3HKZL

The x-ray crystal structure of rna polymerase from archaea
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit A'
total genus 18
structure length 92
sequence length 92
chains with identical sequence V
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hkzL00
5TMFA 3GTQK 4G7ZA 3RZDC 3S1QC 3HOXK 2JA8C 4YFKA 4A3CK 3GTQC 4YFXA 2PMZD 2R7ZK 2NVXC 2JA6K 3HOYK 1TWCK 4XSXA 5C4XC 4GZYA 4LK0A 4QIWD 4A3LK 5IYDK 4BXXC 5C4XK 1Y1VC 3GTLK 2R92K 1Y1WC 3GTOK 4QJVB 4BXXK 4A3DK 1Y1VK 1WCMK 1TWFC 4OIQA 3HOZC 1TWGC 1BDFA 3GTOC 3GTPC 3H3VD 1TWAC 4A3DC 5IYBK 1R9TC 3GTGK 4X6AC 1TWGK 3GTPK 3S2DC 1I6HC 1TWAK 2PMZL 3S14K 2Y0SL 3GTKK 5IYCC 1I6HK 5M5YK 1SFOC 2E2HK 4A3KC 5M5WK 3RZOK 4Y7NC 5IYCK 3HOVK 3S2HC 1ZYRA 4A3KK 4OIPA 1I3QK 1HQMA 4LLGA 5IP9K 2PA8D 4Y7NK 1XPPA 3HOVC 4YFNA 3S2HK 4BY7K 2O5IA 2CW0A 2A6EA 5IP9C 2NVYK 3PO3C 3S16C 4A93K 4BY7C 2A6HA 2B63K 4A3MC 2BE5A 2O5JA 2R93K 1IW7A 3H0GK 5IP7C 4A93C 3S1NK 4C3HK 2YU9K 2B63C 2NVQC 2Y0SD 4A3MK 2E2IC 3M3YC 3I4MC 3H0GC 5IP7K 3HOWK 4C2MK 4Y52C 2YU9C 2NVQK 3M3YK 2JA8K 4A3CC 3I4MK 4QJVA 4ZH4A 4XLPA 3H3VL 4G7OA 4KN4A 2NVXK 3HOYC 3I4NC 4C3IK 3PO2C 4A3IC 4AYBL 1TWHC 2JA7K 1YNJA 4BY1C 3I4NK 5M5XK 3GTMK 3S15K 1I50K 4QIWL 5IYDC 4OINA 2NVTC 3S17C 4LK1A 2R92C 4A3LC 1Y1WK 2VUMC 3GTMC 3S1MC 1I6VA 3M4OC 5M3MK 3S17K 3RZDK 1TWFK 5C44C 2A69A 3S1RK 2E2JK 5IYBC 1R9TK 4C3JK 4OIRA 3M4OK 5C44K 1K83K 3GTJK 4X6AK 3FKIC 3S1RC 2E2JC 2R7ZC 3S14C 2JA6C 1K83C 3GTJC 1SMYA 1TWCC 5C4JK 3FKIK 2JA5C 3DXJA 5C4JC 5FLMC 2VUMK 3GTLC 2PA8L 3EQLA 4KN7A 2JA5K 1I3QC 3WODA 4MEXA 5FLMK 4Q5SA 1WCMC 4LJZA 4MQ9A 4BBRK 5FJ8K 4KMUA 4AYBD 5M3FK 2WB1D 3HOZK 4JK1A 2WAQD 4Q4ZA 2NVYC 3HKZL 4G7HA 2PPBA 3GTGC 4BBRC 4A3BK 4YG2A 3PO2K 3S2DK 3S1NC 3K7AC 4A3JC 2A68A 4XSZA 4A3BC 5C3EK 3GTKC 3K7AK 4A3JK 2E2IK 5D4DA 1SFOK 2E2HC 3CQZC 5C3EC 3HOWC 4OIOA 4Y52K 3RZOC 3HOUK 1YNNA 3CQZK 4BBSK 2WB1L 3HKZD 3HOUC 2WAQL 4XLNA 4BBSC 4A3GK 4A3IK 3S16K 3PO3K 4A3EK 4A3FC 1TWHK 2JA7C 4BY1K 3S15C 4A3GC 1I50C 2NVTK 2R93C 5TMCA 4MEYA 4A3EC 4NOIA 4A3FK 3S1QK 3HOXC 3S1MK
chains in the Genus database with same CATH superfamily
4KARA 1YCLA 2EBBA 3RZDC 2XCOA 4KAWX 3HOXK 2JA8C 4BLBA 1TWCK 1VJEA 4LK0A 1TWGA 1TWAA 1Y1VC 4BXXK 1WCMK 4OIQA 1TWGC 1F7UA 1TWGK 3S2DC 3GEIA 3RZOK 1EK8A 1VLOA 2R93A 2FQOA 3S2HK 4YFNA 1J98A 5IP9C 5JVOA 2NVYK 2A6HA 2B63K 4A3MC 1WQGA 2O5JA 2R93K 5IP7C 2B63C 3TFHA 5IP7K 3HOWK 3GSIA 4C2MK 1I50A 1EH1A 4G7OA 4M1XA 4G0VA 1XZQB 2YU9A 4C3IK 2GAHC 4A3IC 3N3YA 2JA7K 3GTMK 4A3LC 4QIWL 5IYDC 4OINA 1Y1WK 1INNA 3GTMC 3RZDK 4OIRA 1XZPA 2R7ZC 1Y1WA 1SMYA 1TWCC 3AD7C 4AH6A 3OPFA 2JA5C 3DXJA 3GTLC 3EQLA 2JA5K 4WILA 3QX3A 4Q5SA 2E2IA 1WCMC 4LJZA 4MQ9A 2P5MA 4AYBD 4FM9A 2WAQD 2PPBA 3CQZA 1DCOA 3S2DK 4A3JC 2JA5A 3K7AK 4A3JK 2E2IK 4OIOA 3RZOC 3HOUK 5TJ3A 1BGWA 4GT9A 1YNNA 3CQZK 1XXBA 3T01A 4WJ4A 4BBSC 3S15C 1WOPA 1I50C 1HI9A 4A3EC 1USOA 2VUMK 3S0XA 3BUEA 2CFAA 4YFKA 5CJ9A 3BP8C 1O2FB 3HOYK 2VUMA 3TTGA 3GTPA 4WJ3M 4A3LK 5IYDK 4BXXC 1IS1A 3GTOK 4QJVB 4A3DK 1BDFA 3LPXA 3GTOC 3H3VD 4A3DC 3GTGK 3N0CA 4J3NA 4PAAA 3GTLA 3GTOA 2Y0SL 3GTKK 1I6HK 2ZFZA 1DD5A 2XCQA 4Y7NC 5IYCK 3S2HC 4O2DA 3LAJA 4Y7NK 5IP9K 1USMA 1VH2A 5L46A 3GTKA 2O5IA 3T00A 3S16C 4A93K 4G0UA 4GTBA 2BE5A 1IW7A 3H0GK 4A93C 2Y0SD 2E2IC 3OREA 3H0GC 2YU9C 2NVQK 3M3YK 4A3CC 4KASA 3I4MK 1WSVA 1O29A 4PABA 3H3VL 4C3IC 3H0GA 3FOEA 2JH3A 2NVXK 1TWFA 4P9SA 2RH6A 5IOQA 1ZXOA 3MMLB 4AYBL 2PHCB 3V4GA 4BY1C 3I4NK 1ZBSA 3NUHA 3S17C 2VUMC 2FQTA 3S17K 2NVXA 1TWFK 2A69A 3S1RK 5IYBC 1ZQ1C 1R9TK 4X6AK 5C44K 3IPJA 3S1RC 3BP3A 3ADAC 1WQHA 1O25A 5FLMC 5C4JC 4G0WA 4GTFA 4KATA 1I3QC 1AB4A 4KM9A 1B4BA 5FLMK 5FJ8K 4BBRK 5JFEA 1KQ4A 4LOWA 4RMFA 4Q4ZA 3HKZL 2P8TA 4BBRC 4YG2A 3PO2K 1WOSA 3K7AC 3A8KA 2A68A 4A3BC 5C3EK 4C3HC 3GTKC 5IOSA 3CQZC 5C3EC 4Y52K 1YX2A 5CHPA 3G4CA 4BBSK 1O26A 2WAQL 3S16K 4A3EK 1TWHK 2NVTK 1IL2A 2R93C 4MEYA 4A3FK 1L0WA 5TMFA 3GTQK 4G7ZA 4KMAA 4A3CK 3GTQC 3GDZA 1TWHA 4YFXA 1EI6A 4XCHA 2D6FC 2JA6K 4KC6A 4XSXA 1JOEA 1O27A 1WIHA 1Y1WC 1EQRA 1J6WA 3HOZC 1PJ6A 1TWAC 1O2AA 2V6TA 3AQOA 4X6AC 1UV7A 1I6HC 1TWAK 2Y3PA 3L4KA 5IYCC 2NVYA 1WCMA 5M5YK 5M5WK 3LAPA 3SZZA 2B63A 5E68A 1ZYRA 1VRQC 1B4AA 1I3QK 4GTDA 1HQMA 3L4JA 3HOVC 1IBAA 2KWAA 4BY7K 2GAGC 2A6EA 4BY7C 4GFQA 3S1NK 5EGHA 4C3HK 1I3QA 2YU9K 2NVQC 3M3YC 1G51A 3I4MC 3GTMA 4ILDA 1BJTA 4QJVA 4XLPA 3AD8C 4KN4A 1F7VA 3I4NC 2ZUFA 1YNJA 3S15K 5M5XK 4KMHA 1I50K 4LK1A 2R92C 1PJ5A 1I6VA 5M3MK 3SZYA 5C44C 3GIRA 1IE0A 3M4OK 2JA7A 4C3JK 1XZPB 3S14C 3HXAA 3N0BA 2JA6C 1F9NA 3A8JA 5C4JK 3FKIK 4BKWA 3A8IA 3T02A 2PA8L 3WODA 1O24A 4KMDA 4MEXA 2RGRA 2GSOA 3HOZK 3PO2C 1XZQA 5M3FK 2WB1D 4JK1A 3FKIA 2NVYC 1ISEA 3GTGC 4C45A 3FHZA 4A3BK 1ZVUA 1WQFA 4LQYA 4GTEA 5IORA 3HOWC 4C2MC 1DCPA 3GEEA 2V6UA 4KM8A 4KDDA 1VGXA 1DCHA 5EGEA 4A3FC 2JA7C 1XXAA 4A3GC 3AH5A 1RU0A 4GTCA 1O28A 4NOIA 3FOFA 3S1MK 4DDQA 3S1QC 3AQPA 2PMZD 2R7ZK 2NVXC 5C4XC 1F93A 3GTGA 4GZYA 4QIWD 5C4XK 3GTLK 2R92K 1V5VA 1Y1VK 2R7ZA 2E2HA 1TWFC 3GTPC 2GSUA 5IYBK 1R9TC 4C3JC 3GTPK 2PMZL 2ZUEA 3S14K 2R92A 1GE9A 4FZBA 4LR2A 5HL8A 1Y1VA 2GSNA 1SFOC 2E2HK 1WOOA 4A3KC 3Q3QA 3HOVK 4A3KK 4OIPA 4LLGA 2PA8D 1XPPA 2CFAB 3AD9C 2CW0A 3PO3C 1JQWA 3CAGA 4KB4A 4A3MK 4Y52C 4BLAA 1EFWA 2JA8K 4ZH4A 1J6VA 3HOYC 1TWHC 2NVTC 3ERED 3S1MC 3M4OC 3TFIA 3GEHA 1J6XA 3OEPA 2E2JK 1C0AA 3TFJA 1K83K 3GTJK 1JVIA 3FKIC 1O2BA 1IQ0A 2E2JC 1K83C 3GTJC 2W7VA 1R9TA 1WSRA 2XCRB 4KN7A 1K83A 3GTJA 3JSTA 1X31C 1SFOA 4GTAA 4KMUA 3VA7A 4G7HA 1WORA 4XSZA 2V6SA 4GTLA 5D4DA 1SFOK 2E2HC 4P5AA 5IOTA 2WB1L 3HKZD 3HOUC 3GTQA 4XLNA 4A3GK 1XXCA 3G4AA 4A3IK 3PO3K 1BS2A 4BY1K 1PJ7A 4P5BA 4KB2A 5TMCA 3S1NC 2JA6A 3S1QK 3HOXC 1TWCA
chains in the Genus database with same CATH topology
5TMFA 3GTQK 4G7ZA 3RZDC 3S1QC 3HOXK 2JA8C 4YFKA 4A3CK 3GTQC 4YFXA 2PMZD 2R7ZK 2NVXC 2JA6K 3HOYK 1TWCK 4XSXA 5C4XC 4GZYA 4LK0A 4QIWD 4A3LK 5IYDK 4BXXC 5C4XK 1Y1VC 3GTLK 2R92K 1Y1WC 3GTOK 4QJVB 4BXXK 4A3DK 1Y1VK 1WCMK 1TWFC 4OIQA 3HOZC 1TWGC 1BDFA 3GTOC 3GTPC 3H3VD 1TWAC 4A3DC 5IYBK 1R9TC 3GTGK 4X6AC 1TWGK 3GTPK 3S2DC 1I6HC 1TWAK 2PMZL 3S14K 2Y0SL 3GTKK 5IYCC 1I6HK 5M5YK 1SFOC 2E2HK 4A3KC 5M5WK 3RZOK 4Y7NC 5IYCK 3HOVK 3S2HC 1ZYRA 4A3KK 4OIPA 1I3QK 1HQMA 4LLGA 5IP9K 2PA8D 4Y7NK 1XPPA 3HOVC 4YFNA 3S2HK 4BY7K 2O5IA 2CW0A 2A6EA 5IP9C 2NVYK 3PO3C 3S16C 4A93K 4BY7C 2A6HA 2B63K 4A3MC 2BE5A 2O5JA 2R93K 1IW7A 3H0GK 5IP7C 4A93C 3S1NK 4C3HK 2YU9K 2B63C 2NVQC 2Y0SD 4A3MK 2E2IC 3M3YC 3I4MC 3H0GC 5IP7K 3HOWK 4C2MK 4Y52C 2YU9C 2NVQK 3M3YK 2JA8K 4A3CC 3I4MK 4QJVA 4ZH4A 4XLPA 3H3VL 4G7OA 4KN4A 2NVXK 3HOYC 3I4NC 4C3IK 3PO2C 4A3IC 4AYBL 1TWHC 2JA7K 1YNJA 4BY1C 3I4NK 5M5XK 3GTMK 3S15K 1I50K 4QIWL 5IYDC 4OINA 2NVTC 3S17C 4LK1A 2R92C 4A3LC 1Y1WK 2VUMC 3GTMC 3S1MC 1I6VA 3M4OC 5M3MK 3S17K 3RZDK 1TWFK 5C44C 2A69A 3S1RK 2E2JK 5IYBC 1R9TK 4C3JK 4OIRA 3M4OK 5C44K 1K83K 3GTJK 4X6AK 3FKIC 3S1RC 2E2JC 2R7ZC 3S14C 2JA6C 1K83C 3GTJC 1SMYA 1TWCC 5C4JK 3FKIK 2JA5C 3DXJA 5C4JC 5FLMC 2VUMK 3GTLC 2PA8L 3EQLA 4KN7A 2JA5K 1I3QC 3WODA 4MEXA 5FLMK 4Q5SA 1WCMC 4LJZA 4MQ9A 4BBRK 5FJ8K 4KMUA 4AYBD 5M3FK 2WB1D 3HOZK 4JK1A 2WAQD 4Q4ZA 2NVYC 3HKZL 4G7HA 2PPBA 3GTGC 4BBRC 4A3BK 4YG2A 3PO2K 3S2DK 3S1NC 3K7AC 4A3JC 2A68A 4XSZA 4A3BC 5C3EK 3GTKC 3K7AK 4A3JK 2E2IK 5D4DA 1SFOK 2E2HC 3CQZC 5C3EC 3HOWC 4OIOA 4Y52K 3RZOC 3HOUK 1YNNA 3CQZK 4BBSK 2WB1L 3HKZD 3HOUC 2WAQL 4XLNA 4BBSC 4A3GK 4A3IK 3S16K 3PO3K 4A3EK 4A3FC 1TWHK 2JA7C 4BY1K 3S15C 4A3GC 1I50C 2NVTK 2R93C 5TMCA 4MEYA 4A3EC 4NOIA 4A3FK 3S1QK 3HOXC 3S1MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TMF A;  3GTQ K;  4G7Z A;  3RZD C;  3S1Q C;  3HOX K;  2JA8 C;  4YFK A;  4A3C K;  3GTQ C;  4YFX A;  2PMZ D;  2R7Z K;  2NVX C;  2JA6 K;  3HOY K;  1TWC K;  4XSX A;  5C4X C;  4GZY A;  4LK0 A;  4QIW D;  4A3L K;  5IYD K;  4BXX C;  5C4X K;  1Y1V C;  3GTL K;  2R92 K;  1Y1W C;  3GTO K;  4QJV B;  4BXX K;  4A3D K;  1Y1V K;  1WCM K;  1TWF C;  4OIQ A;  3HOZ C;  1TWG C;  1BDF A;  3GTO C;  3GTP C;  3H3V D;  1TWA C;  4A3D C;  5IYB K;  1R9T C;  3GTG K;  4X6A C;  1TWG K;  3GTP K;  3S2D C;  1I6H C;  1TWA K;  2PMZ L;  3S14 K;  2Y0S L;  3GTK K;  5IYC C;  1I6H K;  5M5Y K;  1SFO C;  2E2H K;  4A3K C;  5M5W K;  3RZO K;  4Y7N C;  5IYC K;  3HOV K;  3S2H C;  1ZYR A;  4A3K K;  4OIP A;  1I3Q K;  1HQM A;  4LLG A;  5IP9 K;  2PA8 D;  4Y7N K;  1XPP A;  3HOV C;  4YFN A;  3S2H K;  4BY7 K;  2O5I A;  2CW0 A;  2A6E A;  5IP9 C;  2NVY K;  3PO3 C;  3S16 C;  4A93 K;  4BY7 C;  2A6H A;  2B63 K;  4A3M C;  2BE5 A;  2O5J A;  2R93 K;  1IW7 A;  3H0G K;  5IP7 C;  4A93 C;  3S1N K;  4C3H K;  2YU9 K;  2B63 C;  2NVQ C;  2Y0S D;  4A3M K;  2E2I C;  3M3Y C;  3I4M C;  3H0G C;  5IP7 K;  3HOW K;  4C2M K;  4Y52 C;  2YU9 C;  2NVQ K;  3M3Y K;  2JA8 K;  4A3C C;  3I4M K;  4QJV A;  4ZH4 A;  4XLP A;  3H3V L;  4G7O A;  4KN4 A;  2NVX K;  3HOY C;  3I4N C;  4C3I K;  3PO2 C;  4A3I C;  4AYB L;  1TWH C;  2JA7 K;  1YNJ A;  4BY1 C;  3I4N K;  5M5X K;  3GTM K;  3S15 K;  1I50 K;  4QIW L;  5IYD C;  4OIN A;  2NVT C;  3S17 C;  4LK1 A;  2R92 C;  4A3L C;  1Y1W K;  2VUM C;  3GTM C;  3S1M C;  1I6V A;  3M4O C;  5M3M K;  3S17 K;  3RZD K;  1TWF K;  5C44 C;  2A69 A;  3S1R K;  2E2J K;  5IYB C;  1R9T K;  4C3J K;  4OIR A;  3M4O K;  5C44 K;  1K83 K;  3GTJ K;  4X6A K;  3FKI C;  3S1R C;  2E2J C;  2R7Z C;  3S14 C;  2JA6 C;  1K83 C;  3GTJ C;  1SMY A;  1TWC C;  5C4J K;  3FKI K;  2JA5 C;  3DXJ A;  5C4J C;  5FLM C;  2VUM K;  3GTL C;  2PA8 L;  3EQL A;  4KN7 A;  2JA5 K;  1I3Q C;  3WOD A;  4MEX A;  5FLM K;  4Q5S A;  1WCM C;  4LJZ A;  4MQ9 A;  4BBR K;  5FJ8 K;  4KMU A;  4AYB D;  5M3F K;  2WB1 D;  3HOZ K;  4JK1 A;  2WAQ D;  4Q4Z A;  2NVY C;  3HKZ L;  4G7H A;  2PPB A;  3GTG C;  4BBR C;  4A3B K;  4YG2 A;  3PO2 K;  3S2D K;  3S1N C;  3K7A C;  4A3J C;  2A68 A;  4XSZ A;  4A3B C;  5C3E K;  3GTK C;  3K7A K;  4A3J K;  2E2I K;  5D4D A;  1SFO K;  2E2H C;  3CQZ C;  5C3E C;  3HOW C;  4OIO A;  4Y52 K;  3RZO C;  3HOU K;  1YNN A;  3CQZ K;  4BBS K;  2WB1 L;  3HKZ D;  3HOU C;  2WAQ L;  4XLN A;  4BBS C;  4A3G K;  4A3I K;  3S16 K;  3PO3 K;  4A3E K;  4A3F C;  1TWH K;  2JA7 C;  4BY1 K;  3S15 C;  4A3G C;  1I50 C;  2NVT K;  2R93 C;  5TMC A;  4MEY A;  4A3E C;  4NOI A;  4A3F K;  3S1Q K;  3HOX C;  3S1M K; 
#chains in the Genus database with same CATH topology
 4KAR A;  1YCL A;  2EBB A;  3RZD C;  2XCO A;  4KAW X;  3HOX K;  2JA8 C;  4BLB A;  1TWC K;  1VJE A;  4LK0 A;  1TWG A;  1TWA A;  1Y1V C;  4BXX K;  1WCM K;  4OIQ A;  1TWG C;  1F7U A;  1TWG K;  3S2D C;  3GEI A;  3RZO K;  1EK8 A;  1VLO A;  2R93 A;  2FQO A;  3S2H K;  4YFN A;  1J98 A;  5IP9 C;  5JVO A;  2NVY K;  2A6H A;  2B63 K;  4A3M C;  1WQG A;  2O5J A;  2R93 K;  5IP7 C;  2B63 C;  3TFH A;  5IP7 K;  3HOW K;  3GSI A;  4C2M K;  1I50 A;  1EH1 A;  4G7O A;  4M1X A;  4G0V A;  1XZQ B;  2YU9 A;  4C3I K;  2GAH C;  4A3I C;  3N3Y A;  2JA7 K;  3GTM K;  4A3L C;  4QIW L;  5IYD C;  4OIN A;  1Y1W K;  1INN A;  3GTM C;  3RZD K;  4OIR A;  1XZP A;  2R7Z C;  1Y1W A;  1SMY A;  1TWC C;  3AD7 C;  4AH6 A;  3OPF A;  2JA5 C;  3DXJ A;  3GTL C;  3EQL A;  2JA5 K;  4WIL A;  3QX3 A;  4Q5S A;  2E2I A;  1WCM C;  4LJZ A;  4MQ9 A;  2P5M A;  4AYB D;  4FM9 A;  2WAQ D;  2PPB A;  3CQZ A;  1DCO A;  3S2D K;  4A3J C;  2JA5 A;  3K7A K;  4A3J K;  2E2I K;  4OIO A;  3RZO C;  3HOU K;  5TJ3 A;  1BGW A;  4GT9 A;  1YNN A;  3CQZ K;  1XXB A;  3T01 A;  4WJ4 A;  4BBS C;  3S15 C;  1WOP A;  1I50 C;  1HI9 A;  4A3E C;  1USO A;  2VUM K;  3S0X A;  3BUE A;  2CFA A;  4YFK A;  5CJ9 A;  3BP8 C;  1O2F B;  3HOY K;  2VUM A;  3TTG A;  3GTP A;  4WJ3 M;  4A3L K;  5IYD K;  4BXX C;  1IS1 A;  3GTO K;  4QJV B;  4A3D K;  1BDF A;  3LPX A;  3GTO C;  3H3V D;  4A3D C;  3GTG K;  3N0C A;  4J3N A;  4PAA A;  3GTL A;  3GTO A;  2Y0S L;  3GTK K;  1I6H K;  2ZFZ A;  1DD5 A;  2XCQ A;  4Y7N C;  5IYC K;  3S2H C;  4O2D A;  3LAJ A;  4Y7N K;  5IP9 K;  1USM A;  1VH2 A;  5L46 A;  3GTK A;  2O5I A;  3T00 A;  3S16 C;  4A93 K;  4G0U A;  4GTB A;  2BE5 A;  1IW7 A;  3H0G K;  4A93 C;  2Y0S D;  2E2I C;  3ORE A;  3H0G C;  2YU9 C;  2NVQ K;  3M3Y K;  4A3C C;  4KAS A;  3I4M K;  1WSV A;  1O29 A;  4PAB A;  3H3V L;  4C3I C;  3H0G A;  3FOE A;  2JH3 A;  2NVX K;  1TWF A;  4P9S A;  2RH6 A;  5IOQ A;  1ZXO A;  3MML B;  4AYB L;  2PHC B;  3V4G A;  4BY1 C;  3I4N K;  1ZBS A;  3NUH A;  3S17 C;  2VUM C;  2FQT A;  3S17 K;  2NVX A;  1TWF K;  2A69 A;  3S1R K;  5IYB C;  1ZQ1 C;  1R9T K;  4X6A K;  5C44 K;  3IPJ A;  3S1R C;  3BP3 A;  3ADA C;  1WQH A;  1O25 A;  5FLM C;  5C4J C;  4G0W A;  4GTF A;  4KAT A;  1I3Q C;  1AB4 A;  4KM9 A;  1B4B A;  5FLM K;  5FJ8 K;  4BBR K;  5JFE A;  1KQ4 A;  4LOW A;  4RMF A;  4Q4Z A;  3HKZ L;  2P8T A;  4BBR C;  4YG2 A;  3PO2 K;  1WOS A;  3K7A C;  3A8K A;  2A68 A;  4A3B C;  5C3E K;  4C3H C;  3GTK C;  5IOS A;  3CQZ C;  5C3E C;  4Y52 K;  1YX2 A;  5CHP A;  3G4C A;  4BBS K;  1O26 A;  2WAQ L;  3S16 K;  4A3E K;  1TWH K;  2NVT K;  1IL2 A;  2R93 C;  4MEY A;  4A3F K;  1L0W A;  5TMF A;  3GTQ K;  4G7Z A;  4KMA A;  4A3C K;  3GTQ C;  3GDZ A;  1TWH A;  4YFX A;  1EI6 A;  4XCH A;  2D6F C;  2JA6 K;  4KC6 A;  4XSX A;  1JOE A;  1O27 A;  1WIH A;  1Y1W C;  1EQR A;  1J6W A;  3HOZ C;  1PJ6 A;  1TWA C;  1O2A A;  2V6T A;  3AQO A;  4X6A C;  1UV7 A;  1I6H C;  1TWA K;  2Y3P A;  3L4K A;  5IYC C;  2NVY A;  1WCM A;  5M5Y K;  5M5W K;  3LAP A;  3SZZ A;  2B63 A;  5E68 A;  1ZYR A;  1VRQ C;  1B4A A;  1I3Q K;  4GTD A;  1HQM A;  3L4J A;  3HOV C;  1IBA A;  2KWA A;  4BY7 K;  2GAG C;  2A6E A;  4BY7 C;  4GFQ A;  3S1N K;  5EGH A;  4C3H K;  1I3Q A;  2YU9 K;  2NVQ C;  3M3Y C;  1G51 A;  3I4M C;  3GTM A;  4ILD A;  1BJT A;  4QJV A;  4XLP A;  3AD8 C;  4KN4 A;  1F7V A;  3I4N C;  2ZUF A;  1YNJ A;  3S15 K;  5M5X K;  4KMH A;  1I50 K;  4LK1 A;  2R92 C;  1PJ5 A;  1I6V A;  5M3M K;  3SZY A;  5C44 C;  3GIR A;  1IE0 A;  3M4O K;  2JA7 A;  4C3J K;  1XZP B;  3S14 C;  3HXA A;  3N0B A;  2JA6 C;  1F9N A;  3A8J A;  5C4J K;  3FKI K;  4BKW A;  3A8I A;  3T02 A;  2PA8 L;  3WOD A;  1O24 A;  4KMD A;  4MEX A;  2RGR A;  2GSO A;  3HOZ K;  3PO2 C;  1XZQ A;  5M3F K;  2WB1 D;  4JK1 A;  3FKI A;  2NVY C;  1ISE A;  3GTG C;  4C45 A;  3FHZ A;  4A3B K;  1ZVU A;  1WQF A;  4LQY A;  4GTE A;  5IOR A;  3HOW C;  4C2M C;  1DCP A;  3GEE A;  2V6U A;  4KM8 A;  4KDD A;  1VGX A;  1DCH A;  5EGE A;  4A3F C;  2JA7 C;  1XXA A;  4A3G C;  3AH5 A;  1RU0 A;  4GTC A;  1O28 A;  4NOI A;  3FOF A;  3S1M K;  4DDQ A;  3S1Q C;  3AQP A;  2PMZ D;  2R7Z K;  2NVX C;  5C4X C;  1F93 A;  3GTG A;  4GZY A;  4QIW D;  5C4X K;  3GTL K;  2R92 K;  1V5V A;  1Y1V K;  2R7Z A;  2E2H A;  1TWF C;  3GTP C;  2GSU A;  5IYB K;  1R9T C;  4C3J C;  3GTP K;  2PMZ L;  2ZUE A;  3S14 K;  2R92 A;  1GE9 A;  4FZB A;  4LR2 A;  5HL8 A;  1Y1V A;  2GSN A;  1SFO C;  2E2H K;  1WOO A;  4A3K C;  3Q3Q A;  3HOV K;  4A3K K;  4OIP A;  4LLG A;  2PA8 D;  1XPP A;  2CFA B;  3AD9 C;  2CW0 A;  3PO3 C;  1JQW A;  3CAG A;  4KB4 A;  4A3M K;  4Y52 C;  4BLA A;  1EFW A;  2JA8 K;  4ZH4 A;  1J6V A;  3HOY C;  1TWH C;  2NVT C;  3ERE D;  3S1M C;  3M4O C;  3TFI A;  3GEH A;  1J6X A;  3OEP A;  2E2J K;  1C0A A;  3TFJ A;  1K83 K;  3GTJ K;  1JVI A;  3FKI C;  1O2B A;  1IQ0 A;  2E2J C;  1K83 C;  3GTJ C;  2W7V A;  1R9T A;  1WSR A;  2XCR B;  4KN7 A;  1K83 A;  3GTJ A;  3JST A;  1X31 C;  1SFO A;  4GTA A;  4KMU A;  3VA7 A;  4G7H A;  1WOR A;  4XSZ A;  2V6S A;  4GTL A;  5D4D A;  1SFO K;  2E2H C;  4P5A A;  5IOT A;  2WB1 L;  3HKZ D;  3HOU C;  3GTQ A;  4XLN A;  4A3G K;  1XXC A;  3G4A A;  4A3I K;  3PO3 K;  1BS2 A;  4BY1 K;  1PJ7 A;  4P5B A;  4KB2 A;  5TMC A;  3S1N C;  2JA6 A;  3S1Q K;  3HOX C;  1TWC A; 
#chains in the Genus database with same CATH homology
 5TMF A;  3GTQ K;  4G7Z A;  3RZD C;  3S1Q C;  3HOX K;  2JA8 C;  4YFK A;  4A3C K;  3GTQ C;  4YFX A;  2PMZ D;  2R7Z K;  2NVX C;  2JA6 K;  3HOY K;  1TWC K;  4XSX A;  5C4X C;  4GZY A;  4LK0 A;  4QIW D;  4A3L K;  5IYD K;  4BXX C;  5C4X K;  1Y1V C;  3GTL K;  2R92 K;  1Y1W C;  3GTO K;  4QJV B;  4BXX K;  4A3D K;  1Y1V K;  1WCM K;  1TWF C;  4OIQ A;  3HOZ C;  1TWG C;  1BDF A;  3GTO C;  3GTP C;  3H3V D;  1TWA C;  4A3D C;  5IYB K;  1R9T C;  3GTG K;  4X6A C;  1TWG K;  3GTP K;  3S2D C;  1I6H C;  1TWA K;  2PMZ L;  3S14 K;  2Y0S L;  3GTK K;  5IYC C;  1I6H K;  5M5Y K;  1SFO C;  2E2H K;  4A3K C;  5M5W K;  3RZO K;  4Y7N C;  5IYC K;  3HOV K;  3S2H C;  1ZYR A;  4A3K K;  4OIP A;  1I3Q K;  1HQM A;  4LLG A;  5IP9 K;  2PA8 D;  4Y7N K;  1XPP A;  3HOV C;  4YFN A;  3S2H K;  4BY7 K;  2O5I A;  2CW0 A;  2A6E A;  5IP9 C;  2NVY K;  3PO3 C;  3S16 C;  4A93 K;  4BY7 C;  2A6H A;  2B63 K;  4A3M C;  2BE5 A;  2O5J A;  2R93 K;  1IW7 A;  3H0G K;  5IP7 C;  4A93 C;  3S1N K;  4C3H K;  2YU9 K;  2B63 C;  2NVQ C;  2Y0S D;  4A3M K;  2E2I C;  3M3Y C;  3I4M C;  3H0G C;  5IP7 K;  3HOW K;  4C2M K;  4Y52 C;  2YU9 C;  2NVQ K;  3M3Y K;  2JA8 K;  4A3C C;  3I4M K;  4QJV A;  4ZH4 A;  4XLP A;  3H3V L;  4G7O A;  4KN4 A;  2NVX K;  3HOY C;  3I4N C;  4C3I K;  3PO2 C;  4A3I C;  4AYB L;  1TWH C;  2JA7 K;  1YNJ A;  4BY1 C;  3I4N K;  5M5X K;  3GTM K;  3S15 K;  1I50 K;  4QIW L;  5IYD C;  4OIN A;  2NVT C;  3S17 C;  4LK1 A;  2R92 C;  4A3L C;  1Y1W K;  2VUM C;  3GTM C;  3S1M C;  1I6V A;  3M4O C;  5M3M K;  3S17 K;  3RZD K;  1TWF K;  5C44 C;  2A69 A;  3S1R K;  2E2J K;  5IYB C;  1R9T K;  4C3J K;  4OIR A;  3M4O K;  5C44 K;  1K83 K;  3GTJ K;  4X6A K;  3FKI C;  3S1R C;  2E2J C;  2R7Z C;  3S14 C;  2JA6 C;  1K83 C;  3GTJ C;  1SMY A;  1TWC C;  5C4J K;  3FKI K;  2JA5 C;  3DXJ A;  5C4J C;  5FLM C;  2VUM K;  3GTL C;  2PA8 L;  3EQL A;  4KN7 A;  2JA5 K;  1I3Q C;  3WOD A;  4MEX A;  5FLM K;  4Q5S A;  1WCM C;  4LJZ A;  4MQ9 A;  4BBR K;  5FJ8 K;  4KMU A;  4AYB D;  5M3F K;  2WB1 D;  3HOZ K;  4JK1 A;  2WAQ D;  4Q4Z A;  2NVY C;  3HKZ L;  4G7H A;  2PPB A;  3GTG C;  4BBR C;  4A3B K;  4YG2 A;  3PO2 K;  3S2D K;  3S1N C;  3K7A C;  4A3J C;  2A68 A;  4XSZ A;  4A3B C;  5C3E K;  3GTK C;  3K7A K;  4A3J K;  2E2I K;  5D4D A;  1SFO K;  2E2H C;  3CQZ C;  5C3E C;  3HOW C;  4OIO A;  4Y52 K;  3RZO C;  3HOU K;  1YNN A;  3CQZ K;  4BBS K;  2WB1 L;  3HKZ D;  3HOU C;  2WAQ L;  4XLN A;  4BBS C;  4A3G K;  4A3I K;  3S16 K;  3PO3 K;  4A3E K;  4A3F C;  1TWH K;  2JA7 C;  4BY1 K;  3S15 C;  4A3G C;  1I50 C;  2NVT K;  2R93 C;  5TMC A;  4MEY A;  4A3E C;  4NOI A;  4A3F K;  3S1Q K;  3HOX C;  3S1M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...