1J6VA

Crystal structure of d. radiodurans luxs, c2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 35
structure length 151
sequence length 151
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6vA00
1J6VA 1YCLA 1VH2A 1INNA 2FQTA 1JVIA 1VGXA 4XCHA 1J98A 1JQWA 1J6XA 1J6WA 1VJEA 2FQOA 1JOEA 5E68A 1IE0A
chains in the Genus database with same CATH superfamily
4KMUA 4G0WA 2NVYC 4C3IK 1BJTA 2O5JA 5C3EK 4YFKA 3S15K 2JA7A 5E68A 4PABA 5C4JK 5L46A 4PAAA 3GTLK 3L4JA 3IPJA 2R92K 5EGHA 4KB4A 5C44K 3T01A 4A3KC 1XZQA 4LLGA 5IOTA 3M4OK 2JH3A 1HQMA 4A3FK 3H0GA 3V4GA 1GE9A 5IP9C 2PMZL 1PJ6A 4O2DA 4DDQA 4A3CC 1WCMA 2R93C 4BY7K 4WJ3M 1TWGC 2E2HA 4C3JK 1WOSA 4BXXC 1SFOA 3GTJA 4A3JC 1JQWA 4G0VA 3TFHA 2P5MA 3GTOA 5IOQA 2W7VA 3TFIA 2JA7K 1J6WA 2P8TA 4LR2A 5JFEA 4A3EK 1V5VA 2NVTK 3GTPK 4GTAA 2A6EA 3GTGK 2JA6K 3SZZA 4G7ZA 3OPFA 4KATA 3S0XA 3S1NC 5D4DA 3S14C 1XXCA 4WILA 2EBBA 2WB1D 3S1QK 1WQFA 2RH6A 1PJ7A 1DD5A 3VA7A 1JVIA 4ILDA 3OREA 3HOUK 3PO2K 1IBAA 3OEPA 1F93A 1EK8A 4KM9A 3GSIA 4KMAA 1WOOA 1WCMK 3S1MC 3EQLA 3AQPA 2E2HK 2B63K 4A93C 4BLAA 1K83C 3ERED 5IYDC 3A8JA 3S17C 1I6HC 3RZOK 1SFOK 5IOSA 3ADAC 4AH6A 1TWHC 1X31C 3GTOK 2V6UA 5C4XK 2R93A 4A3IK 1WSRA 3AD7C 2A69A 1TWGA 4OINA 4A3GK 3H0GC 1I3QC 3AD9C 2E2JK 2WB1L 1O2BA 4G7HA 5IYCK 4ZH4A 3RZDC 2V6SA 3FKIC 2NVYK 1YX2A 4XSZA 3T00A 3GTQC 4GTEA 2A68A 4XLPA 1TWFC 1O25A 4YFXA 1I50A 4KARA 3K7AC 2R7ZC 3HKZD 3Q3QA 4A3KK 1IQ0A 1TWAC 1YNJA 2NVXC 4FM9A 4JK1A 4GFQA 3S2HC 4A3BC 3PO3C 5IP9K 1VJEA 4KB2A 3GDZA 4A3CK 2R93K 4KN7A 3FOFA 3I4NK 3GTMC 1XZQB 3S2DC 1DCOA 1XXAA 3GEEA 3DXJA 1K83A 4Y52C 1VRQC 3GEHA 4BXXK 5CHPA 4A3JK 1TWHA 5IP7K 1JOEA 5JVOA 5IYBK 4QIWD 4BY1K 1KQ4A 3GEIA 1Y1VC 1O24A 1ISEA 3I4MC 1YCLA 1I3QA 3HKZL 3S1NK 3S14K 3QX3A 4X6AK 3FKIA 2BE5A 3BUEA 3A8IA 3GTQA 4QJVB 3AD8C 5EGEA 3HXAA 1J98A 3CQZC 1TWFA 4YFNA 1ZBSA 3HOYK 2R7ZA 4QJVA 1DCPA 1R9TA 4Q4ZA 5M3MK 3S1MK 1TWAA 5CJ9A 4A3BK 4WJ4A 2PHCB 4XCHA 2NVXA 1UV7A 1XPPA 5M5WK 4A93K 1K83K 3SZYA 1I50C 1XZPB 3S17K 4YG2A 4QIWL 4GTLA 1TWHK 5TMCA 5M3FK 2FQOA 2R92C 1WOPA 3HOVC 4GTCA 3HOXK 5C44C 1O2AA 2VUMC 1XZPA 5IORA 2O5IA 3GTMA 3BP8C 3M4OC 3H0GK 4KDDA 1I3QK 2CFAB 3S16C 4M1XA 1SMYA 3RZDK 1ZYRA 3FKIK 2GSNA 2CFAA 1Y1VA 4FZBA 5M5XK 3GTJK 4OIPA 1TWFK 1TWCC 3K7AK 2R7ZK 1Y1WC 3NUHA 1VGXA 4KMHA 2XCRB 2JA5C 4J3NA 3AQOA 2NVXK 3HOZC 2ZFZA 3HOWC 3LAJA 3CQZA 2NVTC 3GTPC 4RMFA 3S2HK 4LQYA 3GIRA 4Y7NC 3GTGC 5TMFA 1IW7A 3TTGA 3PO3K 1PJ5A 4KAWX 4GTDA 2A6HA 2XCOA 3S1RC 2GAHC 1USMA 4A3DC 1RU0A 2JA8C 1VH2A 1DCHA 1IS1A 3GTMK 3S2DK 1USOA 4Y52K 5HL8A 4MQ9A 1XXBA 1J6XA 1R9TC 2V6TA 1BDFA 2R92A 4C2MC 2VUMA 4GTBA 1IE0A 4P5AA 4BLBA 3I4MK 4C3HC 2B63C 2YU9C 3JSTA 3T02A 4KM8A 4Q5SA 1TWGK 3L4KA 4A3IC 5FLMC 2GSOA 1WQHA 4KN4A 4BBRC 1O27A 4GTFA 4BBSC 1TWCA 1Y1WA 2E2JC 2ZUEA 3M3YC 3G4AA 2E2IC 4A3LC 5IYCC 2NVQC 1G51A 2JA5A 1B4AA 2D6FC 4OIOA 1EH1A 3FHZA 1I50K 3GTPA 4XSXA 3GTGA 2JA6A 2CW0A 3GTKC 2GSUA 3HOVK 1VLOA 1WSVA 2VUMK 1O26A 1F9NA 2Y0SD 2WAQD 4A3MC 2ZUFA 3AH5A 3LPXA 1IL2A 1AB4A 3FOEA 1INNA 4P5BA 3S16K 4G7OA 4LK1A 4KC6A 4NOIA 4C3IC 1C0AA 3N3YA 5C3EC 3S15C 4LOWA 5C4JC 5IYDK 1I6HK 5TJ3A 3I4NC 2B63A 1F7VA 3GTLC 4AYBD 1TWCK 1Y1WK 2YU9A 4G0UA 5IP7C 5IYBC 2JA5K 3CAGA 1HI9A 3TFJA 4BY1C 1I6VA 2PPBA 3HOZK 4A3FC 3HOWK 4LK0A 3H3VD 4KMDA 4Y7NK 4MEYA 1O2FB 2KWAA 2WAQL 2Y0SL 2E2IA 2Y3PA 3GTQK 4X6AC 3S1RK 2NVYA 1BS2A 4A3DK 4BY7C 2JA8K 1EI6A 1L0WA 3BP3A 4C3JC 4GT9A 4KASA 1J6VA 3GTKA 2PA8D 1R9TK 3HOYC 1B4BA 4C2MK 1TWAK 1ZXOA 1ZQ1C 2JA7C 4AYBL 1WIHA 4A3EC 1EFWA 1YNNA 1BGWA 4C3HK 2JA6C 4C45A 2YU9K 2XCQA 4P9SA 3G4CA 4OIQA 5M5YK 3HOXC 1O29A 5FLMK 3S1QC 1EQRA 3H3VL 3N0BA 3MMLB 4BBRK 3GTLA 2RGRA 3A8KA 4MEXA 4BBSK 1WQGA 3HOUC 2GAGC 3PO2C 4LJZA 3M3YK 4OIRA 2E2IK 4A3LK 2NVQK 1WCMC 1WORA 1Y1VK 1F7UA 3WODA 2E2HC 1ZVUA 1O28A 2PA8L 4XLNA 3N0CA 3RZOC 1SFOC 3GTJC 3GTKK 5FJ8K 3GTOC 5C4XC 4GZYA 2PMZD 4A3MK 4A3GC 3CQZK 4BKWA 2FQTA 3LAPA
chains in the Genus database with same CATH topology
1J6VA 1YCLA 1VH2A 1INNA 2FQTA 1JVIA 1VGXA 4XCHA 1J98A 1JQWA 1J6XA 1J6WA 1VJEA 2FQOA 1JOEA 5E68A 1IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6V A;  1YCL A;  1VH2 A;  1INN A;  2FQT A;  1JVI A;  1VGX A;  4XCH A;  1J98 A;  1JQW A;  1J6X A;  1J6W A;  1VJE A;  2FQO A;  1JOE A;  5E68 A;  1IE0 A; 
#chains in the Genus database with same CATH topology
 4KMU A;  4G0W A;  2NVY C;  4C3I K;  1BJT A;  2O5J A;  5C3E K;  4YFK A;  3S15 K;  2JA7 A;  5E68 A;  4PAB A;  5C4J K;  5L46 A;  4PAA A;  3GTL K;  3L4J A;  3IPJ A;  2R92 K;  5EGH A;  4KB4 A;  5C44 K;  3T01 A;  4A3K C;  1XZQ A;  4LLG A;  5IOT A;  3M4O K;  2JH3 A;  1HQM A;  4A3F K;  3H0G A;  3V4G A;  1GE9 A;  5IP9 C;  2PMZ L;  1PJ6 A;  4O2D A;  4DDQ A;  4A3C C;  1WCM A;  2R93 C;  4BY7 K;  4WJ3 M;  1TWG C;  2E2H A;  4C3J K;  1WOS A;  4BXX C;  1SFO A;  3GTJ A;  4A3J C;  1JQW A;  4G0V A;  3TFH A;  2P5M A;  3GTO A;  5IOQ A;  2W7V A;  3TFI A;  2JA7 K;  1J6W A;  2P8T A;  4LR2 A;  5JFE A;  4A3E K;  1V5V A;  2NVT K;  3GTP K;  4GTA A;  2A6E A;  3GTG K;  2JA6 K;  3SZZ A;  4G7Z A;  3OPF A;  4KAT A;  3S0X A;  3S1N C;  5D4D A;  3S14 C;  1XXC A;  4WIL A;  2EBB A;  2WB1 D;  3S1Q K;  1WQF A;  2RH6 A;  1PJ7 A;  1DD5 A;  3VA7 A;  1JVI A;  4ILD A;  3ORE A;  3HOU K;  3PO2 K;  1IBA A;  3OEP A;  1F93 A;  1EK8 A;  4KM9 A;  3GSI A;  4KMA A;  1WOO A;  1WCM K;  3S1M C;  3EQL A;  3AQP A;  2E2H K;  2B63 K;  4A93 C;  4BLA A;  1K83 C;  3ERE D;  5IYD C;  3A8J A;  3S17 C;  1I6H C;  3RZO K;  1SFO K;  5IOS A;  3ADA C;  4AH6 A;  1TWH C;  1X31 C;  3GTO K;  2V6U A;  5C4X K;  2R93 A;  4A3I K;  1WSR A;  3AD7 C;  2A69 A;  1TWG A;  4OIN A;  4A3G K;  3H0G C;  1I3Q C;  3AD9 C;  2E2J K;  2WB1 L;  1O2B A;  4G7H A;  5IYC K;  4ZH4 A;  3RZD C;  2V6S A;  3FKI C;  2NVY K;  1YX2 A;  4XSZ A;  3T00 A;  3GTQ C;  4GTE A;  2A68 A;  4XLP A;  1TWF C;  1O25 A;  4YFX A;  1I50 A;  4KAR A;  3K7A C;  2R7Z C;  3HKZ D;  3Q3Q A;  4A3K K;  1IQ0 A;  1TWA C;  1YNJ A;  2NVX C;  4FM9 A;  4JK1 A;  4GFQ A;  3S2H C;  4A3B C;  3PO3 C;  5IP9 K;  1VJE A;  4KB2 A;  3GDZ A;  4A3C K;  2R93 K;  4KN7 A;  3FOF A;  3I4N K;  3GTM C;  1XZQ B;  3S2D C;  1DCO A;  1XXA A;  3GEE A;  3DXJ A;  1K83 A;  4Y52 C;  1VRQ C;  3GEH A;  4BXX K;  5CHP A;  4A3J K;  1TWH A;  5IP7 K;  1JOE A;  5JVO A;  5IYB K;  4QIW D;  4BY1 K;  1KQ4 A;  3GEI A;  1Y1V C;  1O24 A;  1ISE A;  3I4M C;  1YCL A;  1I3Q A;  3HKZ L;  3S1N K;  3S14 K;  3QX3 A;  4X6A K;  3FKI A;  2BE5 A;  3BUE A;  3A8I A;  3GTQ A;  4QJV B;  3AD8 C;  5EGE A;  3HXA A;  1J98 A;  3CQZ C;  1TWF A;  4YFN A;  1ZBS A;  3HOY K;  2R7Z A;  4QJV A;  1DCP A;  1R9T A;  4Q4Z A;  5M3M K;  3S1M K;  1TWA A;  5CJ9 A;  4A3B K;  4WJ4 A;  2PHC B;  4XCH A;  2NVX A;  1UV7 A;  1XPP A;  5M5W K;  4A93 K;  1K83 K;  3SZY A;  1I50 C;  1XZP B;  3S17 K;  4YG2 A;  4QIW L;  4GTL A;  1TWH K;  5TMC A;  5M3F K;  2FQO A;  2R92 C;  1WOP A;  3HOV C;  4GTC A;  3HOX K;  5C44 C;  1O2A A;  2VUM C;  1XZP A;  5IOR A;  2O5I A;  3GTM A;  3BP8 C;  3M4O C;  3H0G K;  4KDD A;  1I3Q K;  2CFA B;  3S16 C;  4M1X A;  1SMY A;  3RZD K;  1ZYR A;  3FKI K;  2GSN A;  2CFA A;  1Y1V A;  4FZB A;  5M5X K;  3GTJ K;  4OIP A;  1TWF K;  1TWC C;  3K7A K;  2R7Z K;  1Y1W C;  3NUH A;  1VGX A;  4KMH A;  2XCR B;  2JA5 C;  4J3N A;  3AQO A;  2NVX K;  3HOZ C;  2ZFZ A;  3HOW C;  3LAJ A;  3CQZ A;  2NVT C;  3GTP C;  4RMF A;  3S2H K;  4LQY A;  3GIR A;  4Y7N C;  3GTG C;  5TMF A;  1IW7 A;  3TTG A;  3PO3 K;  1PJ5 A;  4KAW X;  4GTD A;  2A6H A;  2XCO A;  3S1R C;  2GAH C;  1USM A;  4A3D C;  1RU0 A;  2JA8 C;  1VH2 A;  1DCH A;  1IS1 A;  3GTM K;  3S2D K;  1USO A;  4Y52 K;  5HL8 A;  4MQ9 A;  1XXB A;  1J6X A;  1R9T C;  2V6T A;  1BDF A;  2R92 A;  4C2M C;  2VUM A;  4GTB A;  1IE0 A;  4P5A A;  4BLB A;  3I4M K;  4C3H C;  2B63 C;  2YU9 C;  3JST A;  3T02 A;  4KM8 A;  4Q5S A;  1TWG K;  3L4K A;  4A3I C;  5FLM C;  2GSO A;  1WQH A;  4KN4 A;  4BBR C;  1O27 A;  4GTF A;  4BBS C;  1TWC A;  1Y1W A;  2E2J C;  2ZUE A;  3M3Y C;  3G4A A;  2E2I C;  4A3L C;  5IYC C;  2NVQ C;  1G51 A;  2JA5 A;  1B4A A;  2D6F C;  4OIO A;  1EH1 A;  3FHZ A;  1I50 K;  3GTP A;  4XSX A;  3GTG A;  2JA6 A;  2CW0 A;  3GTK C;  2GSU A;  3HOV K;  1VLO A;  1WSV A;  2VUM K;  1O26 A;  1F9N A;  2Y0S D;  2WAQ D;  4A3M C;  2ZUF A;  3AH5 A;  3LPX A;  1IL2 A;  1AB4 A;  3FOE A;  1INN A;  4P5B A;  3S16 K;  4G7O A;  4LK1 A;  4KC6 A;  4NOI A;  4C3I C;  1C0A A;  3N3Y A;  5C3E C;  3S15 C;  4LOW A;  5C4J C;  5IYD K;  1I6H K;  5TJ3 A;  3I4N C;  2B63 A;  1F7V A;  3GTL C;  4AYB D;  1TWC K;  1Y1W K;  2YU9 A;  4G0U A;  5IP7 C;  5IYB C;  2JA5 K;  3CAG A;  1HI9 A;  3TFJ A;  4BY1 C;  1I6V A;  2PPB A;  3HOZ K;  4A3F C;  3HOW K;  4LK0 A;  3H3V D;  4KMD A;  4Y7N K;  4MEY A;  1O2F B;  2KWA A;  2WAQ L;  2Y0S L;  2E2I A;  2Y3P A;  3GTQ K;  4X6A C;  3S1R K;  2NVY A;  1BS2 A;  4A3D K;  4BY7 C;  2JA8 K;  1EI6 A;  1L0W A;  3BP3 A;  4C3J C;  4GT9 A;  4KAS A;  1J6V A;  3GTK A;  2PA8 D;  1R9T K;  3HOY C;  1B4B A;  4C2M K;  1TWA K;  1ZXO A;  1ZQ1 C;  2JA7 C;  4AYB L;  1WIH A;  4A3E C;  1EFW A;  1YNN A;  1BGW A;  4C3H K;  2JA6 C;  4C45 A;  2YU9 K;  2XCQ A;  4P9S A;  3G4C A;  4OIQ A;  5M5Y K;  3HOX C;  1O29 A;  5FLM K;  3S1Q C;  1EQR A;  3H3V L;  3N0B A;  3MML B;  4BBR K;  3GTL A;  2RGR A;  3A8K A;  4MEX A;  4BBS K;  1WQG A;  3HOU C;  2GAG C;  3PO2 C;  4LJZ A;  3M3Y K;  4OIR A;  2E2I K;  4A3L K;  2NVQ K;  1WCM C;  1WOR A;  1Y1V K;  1F7U A;  3WOD A;  2E2H C;  1ZVU A;  1O28 A;  2PA8 L;  4XLN A;  3N0C A;  3RZO C;  1SFO C;  3GTJ C;  3GTK K;  5FJ8 K;  3GTO C;  5C4X C;  4GZY A;  2PMZ D;  4A3M K;  4A3G C;  3CQZ K;  4BKW A;  2FQT A;  3LAP A; 
#chains in the Genus database with same CATH homology
 1J6V A;  1YCL A;  1VH2 A;  1INN A;  2FQT A;  1JVI A;  1VGX A;  4XCH A;  1J98 A;  1JQW A;  1J6X A;  1J6W A;  1VJE A;  2FQO A;  1JOE A;  5E68 A;  1IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...