5C44K

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c44K00
3S1MK 4C3IK 1Y1VK 2R7ZK 2R92C 4OIOA 5TMCA 3HOYK 5IYDC 3HOVC 2BE5A 3S1QK 4A3DK 4XLPA 5IYBC 3PO2K 5M3MK 3GTGC 4JK1A 2NVTK 3GTPK 1Y1WC 3H0GK 3GTOK 1R9TC 4A3GC 4OINA 3S1MC 4BBSK 1HQMA 3S16K 2A69A 5C3EK 3HOYC 1K83K 2R93C 1TWCK 3HOVK 2A6EA 3PO2C 3GTJK 2PMZL 4YFXA 1YNJA 2O5IA 3GTGK 3HOZK 3PO3C 2NVTC 3H3VD 5IYCK 1TWHK 1R9TK 3S15C 1Y1WK 1I50K 2JA7K 1WCMC 2JA5K 3GTLK 3HOXK 3RZDK 3S14K 4Q5SA 4YFNA 2A68A 1XPPA 4A3CK 4BY1K 2B63K 3HOZC 3I4NC 4A3BK 3GTJC 2PMZD 2O5JA 3S15K 1I6HC 2E2HK 3RZOK 1WCMK 2WB1L 2JA5C 3S17K 4Y52K 3HOXC 2VUMK 4QIWL 3S2DC 4A3EK 1IW7A 1TWFK 5IYBK 4KMUA 1I6HK 4A93C 5C44C 3EQLA 5IP7C 4G7OA 2E2HC 3RZOC 4BY7K 4X6AK 4BBRC 1YNNA 5M5YK 2CW0A 4LLGA 5C3EC 4G7ZA 3GTKK 4A3EC 3HOWK 4QIWD 1TWAK 5C4JK 4NOIA 1TWGK 4MEYA 2E2JC 4XLNA 4A3FC 4A3KK 4AYBD 4LK1A 5IYCC 5FLMK 4Y7NK 2WAQD 2A6HA 4XSXA 4BBRK 2JA7C 3GTMK 3K7AC 4A3MK 3GTLC 3DXJA 4C3JK 4OIRA 4A3JK 4MEXA 4A3IK 3HOUC 5C4XC 4BY1C 1TWGC 2B63C 4XSZA 5C4JC 3FKIK 4Q4ZA 4QJVA 2JA8K 4GZYA 2Y0SD 3S1RK 3GTPC 3M3YC 3M4OK 1SFOK 3GTOC 2YU9K 3S17C 1ZYRA 3S16C 2JA6K 3HOUK 2R93K 3S2DK 3H0GC 4YG2A 4G7HA 4A3IC 4LK0A 4BBSC 1SMYA 4KN4A 2JA8C 3FKIC 3M4OC 2WB1D 4QJVB 3S1RC 3M3YK 5IP7K 4X6AC 1SFOC 1I50C 2YU9C 3HKZD 2JA6C 4KN7A 5M3FK 5IP9C 1TWHC 3I4MK 4A3CC 3S2HK 1K83C 2NVYC 3WODA 3S1NC 5FJ8K 2R92K 3RZDC 3S14C 4A3KC 4Y7NC 1I3QC 2E2IK 3H3VL 3HKZL 3CQZK 3K7AK 5M5XK 4A3MC 4A3LK 4OIQA 1I6VA 5IP9K 3S1NK 5TMFA 4LJZA 3I4MC 3S2HC 1TWFC 4A3GK 3GTQK 5D4DA 5M5WK 2NVXK 4BXXC 5C44K 2VUMC 2NVQK 1TWCC 4BY7C 4AYBL 2E2IC 2PA8L 2PPBA 1I3QK 4Y52C 3PO3K 2WAQL 4A3LC 3CQZC 4YFKA 4A93K 2Y0SL 3GTQC 1BDFA 1Y1VC 2NVXC 2R7ZC 4C2MK 4C3HK 4BXXK 4A3FK 4ZH4A 2NVQC 5IYDK 3GTKC 3HOWC 4MQ9A 3S1QC 1TWAC 3I4NK 4A3BC 2PA8D 3GTMC 4A3DC 2E2JK 4A3JC 5FLMC 5C4XK 4OIPA 2NVYK
chains in the Genus database with same CATH superfamily
3N0BA 3HOYK 3HOVC 2BE5A 3S1QK 5IYBC 1B4AA 3S16K 5C3EK 3AQOA 1B4BA 2A6EA 4G0UA 3GTJK 2PMZL 1F7UA 2O5IA 5IYCK 1J6WA 1R9TK 1IL2A 2JA7K 1K83A 1BJTA 2JA5K 4C3HC 4C2MC 3HOXK 3RZDK 3GTLK 1TWHA 1GE9A 1XPPA 3NUHA 4BY1K 4A3CK 3I4NC 5JVOA 3GTJC 3S15K 2E2HK 3RZOK 1WCMK 3HOXC 3GSIA 4A3EK 1F9NA 4A93C 5C44C 3TFJA 4WJ4A 1DCHA 5M5YK 4GT9A 4C3JC 3LAJA 1TWAK 3IPJA 4A3KK 5FLMK 1ZQ1C 3T00A 3DXJA 1USOA 1O26A 4A3IK 1PJ7A 1TWGC 1I3QA 3M3YC 3A8KA 1C0AA 1ZYRA 3S16C 1USMA 3FOFA 3S2DK 3H0GC 4A3IC 3ADAC 5CHPA 1SMYA 1BGWA 2JA8C 1TWFA 1SFOA 4X6AC 1SFOC 2JA6C 5IP9C 1XXCA 4GFQA 1K83C 3S2HK 5FJ8K 4Y7NC 2GSOA 1V5VA 3A8JA 5M5XK 3G4AA 5IP9K 3GDZA 5M5WK 3OREA 4BXXC 2VUMC 2NVQK 1ISEA 2WAQL 4PAAA 1WCMA 4G0WA 4GTFA 4KATA 4WILA 1BDFA 2R7ZC 4C2MK 4C3HK 1XZQB 1Y1VA 3GTKC 4KB2A 3HOWC 4MQ9A 1XZPA 1EI6A 1AB4A 2NVYK 4C3IK 2ZUEA 2R7ZK 1VRQC 2R92C 4OIOA 1KQ4A 5IYDC 2FQTA 4A3DK 4XLPA 3PO2K 5M3MK 3GTGC 3JSTA 1HI9A 4GTLA 3GTOK 2CFAA 2CFAB 1J6VA 3HOYC 1VH2A 3HOVK 1JVIA 3BP3A 2NVXA 1PJ5A 2NVTC 3Q3QA 2RGRA 4BLAA 3CQZA 3AD8C 1XZPB 5IORA 2PHCB 4A3BK 3HOZC 2O5JA 3GEHA 2JA5C 2WB1L 4GTDA 1ZVUA 3S2DC 1J6XA 1IW7A 4FZBA 4G7OA 3EQLA 5IP7C 3GTQA 1DCPA 1YNNA 2CW0A 2GAHC 2YU9A 3TFHA 4P5AA 4KM9A 4A3EC 3GTKK 3HOWK 4XLNA 4A3FC 4AYBD 4Y7NK 4BBRK 1O24A 2A6HA 1WOOA 3N0CA 4C3JK 3HOUC 4MEXA 5C4XC 2B63C 4GZYA 3H0GA 4Q4ZA 4G0VA 3S1RK 3GTOC 3OPFA 3FOEA 2YU9K 4GTEA 4YG2A 1INNA 1EK8A 3G4CA 4BBSC 4GTCA 2WB1D 3M3YK 3HKZD 1WOPA 4FM9A 2XCQA 5M3FK 2B63A 1TWHC 3I4MK 1WSVA 4A3CC 3S1NC 2NVYC 3S14C 2XCRB 1Y1WA 4KMAA 1I3QC 1TWGA 2EBBA 2E2IK 4A3LK 3CQZK 4A3MC 4C45A 5EGEA 3S2HC 5TMFA 4LJZA 2RH6A 1G51A 2NVXK 5C44K 1DCOA 4AYBL 2PA8L 2PPBA 1I3QK 3L4JA 5EGHA 1O2FB 4DDQA 3GTOA 1WQHA 2JH3A 1JQWA 4KAWX 3GTMA 3TFIA 1X31C 4KARA 3I4NK 1TWAA 1XXBA 2E2JK 3TTGA 2ZUFA 1IBAA 3S1MK 3GEEA 5TMCA 1TWCA 4JK1A 4RMFA 4AH6A 1Y1WC 3H0GK 3GTPK 1R9TC 1JOEA 4A3GC 4ILDA 2A69A 4KASA 2R93C 1TWCK 3GTPA 4YFXA 3PO3C 1YNJA 4Y52K 2JA6A 4XCHA 1TWHK 4LR2A 1Y1WK 3S0XA 2FQOA 3GTKA 3S14K 4Q5SA 1F93A 2B63K 5E68A 1I50A 2PMZD 3GEIA 1XZQA 1O2BA 1I6HC 1VLOA 1EFWA 1WIHA 1VJEA 2V6UA 2VUMK 3V4GA 1WORA 1TWFK 2Y3PA 5IYBK 4KMUA 3MMLB 4BY7K 4X6AK 2E2HC 3RZOC 1BS2A 1WQFA 1O27A 4G7ZA 5C3EC 1O25A 3CAGA 5JFEA 4QIWD 2E2IA 4NOIA 2R92A 1TWGK 2WAQD 2JA7C 3SZZA 4C3IC 4A3MK 3GTLC 4OIRA 4A3JK 1XXAA 1YCLA 3HXAA 3ERED 4XSZA 3FKIK 2XCOA 1ZXOA 3BP8C 2JA8K 2Y0SD 3M4OK 1O29A 3S17C 4GTBA 1DD5A 2V6SA 2R93K 4KC6A 3FKIC 1IQ0A 2W7VA 4KM8A 3S1RC 2YU9C 2E2HA 1IS1A 3WODA 4KMHA 2R92K 4M1XA 3LAPA 2JA5A 3K7AK 4LQYA 4BLBA 1I6VA 3S1NK 3BUEA 3I4MC 1TWFC 3GTQK 3GTJA 5IOTA 1TWCC 2VUMA 3AD7C 3QX3A 1VGXA 4Y52C 3PO3K 3CQZC 4YFKA 2Y0SL 1Y1VC 4BXXK 3T02A 4A3FK 2NVQC 2R7ZA 3AD9C 1RU0A 3S1QC 4A3BC 3SZYA 4A3JC 5FLMC 3AH5A 5C4XK 1WQGA 4OIPA 1Y1VK 4J3NA 2NVTK 3AQPA 3VA7A 4OINA 3S1MC 4BBSK 1HQMA 2GSUA 5L46A 3PO2C 2GSNA 3GTGK 3HOZK 1J98A 4KB4A 3H3VD 3S15C 1I50K 4GTAA 2NVYA 1WCMC 3LPXA 3FKIA 5TJ3A 4YFNA 2A68A 3GTGA 1YX2A 3S17K 1UV7A 4QIWL 3L4KA 5HL8A 1I6HK 1F7VA 2KWAA 4BBRC 1IE0A 4LLGA 3GTLA 3OEPA 5C4JK 4MEYA 1ZBSA 2E2JC 5IYCC 4LK1A 4XSXA 3GTMK 2P5MA 3K7AC 5IOQA 1L0WA 3N3YA 4BY1C 5C4JC 4QJVA 3GTPC 1SFOK 1O28A 2P8TA 2JA6K 3HOUK 4G7HA 4LK0A 3A8IA 2ZFZA 4KN4A 1O2AA 3M4OC 4QJVB 5IP7K 1I50C 5IOSA 3GIRA 4KN7A 1EQRA 4WJ3M 1WOSA 4O2DA 3RZDC 2V6TA 4A3KC 2JA7A 2GAGC 1R9TA 1EH1A 1WSRA 3H3VL 3HKZL 4P5BA 4OIQA 2R93A 4A3GK 1PJ6A 5CJ9A 5D4DA 4BY7C 4P9SA 2D6FC 2E2IC 3T01A 4A3LC 4A93K 4BKWA 3GTQC 2NVXC 3FHZA 4KMDA 4ZH4A 5IYDK 1TWAC 2PA8D 3GTMC 4A3DC 4LOWA 4PABA 4KDDA 1K83K
chains in the Genus database with same CATH topology
3S1MK 4C3IK 1Y1VK 2R7ZK 2R92C 4OIOA 5TMCA 3HOYK 5IYDC 3HOVC 2BE5A 3S1QK 4A3DK 4XLPA 5IYBC 3PO2K 5M3MK 3GTGC 4JK1A 2NVTK 3GTPK 1Y1WC 3H0GK 3GTOK 1R9TC 4A3GC 4OINA 3S1MC 4BBSK 1HQMA 3S16K 2A69A 5C3EK 3HOYC 1K83K 2R93C 1TWCK 3HOVK 2A6EA 3PO2C 3GTJK 2PMZL 4YFXA 1YNJA 2O5IA 3GTGK 3HOZK 3PO3C 2NVTC 3H3VD 5IYCK 1TWHK 1R9TK 3S15C 1Y1WK 1I50K 2JA7K 1WCMC 2JA5K 3GTLK 3HOXK 3RZDK 3S14K 4Q5SA 4YFNA 2A68A 1XPPA 4A3CK 4BY1K 2B63K 3HOZC 3I4NC 4A3BK 3GTJC 2PMZD 2O5JA 3S15K 1I6HC 2E2HK 3RZOK 1WCMK 2WB1L 2JA5C 3S17K 4Y52K 3HOXC 2VUMK 4QIWL 3S2DC 4A3EK 1IW7A 1TWFK 5IYBK 4KMUA 1I6HK 4A93C 5C44C 3EQLA 5IP7C 4G7OA 2E2HC 3RZOC 4BY7K 4X6AK 4BBRC 1YNNA 5M5YK 2CW0A 4LLGA 5C3EC 4G7ZA 3GTKK 4A3EC 3HOWK 4QIWD 1TWAK 5C4JK 4NOIA 1TWGK 4MEYA 2E2JC 4XLNA 4A3FC 4A3KK 4AYBD 4LK1A 5IYCC 5FLMK 4Y7NK 2WAQD 2A6HA 4XSXA 4BBRK 2JA7C 3GTMK 3K7AC 4A3MK 3GTLC 3DXJA 4C3JK 4OIRA 4A3JK 4MEXA 4A3IK 3HOUC 5C4XC 4BY1C 1TWGC 2B63C 4XSZA 5C4JC 3FKIK 4Q4ZA 4QJVA 2JA8K 4GZYA 2Y0SD 3S1RK 3GTPC 3M3YC 3M4OK 1SFOK 3GTOC 2YU9K 3S17C 1ZYRA 3S16C 2JA6K 3HOUK 2R93K 3S2DK 3H0GC 4YG2A 4G7HA 4A3IC 4LK0A 4BBSC 1SMYA 4KN4A 2JA8C 3FKIC 3M4OC 2WB1D 4QJVB 3S1RC 3M3YK 5IP7K 4X6AC 1SFOC 1I50C 2YU9C 3HKZD 2JA6C 4KN7A 5M3FK 5IP9C 1TWHC 3I4MK 4A3CC 3S2HK 1K83C 2NVYC 3WODA 3S1NC 5FJ8K 2R92K 3RZDC 3S14C 4A3KC 4Y7NC 1I3QC 2E2IK 3H3VL 3HKZL 3CQZK 3K7AK 5M5XK 4A3MC 4A3LK 4OIQA 1I6VA 5IP9K 3S1NK 5TMFA 4LJZA 3I4MC 3S2HC 1TWFC 4A3GK 3GTQK 5D4DA 5M5WK 2NVXK 4BXXC 5C44K 2VUMC 2NVQK 1TWCC 4BY7C 4AYBL 2E2IC 2PA8L 2PPBA 1I3QK 4Y52C 3PO3K 2WAQL 4A3LC 3CQZC 4YFKA 4A93K 2Y0SL 3GTQC 1BDFA 1Y1VC 2NVXC 2R7ZC 4C2MK 4C3HK 4BXXK 4A3FK 4ZH4A 2NVQC 5IYDK 3GTKC 3HOWC 4MQ9A 3S1QC 1TWAC 3I4NK 4A3BC 2PA8D 3GTMC 4A3DC 2E2JK 4A3JC 5FLMC 5C4XK 4OIPA 2NVYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M K;  4C3I K;  1Y1V K;  2R7Z K;  2R92 C;  4OIO A;  5TMC A;  3HOY K;  5IYD C;  3HOV C;  2BE5 A;  3S1Q K;  4A3D K;  4XLP A;  5IYB C;  3PO2 K;  5M3M K;  3GTG C;  4JK1 A;  2NVT K;  3GTP K;  1Y1W C;  3H0G K;  3GTO K;  1R9T C;  4A3G C;  4OIN A;  3S1M C;  4BBS K;  1HQM A;  3S16 K;  2A69 A;  5C3E K;  3HOY C;  1K83 K;  2R93 C;  1TWC K;  3HOV K;  2A6E A;  3PO2 C;  3GTJ K;  2PMZ L;  4YFX A;  1YNJ A;  2O5I A;  3GTG K;  3HOZ K;  3PO3 C;  2NVT C;  3H3V D;  5IYC K;  1TWH K;  1R9T K;  3S15 C;  1Y1W K;  1I50 K;  2JA7 K;  1WCM C;  2JA5 K;  3GTL K;  3HOX K;  3RZD K;  3S14 K;  4Q5S A;  4YFN A;  2A68 A;  1XPP A;  4A3C K;  4BY1 K;  2B63 K;  3HOZ C;  3I4N C;  4A3B K;  3GTJ C;  2PMZ D;  2O5J A;  3S15 K;  1I6H C;  2E2H K;  3RZO K;  1WCM K;  2WB1 L;  2JA5 C;  3S17 K;  4Y52 K;  3HOX C;  2VUM K;  4QIW L;  3S2D C;  4A3E K;  1IW7 A;  1TWF K;  5IYB K;  4KMU A;  1I6H K;  4A93 C;  5C44 C;  3EQL A;  5IP7 C;  4G7O A;  2E2H C;  3RZO C;  4BY7 K;  4X6A K;  4BBR C;  1YNN A;  5M5Y K;  2CW0 A;  4LLG A;  5C3E C;  4G7Z A;  3GTK K;  4A3E C;  3HOW K;  4QIW D;  1TWA K;  5C4J K;  4NOI A;  1TWG K;  4MEY A;  2E2J C;  4XLN A;  4A3F C;  4A3K K;  4AYB D;  4LK1 A;  5IYC C;  5FLM K;  4Y7N K;  2WAQ D;  2A6H A;  4XSX A;  4BBR K;  2JA7 C;  3GTM K;  3K7A C;  4A3M K;  3GTL C;  3DXJ A;  4C3J K;  4OIR A;  4A3J K;  4MEX A;  4A3I K;  3HOU C;  5C4X C;  4BY1 C;  1TWG C;  2B63 C;  4XSZ A;  5C4J C;  3FKI K;  4Q4Z A;  4QJV A;  2JA8 K;  4GZY A;  2Y0S D;  3S1R K;  3GTP C;  3M3Y C;  3M4O K;  1SFO K;  3GTO C;  2YU9 K;  3S17 C;  1ZYR A;  3S16 C;  2JA6 K;  3HOU K;  2R93 K;  3S2D K;  3H0G C;  4YG2 A;  4G7H A;  4A3I C;  4LK0 A;  4BBS C;  1SMY A;  4KN4 A;  2JA8 C;  3FKI C;  3M4O C;  2WB1 D;  4QJV B;  3S1R C;  3M3Y K;  5IP7 K;  4X6A C;  1SFO C;  1I50 C;  2YU9 C;  3HKZ D;  2JA6 C;  4KN7 A;  5M3F K;  5IP9 C;  1TWH C;  3I4M K;  4A3C C;  3S2H K;  1K83 C;  2NVY C;  3WOD A;  3S1N C;  5FJ8 K;  2R92 K;  3RZD C;  3S14 C;  4A3K C;  4Y7N C;  1I3Q C;  2E2I K;  3H3V L;  3HKZ L;  3CQZ K;  3K7A K;  5M5X K;  4A3M C;  4A3L K;  4OIQ A;  1I6V A;  5IP9 K;  3S1N K;  5TMF A;  4LJZ A;  3I4M C;  3S2H C;  1TWF C;  4A3G K;  3GTQ K;  5D4D A;  5M5W K;  2NVX K;  4BXX C;  5C44 K;  2VUM C;  2NVQ K;  1TWC C;  4BY7 C;  4AYB L;  2E2I C;  2PA8 L;  2PPB A;  1I3Q K;  4Y52 C;  3PO3 K;  2WAQ L;  4A3L C;  3CQZ C;  4YFK A;  4A93 K;  2Y0S L;  3GTQ C;  1BDF A;  1Y1V C;  2NVX C;  2R7Z C;  4C2M K;  4C3H K;  4BXX K;  4A3F K;  4ZH4 A;  2NVQ C;  5IYD K;  3GTK C;  3HOW C;  4MQ9 A;  3S1Q C;  1TWA C;  3I4N K;  4A3B C;  2PA8 D;  3GTM C;  4A3D C;  2E2J K;  4A3J C;  5FLM C;  5C4X K;  4OIP A;  2NVY K; 
#chains in the Genus database with same CATH topology
 3N0B A;  3HOY K;  3HOV C;  2BE5 A;  3S1Q K;  5IYB C;  1B4A A;  3S16 K;  5C3E K;  3AQO A;  1B4B A;  2A6E A;  4G0U A;  3GTJ K;  2PMZ L;  1F7U A;  2O5I A;  5IYC K;  1J6W A;  1R9T K;  1IL2 A;  2JA7 K;  1K83 A;  1BJT A;  2JA5 K;  4C3H C;  4C2M C;  3HOX K;  3RZD K;  3GTL K;  1TWH A;  1GE9 A;  1XPP A;  3NUH A;  4BY1 K;  4A3C K;  3I4N C;  5JVO A;  3GTJ C;  3S15 K;  2E2H K;  3RZO K;  1WCM K;  3HOX C;  3GSI A;  4A3E K;  1F9N A;  4A93 C;  5C44 C;  3TFJ A;  4WJ4 A;  1DCH A;  5M5Y K;  4GT9 A;  4C3J C;  3LAJ A;  1TWA K;  3IPJ A;  4A3K K;  5FLM K;  1ZQ1 C;  3T00 A;  3DXJ A;  1USO A;  1O26 A;  4A3I K;  1PJ7 A;  1TWG C;  1I3Q A;  3M3Y C;  3A8K A;  1C0A A;  1ZYR A;  3S16 C;  1USM A;  3FOF A;  3S2D K;  3H0G C;  4A3I C;  3ADA C;  5CHP A;  1SMY A;  1BGW A;  2JA8 C;  1TWF A;  1SFO A;  4X6A C;  1SFO C;  2JA6 C;  5IP9 C;  1XXC A;  4GFQ A;  1K83 C;  3S2H K;  5FJ8 K;  4Y7N C;  2GSO A;  1V5V A;  3A8J A;  5M5X K;  3G4A A;  5IP9 K;  3GDZ A;  5M5W K;  3ORE A;  4BXX C;  2VUM C;  2NVQ K;  1ISE A;  2WAQ L;  4PAA A;  1WCM A;  4G0W A;  4GTF A;  4KAT A;  4WIL A;  1BDF A;  2R7Z C;  4C2M K;  4C3H K;  1XZQ B;  1Y1V A;  3GTK C;  4KB2 A;  3HOW C;  4MQ9 A;  1XZP A;  1EI6 A;  1AB4 A;  2NVY K;  4C3I K;  2ZUE A;  2R7Z K;  1VRQ C;  2R92 C;  4OIO A;  1KQ4 A;  5IYD C;  2FQT A;  4A3D K;  4XLP A;  3PO2 K;  5M3M K;  3GTG C;  3JST A;  1HI9 A;  4GTL A;  3GTO K;  2CFA A;  2CFA B;  1J6V A;  3HOY C;  1VH2 A;  3HOV K;  1JVI A;  3BP3 A;  2NVX A;  1PJ5 A;  2NVT C;  3Q3Q A;  2RGR A;  4BLA A;  3CQZ A;  3AD8 C;  1XZP B;  5IOR A;  2PHC B;  4A3B K;  3HOZ C;  2O5J A;  3GEH A;  2JA5 C;  2WB1 L;  4GTD A;  1ZVU A;  3S2D C;  1J6X A;  1IW7 A;  4FZB A;  4G7O A;  3EQL A;  5IP7 C;  3GTQ A;  1DCP A;  1YNN A;  2CW0 A;  2GAH C;  2YU9 A;  3TFH A;  4P5A A;  4KM9 A;  4A3E C;  3GTK K;  3HOW K;  4XLN A;  4A3F C;  4AYB D;  4Y7N K;  4BBR K;  1O24 A;  2A6H A;  1WOO A;  3N0C A;  4C3J K;  3HOU C;  4MEX A;  5C4X C;  2B63 C;  4GZY A;  3H0G A;  4Q4Z A;  4G0V A;  3S1R K;  3GTO C;  3OPF A;  3FOE A;  2YU9 K;  4GTE A;  4YG2 A;  1INN A;  1EK8 A;  3G4C A;  4BBS C;  4GTC A;  2WB1 D;  3M3Y K;  3HKZ D;  1WOP A;  4FM9 A;  2XCQ A;  5M3F K;  2B63 A;  1TWH C;  3I4M K;  1WSV A;  4A3C C;  3S1N C;  2NVY C;  3S14 C;  2XCR B;  1Y1W A;  4KMA A;  1I3Q C;  1TWG A;  2EBB A;  2E2I K;  4A3L K;  3CQZ K;  4A3M C;  4C45 A;  5EGE A;  3S2H C;  5TMF A;  4LJZ A;  2RH6 A;  1G51 A;  2NVX K;  5C44 K;  1DCO A;  4AYB L;  2PA8 L;  2PPB A;  1I3Q K;  3L4J A;  5EGH A;  1O2F B;  4DDQ A;  3GTO A;  1WQH A;  2JH3 A;  1JQW A;  4KAW X;  3GTM A;  3TFI A;  1X31 C;  4KAR A;  3I4N K;  1TWA A;  1XXB A;  2E2J K;  3TTG A;  2ZUF A;  1IBA A;  3S1M K;  3GEE A;  5TMC A;  1TWC A;  4JK1 A;  4RMF A;  4AH6 A;  1Y1W C;  3H0G K;  3GTP K;  1R9T C;  1JOE A;  4A3G C;  4ILD A;  2A69 A;  4KAS A;  2R93 C;  1TWC K;  3GTP A;  4YFX A;  3PO3 C;  1YNJ A;  4Y52 K;  2JA6 A;  4XCH A;  1TWH K;  4LR2 A;  1Y1W K;  3S0X A;  2FQO A;  3GTK A;  3S14 K;  4Q5S A;  1F93 A;  2B63 K;  5E68 A;  1I50 A;  2PMZ D;  3GEI A;  1XZQ A;  1O2B A;  1I6H C;  1VLO A;  1EFW A;  1WIH A;  1VJE A;  2V6U A;  2VUM K;  3V4G A;  1WOR A;  1TWF K;  2Y3P A;  5IYB K;  4KMU A;  3MML B;  4BY7 K;  4X6A K;  2E2H C;  3RZO C;  1BS2 A;  1WQF A;  1O27 A;  4G7Z A;  5C3E C;  1O25 A;  3CAG A;  5JFE A;  4QIW D;  2E2I A;  4NOI A;  2R92 A;  1TWG K;  2WAQ D;  2JA7 C;  3SZZ A;  4C3I C;  4A3M K;  3GTL C;  4OIR A;  4A3J K;  1XXA A;  1YCL A;  3HXA A;  3ERE D;  4XSZ A;  3FKI K;  2XCO A;  1ZXO A;  3BP8 C;  2JA8 K;  2Y0S D;  3M4O K;  1O29 A;  3S17 C;  4GTB A;  1DD5 A;  2V6S A;  2R93 K;  4KC6 A;  3FKI C;  1IQ0 A;  2W7V A;  4KM8 A;  3S1R C;  2YU9 C;  2E2H A;  1IS1 A;  3WOD A;  4KMH A;  2R92 K;  4M1X A;  3LAP A;  2JA5 A;  3K7A K;  4LQY A;  4BLB A;  1I6V A;  3S1N K;  3BUE A;  3I4M C;  1TWF C;  3GTQ K;  3GTJ A;  5IOT A;  1TWC C;  2VUM A;  3AD7 C;  3QX3 A;  1VGX A;  4Y52 C;  3PO3 K;  3CQZ C;  4YFK A;  2Y0S L;  1Y1V C;  4BXX K;  3T02 A;  4A3F K;  2NVQ C;  2R7Z A;  3AD9 C;  1RU0 A;  3S1Q C;  4A3B C;  3SZY A;  4A3J C;  5FLM C;  3AH5 A;  5C4X K;  1WQG A;  4OIP A;  1Y1V K;  4J3N A;  2NVT K;  3AQP A;  3VA7 A;  4OIN A;  3S1M C;  4BBS K;  1HQM A;  2GSU A;  5L46 A;  3PO2 C;  2GSN A;  3GTG K;  3HOZ K;  1J98 A;  4KB4 A;  3H3V D;  3S15 C;  1I50 K;  4GTA A;  2NVY A;  1WCM C;  3LPX A;  3FKI A;  5TJ3 A;  4YFN A;  2A68 A;  3GTG A;  1YX2 A;  3S17 K;  1UV7 A;  4QIW L;  3L4K A;  5HL8 A;  1I6H K;  1F7V A;  2KWA A;  4BBR C;  1IE0 A;  4LLG A;  3GTL A;  3OEP A;  5C4J K;  4MEY A;  1ZBS A;  2E2J C;  5IYC C;  4LK1 A;  4XSX A;  3GTM K;  2P5M A;  3K7A C;  5IOQ A;  1L0W A;  3N3Y A;  4BY1 C;  5C4J C;  4QJV A;  3GTP C;  1SFO K;  1O28 A;  2P8T A;  2JA6 K;  3HOU K;  4G7H A;  4LK0 A;  3A8I A;  2ZFZ A;  4KN4 A;  1O2A A;  3M4O C;  4QJV B;  5IP7 K;  1I50 C;  5IOS A;  3GIR A;  4KN7 A;  1EQR A;  4WJ3 M;  1WOS A;  4O2D A;  3RZD C;  2V6T A;  4A3K C;  2JA7 A;  2GAG C;  1R9T A;  1EH1 A;  1WSR A;  3H3V L;  3HKZ L;  4P5B A;  4OIQ A;  2R93 A;  4A3G K;  1PJ6 A;  5CJ9 A;  5D4D A;  4BY7 C;  4P9S A;  2D6F C;  2E2I C;  3T01 A;  4A3L C;  4A93 K;  4BKW A;  3GTQ C;  2NVX C;  3FHZ A;  4KMD A;  4ZH4 A;  5IYD K;  1TWA C;  2PA8 D;  3GTM C;  4A3D C;  4LOW A;  4PAB A;  4KDD A;  1K83 K; 
#chains in the Genus database with same CATH homology
 3S1M K;  4C3I K;  1Y1V K;  2R7Z K;  2R92 C;  4OIO A;  5TMC A;  3HOY K;  5IYD C;  3HOV C;  2BE5 A;  3S1Q K;  4A3D K;  4XLP A;  5IYB C;  3PO2 K;  5M3M K;  3GTG C;  4JK1 A;  2NVT K;  3GTP K;  1Y1W C;  3H0G K;  3GTO K;  1R9T C;  4A3G C;  4OIN A;  3S1M C;  4BBS K;  1HQM A;  3S16 K;  2A69 A;  5C3E K;  3HOY C;  1K83 K;  2R93 C;  1TWC K;  3HOV K;  2A6E A;  3PO2 C;  3GTJ K;  2PMZ L;  4YFX A;  1YNJ A;  2O5I A;  3GTG K;  3HOZ K;  3PO3 C;  2NVT C;  3H3V D;  5IYC K;  1TWH K;  1R9T K;  3S15 C;  1Y1W K;  1I50 K;  2JA7 K;  1WCM C;  2JA5 K;  3GTL K;  3HOX K;  3RZD K;  3S14 K;  4Q5S A;  4YFN A;  2A68 A;  1XPP A;  4A3C K;  4BY1 K;  2B63 K;  3HOZ C;  3I4N C;  4A3B K;  3GTJ C;  2PMZ D;  2O5J A;  3S15 K;  1I6H C;  2E2H K;  3RZO K;  1WCM K;  2WB1 L;  2JA5 C;  3S17 K;  4Y52 K;  3HOX C;  2VUM K;  4QIW L;  3S2D C;  4A3E K;  1IW7 A;  1TWF K;  5IYB K;  4KMU A;  1I6H K;  4A93 C;  5C44 C;  3EQL A;  5IP7 C;  4G7O A;  2E2H C;  3RZO C;  4BY7 K;  4X6A K;  4BBR C;  1YNN A;  5M5Y K;  2CW0 A;  4LLG A;  5C3E C;  4G7Z A;  3GTK K;  4A3E C;  3HOW K;  4QIW D;  1TWA K;  5C4J K;  4NOI A;  1TWG K;  4MEY A;  2E2J C;  4XLN A;  4A3F C;  4A3K K;  4AYB D;  4LK1 A;  5IYC C;  5FLM K;  4Y7N K;  2WAQ D;  2A6H A;  4XSX A;  4BBR K;  2JA7 C;  3GTM K;  3K7A C;  4A3M K;  3GTL C;  3DXJ A;  4C3J K;  4OIR A;  4A3J K;  4MEX A;  4A3I K;  3HOU C;  5C4X C;  4BY1 C;  1TWG C;  2B63 C;  4XSZ A;  5C4J C;  3FKI K;  4Q4Z A;  4QJV A;  2JA8 K;  4GZY A;  2Y0S D;  3S1R K;  3GTP C;  3M3Y C;  3M4O K;  1SFO K;  3GTO C;  2YU9 K;  3S17 C;  1ZYR A;  3S16 C;  2JA6 K;  3HOU K;  2R93 K;  3S2D K;  3H0G C;  4YG2 A;  4G7H A;  4A3I C;  4LK0 A;  4BBS C;  1SMY A;  4KN4 A;  2JA8 C;  3FKI C;  3M4O C;  2WB1 D;  4QJV B;  3S1R C;  3M3Y K;  5IP7 K;  4X6A C;  1SFO C;  1I50 C;  2YU9 C;  3HKZ D;  2JA6 C;  4KN7 A;  5M3F K;  5IP9 C;  1TWH C;  3I4M K;  4A3C C;  3S2H K;  1K83 C;  2NVY C;  3WOD A;  3S1N C;  5FJ8 K;  2R92 K;  3RZD C;  3S14 C;  4A3K C;  4Y7N C;  1I3Q C;  2E2I K;  3H3V L;  3HKZ L;  3CQZ K;  3K7A K;  5M5X K;  4A3M C;  4A3L K;  4OIQ A;  1I6V A;  5IP9 K;  3S1N K;  5TMF A;  4LJZ A;  3I4M C;  3S2H C;  1TWF C;  4A3G K;  3GTQ K;  5D4D A;  5M5W K;  2NVX K;  4BXX C;  5C44 K;  2VUM C;  2NVQ K;  1TWC C;  4BY7 C;  4AYB L;  2E2I C;  2PA8 L;  2PPB A;  1I3Q K;  4Y52 C;  3PO3 K;  2WAQ L;  4A3L C;  3CQZ C;  4YFK A;  4A93 K;  2Y0S L;  3GTQ C;  1BDF A;  1Y1V C;  2NVX C;  2R7Z C;  4C2M K;  4C3H K;  4BXX K;  4A3F K;  4ZH4 A;  2NVQ C;  5IYD K;  3GTK C;  3HOW C;  4MQ9 A;  3S1Q C;  1TWA C;  3I4N K;  4A3B C;  2PA8 D;  3GTM C;  4A3D C;  2E2J K;  4A3J C;  5FLM C;  5C4X K;  4OIP A;  2NVY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...