3HKZL

The x-ray crystal structure of rna polymerase from archaea
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MEIRILKSESNYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit A'
publication title The X-ray crystal structure of RNA polymerase from Archaea.
pubmed doi rcsb
molecule tags Transferase
total genus 18
structure length 92
sequence length 92
chains with identical sequence V
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3hkzL00
3H0GK 3GTQK 2A6HA 4OIOA 4A3BK 4KMUA 1TWGK 3S1MC 4XLNA 3S14K 1TWHC 4OIRA 3PO3C 1TWCK 4MQ9A 4YFXA 5M3FK 2JA7K 2O5IA 3HKZL 5IYBC 1IW7A 4OIQA 2A69A 3S1NC 1I6HK 4A3KK 4A3IC 4A3JC 3HOUC 1HQMA 3H0GC 2JA8C 4BY1K 2R92C 4NOIA 3S1RK 1XPPA 3I4NK 4A3GK 3S2HK 3S16K 5IP9C 3GTJK 1TWCC 4BY7K 1I6HC 4G7OA 3RZDK 3I4MC 2BE5A 4A3KC 4OIPA 3PO3K 4OINA 3S17C 4XSXA 3HOXK 4LLGA 5IP7K 5IYBK 4A3GC 2WAQL 3S1NK 3S2HC 2R7ZC 3S15K 5M5XK 2JA6K 4A3IK 4A3JK 1TWAK 3FKIC 3HOUK 4BY7C 4C3JK 2JA5K 3S2DC 3RZDC 4KN4A 2E2JK 2JA8K 4A3CK 2R92K 3DXJA 2WAQD 3GTGK 4YG2A 5IP9K 3HOXC 4A3LK 4GZYA 1I3QC 5M5YK 5IP7C 2PMZL 3PO2K 2PA8D 3I4MK 3S15C 2R93C 2JA6C 3GTMC 4C3IK 4XSZA 1TWAC 3M3YK 2JA5C 2E2JC 3S17K 3S1QC 4A3CC 5IYDK 2PMZD 2WB1D 5FJ8K 5C44C 3GTGC 2R7ZK 4G7ZA 3HOZK 2NVQK 4A3LC 5TMCA 3FKIK 4LJZA 3PO2C 4A3MC 2PPBA 3WODA 3GTLC 3S2DK 2Y0SL 3K7AC 4LK0A 4YFKA 4Q4ZA 4G7HA 3M3YC 2A68A 5M3MK 1I3QK 5C4JC 5IYDC 1SMYA 3RZOK 2Y0SD 4Y52C 2R93K 4AYBD 2NVQC 2NVTK 3GTMK 3HOYK 3HOZC 2PA8L 1I50C 1K83K 4QIWD 4A3EK 3S1QK 4ZH4A 5C44K 5TMFA 4LK1A 4BBSK 4C2MK 2WB1L 4A3MK 4BBRC 3H3VL 3GTLK 2B63C 4C3HK 3RZOC 4X6AK 3K7AK 2NVTC 1SFOC 3HOYC 3HOWC 1Y1VK 4BXXK 1K83C 4A3EC 4JK1A 3EQLA 5C4JK 1R9TK 5C4XC 4KN7A 3H3VD 4Y52K 4BBSC 4A93C 1ZYRA 2NVXK 4Y7NC 5C3EC 1I50K 1YNJA 1Y1WK 3GTKC 4X6AC 3CQZC 4AYBL 2VUMC 1Y1VC 4QIWL 4BXXC 2NVYK 3GTPC 5FLMK 1R9TC 4BBRK 2B63K 3HOVC 2A6EA 4MEYA 2E2IC 1SFOK 2NVXC 3HOWK 3M4OC 4Q5SA 5IYCC 1Y1WC 3GTOK 1WCMC 2YU9C 4XLPA 5C4XK 2CW0A 4QJVB 2NVYC 4A93K 2E2HK 3GTQC 4MEXA 5FLMC 4A3FK 4A3BC 1TWFK 1TWGC 5C3EK 4Y7NK 3GTKK 3HKZD 3S14C 3CQZK 4A3DK 5D4DA 2VUMK 2JA7C 3GTOC 4YFNA 3GTPK 4QJVA 3S1MK 1TWHK 1BDFA 5M5WK 3HOVK 2O5JA 2E2HC 2E2IK 3M4OK 4A3FC 4BY1C 1TWFC 5IYCK 3S1RC 1I6VA 1WCMK 3I4NC 2YU9K 3S16C 4A3DC 3GTJC 1YNNA
chains in the Genus database with same CATH superfamily
4P5AA 3GIRA 4KMUA 3S1MC 3N3YA 5TJ3A 1TWCK 4MQ9A 4KMAA 5M3FK 3S1NC 2Y3PA 1XXCA 2V6SA 1WQHA 4BY1K 2R92C 4NOIA 4A3GK 3FKIA 3CAGA 5IP9C 4WJ3M 4G7OA 3I4MC 3GEHA 4GTDA 4XSXA 3HOXK 4LLGA 5IP7K 2R93A 3S1NK 5M5XK 3L4JA 2R92K 3LPXA 3TFIA 5IP9K 5E68A 5M5YK 3I4MK 3S15C 1BS2A 1TWAC 3M3YK 2JA5C 3GEIA 4BKWA 1R9TA 4A3CC 3MMLB 5IYDK 2PMZD 2WB1D 5FJ8K 4KM9A 3HOZK 4A3LC 1I50A 4C2MC 1USMA 3QX3A 3K7AC 4C3IC 1L0WA 2P5MA 5JFEA 1SMYA 3BP8C 2NVQC 5EGEA 3GTKA 4C2MK 2WB1L 3RZOC 3H3VL 2KWAA 4C3HK 3K7AK 1YX2A 1SFOC 1DCPA 1K83C 2XCQA 4JK1A 4A3EC 4BXXK 2ZUEA 4BBSC 3BUEA 1XZQB 1Y1WA 1WCMA 3FOFA 4Y7NC 4X6AC 3CQZC 1VLOA 1J6WA 2NVYK 3GTPC 1R9TC 1VGXA 1JOEA 1JQWA 1SFOK 1VRQC 2CFAB 1PJ5A 4LR2A 2YU9C 4XCHA 2CW0A 1WOOA 2E2HK 4A3BC 1XZPA 1TWFK 4Y7NK 3HKZD 3A8JA 3CQZK 4GTBA 3GTOC 4YFNA 3GTPK 2GAGC 4QJVA 1IBAA 1TWHK 5M5WK 1WQFA 3TTGA 1J6VA 2YU9K 2R92A 2A6HA 1AB4A 4A3BK 1YCLA 4FM9A 3HKZL 4OIQA 2A69A 4GTFA 4A3KK 3HOUC 4C3JC 1VH2A 4AH6A 4PABA 2RH6A 1XPPA 3S2HK 1TWCC 4BY7K 2BE5A 4OIPA 4OINA 3S17C 3A8IA 4FZBA 4A3GC 2WAQL 1O28A 1TWAA 2P8TA 2R7ZC 3HOUK 5CJ9A 4C3JK 4PAAA 3S2DC 4KN4A 3GTGK 3HOXC 3OREA 5IP7C 1RU0A 3S17K 1JVIA 4P5BA 5C44C 3VA7A 2R7ZK 4LJZA 3T02A 4A3MC 3GTLC 3S2DK 2Y0SL 4KARA 2NVYA 3M3YC 2W7VA 5M3MK 1IL2A 1DCHA 3V4GA 4KC6A 5IYDC 1SFOA 2NVTK 3HOZC 1G51A 1K83A 3HOYK 5CHPA 3FOEA 4QIWD 3ERED 4ZH4A 1XXBA 5C44K 2E2HA 2PHCB 3CQZA 4A3MK 4BBRC 3HXAA 2B63C 3GTLK 3GTPA 3LAJA 1TWHA 2V6TA 3JSTA 4LQYA 3H3VD 1EFWA 1ZYRA 3A8KA 2NVXK 3ADAC 2YU9A 4C3HC 2FQOA 2VUMC 4QIWL 4BXXC 5JVOA 1ISEA 4BBRK 3N0BA 1XZPB 2B63K 3GTOA 4QJVB 2NVYC 3GTQC 1TWGC 5D4DA 1O26A 2VUMK 3GSIA 1BDFA 3TFHA 2O5JA 2E2HC 1KQ4A 1TWFC 4KM8A 3I4NC 1WIHA 3S16C 3GTJC 2GSUA 1WQGA 4KAWX 3H0GK 3GTQK 1O24A 1TWGK 5L46A 1O29A 4XLNA 1TWHC 1TWCA 3AD8C 4GTLA 1WSVA 4G0WA 2O5IA 1I6HK 5IYBC 4J3NA 4A3IC 4A3JC 1HQMA 1X31C 1ZQ1C 1INNA 2R7ZA 4KMDA 3I4NK 3S16K 3GTJK 1B4BA 3RZDK 4A3KC 4C45A 4DDQA 1F7VA 1PJ6A 4KB2A 5IYBK 3S2HC 3G4AA 1O27A 4A3IK 4KMHA 4A3JK 2JA6K 1F9NA 4BY7C 3SZYA 3Q3QA 2E2JK 2V6UA 1ZXOA 2WAQD 4YG2A 3GTLA 1I3QC 3PO2K 4KDDA 4GZYA 1F7UA 2PA8D 3GTMC 4ILDA 1PJ7A 4GFQA 4G0UA 1VJEA 2NVXA 3GTGC 5TMCA 2PPBA 3WODA 4LK0A 4Q4ZA 4G7HA 3LAPA 1I3QK 5C4JC 3OPFA 2B63A 1HI9A 3AD7C 1XZQA 4M1XA 2Y0SD 4AYBD 3GTMK 3OEPA 5IORA 1ZVUA 2PA8L 5TMFA 4LK1A 3T00A 2VUMA 2NVTC 1WSRA 3HOYC 1Y1VK 2XCOA 5IOQA 5C4JK 2GAHC 1V5VA 1ZBSA 5C3EC 1YNJA 1Y1WK 4KASA 4G0VA 4AYBL 3GTQA 4GTAA 1TWGA 5FLMK 1BGWA 3HOVC 1O2AA 4GTCA 4MEYA 2E2IC 2NVXC 3AD9C 2FQTA 3AH5A 5IYCC 4KATA 4O2DA 2D6FC 3BP3A 1TWFA 4MEXA 4A3FK 5C3EK 3S14C 3GTJA 4A3DK 2JA7C 1XXAA 3S1MK 3HOVK 2E2IK 5IYCK 3S1RC 1WOPA 2JA6A 1EI6A 1DD5A 4OIOA 1O2BA 3S14K 4OIRA 3PO3C 4YFXA 5IOSA 2JA7K 1IW7A 3T01A 4WJ4A 3H0GC 2JA8C 4BLAA 1USOA 3S1RK 3TFJA 1I6HC 1IE0A 4LOWA 1EK8A 3PO3K 1BJTA 1I3QA 4KB4A 3GTMA 2ZFZA 1B4AA 3S15K 1EQRA 2EBBA 1TWAK 3FKIC 2JA5K 5EGHA 3RZDC 4A3CK 3N0CA 2JA8K 3GTGA 3DXJA 3GDZA 4A3LK 1IQ0A 2PMZL 2R93C 1Y1VA 5IOTA 2JA6C 4C3IK 4XSZA 1EH1A 1WOSA 2E2JC 3S1QC 1GE9A 4G7ZA 2NVQK 3FKIK 2RGRA 3PO2C 1WORA 1O25A 4GTEA 4P9SA 4RMFA 4YFKA 2XCRB 1J6XA 2A68A 4BLBA 3AQPA 2GSOA 3RZOK 3SZZA 4Y52C 2R93K 2GSNA 1I50C 1K83K 4A3EK 3S1QK 3AQOA 3IPJA 5HL8A 3L4KA 4BBSK 2ZUFA 4X6AK 1IS1A 3HOWC 1F93A 3EQLA 1R9TK 2E2IA 4KN7A 5C4XC 4Y52K 4A93C 3GTKC 1I50K 4WILA 1Y1VC 3G4CA 2JA7A 2A6EA 3M4OC 4Q5SA 1DCOA 3HOWK 3S0XA 1Y1WC 3GTOK 1WCMC 4GT9A 4XLPA 5C4XK 1J98A 4A93K 5FLMC 3GTKK 2CFAA 1C0AA 3FHZA 1O2FB 3GEEA 1UV7A 2JH3A 3M4OK 4A3FC 3NUHA 4BY1C 1I6VA 1WCMK 4A3DC 3H0GA 2JA5A 1YNNA
chains in the Genus database with same CATH topology
3H0GK 3GTQK 2A6HA 4OIOA 4A3BK 4KMUA 1TWGK 3S1MC 4XLNA 3S14K 1TWHC 4OIRA 3PO3C 1TWCK 4MQ9A 4YFXA 5M3FK 2JA7K 2O5IA 3HKZL 5IYBC 1IW7A 4OIQA 2A69A 3S1NC 1I6HK 4A3KK 4A3IC 4A3JC 3HOUC 1HQMA 3H0GC 2JA8C 4BY1K 2R92C 4NOIA 3S1RK 1XPPA 3I4NK 4A3GK 3S2HK 3S16K 5IP9C 3GTJK 1TWCC 4BY7K 1I6HC 4G7OA 3RZDK 3I4MC 2BE5A 4A3KC 4OIPA 3PO3K 4OINA 3S17C 4XSXA 3HOXK 4LLGA 5IP7K 5IYBK 4A3GC 2WAQL 3S1NK 3S2HC 2R7ZC 3S15K 5M5XK 2JA6K 4A3IK 4A3JK 1TWAK 3FKIC 3HOUK 4BY7C 4C3JK 2JA5K 3S2DC 3RZDC 4KN4A 2E2JK 2JA8K 4A3CK 2R92K 3DXJA 2WAQD 3GTGK 4YG2A 5IP9K 3HOXC 4A3LK 4GZYA 1I3QC 5M5YK 5IP7C 2PMZL 3PO2K 2PA8D 3I4MK 3S15C 2R93C 2JA6C 3GTMC 4C3IK 4XSZA 1TWAC 3M3YK 2JA5C 2E2JC 3S17K 3S1QC 4A3CC 5IYDK 2PMZD 2WB1D 5FJ8K 5C44C 3GTGC 2R7ZK 4G7ZA 3HOZK 2NVQK 4A3LC 5TMCA 3FKIK 4LJZA 3PO2C 4A3MC 2PPBA 3WODA 3GTLC 3S2DK 2Y0SL 3K7AC 4LK0A 4YFKA 4Q4ZA 4G7HA 3M3YC 2A68A 5M3MK 1I3QK 5C4JC 5IYDC 1SMYA 3RZOK 2Y0SD 4Y52C 2R93K 4AYBD 2NVQC 2NVTK 3GTMK 3HOYK 3HOZC 2PA8L 1I50C 1K83K 4QIWD 4A3EK 3S1QK 4ZH4A 5C44K 5TMFA 4LK1A 4BBSK 4C2MK 2WB1L 4A3MK 4BBRC 3H3VL 3GTLK 2B63C 4C3HK 3RZOC 4X6AK 3K7AK 2NVTC 1SFOC 3HOYC 3HOWC 1Y1VK 4BXXK 1K83C 4A3EC 4JK1A 3EQLA 5C4JK 1R9TK 5C4XC 4KN7A 3H3VD 4Y52K 4BBSC 4A93C 1ZYRA 2NVXK 4Y7NC 5C3EC 1I50K 1YNJA 1Y1WK 3GTKC 4X6AC 3CQZC 4AYBL 2VUMC 1Y1VC 4QIWL 4BXXC 2NVYK 3GTPC 5FLMK 1R9TC 4BBRK 2B63K 3HOVC 2A6EA 4MEYA 2E2IC 1SFOK 2NVXC 3HOWK 3M4OC 4Q5SA 5IYCC 1Y1WC 3GTOK 1WCMC 2YU9C 4XLPA 5C4XK 2CW0A 4QJVB 2NVYC 4A93K 2E2HK 3GTQC 4MEXA 5FLMC 4A3FK 4A3BC 1TWFK 1TWGC 5C3EK 4Y7NK 3GTKK 3HKZD 3S14C 3CQZK 4A3DK 5D4DA 2VUMK 2JA7C 3GTOC 4YFNA 3GTPK 4QJVA 3S1MK 1TWHK 1BDFA 5M5WK 3HOVK 2O5JA 2E2HC 2E2IK 3M4OK 4A3FC 4BY1C 1TWFC 5IYCK 3S1RC 1I6VA 1WCMK 3I4NC 2YU9K 3S16C 4A3DC 3GTJC 1YNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G K;  3GTQ K;  2A6H A;  4OIO A;  4A3B K;  4KMU A;  1TWG K;  3S1M C;  4XLN A;  3S14 K;  1TWH C;  4OIR A;  3PO3 C;  1TWC K;  4MQ9 A;  4YFX A;  5M3F K;  2JA7 K;  2O5I A;  3HKZ L;  5IYB C;  1IW7 A;  4OIQ A;  2A69 A;  3S1N C;  1I6H K;  4A3K K;  4A3I C;  4A3J C;  3HOU C;  1HQM A;  3H0G C;  2JA8 C;  4BY1 K;  2R92 C;  4NOI A;  3S1R K;  1XPP A;  3I4N K;  4A3G K;  3S2H K;  3S16 K;  5IP9 C;  3GTJ K;  1TWC C;  4BY7 K;  1I6H C;  4G7O A;  3RZD K;  3I4M C;  2BE5 A;  4A3K C;  4OIP A;  3PO3 K;  4OIN A;  3S17 C;  4XSX A;  3HOX K;  4LLG A;  5IP7 K;  5IYB K;  4A3G C;  2WAQ L;  3S1N K;  3S2H C;  2R7Z C;  3S15 K;  5M5X K;  2JA6 K;  4A3I K;  4A3J K;  1TWA K;  3FKI C;  3HOU K;  4BY7 C;  4C3J K;  2JA5 K;  3S2D C;  3RZD C;  4KN4 A;  2E2J K;  2JA8 K;  4A3C K;  2R92 K;  3DXJ A;  2WAQ D;  3GTG K;  4YG2 A;  5IP9 K;  3HOX C;  4A3L K;  4GZY A;  1I3Q C;  5M5Y K;  5IP7 C;  2PMZ L;  3PO2 K;  2PA8 D;  3I4M K;  3S15 C;  2R93 C;  2JA6 C;  3GTM C;  4C3I K;  4XSZ A;  1TWA C;  3M3Y K;  2JA5 C;  2E2J C;  3S17 K;  3S1Q C;  4A3C C;  5IYD K;  2PMZ D;  2WB1 D;  5FJ8 K;  5C44 C;  3GTG C;  2R7Z K;  4G7Z A;  3HOZ K;  2NVQ K;  4A3L C;  5TMC A;  3FKI K;  4LJZ A;  3PO2 C;  4A3M C;  2PPB A;  3WOD A;  3GTL C;  3S2D K;  2Y0S L;  3K7A C;  4LK0 A;  4YFK A;  4Q4Z A;  4G7H A;  3M3Y C;  2A68 A;  5M3M K;  1I3Q K;  5C4J C;  5IYD C;  1SMY A;  3RZO K;  2Y0S D;  4Y52 C;  2R93 K;  4AYB D;  2NVQ C;  2NVT K;  3GTM K;  3HOY K;  3HOZ C;  2PA8 L;  1I50 C;  1K83 K;  4QIW D;  4A3E K;  3S1Q K;  4ZH4 A;  5C44 K;  5TMF A;  4LK1 A;  4BBS K;  4C2M K;  2WB1 L;  4A3M K;  4BBR C;  3H3V L;  3GTL K;  2B63 C;  4C3H K;  3RZO C;  4X6A K;  3K7A K;  2NVT C;  1SFO C;  3HOY C;  3HOW C;  1Y1V K;  4BXX K;  1K83 C;  4A3E C;  4JK1 A;  3EQL A;  5C4J K;  1R9T K;  5C4X C;  4KN7 A;  3H3V D;  4Y52 K;  4BBS C;  4A93 C;  1ZYR A;  2NVX K;  4Y7N C;  5C3E C;  1I50 K;  1YNJ A;  1Y1W K;  3GTK C;  4X6A C;  3CQZ C;  4AYB L;  2VUM C;  1Y1V C;  4QIW L;  4BXX C;  2NVY K;  3GTP C;  5FLM K;  1R9T C;  4BBR K;  2B63 K;  3HOV C;  2A6E A;  4MEY A;  2E2I C;  1SFO K;  2NVX C;  3HOW K;  3M4O C;  4Q5S A;  5IYC C;  1Y1W C;  3GTO K;  1WCM C;  2YU9 C;  4XLP A;  5C4X K;  2CW0 A;  4QJV B;  2NVY C;  4A93 K;  2E2H K;  3GTQ C;  4MEX A;  5FLM C;  4A3F K;  4A3B C;  1TWF K;  1TWG C;  5C3E K;  4Y7N K;  3GTK K;  3HKZ D;  3S14 C;  3CQZ K;  4A3D K;  5D4D A;  2VUM K;  2JA7 C;  3GTO C;  4YFN A;  3GTP K;  4QJV A;  3S1M K;  1TWH K;  1BDF A;  5M5W K;  3HOV K;  2O5J A;  2E2H C;  2E2I K;  3M4O K;  4A3F C;  4BY1 C;  1TWF C;  5IYC K;  3S1R C;  1I6V A;  1WCM K;  3I4N C;  2YU9 K;  3S16 C;  4A3D C;  3GTJ C;  1YNN A; 
#chains in the Genus database with same CATH topology
 4P5A A;  3GIR A;  4KMU A;  3S1M C;  3N3Y A;  5TJ3 A;  1TWC K;  4MQ9 A;  4KMA A;  5M3F K;  3S1N C;  2Y3P A;  1XXC A;  2V6S A;  1WQH A;  4BY1 K;  2R92 C;  4NOI A;  4A3G K;  3FKI A;  3CAG A;  5IP9 C;  4WJ3 M;  4G7O A;  3I4M C;  3GEH A;  4GTD A;  4XSX A;  3HOX K;  4LLG A;  5IP7 K;  2R93 A;  3S1N K;  5M5X K;  3L4J A;  2R92 K;  3LPX A;  3TFI A;  5IP9 K;  5E68 A;  5M5Y K;  3I4M K;  3S15 C;  1BS2 A;  1TWA C;  3M3Y K;  2JA5 C;  3GEI A;  4BKW A;  1R9T A;  4A3C C;  3MML B;  5IYD K;  2PMZ D;  2WB1 D;  5FJ8 K;  4KM9 A;  3HOZ K;  4A3L C;  1I50 A;  4C2M C;  1USM A;  3QX3 A;  3K7A C;  4C3I C;  1L0W A;  2P5M A;  5JFE A;  1SMY A;  3BP8 C;  2NVQ C;  5EGE A;  3GTK A;  4C2M K;  2WB1 L;  3RZO C;  3H3V L;  2KWA A;  4C3H K;  3K7A K;  1YX2 A;  1SFO C;  1DCP A;  1K83 C;  2XCQ A;  4JK1 A;  4A3E C;  4BXX K;  2ZUE A;  4BBS C;  3BUE A;  1XZQ B;  1Y1W A;  1WCM A;  3FOF A;  4Y7N C;  4X6A C;  3CQZ C;  1VLO A;  1J6W A;  2NVY K;  3GTP C;  1R9T C;  1VGX A;  1JOE A;  1JQW A;  1SFO K;  1VRQ C;  2CFA B;  1PJ5 A;  4LR2 A;  2YU9 C;  4XCH A;  2CW0 A;  1WOO A;  2E2H K;  4A3B C;  1XZP A;  1TWF K;  4Y7N K;  3HKZ D;  3A8J A;  3CQZ K;  4GTB A;  3GTO C;  4YFN A;  3GTP K;  2GAG C;  4QJV A;  1IBA A;  1TWH K;  5M5W K;  1WQF A;  3TTG A;  1J6V A;  2YU9 K;  2R92 A;  2A6H A;  1AB4 A;  4A3B K;  1YCL A;  4FM9 A;  3HKZ L;  4OIQ A;  2A69 A;  4GTF A;  4A3K K;  3HOU C;  4C3J C;  1VH2 A;  4AH6 A;  4PAB A;  2RH6 A;  1XPP A;  3S2H K;  1TWC C;  4BY7 K;  2BE5 A;  4OIP A;  4OIN A;  3S17 C;  3A8I A;  4FZB A;  4A3G C;  2WAQ L;  1O28 A;  1TWA A;  2P8T A;  2R7Z C;  3HOU K;  5CJ9 A;  4C3J K;  4PAA A;  3S2D C;  4KN4 A;  3GTG K;  3HOX C;  3ORE A;  5IP7 C;  1RU0 A;  3S17 K;  1JVI A;  4P5B A;  5C44 C;  3VA7 A;  2R7Z K;  4LJZ A;  3T02 A;  4A3M C;  3GTL C;  3S2D K;  2Y0S L;  4KAR A;  2NVY A;  3M3Y C;  2W7V A;  5M3M K;  1IL2 A;  1DCH A;  3V4G A;  4KC6 A;  5IYD C;  1SFO A;  2NVT K;  3HOZ C;  1G51 A;  1K83 A;  3HOY K;  5CHP A;  3FOE A;  4QIW D;  3ERE D;  4ZH4 A;  1XXB A;  5C44 K;  2E2H A;  2PHC B;  3CQZ A;  4A3M K;  4BBR C;  3HXA A;  2B63 C;  3GTL K;  3GTP A;  3LAJ A;  1TWH A;  2V6T A;  3JST A;  4LQY A;  3H3V D;  1EFW A;  1ZYR A;  3A8K A;  2NVX K;  3ADA C;  2YU9 A;  4C3H C;  2FQO A;  2VUM C;  4QIW L;  4BXX C;  5JVO A;  1ISE A;  4BBR K;  3N0B A;  1XZP B;  2B63 K;  3GTO A;  4QJV B;  2NVY C;  3GTQ C;  1TWG C;  5D4D A;  1O26 A;  2VUM K;  3GSI A;  1BDF A;  3TFH A;  2O5J A;  2E2H C;  1KQ4 A;  1TWF C;  4KM8 A;  3I4N C;  1WIH A;  3S16 C;  3GTJ C;  2GSU A;  1WQG A;  4KAW X;  3H0G K;  3GTQ K;  1O24 A;  1TWG K;  5L46 A;  1O29 A;  4XLN A;  1TWH C;  1TWC A;  3AD8 C;  4GTL A;  1WSV A;  4G0W A;  2O5I A;  1I6H K;  5IYB C;  4J3N A;  4A3I C;  4A3J C;  1HQM A;  1X31 C;  1ZQ1 C;  1INN A;  2R7Z A;  4KMD A;  3I4N K;  3S16 K;  3GTJ K;  1B4B A;  3RZD K;  4A3K C;  4C45 A;  4DDQ A;  1F7V A;  1PJ6 A;  4KB2 A;  5IYB K;  3S2H C;  3G4A A;  1O27 A;  4A3I K;  4KMH A;  4A3J K;  2JA6 K;  1F9N A;  4BY7 C;  3SZY A;  3Q3Q A;  2E2J K;  2V6U A;  1ZXO A;  2WAQ D;  4YG2 A;  3GTL A;  1I3Q C;  3PO2 K;  4KDD A;  4GZY A;  1F7U A;  2PA8 D;  3GTM C;  4ILD A;  1PJ7 A;  4GFQ A;  4G0U A;  1VJE A;  2NVX A;  3GTG C;  5TMC A;  2PPB A;  3WOD A;  4LK0 A;  4Q4Z A;  4G7H A;  3LAP A;  1I3Q K;  5C4J C;  3OPF A;  2B63 A;  1HI9 A;  3AD7 C;  1XZQ A;  4M1X A;  2Y0S D;  4AYB D;  3GTM K;  3OEP A;  5IOR A;  1ZVU A;  2PA8 L;  5TMF A;  4LK1 A;  3T00 A;  2VUM A;  2NVT C;  1WSR A;  3HOY C;  1Y1V K;  2XCO A;  5IOQ A;  5C4J K;  2GAH C;  1V5V A;  1ZBS A;  5C3E C;  1YNJ A;  1Y1W K;  4KAS A;  4G0V A;  4AYB L;  3GTQ A;  4GTA A;  1TWG A;  5FLM K;  1BGW A;  3HOV C;  1O2A A;  4GTC A;  4MEY A;  2E2I C;  2NVX C;  3AD9 C;  2FQT A;  3AH5 A;  5IYC C;  4KAT A;  4O2D A;  2D6F C;  3BP3 A;  1TWF A;  4MEX A;  4A3F K;  5C3E K;  3S14 C;  3GTJ A;  4A3D K;  2JA7 C;  1XXA A;  3S1M K;  3HOV K;  2E2I K;  5IYC K;  3S1R C;  1WOP A;  2JA6 A;  1EI6 A;  1DD5 A;  4OIO A;  1O2B A;  3S14 K;  4OIR A;  3PO3 C;  4YFX A;  5IOS A;  2JA7 K;  1IW7 A;  3T01 A;  4WJ4 A;  3H0G C;  2JA8 C;  4BLA A;  1USO A;  3S1R K;  3TFJ A;  1I6H C;  1IE0 A;  4LOW A;  1EK8 A;  3PO3 K;  1BJT A;  1I3Q A;  4KB4 A;  3GTM A;  2ZFZ A;  1B4A A;  3S15 K;  1EQR A;  2EBB A;  1TWA K;  3FKI C;  2JA5 K;  5EGH A;  3RZD C;  4A3C K;  3N0C A;  2JA8 K;  3GTG A;  3DXJ A;  3GDZ A;  4A3L K;  1IQ0 A;  2PMZ L;  2R93 C;  1Y1V A;  5IOT A;  2JA6 C;  4C3I K;  4XSZ A;  1EH1 A;  1WOS A;  2E2J C;  3S1Q C;  1GE9 A;  4G7Z A;  2NVQ K;  3FKI K;  2RGR A;  3PO2 C;  1WOR A;  1O25 A;  4GTE A;  4P9S A;  4RMF A;  4YFK A;  2XCR B;  1J6X A;  2A68 A;  4BLB A;  3AQP A;  2GSO A;  3RZO K;  3SZZ A;  4Y52 C;  2R93 K;  2GSN A;  1I50 C;  1K83 K;  4A3E K;  3S1Q K;  3AQO A;  3IPJ A;  5HL8 A;  3L4K A;  4BBS K;  2ZUF A;  4X6A K;  1IS1 A;  3HOW C;  1F93 A;  3EQL A;  1R9T K;  2E2I A;  4KN7 A;  5C4X C;  4Y52 K;  4A93 C;  3GTK C;  1I50 K;  4WIL A;  1Y1V C;  3G4C A;  2JA7 A;  2A6E A;  3M4O C;  4Q5S A;  1DCO A;  3HOW K;  3S0X A;  1Y1W C;  3GTO K;  1WCM C;  4GT9 A;  4XLP A;  5C4X K;  1J98 A;  4A93 K;  5FLM C;  3GTK K;  2CFA A;  1C0A A;  3FHZ A;  1O2F B;  3GEE A;  1UV7 A;  2JH3 A;  3M4O K;  4A3F C;  3NUH A;  4BY1 C;  1I6V A;  1WCM K;  4A3D C;  3H0G A;  2JA5 A;  1YNN A; 
#chains in the Genus database with same CATH homology
 3H0G K;  3GTQ K;  2A6H A;  4OIO A;  4A3B K;  4KMU A;  1TWG K;  3S1M C;  4XLN A;  3S14 K;  1TWH C;  4OIR A;  3PO3 C;  1TWC K;  4MQ9 A;  4YFX A;  5M3F K;  2JA7 K;  2O5I A;  3HKZ L;  5IYB C;  1IW7 A;  4OIQ A;  2A69 A;  3S1N C;  1I6H K;  4A3K K;  4A3I C;  4A3J C;  3HOU C;  1HQM A;  3H0G C;  2JA8 C;  4BY1 K;  2R92 C;  4NOI A;  3S1R K;  1XPP A;  3I4N K;  4A3G K;  3S2H K;  3S16 K;  5IP9 C;  3GTJ K;  1TWC C;  4BY7 K;  1I6H C;  4G7O A;  3RZD K;  3I4M C;  2BE5 A;  4A3K C;  4OIP A;  3PO3 K;  4OIN A;  3S17 C;  4XSX A;  3HOX K;  4LLG A;  5IP7 K;  5IYB K;  4A3G C;  2WAQ L;  3S1N K;  3S2H C;  2R7Z C;  3S15 K;  5M5X K;  2JA6 K;  4A3I K;  4A3J K;  1TWA K;  3FKI C;  3HOU K;  4BY7 C;  4C3J K;  2JA5 K;  3S2D C;  3RZD C;  4KN4 A;  2E2J K;  2JA8 K;  4A3C K;  2R92 K;  3DXJ A;  2WAQ D;  3GTG K;  4YG2 A;  5IP9 K;  3HOX C;  4A3L K;  4GZY A;  1I3Q C;  5M5Y K;  5IP7 C;  2PMZ L;  3PO2 K;  2PA8 D;  3I4M K;  3S15 C;  2R93 C;  2JA6 C;  3GTM C;  4C3I K;  4XSZ A;  1TWA C;  3M3Y K;  2JA5 C;  2E2J C;  3S17 K;  3S1Q C;  4A3C C;  5IYD K;  2PMZ D;  2WB1 D;  5FJ8 K;  5C44 C;  3GTG C;  2R7Z K;  4G7Z A;  3HOZ K;  2NVQ K;  4A3L C;  5TMC A;  3FKI K;  4LJZ A;  3PO2 C;  4A3M C;  2PPB A;  3WOD A;  3GTL C;  3S2D K;  2Y0S L;  3K7A C;  4LK0 A;  4YFK A;  4Q4Z A;  4G7H A;  3M3Y C;  2A68 A;  5M3M K;  1I3Q K;  5C4J C;  5IYD C;  1SMY A;  3RZO K;  2Y0S D;  4Y52 C;  2R93 K;  4AYB D;  2NVQ C;  2NVT K;  3GTM K;  3HOY K;  3HOZ C;  2PA8 L;  1I50 C;  1K83 K;  4QIW D;  4A3E K;  3S1Q K;  4ZH4 A;  5C44 K;  5TMF A;  4LK1 A;  4BBS K;  4C2M K;  2WB1 L;  4A3M K;  4BBR C;  3H3V L;  3GTL K;  2B63 C;  4C3H K;  3RZO C;  4X6A K;  3K7A K;  2NVT C;  1SFO C;  3HOY C;  3HOW C;  1Y1V K;  4BXX K;  1K83 C;  4A3E C;  4JK1 A;  3EQL A;  5C4J K;  1R9T K;  5C4X C;  4KN7 A;  3H3V D;  4Y52 K;  4BBS C;  4A93 C;  1ZYR A;  2NVX K;  4Y7N C;  5C3E C;  1I50 K;  1YNJ A;  1Y1W K;  3GTK C;  4X6A C;  3CQZ C;  4AYB L;  2VUM C;  1Y1V C;  4QIW L;  4BXX C;  2NVY K;  3GTP C;  5FLM K;  1R9T C;  4BBR K;  2B63 K;  3HOV C;  2A6E A;  4MEY A;  2E2I C;  1SFO K;  2NVX C;  3HOW K;  3M4O C;  4Q5S A;  5IYC C;  1Y1W C;  3GTO K;  1WCM C;  2YU9 C;  4XLP A;  5C4X K;  2CW0 A;  4QJV B;  2NVY C;  4A93 K;  2E2H K;  3GTQ C;  4MEX A;  5FLM C;  4A3F K;  4A3B C;  1TWF K;  1TWG C;  5C3E K;  4Y7N K;  3GTK K;  3HKZ D;  3S14 C;  3CQZ K;  4A3D K;  5D4D A;  2VUM K;  2JA7 C;  3GTO C;  4YFN A;  3GTP K;  4QJV A;  3S1M K;  1TWH K;  1BDF A;  5M5W K;  3HOV K;  2O5J A;  2E2H C;  2E2I K;  3M4O K;  4A3F C;  4BY1 C;  1TWF C;  5IYC K;  3S1R C;  1I6V A;  1WCM K;  3I4N C;  2YU9 K;  3S16 C;  4A3D C;  3GTJ C;  1YNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...