0XA 3M3YK 2D6FC 3PO2K 4C3IC 1ZXOA 1HQMA 2GSOA 2ZFZA 2R7ZK 3GSIA 5JFEA 2R7ZA 3AQPA 3LPXA 3T00A 2EBBA 4LOWA 5IP9K 3HXAA 2Y3PA 5C44C 3GTQC 1HI9A 4Y7NC 1IW7A 1O25A 1YNNA 2NVYC 5C3EC 3HOYK 2GSNA 2RH6A 1EK8A 4A3KC 1XPPA 4C3JC 5IYCK 3RZOK 3GTLC 2XCRB 5IYDK 1EI6A 4OIPA 4P5BA 4BXXK 4BKWA 3T01A 3S17C 1WQFA 3LAJA 4WJ4A 1B4AA 3PO3C 3M4OK 3H0GK 1TWGC 4JK1A 2CFAA 3H0GA 4WILA 1SMYA 4A3DC 1F93A 2O5IA 3N0BA 3I4MC 4A93K 3S16K 2WAQD 1IQ0A 3OREA 3S15C 3GDZA 1F9NA 4KM9A 3A8KA 1DCPA 3QX3A 1KQ4A 4P5AA 2A68A 1O2AA 4PAAA 3I4NK 3S14C 4X6AK 3K7AK 2GSUA 4O2DA 4A3EK 3SZZA 4C3IK 4XLNA 3Q3QA 3AD8C 3MMLB 1USMA 2R92C 3M3YC 5C44K 3N0CA 3PO2C 2R7ZC 5IYBK 4OIRA 3FKIK 3GTGK 3GEHA 3FKIA 4BLBA 2WAQL 5C3EK 1WQHA 3GTGA 5IP9C 2V6TA 4ZH4A 3HOUK 4G7ZA 4A3KK 4C3JK
chains in the Genus database with same CATH topology
1I6VA 4KN4A 4NOIA 4YFXA 3HOWC 2JA7C 1BDFA 3HOYC 3S16C 4A3CC 3S1RC 5M3FK 2NVTK 2E2HC 5C4JC 5FJ8K 1Y1WC 4QIWL 4C3HK 2JA6K 3H3VD 3HOXC 5M5WK 4Q5SA 2A69A 4LLGA 5IYCC 2VUMK 3GTPC 3HOZC 4A3GK 2R93C 5IP7K 3S1NK 1TWHC 3HKZL 3S2DC 4BY1K 3GTOC 3RZOC 1TWCC 4LK1A 4YFKA 2JA5K 5IYDC 2PPBA 4BXXC 3HOVK 1K83K 4A3DK 5C4XK 1R9TK 2PMZD 3K7AC 4OIQA 4A3EC 4A3JC 3GTKK 3GTJK 3M3YK 4LK0A 3PO2K 2R7ZK 1HQMA 3WODA 3M4OC 4A3LC 3H0GC 3S15K 4G7OA 3S1MC 2WB1L 1Y1VC 2CW0A 4A3IC 5TMFA 5TMCA 5IP9K 5C44C 2NVXC 3GTQC 4BBSC 4Y52K 1TWFC 4A3MK 1TWAC 1WCMC 3S2HC 4GZYA 4A3FC 4Y7NC 3S14K 1IW7A 3RZDC 2JA8C 1YNNA 2NVYC 5C3EC 3HOWK 3HOYK 4A3CK 1I50C 4YFNA 3S1RK 2YU9K 2E2HK 5C4JK 3H3VL 1I3QC 2Y0SD 1Y1WK 1SFOC 4A3KC 4XLPA 2NVQK 1XPPA 3S1QC 3I4NC 3GTMC 5IYCK 4BBRC 2B63C 3HOZK 2E2IC 4X6AC 3DXJA 1TWHK 2PA8D 5M5XK 2R92K 3S2DK 2E2JC 3GTLC 1TWCK 3RZOK 5IYDK 4OIPA 5FLMC 4KMUA 4BXXK 3S17C 4QIWD 4A3JK 3EQLA 4AYBL 3PO3C 3HKZD 4QJVB 2JA5C 3M4OK 3H0GK 1TWGC 4JK1A 3HOVC 5IYBC 1SMYA 4Q4ZA 4G7HA 4A3DC 2O5IA 3FKIC 3GTGC 3I4MC 4A3BC 4A93K 2A6EA 2NVXK 2JA7K 3GTQK 5M3MK 3S16K 4BY7C 1TWFK 2WAQD 4BBSK 2A6HA 4Y7NK 3S15C 3RZDK 3HOUC 2JA8K 3HOXK 2NVYK 2O5JA 4MEXA 3GTPK 2WB1D 4XSXA 1I6HC 3CQZC 2R93K 2Y0SL 4YG2A 4OINA 2A68A 3GTOK 4QJVA 4XSZA 4C2MK 2NVTC 3I4NK 3S14C 2B63K 2JA6C 2PMZL 2E2IK 4X6AK 3K7AK 1ZYRA 2E2JK 2VUMC 4A3EK 3GTLK 2YU9C 4A3GC 4MEYA 5IP7C 5FLMK 3S1NC 4LJZA 4OIOA 4C3IK 5M5YK 4XLNA 4BY1C 4A3LK 2NVQC 3S17K 3S1MK 1Y1VK 1K83C 4MQ9A 1R9TC 4A3IK 5C4XC 2R92C 3PO3K 3GTKC 3M3YC 5C44K 4KN7A 1TWGK 3GTJC 3PO2C 3S2HK 1TWAK 1WCMK 2R7ZC 5IYBK 4A3FK 4OIRA 3FKIK 3GTGK 3I4MK 4A3BK 5C3EK 2WAQL 4BY7K 1I50K 4AYBD 5D4DA 5IP9C 4ZH4A 1I3QK 4Y52C 1SFOK 4A3MC 4G7ZA 4A3KK 3HOUK 1YNJA 4C3JK 3S1QK 2BE5A 3GTMK 4BBRK 1I6HK 3CQZK 2PA8L 4A93C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6V A;  4KN4 A;  4NOI A;  4YFX A;  3HOW C;  2JA7 C;  1BDF A;  3HOY C;  3S16 C;  4A3C C;  3S1R C;  5M3F K;  2NVT K;  2E2H C;  5C4J C;  5FJ8 K;  1Y1W C;  4QIW L;  4C3H K;  2JA6 K;  3H3V D;  3HOX C;  5M5W K;  4Q5S A;  2A69 A;  4LLG A;  5IYC C;  2VUM K;  3GTP C;  3HOZ C;  4A3G K;  2R93 C;  5IP7 K;  3S1N K;  1TWH C;  3HKZ L;  3S2D C;  4BY1 K;  3GTO C;  3RZO C;  1TWC C;  4LK1 A;  4YFK A;  2JA5 K;  5IYD C;  2PPB A;  4BXX C;  3HOV K;  1K83 K;  4A3D K;  5C4X K;  1R9T K;  2PMZ D;  3K7A C;  4OIQ A;  4A3E C;  4A3J C;  3GTK K;  3GTJ K;  3M3Y K;  4LK0 A;  3PO2 K;  2R7Z K;  1HQM A;  3WOD A;  3M4O C;  4A3L C;  3H0G C;  3S15 K;  4G7O A;  3S1M C;  2WB1 L;  1Y1V C;  2CW0 A;  4A3I C;  5TMF A;  5TMC A;  5IP9 K;  5C44 C;  2NVX C;  3GTQ C;  4BBS C;  4Y52 K;  1TWF C;  4A3M K;  1TWA C;  1WCM C;  3S2H C;  4GZY A;  4A3F C;  4Y7N C;  3S14 K;  1IW7 A;  3RZD C;  2JA8 C;  1YNN A;  2NVY C;  5C3E C;  3HOW K;  3HOY K;  4A3C K;  1I50 C;  4YFN A;  3S1R K;  2YU9 K;  2E2H K;  5C4J K;  3H3V L;  1I3Q C;  2Y0S D;  1Y1W K;  1SFO C;  4A3K C;  4XLP A;  2NVQ K;  1XPP A;  3S1Q C;  3I4N C;  3GTM C;  5IYC K;  4BBR C;  2B63 C;  3HOZ K;  2E2I C;  4X6A C;  3DXJ A;  1TWH K;  2PA8 D;  5M5X K;  2R92 K;  3S2D K;  2E2J C;  3GTL C;  1TWC K;  3RZO K;  5IYD K;  4OIP A;  5FLM C;  4KMU A;  4BXX K;  3S17 C;  4QIW D;  4A3J K;  3EQL A;  4AYB L;  3PO3 C;  3HKZ D;  4QJV B;  2JA5 C;  3M4O K;  3H0G K;  1TWG C;  4JK1 A;  3HOV C;  5IYB C;  1SMY A;  4Q4Z A;  4G7H A;  4A3D C;  2O5I A;  3FKI C;  3GTG C;  3I4M C;  4A3B C;  4A93 K;  2A6E A;  2NVX K;  2JA7 K;  3GTQ K;  5M3M K;  3S16 K;  4BY7 C;  1TWF K;  2WAQ D;  4BBS K;  2A6H A;  4Y7N K;  3S15 C;  3RZD K;  3HOU C;  2JA8 K;  3HOX K;  2NVY K;  2O5J A;  4MEX A;  3GTP K;  2WB1 D;  4XSX A;  1I6H C;  3CQZ C;  2R93 K;  2Y0S L;  4YG2 A;  4OIN A;  2A68 A;  3GTO K;  4QJV A;  4XSZ A;  4C2M K;  2NVT C;  3I4N K;  3S14 C;  2B63 K;  2JA6 C;  2PMZ L;  2E2I K;  4X6A K;  3K7A K;  1ZYR A;  2E2J K;  2VUM C;  4A3E K;  3GTL K;  2YU9 C;  4A3G C;  4MEY A;  5IP7 C;  5FLM K;  3S1N C;  4LJZ A;  4OIO A;  4C3I K;  5M5Y K;  4XLN A;  4BY1 C;  4A3L K;  2NVQ C;  3S17 K;  3S1M K;  1Y1V K;  1K83 C;  4MQ9 A;  1R9T C;  4A3I K;  5C4X C;  2R92 C;  3PO3 K;  3GTK C;  3M3Y C;  5C44 K;  4KN7 A;  1TWG K;  3GTJ C;  3PO2 C;  3S2H K;  1TWA K;  1WCM K;  2R7Z C;  5IYB K;  4A3F K;  4OIR A;  3FKI K;  3GTG K;  3I4M K;  4A3B K;  5C3E K;  2WAQ L;  4BY7 K;  1I50 K;  4AYB D;  5D4D A;  5IP9 C;  4ZH4 A;  1I3Q K;  4Y52 C;  1SFO K;  4A3M C;  4G7Z A;  4A3K K;  3HOU K;  1YNJ A;  4C3J K;  3S1Q K;  2BE5 A;  3GTM K;  4BBR K;  1I6H K;  3CQZ K;  2PA8 L;  4A93 C; 
#chains in the Genus database with same CATH topology
 2P5M A;  1I6V A;  3HOY C;  2NVT K;  4KM8 A;  2GAH C;  4C3H K;  3HOX C;  2A69 A;  3OPF A;  5IYC C;  2VUM K;  3S1N K;  2VUM A;  4BY1 K;  3RZO C;  1J6W A;  4LK1 A;  4YFK A;  5IYD C;  4BXX C;  4A3D K;  1R9T K;  1F7V A;  1R9T A;  4OIQ A;  1VJE A;  3CAG A;  5CHP A;  1YCL A;  1J6X A;  1V5V A;  3WOD A;  3M4O C;  4A3L C;  3H0G C;  3S15 K;  4G7O A;  3AD9 C;  4ILD A;  4A3I C;  4KMA A;  3FOF A;  2V6S A;  4G0W A;  1XZQ A;  4P9S A;  1B4B A;  1WCM C;  1WSR A;  3S14 K;  3TFJ A;  1I50 C;  1O24 A;  1ZBS A;  5C4J K;  2E2H K;  2Y0S D;  2E2H A;  2W7V A;  4XLP A;  1WOR A;  3S1Q C;  3I4N C;  3GTM C;  4C45 A;  4X6A C;  2R92 K;  4AH6 A;  2R92 A;  1XXB A;  1VLO A;  1EQR A;  1BS2 A;  1WOS A;  2JA5 C;  2ZUF A;  5IYB C;  3GEI A;  4Q4Z A;  3FKI C;  3GTG C;  1UV7 A;  2A6E A;  2XCQ A;  2NVX K;  4KB2 A;  4GTD A;  4GTC A;  2NVX A;  4LQY A;  3V4G A;  3RZD K;  3HOU C;  2JA8 K;  1XXA A;  1IE0 A;  3HOX K;  5CJ9 A;  4MEX A;  5JVO A;  2WB1 D;  4XSX A;  5EGH A;  2Y0S L;  3TFH A;  4OIN A;  4QJV A;  4XSZ A;  4C2M K;  2NVT C;  2PMZ L;  4C3H C;  5E68 A;  4FZB A;  1ZYR A;  2E2J K;  2VUM C;  4MEY A;  4G0U A;  5FLM K;  4KAW X;  3S1N C;  4LJZ A;  5HL8 A;  4OIO A;  4BY1 C;  3G4A A;  4A3L K;  1R9T C;  4A3I K;  4WJ3 M;  3AD7 C;  4KN7 A;  1WCM K;  1AB4 A;  1WCM A;  2ZUE A;  4A3B K;  4PAB A;  5EGE A;  4BY7 K;  1I50 K;  4AYB D;  3IPJ A;  5D4D A;  1I50 A;  4LR2 A;  1WIH A;  3S1Q K;  2BE5 A;  3GTM K;  4GTA A;  1I6H K;  3CQZ K;  3GTM A;  4NOI A;  3CQZ A;  3LAP A;  3T02 A;  5M3F K;  1PJ5 A;  5C4J C;  2E2H C;  5FJ8 K;  2JA6 K;  3BP8 C;  3H3V D;  1O26 A;  2JA6 A;  1PJ7 A;  2R93 C;  3GTO C;  2JA5 K;  3ERE D;  1IL2 A;  1XZP A;  2PPB A;  2JA5 A;  3GEE A;  5C4X K;  3A8J A;  4KDD A;  2PHC B;  1Y1V C;  3VA7 A;  1DCH A;  3L4K A;  3OEP A;  2NVX C;  4Y52 K;  1J6V A;  4A3M K;  3S2H C;  1G51 A;  4GZY A;  4A3F C;  4KAS A;  1L0W A;  3RZD C;  2JA8 C;  4GTF A;  4KB4 A;  1C0A A;  3S1R K;  3H3V L;  1I3Q C;  1Y1W K;  1SFO C;  2CFA B;  1DD5 A;  4C2M C;  1Y1W A;  4BBR C;  2PA8 D;  2E2J C;  1JQW A;  5FLM C;  4KMU A;  4KMH A;  2KWA A;  4QIW D;  2FQT A;  3GIR A;  3AQO A;  3HKZ D;  3HOV C;  4A3B C;  4KMD A;  4BY7 C;  4BBS K;  1TWF K;  3JST A;  1TWF A;  1WQG A;  1I6H C;  3CQZ C;  2R93 K;  4YG2 A;  2R93 A;  3GTO K;  5IOR A;  3GTO A;  2B63 K;  2JA6 C;  2E2I K;  2B63 A;  4G0V A;  1O2B A;  2E2I A;  1EFW A;  2YU9 C;  1VGX A;  2NVQ C;  4GTE A;  1Y1V K;  4GT9 A;  5C4X C;  1Y1V A;  5IOQ A;  2RGR A;  1F7U A;  3S2H K;  4A3F K;  1JVI A;  4KAR A;  1I3Q K;  3G4C A;  4Y52 C;  1SFO K;  1IS1 A;  4A3M C;  1I3Q A;  1YNJ A;  1SFO A;  1BJT A;  4BBR K;  3A8I A;  3NUH A;  2JA7 C;  3S1R C;  1Y1W C;  1USO A;  1INN A;  3GTP C;  4A3G K;  5IOS A;  5IP7 K;  1XZQ B;  2V6U A;  4XCH A;  2P8T A;  3HOV K;  5TJ3 A;  1K83 K;  1K83 A;  3L4J A;  1ZVU A;  3GTK K;  3GTJ K;  4LK0 A;  2JH3 A;  3GTK A;  3GTJ A;  1BGW A;  3S1M C;  2WB1 L;  2CW0 A;  2XCO A;  5TMF A;  5TMC A;  1VH2 A;  4BBS C;  1TWF C;  1TWA C;  5L46 A;  3HOW K;  4A3C K;  4GFQ A;  4YFN A;  4KAT A;  2YU9 K;  1PJ6 A;  2YU9 A;  1IBA A;  4KC6 A;  2NVQ K;  1WOO A;  2B63 C;  3HOZ K;  2E2I C;  3DXJ A;  1TWH K;  5M5X K;  3S2D K;  1TWC K;  1TWH A;  1TWC A;  1EH1 A;  4A3J K;  1O2F B;  3AH5 A;  3EQL A;  4AYB L;  4QJV B;  4FM9 A;  1O28 A;  4G7H A;  1J98 A;  4J3N A;  2JA7 K;  3GTQ K;  5M3M K;  3ADA C;  2JA7 A;  3GTQ A;  1WSV A;  2A6H A;  1DCO A;  4Y7N K;  2NVY K;  2O5J A;  3GTP K;  2NVY A;  3BP3 A;  3GTP A;  3TFI A;  4DDQ A;  1RU0 A;  4A3G C;  3GTL K;  5IP7 C;  3GTL A;  4GTB A;  5M5Y K;  3S17 K;  3S1M K;  1K83 C;  4MQ9 A;  3PO3 K;  4GTL A;  1JOE A;  2FQO A;  3GTK C;  3GTJ C;  1TWG K;  1ISE A;  1TWA K;  1TWG A;  5IOT A;  1YX2 A;  1WOP A;  1TWA A;  3FOE A;  1X31 C;  3I4M K;  4BLA A;  1O29 A;  1O27 A;  4M1X A;  1XZP B;  3BUE A;  1VRQ C;  2PA8 L;  4A93 C;  4KN4 A;  4YFX A;  3HOW C;  1BDF A;  1XXC A;  3S16 C;  4A3C C;  3N3Y A;  1ZQ1 C;  4QIW L;  3FHZ A;  5M5W K;  4Q5S A;  4LLG A;  3HOZ C;  1GE9 A;  1TWH C;  3HKZ L;  3S2D C;  1TWC C;  3SZY A;  3TTG A;  2GAG C;  2PMZ D;  3K7A C;  4RMF A;  4A3E C;  4A3J C;  3S0X A;  3M3Y K;  2D6F C;  3PO2 K;  4C3I C;  1ZXO A;  1HQM A;  2GSO A;  2ZFZ A;  2R7Z K;  3GSI A;  5JFE A;  2R7Z A;  3AQP A;  3LPX A;  3T00 A;  2EBB A;  4LOW A;  5IP9 K;  3HXA A;  2Y3P A;  5C44 C;  3GTQ C;  1HI9 A;  4Y7N C;  1IW7 A;  1O25 A;  1YNN A;  2NVY C;  5C3E C;  3HOY K;  2GSN A;  2RH6 A;  1EK8 A;  4A3K C;  1XPP A;  4C3J C;  5IYC K;  3RZO K;  3GTL C;  2XCR B;  5IYD K;  1EI6 A;  4OIP A;  4P5B A;  4BXX K;  4BKW A;  3T01 A;  3S17 C;  1WQF A;  3LAJ A;  4WJ4 A;  1B4A A;  3PO3 C;  3M4O K;  3H0G K;  1TWG C;  4JK1 A;  2CFA A;  3H0G A;  4WIL A;  1SMY A;  4A3D C;  1F93 A;  2O5I A;  3N0B A;  3I4M C;  4A93 K;  3S16 K;  2WAQ D;  1IQ0 A;  3ORE A;  3S15 C;  3GDZ A;  1F9N A;  4KM9 A;  3A8K A;  1DCP A;  3QX3 A;  1KQ4 A;  4P5A A;  2A68 A;  1O2A A;  4PAA A;  3I4N K;  3S14 C;  4X6A K;  3K7A K;  2GSU A;  4O2D A;  4A3E K;  3SZZ A;  4C3I K;  4XLN A;  3Q3Q A;  3AD8 C;  3MML B;  1USM A;  2R92 C;  3M3Y C;  5C44 K;  3N0C A;  3PO2 C;  2R7Z C;  5IYB K;  4OIR A;  3FKI K;  3GTG K;  3GEH A;  3FKI A;  4BLB A;  2WAQ L;  5C3E K;  1WQH A;  3GTG A;  5IP9 C;  2V6T A;  4ZH4 A;  3HOU K;  4G7Z A;  4A3K K;  4C3J K; 
#chains in the Genus database with same CATH homology
 1I6V A;  4KN4 A;  4NOI A;  4YFX A;  3HOW C;  2JA7 C;  1BDF A;  3HOY C;  3S16 C;  4A3C C;  3S1R C;  5M3F K;  2NVT K;  2E2H C;  5C4J C;  5FJ8 K;  1Y1W C;  4QIW L;  4C3H K;  2JA6 K;  3H3V D;  3HOX C;  5M5W K;  4Q5S A;  2A69 A;  4LLG A;  5IYC C;  2VUM K;  3GTP C;  3HOZ C;  4A3G K;  2R93 C;  5IP7 K;  3S1N K;  1TWH C;  3HKZ L;  3S2D C;  4BY1 K;  3GTO C;  3RZO C;  1TWC C;  4LK1 A;  4YFK A;  2JA5 K;  5IYD C;  2PPB A;  4BXX C;  3HOV K;  1K83 K;  4A3D K;  5C4X K;  1R9T K;  2PMZ D;  3K7A C;  4OIQ A;  4A3E C;  4A3J C;  3GTK K;  3GTJ K;  3M3Y K;  4LK0 A;  3PO2 K;  2R7Z K;  1HQM A;  3WOD A;  3M4O C;  4A3L C;  3H0G C;  3S15 K;  4G7O A;  3S1M C;  2WB1 L;  1Y1V C;  2CW0 A;  4A3I C;  5TMF A;  5TMC A;  5IP9 K;  5C44 C;  2NVX C;  3GTQ C;  4BBS C;  4Y52 K;  1TWF C;  4A3M K;  1TWA C;  1WCM C;  3S2H C;  4GZY A;  4A3F C;  4Y7N C;  3S14 K;  1IW7 A;  3RZD C;  2JA8 C;  1YNN A;  2NVY C;  5C3E C;  3HOW K;  3HOY K;  4A3C K;  1I50 C;  4YFN A;  3S1R K;  2YU9 K;  2E2H K;  5C4J K;  3H3V L;  1I3Q C;  2Y0S D;  1Y1W K;  1SFO C;  4A3K C;  4XLP A;  2NVQ K;  1XPP A;  3S1Q C;  3I4N C;  3GTM C;  5IYC K;  4BBR C;  2B63 C;  3HOZ K;  2E2I C;  4X6A C;  3DXJ A;  1TWH K;  2PA8 D;  5M5X K;  2R92 K;  3S2D K;  2E2J C;  3GTL C;  1TWC K;  3RZO K;  5IYD K;  4OIP A;  5FLM C;  4KMU A;  4BXX K;  3S17 C;  4QIW D;  4A3J K;  3EQL A;  4AYB L;  3PO3 C;  3HKZ D;  4QJV B;  2JA5 C;  3M4O K;  3H0G K;  1TWG C;  4JK1 A;  3HOV C;  5IYB C;  1SMY A;  4Q4Z A;  4G7H A;  4A3D C;  2O5I A;  3FKI C;  3GTG C;  3I4M C;  4A3B C;  4A93 K;  2A6E A;  2NVX K;  2JA7 K;  3GTQ K;  5M3M K;  3S16 K;  4BY7 C;  1TWF K;  2WAQ D;  4BBS K;  2A6H A;  4Y7N K;  3S15 C;  3RZD K;  3HOU C;  2JA8 K;  3HOX K;  2NVY K;  2O5J A;  4MEX A;  3GTP K;  2WB1 D;  4XSX A;  1I6H C;  3CQZ C;  2R93 K;  2Y0S L;  4YG2 A;  4OIN A;  2A68 A;  3GTO K;  4QJV A;  4XSZ A;  4C2M K;  2NVT C;  3I4N K;  3S14 C;  2B63 K;  2JA6 C;  2PMZ L;  2E2I K;  4X6A K;  3K7A K;  1ZYR A;  2E2J K;  2VUM C;  4A3E K;  3GTL K;  2YU9 C;  4A3G C;  4MEY A;  5IP7 C;  5FLM K;  3S1N C;  4LJZ A;  4OIO A;  4C3I K;  5M5Y K;  4XLN A;  4BY1 C;  4A3L K;  2NVQ C;  3S17 K;  3S1M K;  1Y1V K;  1K83 C;  4MQ9 A;  1R9T C;  4A3I K;  5C4X C;  2R92 C;  3PO3 K;  3GTK C;  3M3Y C;  5C44 K;  4KN7 A;  1TWG K;  3GTJ C;  3PO2 C;  3S2H K;  1TWA K;  1WCM K;  2R7Z C;  5IYB K;  4A3F K;  4OIR A;  3FKI K;  3GTG K;  3I4M K;  4A3B K;  5C3E K;  2WAQ L;  4BY7 K;  1I50 K;  4AYB D;  5D4D A;  5IP9 C;  4ZH4 A;  1I3Q K;  4Y52 C;  1SFO K;  4A3M C;  4G7Z A;  4A3K K;  3HOU K;  1YNJ A;  4C3J K;  3S1Q K;  2BE5 A;  3GTM K;  4BBR K;  1I6H K;  3CQZ K;  2PA8 L;  4A93 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...