3HKZL

The x-ray crystal structure of rna polymerase from archaea
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
total genus 18
structure length 92
sequence length 92
chains with identical sequence V
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hkzL00
4A3JC 3S16C 5IYDC 3S2DK 5M3FK 4QIWL 3GTQC 3GTKK 5IP7C 2E2HC 5C4XC 2JA5C 3CQZK 4MQ9A 3PO3K 1WCMK 2JA8C 4A93C 4BY7C 2WAQL 4QJVB 3GTJC 2PPBA 1I6VA 4AYBL 4A3JK 2NVXK 3RZOC 4A3BC 1YNNA 2R92C 3HKZD 3S2HC 4LK0A 1TWHK 5IP9C 2JA6C 4XSZA 2NVYC 4XLNA 4OINA 2E2JK 3S17C 1Y1VC 4A3FK 1I3QC 2E2IK 2B63K 3M3YK 4A3LK 3GTGK 2PA8D 3GTOK 3RZOK 4BY1K 3S1MK 3PO2C 3S1QC 2PMZD 2A6EA 2WB1D 4KN4A 4Y52C 3FKIK 5FLMK 3GTPK 3HOYK 3S14C 4OIPA 4A3DC 4X6AK 3HOWC 3K7AK 1HQMA 4BBSC 1TWGC 5TMFA 1SMYA 3S15K 3M4OK 2JA7C 4YG2A 1IW7A 5M3MK 2VUMC 2R93K 3RZDC 1R9TK 1TWCC 3GTMC 4A3MC 1Y1WC 1SFOC 5TMCA 4A3EC 3H3VD 3S1RK 2YU9K 4GZYA 2PA8L 4BBRK 3I4MC 5FJ8K 1BDFA 4MEYA 5M5WK 2PMZL 2WB1L 4QJVA 4Y7NK 4A3KK 3S16K 5IYBC 3S1NC 5IYDK 1K83C 5C3EC 3GTQK 3HOZC 3H0GC 5IP7K 5C4XK 2E2HK 2JA5K 3HOUC 4BXXC 1TWFC 2O5JA 5C44C 2JA8K 4A93K 4BY7K 1YNJA 3GTJK 3H3VL 5M5YK 4A3IC 4A3BK 4OIOA 2CW0A 4C3JK 5D4DA 2R92K 3S2HK 5IP9K 2JA6K 3GTLC 2NVYK 3S17K 1Y1VK 2A68A 3HKZL 1I3QK 2R7ZC 1I6HC 4YFXA 4A3GC 4XLPA 3HOVC 3PO2K 3S1QK 5C4JC 1XPPA 1I50C 4C2MK 3S14K 4C3IK 4Y52K 4A3DK 3HOXC 4YFNA 4A3CC 4C3HK 2Y0SD 3HOWK 1TWAC 4A3KC 4BBSK 1TWGK 4MEXA 3I4NC 5IYCC 2NVTC 4G7ZA 3PO3C 1ZYRA 4LLGA 2JA7K 4KMUA 2VUMK 3RZDK 3GTMK 1TWCK 4A3MK 1Y1WK 4Q4ZA 1SFOK 4A3EK 2BE5A 4OIQA 3GTKC 3S2DC 4Q5SA 3CQZC 3I4MK 1WCMC 3S1NK 5IYBK 1K83K 5C3EK 2Y0SL 2NVXC 3HOZK 2A6HA 3H0GK 4G7OA 4G7HA 1TWHC 4YFKA 3HOUK 4BXXK 1TWFK 5M5XK 4LK1A 4LJZA 5C44K 2E2JC 4KN7A 4A3FC 2E2IC 3EQLA 2B63C 4A3IK 3M3YC 3GTGC 4A3LC 2O5IA 3GTOC 4BY1C 3S1MC 3GTLK 3GTPC 3HOYC 2NVQC 3FKIC 5FLMC 4X6AC 3K7AC 4QIWD 2A69A 2R7ZK 4XSXA 1I6HK 4A3GK 3S15C 3HOVK 4OIRA 4ZH4A 5C4JK 3M4OC 1I50K 3DXJA 2R93C 2WAQD 3HOXK 1R9TC 4A3CK 4JK1A 2NVQK 4AYBD 1TWAK 3S1RC 2YU9C 3WODA 4BBRC 3I4NK 5IYCK 2NVTK 4Y7NC 4NOIA
chains in the Genus database with same CATH superfamily
1RU0A 5M3FK 2XCQA 4QIWL 3GTKA 3AH5A 1XZPA 2JA8C 5CJ9A 4A93C 3RZOC 4A3JK 1O2BA 2JA6C 5IOTA 4BKWA 2E2JK 4A3FK 3GSIA 4KB4A 3TTGA 4A3LK 3GTGK 3GTOK 3IPJA 1ZXOA 4C2MC 2A6EA 3HOYK 3FKIK 4X6AK 4OIPA 4KASA 4FZBA 4BBSC 3G4CA 3A8IA 1Y1WC 3S1RK 4G0VA 1DCOA 3ADAC 4BBRK 1BDFA 2JH3A 2V6UA 3TFIA 4A3KK 1K83C 1O28A 1TWHA 3FOFA 1INNA 1WSRA 1TWFC 1WQHA 1BJTA 2JA8K 4A93K 2E2IA 5M5YK 3LPXA 4A3IC 3A8JA 3GTJA 5D4DA 1ZVUA 2JA6K 4J3NA 3GTLC 4P5BA 3HKZL 4WJ3M 2FQTA 1I6HC 2ZUEA 3HOVC 1XPPA 4C2MK 4GTFA 4YFNA 4A3CC 1O2AA 2YU9A 4BBSK 3I4NC 4G7ZA 1ZYRA 4LLGA 4WJ4A 1O27A 4KMUA 1WOPA 1Y1WK 4Q4ZA 3L4KA 2JA5A 1WCMC 1K83K 3LAPA 2NVXC 3N0BA 2R92A 3H0GA 1JQWA 3AD9C 1TWFK 1XZPB 4GTDA 2GAHC 4KN7A 3NUHA 1I3QA 3EQLA 4A3IK 4BY1C 3GTLK 1XXBA 2A69A 3A8KA 1TWGA 3N0CA 1I6HK 1J6VA 3HOVK 1J6WA 3GTMA 2R93C 4A3CK 4AYBD 1F7UA 3WODA 3I4NK 2A68A 4A3JC 3S16C 5IYDC 3GTQC 2XCRB 2E2HC 1WCMK 2CFAA 4BY7C 4BLAA 1WOSA 4AYBL 2NVXK 2PPBA 3N3YA 2FQOA 1PJ7A 4C3JC 2P8TA 2XCOA 4XSZA 2NVYC 3TFJA 4XLNA 4OINA 3S17C 5JVOA 2PA8D 4BY1K 1VJEA 2PHCB 3GTGA 3S1QC 1I50A 1IS1A 3S14C 4C3IC 3GIRA 3HOWC 1EK8A 1V5VA 2JA7C 1IW7A 3SZYA 3TFHA 2VUMC 2R93K 1TWCC 3L4JA 3H3VD 5HL8A 5TMCA 1JVIA 2PA8L 2W7VA 3CQZA 4MEYA 4QJVA 1IL2A 5JFEA 1O24A 3S16K 1EFWA 5IYDK 5C3EC 3GTQK 3HOZC 4LOWA 2E2HK 3VA7A 4BY7K 2B63A 3H3VL 4C3JK 3GTPA 2NVYK 3S17K 4YFXA 1KQ4A 3S1QK 5C4JC 3S14K 4C3IK 1R9TA 2EBBA 4C3HK 2Y0SD 1F9NA 3HOWK 5TJ3A 4MEXA 1USMA 2JA7K 4GTAA 2VUMK 1TWCK 4Q5SA 4OIQA 5C3EK 2Y0SL 1O25A 1G51A 2A6HA 3HOZK 4G7OA 1TWHC 4YFKA 2KWAA 1Y1VA 4KC6A 1BGWA 2CFAB 4P9SA 2E2IC 1XXCA 1O26A 3T00A 2P5MA 3K7AC 4XSXA 4KM8A 3S15C 1F93A 5C4JK 5L46A 1XXAA 1SFOA 2YU9C 1F7VA 3SZZA 4NOIA 4KARA 4P5AA 2GSUA 5CHPA 5C4XC 2JA5C 2GAGC 4MQ9A 1AB4A 3QX3A 4QJVB 4G0UA 1I6VA 4GTCA 1YNNA 2R92C 4LK0A 1TWHK 5IP9C 1VLOA 2R7ZA 1I3QC 2E2IK 4PAAA 3T02A 3FHZA 2WB1D 4KN4A 4A3DC 1TWAA 3BP3A 3Q3QA 3K7AK 1TWGC 5TMFA 3S15K 4KMHA 4YG2A 3G4AA 5M3MK 4KATA 3RZDC 3GTMC 4A3MC 2YU9K 4AH6A 3S1NC 2WB1L 4XCHA 4O2DA 5C4XK 2JA5K 1ZBSA 4BXXC 2GSNA 5IORA 1YNJA 3GTOA 4OIOA 2CW0A 2R92K 5IP9K 1WIHA 4C45A 3FKIA 4C3HC 1GE9A 4KM9A 1I3QK 4LR2A 1ZQ1C 4A3GC 4PABA 4XLPA 1I50C 4A3DK 4KMDA 2Y3PA 1TWGK 5IYCC 2NVTC 3AQOA 4ILDA 1PJ6A 3RZDK 3GTMK 4A3MK 3GTKC 3S2DC 2BE5A 3OPFA 3CQZC 3S1NK 2V6SA 4G0WA 3OEPA 4G7HA 2JA6A 4BXXK 4KAWX 5M5XK 4LK1A 4LJZA 3BP8C 2B63C 3M3YC 2O5IA 1HI9A 1UV7A 1WOOA 3S1MC 3GTPC 5FLMC 2V6TA 4A3GK 1XZQA 1J6XA 3CAGA 4ZH4A 3M4OC 2GSOA 1I50K 2WAQD 1R9TC 1Y1WA 2NVQK 1WORA 3FOEA 5IYCK 2NVTK 3GDZA 4Y7NC 1DCHA 1K83A 1WQGA 5EGHA 3S2DK 3GTKK 5IP7C 4GTEA 5IOSA 1TWFA 3CQZK 1O2FB 2WAQL 1PJ5A 3GTJC 4KB2A 4A3BC 3S2HC 3HKZD 3GTLA 4GTBA 4M1XA 1YCLA 1Y1VC 2B63K 3M3YK 3RZOK 3S1MK 3PO2C 3AD7C 2PMZD 4Y52C 3GTPK 5FLMK 3GEHA 1JOEA 1VRQC 1HQMA 1ISEA 1WSVA 1SMYA 5E68A 3M4OK 1B4BA 1R9TK 4GZYA 1SFOC 2D6FC 4A3EC 1L0WA 3I4MC 5FJ8K 1WCMA 1IQ0A 5M5WK 2PMZL 4Y7NK 1IBAA 5IYBC 2NVXA 3H0GC 1WQFA 5IP7K 1IE0A 3HOUC 2O5JA 5C44C 1B4AA 2RGRA 3GEIA 4KMAA 3GTJK 4A3BK 3S2HK 1USOA 2ZFZA 1BS2A 1O29A 4BLBA 1EH1A 4RMFA 1Y1VK 3HXAA 2R7ZC 3PO2K 1C0AA 2R93A 1DD5A 4Y52K 4KDDA 3HOXC 4GT9A 1TWAC 4FM9A 1DCPA 1J98A 1EQRA 3PO3C 1XZQB 3MMLB 2ZUFA 3JSTA 3GTQA 3V4GA 4GTLA 1SFOK 4A3EK 2E2HA 3ERED 4LQYA 3GEEA 3I4MK 1X31C 3OREA 1YX2A 5IYBK 3S0XA 3AD8C 5EGEA 3H0GK 1VGXA 3HOUK 2NVYA 5C44K 2E2JC 4A3FC 3AQPA 4A3LC 3GTGC 3GTOC 5IOQA 3HOYC 1EI6A 4DDQA 2NVQC 3FKIC 3LAJA 4X6AC 4QIWD 2R7ZK 3T01A 3BUEA 2RH6A 4OIRA 2JA7A 3DXJA 2VUMA 1TWCA 4WILA 3HOXK 4JK1A 1TWAK 3S1RC 4BBRC 4GFQA 3PO3K 1VH2A 4A3KC
chains in the Genus database with same CATH topology
4A3JC 3S16C 5IYDC 3S2DK 5M3FK 4QIWL 3GTQC 3GTKK 5IP7C 2E2HC 5C4XC 2JA5C 3CQZK 4MQ9A 3PO3K 1WCMK 2JA8C 4A93C 4BY7C 2WAQL 4QJVB 3GTJC 2PPBA 1I6VA 4AYBL 4A3JK 2NVXK 3RZOC 4A3BC 1YNNA 2R92C 3HKZD 3S2HC 4LK0A 1TWHK 5IP9C 2JA6C 4XSZA 2NVYC 4XLNA 4OINA 2E2JK 3S17C 1Y1VC 4A3FK 1I3QC 2E2IK 2B63K 3M3YK 4A3LK 3GTGK 2PA8D 3GTOK 3RZOK 4BY1K 3S1MK 3PO2C 3S1QC 2PMZD 2A6EA 2WB1D 4KN4A 4Y52C 3FKIK 5FLMK 3GTPK 3HOYK 3S14C 4OIPA 4A3DC 4X6AK 3HOWC 3K7AK 1HQMA 4BBSC 1TWGC 5TMFA 1SMYA 3S15K 3M4OK 2JA7C 4YG2A 1IW7A 5M3MK 2VUMC 2R93K 3RZDC 1R9TK 1TWCC 3GTMC 4A3MC 1Y1WC 1SFOC 5TMCA 4A3EC 3H3VD 3S1RK 2YU9K 4GZYA 2PA8L 4BBRK 3I4MC 5FJ8K 1BDFA 4MEYA 5M5WK 2PMZL 2WB1L 4QJVA 4Y7NK 4A3KK 3S16K 5IYBC 3S1NC 5IYDK 1K83C 5C3EC 3GTQK 3HOZC 3H0GC 5IP7K 5C4XK 2E2HK 2JA5K 3HOUC 4BXXC 1TWFC 2O5JA 5C44C 2JA8K 4A93K 4BY7K 1YNJA 3GTJK 3H3VL 5M5YK 4A3IC 4A3BK 4OIOA 2CW0A 4C3JK 5D4DA 2R92K 3S2HK 5IP9K 2JA6K 3GTLC 2NVYK 3S17K 1Y1VK 2A68A 3HKZL 1I3QK 2R7ZC 1I6HC 4YFXA 4A3GC 4XLPA 3HOVC 3PO2K 3S1QK 5C4JC 1XPPA 1I50C 4C2MK 3S14K 4C3IK 4Y52K 4A3DK 3HOXC 4YFNA 4A3CC 4C3HK 2Y0SD 3HOWK 1TWAC 4A3KC 4BBSK 1TWGK 4MEXA 3I4NC 5IYCC 2NVTC 4G7ZA 3PO3C 1ZYRA 4LLGA 2JA7K 4KMUA 2VUMK 3RZDK 3GTMK 1TWCK 4A3MK 1Y1WK 4Q4ZA 1SFOK 4A3EK 2BE5A 4OIQA 3GTKC 3S2DC 4Q5SA 3CQZC 3I4MK 1WCMC 3S1NK 5IYBK 1K83K 5C3EK 2Y0SL 2NVXC 3HOZK 2A6HA 3H0GK 4G7OA 4G7HA 1TWHC 4YFKA 3HOUK 4BXXK 1TWFK 5M5XK 4LK1A 4LJZA 5C44K 2E2JC 4KN7A 4A3FC 2E2IC 3EQLA 2B63C 4A3IK 3M3YC 3GTGC 4A3LC 2O5IA 3GTOC 4BY1C 3S1MC 3GTLK 3GTPC 3HOYC 2NVQC 3FKIC 5FLMC 4X6AC 3K7AC 4QIWD 2A69A 2R7ZK 4XSXA 1I6HK 4A3GK 3S15C 3HOVK 4OIRA 4ZH4A 5C4JK 3M4OC 1I50K 3DXJA 2R93C 2WAQD 3HOXK 1R9TC 4A3CK 4JK1A 2NVQK 4AYBD 1TWAK 3S1RC 2YU9C 3WODA 4BBRC 3I4NK 5IYCK 2NVTK 4Y7NC 4NOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J C;  3S16 C;  5IYD C;  3S2D K;  5M3F K;  4QIW L;  3GTQ C;  3GTK K;  5IP7 C;  2E2H C;  5C4X C;  2JA5 C;  3CQZ K;  4MQ9 A;  3PO3 K;  1WCM K;  2JA8 C;  4A93 C;  4BY7 C;  2WAQ L;  4QJV B;  3GTJ C;  2PPB A;  1I6V A;  4AYB L;  4A3J K;  2NVX K;  3RZO C;  4A3B C;  1YNN A;  2R92 C;  3HKZ D;  3S2H C;  4LK0 A;  1TWH K;  5IP9 C;  2JA6 C;  4XSZ A;  2NVY C;  4XLN A;  4OIN A;  2E2J K;  3S17 C;  1Y1V C;  4A3F K;  1I3Q C;  2E2I K;  2B63 K;  3M3Y K;  4A3L K;  3GTG K;  2PA8 D;  3GTO K;  3RZO K;  4BY1 K;  3S1M K;  3PO2 C;  3S1Q C;  2PMZ D;  2A6E A;  2WB1 D;  4KN4 A;  4Y52 C;  3FKI K;  5FLM K;  3GTP K;  3HOY K;  3S14 C;  4OIP A;  4A3D C;  4X6A K;  3HOW C;  3K7A K;  1HQM A;  4BBS C;  1TWG C;  5TMF A;  1SMY A;  3S15 K;  3M4O K;  2JA7 C;  4YG2 A;  1IW7 A;  5M3M K;  2VUM C;  2R93 K;  3RZD C;  1R9T K;  1TWC C;  3GTM C;  4A3M C;  1Y1W C;  1SFO C;  5TMC A;  4A3E C;  3H3V D;  3S1R K;  2YU9 K;  4GZY A;  2PA8 L;  4BBR K;  3I4M C;  5FJ8 K;  1BDF A;  4MEY A;  5M5W K;  2PMZ L;  2WB1 L;  4QJV A;  4Y7N K;  4A3K K;  3S16 K;  5IYB C;  3S1N C;  5IYD K;  1K83 C;  5C3E C;  3GTQ K;  3HOZ C;  3H0G C;  5IP7 K;  5C4X K;  2E2H K;  2JA5 K;  3HOU C;  4BXX C;  1TWF C;  2O5J A;  5C44 C;  2JA8 K;  4A93 K;  4BY7 K;  1YNJ A;  3GTJ K;  3H3V L;  5M5Y K;  4A3I C;  4A3B K;  4OIO A;  2CW0 A;  4C3J K;  5D4D A;  2R92 K;  3S2H K;  5IP9 K;  2JA6 K;  3GTL C;  2NVY K;  3S17 K;  1Y1V K;  2A68 A;  3HKZ L;  1I3Q K;  2R7Z C;  1I6H C;  4YFX A;  4A3G C;  4XLP A;  3HOV C;  3PO2 K;  3S1Q K;  5C4J C;  1XPP A;  1I50 C;  4C2M K;  3S14 K;  4C3I K;  4Y52 K;  4A3D K;  3HOX C;  4YFN A;  4A3C C;  4C3H K;  2Y0S D;  3HOW K;  1TWA C;  4A3K C;  4BBS K;  1TWG K;  4MEX A;  3I4N C;  5IYC C;  2NVT C;  4G7Z A;  3PO3 C;  1ZYR A;  4LLG A;  2JA7 K;  4KMU A;  2VUM K;  3RZD K;  3GTM K;  1TWC K;  4A3M K;  1Y1W K;  4Q4Z A;  1SFO K;  4A3E K;  2BE5 A;  4OIQ A;  3GTK C;  3S2D C;  4Q5S A;  3CQZ C;  3I4M K;  1WCM C;  3S1N K;  5IYB K;  1K83 K;  5C3E K;  2Y0S L;  2NVX C;  3HOZ K;  2A6H A;  3H0G K;  4G7O A;  4G7H A;  1TWH C;  4YFK A;  3HOU K;  4BXX K;  1TWF K;  5M5X K;  4LK1 A;  4LJZ A;  5C44 K;  2E2J C;  4KN7 A;  4A3F C;  2E2I C;  3EQL A;  2B63 C;  4A3I K;  3M3Y C;  3GTG C;  4A3L C;  2O5I A;  3GTO C;  4BY1 C;  3S1M C;  3GTL K;  3GTP C;  3HOY C;  2NVQ C;  3FKI C;  5FLM C;  4X6A C;  3K7A C;  4QIW D;  2A69 A;  2R7Z K;  4XSX A;  1I6H K;  4A3G K;  3S15 C;  3HOV K;  4OIR A;  4ZH4 A;  5C4J K;  3M4O C;  1I50 K;  3DXJ A;  2R93 C;  2WAQ D;  3HOX K;  1R9T C;  4A3C K;  4JK1 A;  2NVQ K;  4AYB D;  1TWA K;  3S1R C;  2YU9 C;  3WOD A;  4BBR C;  3I4N K;  5IYC K;  2NVT K;  4Y7N C;  4NOI A; 
#chains in the Genus database with same CATH topology
 1RU0 A;  5M3F K;  2XCQ A;  4QIW L;  3GTK A;  3AH5 A;  1XZP A;  2JA8 C;  5CJ9 A;  4A93 C;  3RZO C;  4A3J K;  1O2B A;  2JA6 C;  5IOT A;  4BKW A;  2E2J K;  4A3F K;  3GSI A;  4KB4 A;  3TTG A;  4A3L K;  3GTG K;  3GTO K;  3IPJ A;  1ZXO A;  4C2M C;  2A6E A;  3HOY K;  3FKI K;  4X6A K;  4OIP A;  4KAS A;  4FZB A;  4BBS C;  3G4C A;  3A8I A;  1Y1W C;  3S1R K;  4G0V A;  1DCO A;  3ADA C;  4BBR K;  1BDF A;  2JH3 A;  2V6U A;  3TFI A;  4A3K K;  1K83 C;  1O28 A;  1TWH A;  3FOF A;  1INN A;  1WSR A;  1TWF C;  1WQH A;  1BJT A;  2JA8 K;  4A93 K;  2E2I A;  5M5Y K;  3LPX A;  4A3I C;  3A8J A;  3GTJ A;  5D4D A;  1ZVU A;  2JA6 K;  4J3N A;  3GTL C;  4P5B A;  3HKZ L;  4WJ3 M;  2FQT A;  1I6H C;  2ZUE A;  3HOV C;  1XPP A;  4C2M K;  4GTF A;  4YFN A;  4A3C C;  1O2A A;  2YU9 A;  4BBS K;  3I4N C;  4G7Z A;  1ZYR A;  4LLG A;  4WJ4 A;  1O27 A;  4KMU A;  1WOP A;  1Y1W K;  4Q4Z A;  3L4K A;  2JA5 A;  1WCM C;  1K83 K;  3LAP A;  2NVX C;  3N0B A;  2R92 A;  3H0G A;  1JQW A;  3AD9 C;  1TWF K;  1XZP B;  4GTD A;  2GAH C;  4KN7 A;  3NUH A;  1I3Q A;  3EQL A;  4A3I K;  4BY1 C;  3GTL K;  1XXB A;  2A69 A;  3A8K A;  1TWG A;  3N0C A;  1I6H K;  1J6V A;  3HOV K;  1J6W A;  3GTM A;  2R93 C;  4A3C K;  4AYB D;  1F7U A;  3WOD A;  3I4N K;  2A68 A;  4A3J C;  3S16 C;  5IYD C;  3GTQ C;  2XCR B;  2E2H C;  1WCM K;  2CFA A;  4BY7 C;  4BLA A;  1WOS A;  4AYB L;  2NVX K;  2PPB A;  3N3Y A;  2FQO A;  1PJ7 A;  4C3J C;  2P8T A;  2XCO A;  4XSZ A;  2NVY C;  3TFJ A;  4XLN A;  4OIN A;  3S17 C;  5JVO A;  2PA8 D;  4BY1 K;  1VJE A;  2PHC B;  3GTG A;  3S1Q C;  1I50 A;  1IS1 A;  3S14 C;  4C3I C;  3GIR A;  3HOW C;  1EK8 A;  1V5V A;  2JA7 C;  1IW7 A;  3SZY A;  3TFH A;  2VUM C;  2R93 K;  1TWC C;  3L4J A;  3H3V D;  5HL8 A;  5TMC A;  1JVI A;  2PA8 L;  2W7V A;  3CQZ A;  4MEY A;  4QJV A;  1IL2 A;  5JFE A;  1O24 A;  3S16 K;  1EFW A;  5IYD K;  5C3E C;  3GTQ K;  3HOZ C;  4LOW A;  2E2H K;  3VA7 A;  4BY7 K;  2B63 A;  3H3V L;  4C3J K;  3GTP A;  2NVY K;  3S17 K;  4YFX A;  1KQ4 A;  3S1Q K;  5C4J C;  3S14 K;  4C3I K;  1R9T A;  2EBB A;  4C3H K;  2Y0S D;  1F9N A;  3HOW K;  5TJ3 A;  4MEX A;  1USM A;  2JA7 K;  4GTA A;  2VUM K;  1TWC K;  4Q5S A;  4OIQ A;  5C3E K;  2Y0S L;  1O25 A;  1G51 A;  2A6H A;  3HOZ K;  4G7O A;  1TWH C;  4YFK A;  2KWA A;  1Y1V A;  4KC6 A;  1BGW A;  2CFA B;  4P9S A;  2E2I C;  1XXC A;  1O26 A;  3T00 A;  2P5M A;  3K7A C;  4XSX A;  4KM8 A;  3S15 C;  1F93 A;  5C4J K;  5L46 A;  1XXA A;  1SFO A;  2YU9 C;  1F7V A;  3SZZ A;  4NOI A;  4KAR A;  4P5A A;  2GSU A;  5CHP A;  5C4X C;  2JA5 C;  2GAG C;  4MQ9 A;  1AB4 A;  3QX3 A;  4QJV B;  4G0U A;  1I6V A;  4GTC A;  1YNN A;  2R92 C;  4LK0 A;  1TWH K;  5IP9 C;  1VLO A;  2R7Z A;  1I3Q C;  2E2I K;  4PAA A;  3T02 A;  3FHZ A;  2WB1 D;  4KN4 A;  4A3D C;  1TWA A;  3BP3 A;  3Q3Q A;  3K7A K;  1TWG C;  5TMF A;  3S15 K;  4KMH A;  4YG2 A;  3G4A A;  5M3M K;  4KAT A;  3RZD C;  3GTM C;  4A3M C;  2YU9 K;  4AH6 A;  3S1N C;  2WB1 L;  4XCH A;  4O2D A;  5C4X K;  2JA5 K;  1ZBS A;  4BXX C;  2GSN A;  5IOR A;  1YNJ A;  3GTO A;  4OIO A;  2CW0 A;  2R92 K;  5IP9 K;  1WIH A;  4C45 A;  3FKI A;  4C3H C;  1GE9 A;  4KM9 A;  1I3Q K;  4LR2 A;  1ZQ1 C;  4A3G C;  4PAB A;  4XLP A;  1I50 C;  4A3D K;  4KMD A;  2Y3P A;  1TWG K;  5IYC C;  2NVT C;  3AQO A;  4ILD A;  1PJ6 A;  3RZD K;  3GTM K;  4A3M K;  3GTK C;  3S2D C;  2BE5 A;  3OPF A;  3CQZ C;  3S1N K;  2V6S A;  4G0W A;  3OEP A;  4G7H A;  2JA6 A;  4BXX K;  4KAW X;  5M5X K;  4LK1 A;  4LJZ A;  3BP8 C;  2B63 C;  3M3Y C;  2O5I A;  1HI9 A;  1UV7 A;  1WOO A;  3S1M C;  3GTP C;  5FLM C;  2V6T A;  4A3G K;  1XZQ A;  1J6X A;  3CAG A;  4ZH4 A;  3M4O C;  2GSO A;  1I50 K;  2WAQ D;  1R9T C;  1Y1W A;  2NVQ K;  1WOR A;  3FOE A;  5IYC K;  2NVT K;  3GDZ A;  4Y7N C;  1DCH A;  1K83 A;  1WQG A;  5EGH A;  3S2D K;  3GTK K;  5IP7 C;  4GTE A;  5IOS A;  1TWF A;  3CQZ K;  1O2F B;  2WAQ L;  1PJ5 A;  3GTJ C;  4KB2 A;  4A3B C;  3S2H C;  3HKZ D;  3GTL A;  4GTB A;  4M1X A;  1YCL A;  1Y1V C;  2B63 K;  3M3Y K;  3RZO K;  3S1M K;  3PO2 C;  3AD7 C;  2PMZ D;  4Y52 C;  3GTP K;  5FLM K;  3GEH A;  1JOE A;  1VRQ C;  1HQM A;  1ISE A;  1WSV A;  1SMY A;  5E68 A;  3M4O K;  1B4B A;  1R9T K;  4GZY A;  1SFO C;  2D6F C;  4A3E C;  1L0W A;  3I4M C;  5FJ8 K;  1WCM A;  1IQ0 A;  5M5W K;  2PMZ L;  4Y7N K;  1IBA A;  5IYB C;  2NVX A;  3H0G C;  1WQF A;  5IP7 K;  1IE0 A;  3HOU C;  2O5J A;  5C44 C;  1B4A A;  2RGR A;  3GEI A;  4KMA A;  3GTJ K;  4A3B K;  3S2H K;  1USO A;  2ZFZ A;  1BS2 A;  1O29 A;  4BLB A;  1EH1 A;  4RMF A;  1Y1V K;  3HXA A;  2R7Z C;  3PO2 K;  1C0A A;  2R93 A;  1DD5 A;  4Y52 K;  4KDD A;  3HOX C;  4GT9 A;  1TWA C;  4FM9 A;  1DCP A;  1J98 A;  1EQR A;  3PO3 C;  1XZQ B;  3MML B;  2ZUF A;  3JST A;  3GTQ A;  3V4G A;  4GTL A;  1SFO K;  4A3E K;  2E2H A;  3ERE D;  4LQY A;  3GEE A;  3I4M K;  1X31 C;  3ORE A;  1YX2 A;  5IYB K;  3S0X A;  3AD8 C;  5EGE A;  3H0G K;  1VGX A;  3HOU K;  2NVY A;  5C44 K;  2E2J C;  4A3F C;  3AQP A;  4A3L C;  3GTG C;  3GTO C;  5IOQ A;  3HOY C;  1EI6 A;  4DDQ A;  2NVQ C;  3FKI C;  3LAJ A;  4X6A C;  4QIW D;  2R7Z K;  3T01 A;  3BUE A;  2RH6 A;  4OIR A;  2JA7 A;  3DXJ A;  2VUM A;  1TWC A;  4WIL A;  3HOX K;  4JK1 A;  1TWA K;  3S1R C;  4BBR C;  4GFQ A;  3PO3 K;  1VH2 A;  4A3K C; 
#chains in the Genus database with same CATH homology
 4A3J C;  3S16 C;  5IYD C;  3S2D K;  5M3F K;  4QIW L;  3GTQ C;  3GTK K;  5IP7 C;  2E2H C;  5C4X C;  2JA5 C;  3CQZ K;  4MQ9 A;  3PO3 K;  1WCM K;  2JA8 C;  4A93 C;  4BY7 C;  2WAQ L;  4QJV B;  3GTJ C;  2PPB A;  1I6V A;  4AYB L;  4A3J K;  2NVX K;  3RZO C;  4A3B C;  1YNN A;  2R92 C;  3HKZ D;  3S2H C;  4LK0 A;  1TWH K;  5IP9 C;  2JA6 C;  4XSZ A;  2NVY C;  4XLN A;  4OIN A;  2E2J K;  3S17 C;  1Y1V C;  4A3F K;  1I3Q C;  2E2I K;  2B63 K;  3M3Y K;  4A3L K;  3GTG K;  2PA8 D;  3GTO K;  3RZO K;  4BY1 K;  3S1M K;  3PO2 C;  3S1Q C;  2PMZ D;  2A6E A;  2WB1 D;  4KN4 A;  4Y52 C;  3FKI K;  5FLM K;  3GTP K;  3HOY K;  3S14 C;  4OIP A;  4A3D C;  4X6A K;  3HOW C;  3K7A K;  1HQM A;  4BBS C;  1TWG C;  5TMF A;  1SMY A;  3S15 K;  3M4O K;  2JA7 C;  4YG2 A;  1IW7 A;  5M3M K;  2VUM C;  2R93 K;  3RZD C;  1R9T K;  1TWC C;  3GTM C;  4A3M C;  1Y1W C;  1SFO C;  5TMC A;  4A3E C;  3H3V D;  3S1R K;  2YU9 K;  4GZY A;  2PA8 L;  4BBR K;  3I4M C;  5FJ8 K;  1BDF A;  4MEY A;  5M5W K;  2PMZ L;  2WB1 L;  4QJV A;  4Y7N K;  4A3K K;  3S16 K;  5IYB C;  3S1N C;  5IYD K;  1K83 C;  5C3E C;  3GTQ K;  3HOZ C;  3H0G C;  5IP7 K;  5C4X K;  2E2H K;  2JA5 K;  3HOU C;  4BXX C;  1TWF C;  2O5J A;  5C44 C;  2JA8 K;  4A93 K;  4BY7 K;  1YNJ A;  3GTJ K;  3H3V L;  5M5Y K;  4A3I C;  4A3B K;  4OIO A;  2CW0 A;  4C3J K;  5D4D A;  2R92 K;  3S2H K;  5IP9 K;  2JA6 K;  3GTL C;  2NVY K;  3S17 K;  1Y1V K;  2A68 A;  3HKZ L;  1I3Q K;  2R7Z C;  1I6H C;  4YFX A;  4A3G C;  4XLP A;  3HOV C;  3PO2 K;  3S1Q K;  5C4J C;  1XPP A;  1I50 C;  4C2M K;  3S14 K;  4C3I K;  4Y52 K;  4A3D K;  3HOX C;  4YFN A;  4A3C C;  4C3H K;  2Y0S D;  3HOW K;  1TWA C;  4A3K C;  4BBS K;  1TWG K;  4MEX A;  3I4N C;  5IYC C;  2NVT C;  4G7Z A;  3PO3 C;  1ZYR A;  4LLG A;  2JA7 K;  4KMU A;  2VUM K;  3RZD K;  3GTM K;  1TWC K;  4A3M K;  1Y1W K;  4Q4Z A;  1SFO K;  4A3E K;  2BE5 A;  4OIQ A;  3GTK C;  3S2D C;  4Q5S A;  3CQZ C;  3I4M K;  1WCM C;  3S1N K;  5IYB K;  1K83 K;  5C3E K;  2Y0S L;  2NVX C;  3HOZ K;  2A6H A;  3H0G K;  4G7O A;  4G7H A;  1TWH C;  4YFK A;  3HOU K;  4BXX K;  1TWF K;  5M5X K;  4LK1 A;  4LJZ A;  5C44 K;  2E2J C;  4KN7 A;  4A3F C;  2E2I C;  3EQL A;  2B63 C;  4A3I K;  3M3Y C;  3GTG C;  4A3L C;  2O5I A;  3GTO C;  4BY1 C;  3S1M C;  3GTL K;  3GTP C;  3HOY C;  2NVQ C;  3FKI C;  5FLM C;  4X6A C;  3K7A C;  4QIW D;  2A69 A;  2R7Z K;  4XSX A;  1I6H K;  4A3G K;  3S15 C;  3HOV K;  4OIR A;  4ZH4 A;  5C4J K;  3M4O C;  1I50 K;  3DXJ A;  2R93 C;  2WAQ D;  3HOX K;  1R9T C;  4A3C K;  4JK1 A;  2NVQ K;  4AYB D;  1TWA K;  3S1R C;  2YU9 C;  3WOD A;  4BBR C;  3I4N K;  5IYC K;  2NVT K;  4Y7N C;  4NOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...