1J6VA

Crystal structure of d. radiodurans luxs, c2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Signaling protein
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
total genus 35
structure length 151
sequence length 151
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6vA00
1JQWA 1J98A 1J6XA 1VJEA 1YCLA 2FQTA 1J6VA 5E68A 4XCHA 1IE0A 1JOEA 1VH2A 2FQOA 1VGXA 1JVIA 1INNA 1J6WA
chains in the Genus database with same CATH superfamily
3S14C 1TWGA 1BDFA 3GIRA 5C4XK 1PJ6A 2CW0A 1G51A 3V4GA 4OIRA 2B63C 3DXJA 4BXXK 2JA6C 5FJ8K 2JA5C 4GT9A 3OEPA 3FOEA 4A3KC 3FKIA 1XZQB 1YNJA 2PMZL 3RZDK 5M5WK 5IORA 4XCHA 1I6VA 2O5IA 4KAWX 1WCMK 4BY7K 3EQLA 1TWGK 1XZPB 4GZYA 2E2IC 3S1RK 3RZOC 1O26A 4GTBA 1WOSA 1EFWA 4MQ9A 2GSOA 3GTMC 2YU9A 3HOXK 4G0VA 4LJZA 3BP8C 1TWGC 3CQZK 1F9NA 2VUMK 3N0CA 3HOYC 2JA5A 4Y7NC 3GTLC 2PA8D 5E68A 1ZXOA 4A3CK 3I4MC 4GFQA 3TFIA 3FOFA 5C3EC 2R92C 3GTLK 4G0WA 3HOYK 3GDZA 4C3JK 2E2IA 1I50A 4X6AK 1YNNA 2R92A 3FKIC 4A3IK 3K7AK 3S1MK 5IYBK 4A3KK 2RGRA 3HOVK 4OIOA 4XSXA 2NVYK 2GSNA 1IQ0A 2ZUFA 1ZBSA 5CHPA 1GE9A 3S2HK 5IYDK 4A3GC 4A3JC 1TWAC 4C3HC 3GTJC 4G7OA 1HQMA 1TWCC 4JK1A 2VUMA 2E2HA 3S17K 3AH5A 1USMA 2WB1L 4AYBD 3HOZC 3HXAA 1J98A 4C3IC 3A8KA 3AD7C 1WSVA 1TWCK 1WQHA 3GTPK 3GTQC 3JSTA 4G7ZA 1PJ5A 1TWFK 4BBRK 1XXBA 3PO3C 3T01A 4RMFA 1B4BA 2R92K 5C3EK 1TWHA 4C2MK 4A3EC 3HOWK 3I4MK 1R9TA 1I3QC 3N3YA 2R93K 2GSUA 1TWHC 4A3FK 3S15K 1XZQA 2EBBA 1I6HK 3FKIK 2JH3A 5C4JC 3CQZC 5TMCA 2CFAB 2W7VA 4M1XA 3AQOA 2FQOA 1YCLA 3LPXA 4O2DA 3CQZA 1RU0A 1TWAA 3H0GA 3S17C 4QIWD 4QIWL 1Y1WC 3TTGA 5D4DA 2JA6A 3S2DC 2JA8K 4C3JC 3PO2C 3I4NC 2R7ZA 4GTEA 2NVYC 4OIPA 5IP9C 1XXCA 5IP7C 4ZH4A 1WSRA 2B63K 2D6FC 3S14K 3I4NK 2XCRB 4LK0A 3M3YK 4A3BK 3H0GK 4P9SA 4KB4A 1WIHA 4LK1A 3Q3QA 4YFNA 2NVTK 4G7HA 3S2DK 3S1QK 4KB2A 3ADAC 4YFKA 1UV7A 1WCMA 3GTPA 3VA7A 4XLNA 1I50K 5IYCK 2Y0SL 2E2IK 3RZOK 3HOUC 1WCMC 4KM9A 2B63A 2A6HA 2PMZD 2NVXA 4GTFA 2V6SA 1YX2A 5TJ3A 2NVXK 3GTOA 1SFOA 1BJTA 2P8TA 1ISEA 1V5VA 3BUEA 3HOWC 3S1NK 1I3QK 1VH2A 3GSIA 1AB4A 4C2MC 4A3EK 3GTQK 4BBSK 2R93A 2NVYA 4QJVB 1R9TK 1F7UA 1I6HC 1HI9A 4P5BA 3SZZA 5IYDC 2E2JC 3TFHA 1INNA 4GTLA 1XZPA 4LOWA 1ZVUA 3NUHA 2E2JK 2Y3PA 3A8IA 4C45A 3HOVC 2O5JA 2YU9C 4A3IC 4KMAA 1WQGA 2A69A 3N0BA 3M4OC 2PA8L 5L46A 1K83K 2JA7K 1PJ7A 3S16C 1F93A 3T00A 2V6TA 3GEIA 4GTCA 4MEXA 4QJVA 1IS1A 1USOA 1DCPA 1O28A 2ZUEA 1TWAK 3K7AC 1R9TC 1IBAA 5M5YK 3GTGC 2JA7A 4A93C 1Y1WK 3GTMK 1Y1VK 1K83A 2GAGC 3S1QC 5IYBC 1JOEA 5M3MK 4KMDA 5C44C 2VUMC 3GTGK 4X6AC 3OPFA 4Y7NK 5CJ9A 1IW7A 4KASA 3HOXC 3G4AA 1EH1A 4A3DC 1O27A 4A3CC 1JQWA 1TWCA 4A93K 4PAAA 4BLAA 4LQYA 3S1RC 3M3YC 4A3BC 1Y1VA 3RZDC 1I3QA 2KWAA 3QX3A 4BKWA 1XPPA 2JA5K 4GTDA 1VJEA 5C4XC 4BXXC 3GTJA 4NOIA 1O25A 3HKZL 4GTAA 2WAQD 1L0WA 3H3VL 3PO2K 4YFXA 1K83C 2YU9K 1J6VA 3IPJA 4YG2A 5JFEA 1EQRA 4A3GK 3LAJA 4BY1C 4WILA 3SZYA 1F7VA 1WOPA 1O2FB 4A3LK 4Q4ZA 3GTLA 1ZQ1C 5TMFA 4BBRC 2V6UA 1DCOA 4J3NA 3S1MC 3GTKK 4A3MC 4BY1K 1Y1WA 4BLBA 1VLOA 4P5AA 4ILDA 4BBSC 1KQ4A 2P5MA 4PABA 1TWHK 1J6XA 4KN7A 1I50C 3GEEA 2R93C 1WQFA 3S0XA 1BGWA 3PO3K 4KMUA 3TFJA 3H3VD 2NVTC 4Y52C 5EGEA 1C0AA 5C44K 4WJ3M 2ZFZA 3S1NC 2XCQA 3HOZK 4A3LC 3AQPA 1EK8A 4KN4A 1X31C 2WB1D 4AYBL 5EGHA 3G4CA 4FZBA 3H0GC 1IL2A 4A3JK 2JA8C 5IYCC 4KARA 2RH6A 1EI6A 1BS2A 2FQTA 5IP9K 5IP7K 4G0UA 1Y1VC 2R7ZC 1SFOC 3L4KA 5IOSA 2CFAA 3GEHA 4OINA 4BY7C 3WODA 5C4JK 1O29A 4Y52K 3LAPA 3GTOK 5IOTA 1DCHA 4FM9A 5M5XK 3MMLB 4KDDA 3L4JA 1SFOK 4LLGA 2R7ZK 2A6EA 1O2AA 4Q5SA 3AD9C 2XCOA 4A3DK 1DD5A 1VGXA 2JA6K 3HKZD 1B4AA 4WJ4A 4LR2A 1SMYA 3T02A 4XSZA 3M4OK 3OREA 3AD8C 4KMHA 4A3FC 3S15C 1WORA 2NVQC 3CAGA 4KM8A 4XLPA 3BP3A 2Y0SD 4MEYA 2BE5A 4C3IK 5JVOA 5M3FK 3GTQA 2JA7C 5FLMC 2NVQK 3GTGA 3A8JA 1WOOA 4OIQA 2E2HK 2GAHC 4DDQA 2PPBA 3S2HC 3GTMA 3GTPC 3HOUK 1O24A 5IOQA 1O2BA 3GTKC 5FLMK 3FHZA 1JVIA 1J6WA 2PHCB 1TWFA 4AH6A 3GTKA 3ERED 1VRQC 1ZYRA 3S16K 2A68A 1TWFC 4C3HK 1XXAA 3GTJK 5HL8A 2NVXC 2E2HC 2WAQL 4KC6A 1IE0A 3GTOC 4KATA 4A3MK
chains in the Genus database with same CATH topology
1JQWA 1J98A 1J6XA 1VJEA 1YCLA 2FQTA 1J6VA 5E68A 4XCHA 1IE0A 1JOEA 1VH2A 2FQOA 1VGXA 1JVIA 1INNA 1J6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  1J98 A;  1J6X A;  1VJE A;  1YCL A;  2FQT A;  1J6V A;  5E68 A;  4XCH A;  1IE0 A;  1JOE A;  1VH2 A;  2FQO A;  1VGX A;  1JVI A;  1INN A;  1J6W A; 
#chains in the Genus database with same CATH topology
 3S14 C;  1TWG A;  1BDF A;  3GIR A;  5C4X K;  1PJ6 A;  2CW0 A;  1G51 A;  3V4G A;  4OIR A;  2B63 C;  3DXJ A;  4BXX K;  2JA6 C;  5FJ8 K;  2JA5 C;  4GT9 A;  3OEP A;  3FOE A;  4A3K C;  3FKI A;  1XZQ B;  1YNJ A;  2PMZ L;  3RZD K;  5M5W K;  5IOR A;  4XCH A;  1I6V A;  2O5I A;  4KAW X;  1WCM K;  4BY7 K;  3EQL A;  1TWG K;  1XZP B;  4GZY A;  2E2I C;  3S1R K;  3RZO C;  1O26 A;  4GTB A;  1WOS A;  1EFW A;  4MQ9 A;  2GSO A;  3GTM C;  2YU9 A;  3HOX K;  4G0V A;  4LJZ A;  3BP8 C;  1TWG C;  3CQZ K;  1F9N A;  2VUM K;  3N0C A;  3HOY C;  2JA5 A;  4Y7N C;  3GTL C;  2PA8 D;  5E68 A;  1ZXO A;  4A3C K;  3I4M C;  4GFQ A;  3TFI A;  3FOF A;  5C3E C;  2R92 C;  3GTL K;  4G0W A;  3HOY K;  3GDZ A;  4C3J K;  2E2I A;  1I50 A;  4X6A K;  1YNN A;  2R92 A;  3FKI C;  4A3I K;  3K7A K;  3S1M K;  5IYB K;  4A3K K;  2RGR A;  3HOV K;  4OIO A;  4XSX A;  2NVY K;  2GSN A;  1IQ0 A;  2ZUF A;  1ZBS A;  5CHP A;  1GE9 A;  3S2H K;  5IYD K;  4A3G C;  4A3J C;  1TWA C;  4C3H C;  3GTJ C;  4G7O A;  1HQM A;  1TWC C;  4JK1 A;  2VUM A;  2E2H A;  3S17 K;  3AH5 A;  1USM A;  2WB1 L;  4AYB D;  3HOZ C;  3HXA A;  1J98 A;  4C3I C;  3A8K A;  3AD7 C;  1WSV A;  1TWC K;  1WQH A;  3GTP K;  3GTQ C;  3JST A;  4G7Z A;  1PJ5 A;  1TWF K;  4BBR K;  1XXB A;  3PO3 C;  3T01 A;  4RMF A;  1B4B A;  2R92 K;  5C3E K;  1TWH A;  4C2M K;  4A3E C;  3HOW K;  3I4M K;  1R9T A;  1I3Q C;  3N3Y A;  2R93 K;  2GSU A;  1TWH C;  4A3F K;  3S15 K;  1XZQ A;  2EBB A;  1I6H K;  3FKI K;  2JH3 A;  5C4J C;  3CQZ C;  5TMC A;  2CFA B;  2W7V A;  4M1X A;  3AQO A;  2FQO A;  1YCL A;  3LPX A;  4O2D A;  3CQZ A;  1RU0 A;  1TWA A;  3H0G A;  3S17 C;  4QIW D;  4QIW L;  1Y1W C;  3TTG A;  5D4D A;  2JA6 A;  3S2D C;  2JA8 K;  4C3J C;  3PO2 C;  3I4N C;  2R7Z A;  4GTE A;  2NVY C;  4OIP A;  5IP9 C;  1XXC A;  5IP7 C;  4ZH4 A;  1WSR A;  2B63 K;  2D6F C;  3S14 K;  3I4N K;  2XCR B;  4LK0 A;  3M3Y K;  4A3B K;  3H0G K;  4P9S A;  4KB4 A;  1WIH A;  4LK1 A;  3Q3Q A;  4YFN A;  2NVT K;  4G7H A;  3S2D K;  3S1Q K;  4KB2 A;  3ADA C;  4YFK A;  1UV7 A;  1WCM A;  3GTP A;  3VA7 A;  4XLN A;  1I50 K;  5IYC K;  2Y0S L;  2E2I K;  3RZO K;  3HOU C;  1WCM C;  4KM9 A;  2B63 A;  2A6H A;  2PMZ D;  2NVX A;  4GTF A;  2V6S A;  1YX2 A;  5TJ3 A;  2NVX K;  3GTO A;  1SFO A;  1BJT A;  2P8T A;  1ISE A;  1V5V A;  3BUE A;  3HOW C;  3S1N K;  1I3Q K;  1VH2 A;  3GSI A;  1AB4 A;  4C2M C;  4A3E K;  3GTQ K;  4BBS K;  2R93 A;  2NVY A;  4QJV B;  1R9T K;  1F7U A;  1I6H C;  1HI9 A;  4P5B A;  3SZZ A;  5IYD C;  2E2J C;  3TFH A;  1INN A;  4GTL A;  1XZP A;  4LOW A;  1ZVU A;  3NUH A;  2E2J K;  2Y3P A;  3A8I A;  4C45 A;  3HOV C;  2O5J A;  2YU9 C;  4A3I C;  4KMA A;  1WQG A;  2A69 A;  3N0B A;  3M4O C;  2PA8 L;  5L46 A;  1K83 K;  2JA7 K;  1PJ7 A;  3S16 C;  1F93 A;  3T00 A;  2V6T A;  3GEI A;  4GTC A;  4MEX A;  4QJV A;  1IS1 A;  1USO A;  1DCP A;  1O28 A;  2ZUE A;  1TWA K;  3K7A C;  1R9T C;  1IBA A;  5M5Y K;  3GTG C;  2JA7 A;  4A93 C;  1Y1W K;  3GTM K;  1Y1V K;  1K83 A;  2GAG C;  3S1Q C;  5IYB C;  1JOE A;  5M3M K;  4KMD A;  5C44 C;  2VUM C;  3GTG K;  4X6A C;  3OPF A;  4Y7N K;  5CJ9 A;  1IW7 A;  4KAS A;  3HOX C;  3G4A A;  1EH1 A;  4A3D C;  1O27 A;  4A3C C;  1JQW A;  1TWC A;  4A93 K;  4PAA A;  4BLA A;  4LQY A;  3S1R C;  3M3Y C;  4A3B C;  1Y1V A;  3RZD C;  1I3Q A;  2KWA A;  3QX3 A;  4BKW A;  1XPP A;  2JA5 K;  4GTD A;  1VJE A;  5C4X C;  4BXX C;  3GTJ A;  4NOI A;  1O25 A;  3HKZ L;  4GTA A;  2WAQ D;  1L0W A;  3H3V L;  3PO2 K;  4YFX A;  1K83 C;  2YU9 K;  1J6V A;  3IPJ A;  4YG2 A;  5JFE A;  1EQR A;  4A3G K;  3LAJ A;  4BY1 C;  4WIL A;  3SZY A;  1F7V A;  1WOP A;  1O2F B;  4A3L K;  4Q4Z A;  3GTL A;  1ZQ1 C;  5TMF A;  4BBR C;  2V6U A;  1DCO A;  4J3N A;  3S1M C;  3GTK K;  4A3M C;  4BY1 K;  1Y1W A;  4BLB A;  1VLO A;  4P5A A;  4ILD A;  4BBS C;  1KQ4 A;  2P5M A;  4PAB A;  1TWH K;  1J6X A;  4KN7 A;  1I50 C;  3GEE A;  2R93 C;  1WQF A;  3S0X A;  1BGW A;  3PO3 K;  4KMU A;  3TFJ A;  3H3V D;  2NVT C;  4Y52 C;  5EGE A;  1C0A A;  5C44 K;  4WJ3 M;  2ZFZ A;  3S1N C;  2XCQ A;  3HOZ K;  4A3L C;  3AQP A;  1EK8 A;  4KN4 A;  1X31 C;  2WB1 D;  4AYB L;  5EGH A;  3G4C A;  4FZB A;  3H0G C;  1IL2 A;  4A3J K;  2JA8 C;  5IYC C;  4KAR A;  2RH6 A;  1EI6 A;  1BS2 A;  2FQT A;  5IP9 K;  5IP7 K;  4G0U A;  1Y1V C;  2R7Z C;  1SFO C;  3L4K A;  5IOS A;  2CFA A;  3GEH A;  4OIN A;  4BY7 C;  3WOD A;  5C4J K;  1O29 A;  4Y52 K;  3LAP A;  3GTO K;  5IOT A;  1DCH A;  4FM9 A;  5M5X K;  3MML B;  4KDD A;  3L4J A;  1SFO K;  4LLG A;  2R7Z K;  2A6E A;  1O2A A;  4Q5S A;  3AD9 C;  2XCO A;  4A3D K;  1DD5 A;  1VGX A;  2JA6 K;  3HKZ D;  1B4A A;  4WJ4 A;  4LR2 A;  1SMY A;  3T02 A;  4XSZ A;  3M4O K;  3ORE A;  3AD8 C;  4KMH A;  4A3F C;  3S15 C;  1WOR A;  2NVQ C;  3CAG A;  4KM8 A;  4XLP A;  3BP3 A;  2Y0S D;  4MEY A;  2BE5 A;  4C3I K;  5JVO A;  5M3F K;  3GTQ A;  2JA7 C;  5FLM C;  2NVQ K;  3GTG A;  3A8J A;  1WOO A;  4OIQ A;  2E2H K;  2GAH C;  4DDQ A;  2PPB A;  3S2H C;  3GTM A;  3GTP C;  3HOU K;  1O24 A;  5IOQ A;  1O2B A;  3GTK C;  5FLM K;  3FHZ A;  1JVI A;  1J6W A;  2PHC B;  1TWF A;  4AH6 A;  3GTK A;  3ERE D;  1VRQ C;  1ZYR A;  3S16 K;  2A68 A;  1TWF C;  4C3H K;  1XXA A;  3GTJ K;  5HL8 A;  2NVX C;  2E2H C;  2WAQ L;  4KC6 A;  1IE0 A;  3GTO C;  4KAT A;  4A3M K; 
#chains in the Genus database with same CATH homology
 1JQW A;  1J98 A;  1J6X A;  1VJE A;  1YCL A;  2FQT A;  1J6V A;  5E68 A;  4XCH A;  1IE0 A;  1JOE A;  1VH2 A;  2FQO A;  1VGX A;  1JVI A;  1INN A;  1J6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...