3HKZL

The x-ray crystal structure of rna polymerase from archaea
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
total genus 18
structure length 92
sequence length 92
chains with identical sequence V
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hkzL00
2BE5A 4AYBL 3HOVC 4GZYA 1TWFC 3GTLK 4XSZA 2B63K 3HOWC 3S15K 1Y1WK 3S1NC 4Q4ZA 2PMZL 1SFOC 3HKZL 3RZOC 3S14K 4BXXK 5IYBC 4YFNA 4AYBD 4C3JK 3HOXK 4A3FC 3GTQK 1K83K 3GTMK 3S1MK 3M4OC 2JA7K 4QJVA 4C2MK 4A3GK 1WCMK 2NVYK 2WB1L 2PMZD 5IP7K 2E2HC 3HKZD 3HOUK 4G7ZA 2VUMC 1I6HK 4A3JK 3H0GK 4QJVB 1R9TK 4LJZA 5M3MK 3H3VL 3S2HC 5M3FK 4A3IK 2E2IK 2JA5C 4MEYA 2NVXC 2A69A 5IYDK 2WB1D 3K7AK 4YFXA 3GTJC 3FKIK 4BY7C 4BBSC 4KMUA 5TMFA 4LLGA 3HOYC 3PO2K 4A93C 4A3LC 3GTPC 1TWAC 3H3VD 2E2JK 1TWCC 4A3EK 2NVTC 1ZYRA 2R92K 4G7HA 4A3CC 2O5JA 3HOZK 3GTGC 4A3DK 4YG2A 5IP9K 1HQMA 1SMYA 1Y1VK 3GTKK 1BDFA 4KN4A 2WAQL 1Y1WC 1YNJA 5IYCK 4BY1C 2O5IA 4X6AK 5C4XC 2JA6K 3I4NC 5FLMK 2JA7C 3S16K 2WAQD 2NVYC 4A3MC 2Y0SL 2JA8C 3HOUC 3RZDC 1TWHC 4A3BC 3CQZC 1I3QC 2YU9C 4OIRA 3S2DK 3S17C 4ZH4A 2NVQC 2E2IC 3S1RK 1TWGC 5D4DA 2R7ZC 3GTOK 4Y52C 3S1QC 2Y0SD 5C44C 4YFKA 3I4MK 4XLPA 1I50C 3PO2C 4Q5SA 4KN7A 4Y7NK 2A6HA 5C4JK 2E2HK 3M3YC 4A3KC 1IW7A 3HOVK 2PA8L 1TWFK 4BBRC 3PO3C 3HOWK 2R93C 3S1NK 1SFOK 3DXJA 3RZOK 3GTLC 2CW0A 5TMCA 5IYBK 4A3FK 2B63C 3S15C 3M4OK 2PA8D 3WODA 4G7OA 3S14C 4BXXC 3HOXC 4QIWL 3GTQC 3S1MC 3GTMC 1K83C 2VUMK 4A3GC 1WCMC 3S2HK 5IP7C 2NVXK 5FJ8K 2JA5K 1I6HC 4A3JC 3H0GC 4QIWD 3GTJK 1R9TC 4BBSK 4XSXA 4OIQA 4BY7K 3HOYK 4A3IC 5IYDC 2PPBA 4A93K 4MQ9A 4A3LK 3GTPK 1TWAK 3K7AC 4C3HK 3FKIC 1TWCK 4LK0A 2NVTK 4A3CK 2A68A 5C3EK 4NOIA 4MEXA 3GTGK 1I6VA 4OINA 2E2JC 4A3EC 2R92C 4JK1A 3HOZC 4A3DC 5IP9C 4OIOA 4BY1K 1Y1VC 3GTKC 5C4XK 3I4NK 5M5YK 4C3IK 5IYCC 4X6AC 5M5WK 3EQLA 4XLNA 4A3MK 2JA8K 2JA6C 5M5XK 5FLMC 1TWHK 3RZDK 3CQZK 3S16C 4A3BK 1I3QK 1YNNA 2YU9K 3S17K 2NVQK 2R7ZK 1TWGK 4Y52K 3S1QK 4OIPA 5C44K 3S2DC 1I50K 3GTOC 3S1RC 1XPPA 2A6EA 4A3KK 3M3YK 3I4MC 4LK1A 4BBRK 3PO3K 5C3EC 4Y7NC 2R93K 5C4JC
chains in the Genus database with same CATH superfamily
2BE5A 4AYBL 1JOEA 3GTLK 3GTJA 3S15K 1Y1WK 2CFAB 3RZOC 4BXXK 4YFNA 4C3JK 3T00A 4A3GK 1WCMK 2NVYK 1IE0A 2WB1L 3HOUK 1O28A 1O25A 4G7ZA 4A3JK 1YX2A 4LJZA 2GAHC 5M3MK 3H3VL 2E2IK 2NVXC 2JA5C 1PJ6A 3N3YA 4YFXA 4BY7C 1DCPA 1TWHA 2E2JK 1I3QA 2YU9A 1O24A 1TWGA 2EBBA 1Y1WC 1WOPA 2WAQL 1I50A 5IYCK 4BY1C 2O5IA 5C4XC 1O29A 1TWAA 5JFEA 2JA6K 1BS2A 3G4CA 2NVYC 4A3MC 1JVIA 3HOUC 3RZDC 3CQZC 4OIRA 3ADAC 1DCHA 3S2DK 2NVQC 2E2IC 3S1RK 5D4DA 3AH5A 3OEPA 2P8TA 1F93A 5C44C 1K83A 2JA7A 3BP3A 3M3YC 1R9TA 3HOWK 3TFIA 3S1NK 1SFOK 2B63C 5IYBK 4G7OA 3GSIA 5CJ9A 4G0UA 3GTQC 3S1MC 4KAWX 2PHCB 1Y1VA 3H0GC 4A3IC 2V6TA 4MQ9A 4A3LK 3GTPK 1TWAK 3OREA 3FKIC 4KB2A 1TWCK 4LK0A 4KMHA 2R92C 3FOFA 3CAGA 1WORA 3GTOA 4FM9A 4A3DC 1F7UA 1INNA 4X6AC 2ZUFA 3MMLB 2RH6A 3S16C 4A3BK 4KM9A 2R7ZK 4KB4A 4KATA 3LAPA 5IOSA 1WOSA 4BBRK 2E2HC 2FQOA 1WQHA 3HOVC 2NVXA 2JA5A 2CFAA 1BGWA 1TWFC 2GSOA 4XSZA 1AB4A 4Q4ZA 2PMZL 3IPJA 3HKZL 3S14K 1ZXOA 4A3FC 3GDZA 3M4OC 3GTMK 2RGRA 2D6FC 1WOOA 1I6HK 1HI9A 4QJVB 3S2HC 4LLGA 2FQTA 3T02A 1WSVA 3SZZA 1RU0A 3CQZA 1ZYRA 3A8IA 4LQYA 3GTGC 4YG2A 1HQMA 1SMYA 3GTKK 1BDFA 1ZBSA 5FLMK 2Y0SL 3LPXA 4P9SA 1WIHA 4BLBA 2B63A 1JQWA 4GTAA 3S17C 4Y52C 1KQ4A 4YFKA 3GTQA 2ZFZA 4KN7A 4RMFA 2A6HA 4Y7NK 5C4JK 1YCLA 4A3KC 4GTCA 3H0GA 3PO3C 2XCQA 2R93C 1UV7A 1VJEA 1IL2A 2V6SA 1DCOA 3GTLC 5TMCA 3FKIA 3BUEA 3S15C 2PA8D 4BXXC 1O27A 4C3JC 2R92A 5CHPA 2VUMK 4A3GC 1WCMC 5FJ8K 1DD5A 4A3JC 4QIWD 3GTJK 4BBSK 1USOA 2GAGC 3HOYK 2PPBA 4A93K 4C3HK 1EK8A 1G51A 2P5MA 2NVTK 4A3CK 3HXAA 1XXBA 2E2JC 4JK1A 4PABA 4G0WA 1VRQC 3I4NK 2GSNA 4BKWA 5HL8A 4C3IK 5IYCC 2E2HA 3TFHA 3EQLA 2JA6C 2JA8K 1TWFA 1TWHK 1I3QK 2YU9K 4GT9A 2ZUEA 1TWGK 3AD7C 3S1QK 4OIPA 3S2DC 1I50K 3S1RC 1XXAA 4LK1A 3Q3QA 3A8JA 3GEIA 4WILA 1ZQ1C 3HOWC 3T01A 3S1NC 1SFOC 2W7VA 1X31C 5IOTA 5L46A 5IYBC 4AYBD 3HOXK 1K83K 1O2FB 4C3IC 2JA7K 4QJVA 4C2MK 3GTGA 5IP7K 1R9TK 5M3FK 5IYDK 2XCRB 2WB1D 3K7AK 2GSUA 5TMFA 3SZYA 3PO2K 4A3LC 3GTPC 1TWAC 3H3VD 3GIRA 1TWCC 4A3EK 2O5JA 3HOZK 3V4GA 5IP9K 1USMA 1WQFA 1Y1VK 4KN4A 1BJTA 1J6VA 1YNJA 4LR2A 2JA7C 2R93A 2WAQD 4A3BC 3GTLA 3L4KA 1Y1WA 2R7ZC 3GTOK 3ERED 4O2DA 3I4MK 3AD9C 3PO2C 4Q5SA 1WCMA 2NVYA 3N0BA 4P5BA 1IW7A 4BBRC 2E2IA 3DXJA 4GTLA 3RZOK 3WODA 5C3EC 3S14C 1PJ5A 3GTMC 5JVOA 1VGXA 2NVXK 2JA5K 1I6HC 4GTBA 1EFWA 4BY7K 4OIQA 2Y3PA 4GTEA 3TFJA 4J3NA 3N0CA 2JA6A 1WQGA 5E68A 5IOQA 2V6UA 1J98A 2JH3A 4MEXA 1B4AA 4LOWA 1XZPB 4BY1K 3GTKC 5C4XK 4KASA 2XCOA 1F9NA 5M5WK 4A3MK 4KC6A 5M5XK 5EGHA 5FLMC 3RZDK 3CQZK 1GE9A 1YNNA 3FOEA 1SFOA 2NVQK 4XCHA 5C44K 4BLAA 3QX3A 1C0AA 1ISEA 1XPPA 3M3YK 3A8KA 4Y7NC 5C4JC 4GZYA 4KDDA 1XZQB 2B63K 1WSRA 3GTPA 3GTQK 3S1MK 1TWCA 1IS1A 4M1XA 3L4JA 2PMZD 3HKZD 2VUMC 3H0GK 1EQRA 4A3IK 4MEYA 2A69A 4DDQA 5IORA 3GTJC 4BBSC 3FKIK 4G0VA 4KMUA 3HOYC 4A93C 4C3HC 1VH2A 2NVTC 2R92K 4A3CC 4G7HA 2R7ZA 4A3DK 5EGEA 1O26A 1B4BA 4KMAA 4GTDA 4GTFA 3FHZA 3G4AA 4X6AK 1V5VA 3I4NC 3S16K 3AQOA 3GEEA 3S0XA 2JA8C 3NUHA 1TWHC 1I3QC 3BP8C 2YU9C 4ZH4A 1TWGC 3VA7A 3S1QC 2Y0SD 3GTMA 4XLPA 1I50C 2E2HK 4KM8A 3HOVK 2PA8L 1TWFK 2KWAA 3JSTA 1EI6A 1J6WA 2CW0A 1O2AA 4A3FK 3M4OK 1J6XA 3AD8C 4P5AA 3OPFA 5TJ3A 3HOXC 1EH1A 4QIWL 1ZVUA 1IQ0A 1K83C 3AQPA 4C2MC 3S2HK 5IP7C 3GTKA 1R9TC 4XSXA 3LAJA 5IYDC 4PAAA 1IBAA 3K7AC 4KARA 2A68A 5C3EK 4NOIA 1XZPA 1O2BA 3GTGK 1I6VA 1L0WA 4OINA 4A3EC 3HOZC 5IP9C 4OIOA 1Y1VC 1VLOA 1XXCA 4FZBA 4AH6A 5M5YK 4XLNA 4KMDA 4C45A 4ILDA 3S17K 4Y52K 1PJ7A 4WJ4A 3GTOC 4WJ3M 1F7VA 2A6EA 4A3KK 3I4MC 3GEHA 2VUMA 3PO3K 1XZQA 3TTGA 2R93K 4GFQA
chains in the Genus database with same CATH topology
2BE5A 4AYBL 3HOVC 4GZYA 1TWFC 3GTLK 4XSZA 2B63K 3HOWC 3S15K 1Y1WK 3S1NC 4Q4ZA 2PMZL 1SFOC 3HKZL 3RZOC 3S14K 4BXXK 5IYBC 4YFNA 4AYBD 4C3JK 3HOXK 4A3FC 3GTQK 1K83K 3GTMK 3S1MK 3M4OC 2JA7K 4QJVA 4C2MK 4A3GK 1WCMK 2NVYK 2WB1L 2PMZD 5IP7K 2E2HC 3HKZD 3HOUK 4G7ZA 2VUMC 1I6HK 4A3JK 3H0GK 4QJVB 1R9TK 4LJZA 5M3MK 3H3VL 3S2HC 5M3FK 4A3IK 2E2IK 2JA5C 4MEYA 2NVXC 2A69A 5IYDK 2WB1D 3K7AK 4YFXA 3GTJC 3FKIK 4BY7C 4BBSC 4KMUA 5TMFA 4LLGA 3HOYC 3PO2K 4A93C 4A3LC 3GTPC 1TWAC 3H3VD 2E2JK 1TWCC 4A3EK 2NVTC 1ZYRA 2R92K 4G7HA 4A3CC 2O5JA 3HOZK 3GTGC 4A3DK 4YG2A 5IP9K 1HQMA 1SMYA 1Y1VK 3GTKK 1BDFA 4KN4A 2WAQL 1Y1WC 1YNJA 5IYCK 4BY1C 2O5IA 4X6AK 5C4XC 2JA6K 3I4NC 5FLMK 2JA7C 3S16K 2WAQD 2NVYC 4A3MC 2Y0SL 2JA8C 3HOUC 3RZDC 1TWHC 4A3BC 3CQZC 1I3QC 2YU9C 4OIRA 3S2DK 3S17C 4ZH4A 2NVQC 2E2IC 3S1RK 1TWGC 5D4DA 2R7ZC 3GTOK 4Y52C 3S1QC 2Y0SD 5C44C 4YFKA 3I4MK 4XLPA 1I50C 3PO2C 4Q5SA 4KN7A 4Y7NK 2A6HA 5C4JK 2E2HK 3M3YC 4A3KC 1IW7A 3HOVK 2PA8L 1TWFK 4BBRC 3PO3C 3HOWK 2R93C 3S1NK 1SFOK 3DXJA 3RZOK 3GTLC 2CW0A 5TMCA 5IYBK 4A3FK 2B63C 3S15C 3M4OK 2PA8D 3WODA 4G7OA 3S14C 4BXXC 3HOXC 4QIWL 3GTQC 3S1MC 3GTMC 1K83C 2VUMK 4A3GC 1WCMC 3S2HK 5IP7C 2NVXK 5FJ8K 2JA5K 1I6HC 4A3JC 3H0GC 4QIWD 3GTJK 1R9TC 4BBSK 4XSXA 4OIQA 4BY7K 3HOYK 4A3IC 5IYDC 2PPBA 4A93K 4MQ9A 4A3LK 3GTPK 1TWAK 3K7AC 4C3HK 3FKIC 1TWCK 4LK0A 2NVTK 4A3CK 2A68A 5C3EK 4NOIA 4MEXA 3GTGK 1I6VA 4OINA 2E2JC 4A3EC 2R92C 4JK1A 3HOZC 4A3DC 5IP9C 4OIOA 4BY1K 1Y1VC 3GTKC 5C4XK 3I4NK 5M5YK 4C3IK 5IYCC 4X6AC 5M5WK 3EQLA 4XLNA 4A3MK 2JA8K 2JA6C 5M5XK 5FLMC 1TWHK 3RZDK 3CQZK 3S16C 4A3BK 1I3QK 1YNNA 2YU9K 3S17K 2NVQK 2R7ZK 1TWGK 4Y52K 3S1QK 4OIPA 5C44K 3S2DC 1I50K 3GTOC 3S1RC 1XPPA 2A6EA 4A3KK 3M3YK 3I4MC 4LK1A 4BBRK 3PO3K 5C3EC 4Y7NC 2R93K 5C4JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE5 A;  4AYB L;  3HOV C;  4GZY A;  1TWF C;  3GTL K;  4XSZ A;  2B63 K;  3HOW C;  3S15 K;  1Y1W K;  3S1N C;  4Q4Z A;  2PMZ L;  1SFO C;  3HKZ L;  3RZO C;  3S14 K;  4BXX K;  5IYB C;  4YFN A;  4AYB D;  4C3J K;  3HOX K;  4A3F C;  3GTQ K;  1K83 K;  3GTM K;  3S1M K;  3M4O C;  2JA7 K;  4QJV A;  4C2M K;  4A3G K;  1WCM K;  2NVY K;  2WB1 L;  2PMZ D;  5IP7 K;  2E2H C;  3HKZ D;  3HOU K;  4G7Z A;  2VUM C;  1I6H K;  4A3J K;  3H0G K;  4QJV B;  1R9T K;  4LJZ A;  5M3M K;  3H3V L;  3S2H C;  5M3F K;  4A3I K;  2E2I K;  2JA5 C;  4MEY A;  2NVX C;  2A69 A;  5IYD K;  2WB1 D;  3K7A K;  4YFX A;  3GTJ C;  3FKI K;  4BY7 C;  4BBS C;  4KMU A;  5TMF A;  4LLG A;  3HOY C;  3PO2 K;  4A93 C;  4A3L C;  3GTP C;  1TWA C;  3H3V D;  2E2J K;  1TWC C;  4A3E K;  2NVT C;  1ZYR A;  2R92 K;  4G7H A;  4A3C C;  2O5J A;  3HOZ K;  3GTG C;  4A3D K;  4YG2 A;  5IP9 K;  1HQM A;  1SMY A;  1Y1V K;  3GTK K;  1BDF A;  4KN4 A;  2WAQ L;  1Y1W C;  1YNJ A;  5IYC K;  4BY1 C;  2O5I A;  4X6A K;  5C4X C;  2JA6 K;  3I4N C;  5FLM K;  2JA7 C;  3S16 K;  2WAQ D;  2NVY C;  4A3M C;  2Y0S L;  2JA8 C;  3HOU C;  3RZD C;  1TWH C;  4A3B C;  3CQZ C;  1I3Q C;  2YU9 C;  4OIR A;  3S2D K;  3S17 C;  4ZH4 A;  2NVQ C;  2E2I C;  3S1R K;  1TWG C;  5D4D A;  2R7Z C;  3GTO K;  4Y52 C;  3S1Q C;  2Y0S D;  5C44 C;  4YFK A;  3I4M K;  4XLP A;  1I50 C;  3PO2 C;  4Q5S A;  4KN7 A;  4Y7N K;  2A6H A;  5C4J K;  2E2H K;  3M3Y C;  4A3K C;  1IW7 A;  3HOV K;  2PA8 L;  1TWF K;  4BBR C;  3PO3 C;  3HOW K;  2R93 C;  3S1N K;  1SFO K;  3DXJ A;  3RZO K;  3GTL C;  2CW0 A;  5TMC A;  5IYB K;  4A3F K;  2B63 C;  3S15 C;  3M4O K;  2PA8 D;  3WOD A;  4G7O A;  3S14 C;  4BXX C;  3HOX C;  4QIW L;  3GTQ C;  3S1M C;  3GTM C;  1K83 C;  2VUM K;  4A3G C;  1WCM C;  3S2H K;  5IP7 C;  2NVX K;  5FJ8 K;  2JA5 K;  1I6H C;  4A3J C;  3H0G C;  4QIW D;  3GTJ K;  1R9T C;  4BBS K;  4XSX A;  4OIQ A;  4BY7 K;  3HOY K;  4A3I C;  5IYD C;  2PPB A;  4A93 K;  4MQ9 A;  4A3L K;  3GTP K;  1TWA K;  3K7A C;  4C3H K;  3FKI C;  1TWC K;  4LK0 A;  2NVT K;  4A3C K;  2A68 A;  5C3E K;  4NOI A;  4MEX A;  3GTG K;  1I6V A;  4OIN A;  2E2J C;  4A3E C;  2R92 C;  4JK1 A;  3HOZ C;  4A3D C;  5IP9 C;  4OIO A;  4BY1 K;  1Y1V C;  3GTK C;  5C4X K;  3I4N K;  5M5Y K;  4C3I K;  5IYC C;  4X6A C;  5M5W K;  3EQL A;  4XLN A;  4A3M K;  2JA8 K;  2JA6 C;  5M5X K;  5FLM C;  1TWH K;  3RZD K;  3CQZ K;  3S16 C;  4A3B K;  1I3Q K;  1YNN A;  2YU9 K;  3S17 K;  2NVQ K;  2R7Z K;  1TWG K;  4Y52 K;  3S1Q K;  4OIP A;  5C44 K;  3S2D C;  1I50 K;  3GTO C;  3S1R C;  1XPP A;  2A6E A;  4A3K K;  3M3Y K;  3I4M C;  4LK1 A;  4BBR K;  3PO3 K;  5C3E C;  4Y7N C;  2R93 K;  5C4J C; 
#chains in the Genus database with same CATH topology
 2BE5 A;  4AYB L;  1JOE A;  3GTL K;  3GTJ A;  3S15 K;  1Y1W K;  2CFA B;  3RZO C;  4BXX K;  4YFN A;  4C3J K;  3T00 A;  4A3G K;  1WCM K;  2NVY K;  1IE0 A;  2WB1 L;  3HOU K;  1O28 A;  1O25 A;  4G7Z A;  4A3J K;  1YX2 A;  4LJZ A;  2GAH C;  5M3M K;  3H3V L;  2E2I K;  2NVX C;  2JA5 C;  1PJ6 A;  3N3Y A;  4YFX A;  4BY7 C;  1DCP A;  1TWH A;  2E2J K;  1I3Q A;  2YU9 A;  1O24 A;  1TWG A;  2EBB A;  1Y1W C;  1WOP A;  2WAQ L;  1I50 A;  5IYC K;  4BY1 C;  2O5I A;  5C4X C;  1O29 A;  1TWA A;  5JFE A;  2JA6 K;  1BS2 A;  3G4C A;  2NVY C;  4A3M C;  1JVI A;  3HOU C;  3RZD C;  3CQZ C;  4OIR A;  3ADA C;  1DCH A;  3S2D K;  2NVQ C;  2E2I C;  3S1R K;  5D4D A;  3AH5 A;  3OEP A;  2P8T A;  1F93 A;  5C44 C;  1K83 A;  2JA7 A;  3BP3 A;  3M3Y C;  1R9T A;  3HOW K;  3TFI A;  3S1N K;  1SFO K;  2B63 C;  5IYB K;  4G7O A;  3GSI A;  5CJ9 A;  4G0U A;  3GTQ C;  3S1M C;  4KAW X;  2PHC B;  1Y1V A;  3H0G C;  4A3I C;  2V6T A;  4MQ9 A;  4A3L K;  3GTP K;  1TWA K;  3ORE A;  3FKI C;  4KB2 A;  1TWC K;  4LK0 A;  4KMH A;  2R92 C;  3FOF A;  3CAG A;  1WOR A;  3GTO A;  4FM9 A;  4A3D C;  1F7U A;  1INN A;  4X6A C;  2ZUF A;  3MML B;  2RH6 A;  3S16 C;  4A3B K;  4KM9 A;  2R7Z K;  4KB4 A;  4KAT A;  3LAP A;  5IOS A;  1WOS A;  4BBR K;  2E2H C;  2FQO A;  1WQH A;  3HOV C;  2NVX A;  2JA5 A;  2CFA A;  1BGW A;  1TWF C;  2GSO A;  4XSZ A;  1AB4 A;  4Q4Z A;  2PMZ L;  3IPJ A;  3HKZ L;  3S14 K;  1ZXO A;  4A3F C;  3GDZ A;  3M4O C;  3GTM K;  2RGR A;  2D6F C;  1WOO A;  1I6H K;  1HI9 A;  4QJV B;  3S2H C;  4LLG A;  2FQT A;  3T02 A;  1WSV A;  3SZZ A;  1RU0 A;  3CQZ A;  1ZYR A;  3A8I A;  4LQY A;  3GTG C;  4YG2 A;  1HQM A;  1SMY A;  3GTK K;  1BDF A;  1ZBS A;  5FLM K;  2Y0S L;  3LPX A;  4P9S A;  1WIH A;  4BLB A;  2B63 A;  1JQW A;  4GTA A;  3S17 C;  4Y52 C;  1KQ4 A;  4YFK A;  3GTQ A;  2ZFZ A;  4KN7 A;  4RMF A;  2A6H A;  4Y7N K;  5C4J K;  1YCL A;  4A3K C;  4GTC A;  3H0G A;  3PO3 C;  2XCQ A;  2R93 C;  1UV7 A;  1VJE A;  1IL2 A;  2V6S A;  1DCO A;  3GTL C;  5TMC A;  3FKI A;  3BUE A;  3S15 C;  2PA8 D;  4BXX C;  1O27 A;  4C3J C;  2R92 A;  5CHP A;  2VUM K;  4A3G C;  1WCM C;  5FJ8 K;  1DD5 A;  4A3J C;  4QIW D;  3GTJ K;  4BBS K;  1USO A;  2GAG C;  3HOY K;  2PPB A;  4A93 K;  4C3H K;  1EK8 A;  1G51 A;  2P5M A;  2NVT K;  4A3C K;  3HXA A;  1XXB A;  2E2J C;  4JK1 A;  4PAB A;  4G0W A;  1VRQ C;  3I4N K;  2GSN A;  4BKW A;  5HL8 A;  4C3I K;  5IYC C;  2E2H A;  3TFH A;  3EQL A;  2JA6 C;  2JA8 K;  1TWF A;  1TWH K;  1I3Q K;  2YU9 K;  4GT9 A;  2ZUE A;  1TWG K;  3AD7 C;  3S1Q K;  4OIP A;  3S2D C;  1I50 K;  3S1R C;  1XXA A;  4LK1 A;  3Q3Q A;  3A8J A;  3GEI A;  4WIL A;  1ZQ1 C;  3HOW C;  3T01 A;  3S1N C;  1SFO C;  2W7V A;  1X31 C;  5IOT A;  5L46 A;  5IYB C;  4AYB D;  3HOX K;  1K83 K;  1O2F B;  4C3I C;  2JA7 K;  4QJV A;  4C2M K;  3GTG A;  5IP7 K;  1R9T K;  5M3F K;  5IYD K;  2XCR B;  2WB1 D;  3K7A K;  2GSU A;  5TMF A;  3SZY A;  3PO2 K;  4A3L C;  3GTP C;  1TWA C;  3H3V D;  3GIR A;  1TWC C;  4A3E K;  2O5J A;  3HOZ K;  3V4G A;  5IP9 K;  1USM A;  1WQF A;  1Y1V K;  4KN4 A;  1BJT A;  1J6V A;  1YNJ A;  4LR2 A;  2JA7 C;  2R93 A;  2WAQ D;  4A3B C;  3GTL A;  3L4K A;  1Y1W A;  2R7Z C;  3GTO K;  3ERE D;  4O2D A;  3I4M K;  3AD9 C;  3PO2 C;  4Q5S A;  1WCM A;  2NVY A;  3N0B A;  4P5B A;  1IW7 A;  4BBR C;  2E2I A;  3DXJ A;  4GTL A;  3RZO K;  3WOD A;  5C3E C;  3S14 C;  1PJ5 A;  3GTM C;  5JVO A;  1VGX A;  2NVX K;  2JA5 K;  1I6H C;  4GTB A;  1EFW A;  4BY7 K;  4OIQ A;  2Y3P A;  4GTE A;  3TFJ A;  4J3N A;  3N0C A;  2JA6 A;  1WQG A;  5E68 A;  5IOQ A;  2V6U A;  1J98 A;  2JH3 A;  4MEX A;  1B4A A;  4LOW A;  1XZP B;  4BY1 K;  3GTK C;  5C4X K;  4KAS A;  2XCO A;  1F9N A;  5M5W K;  4A3M K;  4KC6 A;  5M5X K;  5EGH A;  5FLM C;  3RZD K;  3CQZ K;  1GE9 A;  1YNN A;  3FOE A;  1SFO A;  2NVQ K;  4XCH A;  5C44 K;  4BLA A;  3QX3 A;  1C0A A;  1ISE A;  1XPP A;  3M3Y K;  3A8K A;  4Y7N C;  5C4J C;  4GZY A;  4KDD A;  1XZQ B;  2B63 K;  1WSR A;  3GTP A;  3GTQ K;  3S1M K;  1TWC A;  1IS1 A;  4M1X A;  3L4J A;  2PMZ D;  3HKZ D;  2VUM C;  3H0G K;  1EQR A;  4A3I K;  4MEY A;  2A69 A;  4DDQ A;  5IOR A;  3GTJ C;  4BBS C;  3FKI K;  4G0V A;  4KMU A;  3HOY C;  4A93 C;  4C3H C;  1VH2 A;  2NVT C;  2R92 K;  4A3C C;  4G7H A;  2R7Z A;  4A3D K;  5EGE A;  1O26 A;  1B4B A;  4KMA A;  4GTD A;  4GTF A;  3FHZ A;  3G4A A;  4X6A K;  1V5V A;  3I4N C;  3S16 K;  3AQO A;  3GEE A;  3S0X A;  2JA8 C;  3NUH A;  1TWH C;  1I3Q C;  3BP8 C;  2YU9 C;  4ZH4 A;  1TWG C;  3VA7 A;  3S1Q C;  2Y0S D;  3GTM A;  4XLP A;  1I50 C;  2E2H K;  4KM8 A;  3HOV K;  2PA8 L;  1TWF K;  2KWA A;  3JST A;  1EI6 A;  1J6W A;  2CW0 A;  1O2A A;  4A3F K;  3M4O K;  1J6X A;  3AD8 C;  4P5A A;  3OPF A;  5TJ3 A;  3HOX C;  1EH1 A;  4QIW L;  1ZVU A;  1IQ0 A;  1K83 C;  3AQP A;  4C2M C;  3S2H K;  5IP7 C;  3GTK A;  1R9T C;  4XSX A;  3LAJ A;  5IYD C;  4PAA A;  1IBA A;  3K7A C;  4KAR A;  2A68 A;  5C3E K;  4NOI A;  1XZP A;  1O2B A;  3GTG K;  1I6V A;  1L0W A;  4OIN A;  4A3E C;  3HOZ C;  5IP9 C;  4OIO A;  1Y1V C;  1VLO A;  1XXC A;  4FZB A;  4AH6 A;  5M5Y K;  4XLN A;  4KMD A;  4C45 A;  4ILD A;  3S17 K;  4Y52 K;  1PJ7 A;  4WJ4 A;  3GTO C;  4WJ3 M;  1F7V A;  2A6E A;  4A3K K;  3I4M C;  3GEH A;  2VUM A;  3PO3 K;  1XZQ A;  3TTG A;  2R93 K;  4GFQ A; 
#chains in the Genus database with same CATH homology
 2BE5 A;  4AYB L;  3HOV C;  4GZY A;  1TWF C;  3GTL K;  4XSZ A;  2B63 K;  3HOW C;  3S15 K;  1Y1W K;  3S1N C;  4Q4Z A;  2PMZ L;  1SFO C;  3HKZ L;  3RZO C;  3S14 K;  4BXX K;  5IYB C;  4YFN A;  4AYB D;  4C3J K;  3HOX K;  4A3F C;  3GTQ K;  1K83 K;  3GTM K;  3S1M K;  3M4O C;  2JA7 K;  4QJV A;  4C2M K;  4A3G K;  1WCM K;  2NVY K;  2WB1 L;  2PMZ D;  5IP7 K;  2E2H C;  3HKZ D;  3HOU K;  4G7Z A;  2VUM C;  1I6H K;  4A3J K;  3H0G K;  4QJV B;  1R9T K;  4LJZ A;  5M3M K;  3H3V L;  3S2H C;  5M3F K;  4A3I K;  2E2I K;  2JA5 C;  4MEY A;  2NVX C;  2A69 A;  5IYD K;  2WB1 D;  3K7A K;  4YFX A;  3GTJ C;  3FKI K;  4BY7 C;  4BBS C;  4KMU A;  5TMF A;  4LLG A;  3HOY C;  3PO2 K;  4A93 C;  4A3L C;  3GTP C;  1TWA C;  3H3V D;  2E2J K;  1TWC C;  4A3E K;  2NVT C;  1ZYR A;  2R92 K;  4G7H A;  4A3C C;  2O5J A;  3HOZ K;  3GTG C;  4A3D K;  4YG2 A;  5IP9 K;  1HQM A;  1SMY A;  1Y1V K;  3GTK K;  1BDF A;  4KN4 A;  2WAQ L;  1Y1W C;  1YNJ A;  5IYC K;  4BY1 C;  2O5I A;  4X6A K;  5C4X C;  2JA6 K;  3I4N C;  5FLM K;  2JA7 C;  3S16 K;  2WAQ D;  2NVY C;  4A3M C;  2Y0S L;  2JA8 C;  3HOU C;  3RZD C;  1TWH C;  4A3B C;  3CQZ C;  1I3Q C;  2YU9 C;  4OIR A;  3S2D K;  3S17 C;  4ZH4 A;  2NVQ C;  2E2I C;  3S1R K;  1TWG C;  5D4D A;  2R7Z C;  3GTO K;  4Y52 C;  3S1Q C;  2Y0S D;  5C44 C;  4YFK A;  3I4M K;  4XLP A;  1I50 C;  3PO2 C;  4Q5S A;  4KN7 A;  4Y7N K;  2A6H A;  5C4J K;  2E2H K;  3M3Y C;  4A3K C;  1IW7 A;  3HOV K;  2PA8 L;  1TWF K;  4BBR C;  3PO3 C;  3HOW K;  2R93 C;  3S1N K;  1SFO K;  3DXJ A;  3RZO K;  3GTL C;  2CW0 A;  5TMC A;  5IYB K;  4A3F K;  2B63 C;  3S15 C;  3M4O K;  2PA8 D;  3WOD A;  4G7O A;  3S14 C;  4BXX C;  3HOX C;  4QIW L;  3GTQ C;  3S1M C;  3GTM C;  1K83 C;  2VUM K;  4A3G C;  1WCM C;  3S2H K;  5IP7 C;  2NVX K;  5FJ8 K;  2JA5 K;  1I6H C;  4A3J C;  3H0G C;  4QIW D;  3GTJ K;  1R9T C;  4BBS K;  4XSX A;  4OIQ A;  4BY7 K;  3HOY K;  4A3I C;  5IYD C;  2PPB A;  4A93 K;  4MQ9 A;  4A3L K;  3GTP K;  1TWA K;  3K7A C;  4C3H K;  3FKI C;  1TWC K;  4LK0 A;  2NVT K;  4A3C K;  2A68 A;  5C3E K;  4NOI A;  4MEX A;  3GTG K;  1I6V A;  4OIN A;  2E2J C;  4A3E C;  2R92 C;  4JK1 A;  3HOZ C;  4A3D C;  5IP9 C;  4OIO A;  4BY1 K;  1Y1V C;  3GTK C;  5C4X K;  3I4N K;  5M5Y K;  4C3I K;  5IYC C;  4X6A C;  5M5W K;  3EQL A;  4XLN A;  4A3M K;  2JA8 K;  2JA6 C;  5M5X K;  5FLM C;  1TWH K;  3RZD K;  3CQZ K;  3S16 C;  4A3B K;  1I3Q K;  1YNN A;  2YU9 K;  3S17 K;  2NVQ K;  2R7Z K;  1TWG K;  4Y52 K;  3S1Q K;  4OIP A;  5C44 K;  3S2D C;  1I50 K;  3GTO C;  3S1R C;  1XPP A;  2A6E A;  4A3K K;  3M3Y K;  3I4M C;  4LK1 A;  4BBR K;  3PO3 K;  5C3E C;  4Y7N C;  2R93 K;  5C4J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...