1J6VA

Crystal structure of d. radiodurans luxs, c2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
VESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGCRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUTOINDUCER-2 PRODUCTION PROTEIN LUXS
publication title A structural genomics approach to the study of quorum sensing: crystal structures of three LuxS orthologs.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Signaling protein
total genus 35
structure length 151
sequence length 151
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1j6vA00
2FQTA 5E68A 4XCHA 1JQWA 1VGXA 1J6VA 1VH2A 1JVIA 1IE0A 1J98A 1JOEA 1INNA 1YCLA 1VJEA 1J6XA 2FQOA 1J6WA
chains in the Genus database with same CATH superfamily
4A3FC 4Q4ZA 2E2HK 3PO2C 3A8IA 3CQZC 4A3KK 4MEXA 3S1MK 3I4NC 3H0GA 4XLPA 1BGWA 1WQGA 2E2JK 3GTGA 5C3EC 4BBSK 4GZYA 2NVQC 2BE5A 2CW0A 2CFAA 4WILA 3S0XA 3SZYA 3M3YK 4MQ9A 4OIRA 3GTMA 3S14K 5TJ3A 1TWHK 4GTLA 4LK0A 5IYBC 2JA7C 3M4OC 4A3MK 1XXBA 3GTQC 1EH1A 4GTAA 5HL8A 4QIWL 2YU9C 4RMFA 1SMYA 1USOA 1J6WA 2PHCB 1B4BA 4AH6A 4NOIA 3GIRA 1WOOA 1ISEA 1C0AA 1I50K 5C4JC 1I6VA 2R93C 1HI9A 1VJEA 4KARA 2JA8K 1YNJA 4X6AK 1XZPB 5IYDC 3GTPA 3AD8C 5C44C 3A8JA 4KM9A 3S1NC 1USMA 2R92C 3BP3A 2A69A 3GTOC 4A93C 3L4KA 3TFIA 4A3GK 3PO3C 5EGHA 4Y7NK 1WQHA 5IYCC 1Y1WA 1WSRA 3S16C 4PABA 3T00A 3S2HC 5IORA 4A3IK 4KMAA 4A3KC 4KATA 3S1MC 2PPBA 2JA7A 1DD5A 2WB1L 4XSZA 2E2JC 2FQOA 4BBSC 4GT9A 1TWAK 4QJVB 3GTMC 2YU9A 1F93A 3M3YC 3VA7A 1DCOA 5TMFA 1F7UA 2A6EA 3N3YA 1BDFA 4GFQA 1IW7A 1SFOA 2R93A 5IOQA 2O5JA 2WAQD 4G0UA 3GEEA 4P9SA 4O2DA 5E68A 4A3EK 1JQWA 1I50C 4M1XA 2R92A 1I3QK 3GTOA 4OINA 5EGEA 4GTEA 4Q5SA 4X6AC 4ZH4A 1EI6A 2KWAA 4OIOA 3S1QC 2PMZD 4KMUA 5M3MK 4G7HA 1Y1VK 3HKZD 3BP8C 5M5XK 5CJ9A 1O24A 3QX3A 4A3GC 2E2HA 1ZVUA 4Y7NC 1Y1WC 2PA8D 4C3IK 1YNNA 1JVIA 2E2IK 2ZFZA 3I4MK 4LOWA 4AYBD 3HOXC 1XXCA 4A3IC 3HOZK 3HOVC 4LQYA 3HOWK 2VUMK 4Y52C 3T02A 4GTFA 5L46A 5FLMK 4A3DK 1TWHA 4KDDA 2ZUEA 2Y0SD 4XCHA 1XPPA 4JK1A 4OIPA 1IQ0A 2GSOA 3TFHA 5D4DA 4WJ3M 1VH2A 3RZOK 1TWGK 5IP7K 3GEHA 2GAHC 4PAAA 4J3NA 3GSIA 1V5VA 3K7AK 4KASA 1I50A 1SFOC 2JA6K 3ERED 2A6HA 2CFAB 4BBRK 1AB4A 3S17K 4LR2A 3V4GA 3TTGA 1XZQA 4OIQA 1O2FB 2GSUA 1IE0A 4A3EC 2EBBA 1I3QC 4BY7K 3BUEA 3HOUK 2XCRB 1BS2A 4KN4A 1TWCK 4G7OA 5IP9K 5JVOA 3GTJK 1GE9A 1Y1VC 1WCMK 3AD7C 3JSTA 2E2HC 2NVXK 5M3FK 1YCLA 3CQZK 4C3IC 4P5AA 2E2IC 2FQTA 2R7ZK 5TMCA 3I4MC 4GTDA 3AQPA 3HOZC 4BKWA 1TWAA 1ZBSA 3HOWC 2NVTK 4BLBA 2VUMC 3S14C 4YG2A 1TWHC 4C3HK 4A3BK 5FLMC 4LJZA 4A3MC 4A3DC 4C2MK 5IYBK 4DDQA 1EFWA 3GTKK 4YFNA 3GTQK 3EQLA 4XLNA 1O25A 2Y3PA 3FKIK 3LAJA 5M5WK 3AQOA 4A3CK 3RZOC 1L0WA 1TWGC 3T01A 5IP7C 1RU0A 3CAGA 3GTLK 4YFKA 3K7AC 5JFEA 1WOSA 2V6UA 2JA6C 1I3QA 1TWFK 4ILDA 1O29A 2JA5K 2XCOA 2JA8C 2B63K 4KB4A 3Q3QA 4GTCA 3S17C 4QIWD 2GAGC 1B4AA 1K83K 1IS1A 5C4XK 5IOTA 2ZUFA 4BY1K 3S1NK 1HQMA 1Y1VA 4KM8A 1R9TK 1X31C 4A3JK 4BY7C 1G51A 1XXAA 1O26A 4KAWX 4LLGA 3HOUC 3A8KA 4KB2A 2V6TA 1TWCC 3DXJA 5IYCK 2E2IA 4YFXA 3S16K 5IP9C 5M5YK 3GTJC 1IBAA 4KMDA 1WQFA 2O5IA 2NVXC 1O27A 2D6FC 1ZQ1C 3TFJA 2VUMA 2NVYK 3H0GK 3L4JA 3S2DK 2NVYA 2R7ZC 1O28A 3GTGK 1WSVA 2WAQL 1TWAC 4FZBA 1PJ6A 4KN7A 4KC6A 1VLOA 2A68A 3FOFA 1I6HK 2NVTC 1XZPA 3GTMK 1F7VA 1VGXA 1TWGA 4C3HC 4C45A 3S15K 4A3BC 1J98A 3N0BA 4C3JK 4BXXK 1UV7A 4C2MC 2P5MA 3GTKC 2JA6A 2WB1D 4G7ZA 1PJ5A 3S1RK 1DCPA 4LK1A 3FKIC 3H3VD 2PMZL 3WODA 4A3CC 1EK8A 3GTLC 1J6VA 3HKZL 1YX2A 1TWFC 3HOYK 2JA5C 3OPFA 2P8TA 4BLAA 3HXAA 3GDZA 2B63C 2PA8L 3RZDK 1F9NA 3AH5A 3GTPK 1EQRA 2XCQA 4AYBL 1TWCA 4A3LK 3FOEA 3S1QK 1K83C 5C4XC 3IPJA 4BY1C 1INNA 3GTJA 1R9TC 1WCMA 4QJVA 3SZZA 4A3JC 2JH3A 4A3FK 2NVXA 4MEYA 3PO2K 2Y0SL 3I4NK 1XZQB 1Y1WK 3CQZA 1VRQC 3G4AA 2R7ZA 2RH6A 3G4CA 3OREA 5C3EK 1ZXOA 2NVQK 3HOXK 5CHPA 1JOEA 3HOVK 1WIHA 2NVYC 3H0GC 4Y52K 3LAPA 2JA7K 3M4OK 4GTBA 3S2DC 3GTGC 2V6SA 3N0CA 3GTKA 3GTQA 1J6XA 3ADAC 2YU9K 1I6HC 1IL2A 4WJ4A 3FKIA 3H3VL 5FJ8K 2RGRA 3NUHA 3S15C 1ZYRA 3AD9C 3GTLA 4C3JC 4BXXC 5C4JK 1O2AA 1SFOK 2R93K 1TWFA 3OEPA 3MMLB 4BBRC 3GEIA 2JA5A 3S1RC 2B63A 5IYDK 4XSXA 5C44K 1O2BA 3LPXA 4G0WA 1K83A 1BJTA 2R92K 1KQ4A 3GTOK 4A93K 4KMHA 1R9TA 3HOYC 1DCHA 4G0VA 2W7VA 3PO3K 3FHZA 5IOSA 3RZDC 3GTPC 1WORA 4FM9A 1PJ7A 4A3LC 3S2HK 1WCMC 4P5BA 1WOPA 2GSNA
chains in the Genus database with same CATH topology
2FQTA 5E68A 4XCHA 1JQWA 1VGXA 1J6VA 1VH2A 1JVIA 1IE0A 1J98A 1JOEA 1INNA 1YCLA 1VJEA 1J6XA 2FQOA 1J6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQT A;  5E68 A;  4XCH A;  1JQW A;  1VGX A;  1J6V A;  1VH2 A;  1JVI A;  1IE0 A;  1J98 A;  1JOE A;  1INN A;  1YCL A;  1VJE A;  1J6X A;  2FQO A;  1J6W A; 
#chains in the Genus database with same CATH topology
 4A3F C;  4Q4Z A;  2E2H K;  3PO2 C;  3A8I A;  3CQZ C;  4A3K K;  4MEX A;  3S1M K;  3I4N C;  3H0G A;  4XLP A;  1BGW A;  1WQG A;  2E2J K;  3GTG A;  5C3E C;  4BBS K;  4GZY A;  2NVQ C;  2BE5 A;  2CW0 A;  2CFA A;  4WIL A;  3S0X A;  3SZY A;  3M3Y K;  4MQ9 A;  4OIR A;  3GTM A;  3S14 K;  5TJ3 A;  1TWH K;  4GTL A;  4LK0 A;  5IYB C;  2JA7 C;  3M4O C;  4A3M K;  1XXB A;  3GTQ C;  1EH1 A;  4GTA A;  5HL8 A;  4QIW L;  2YU9 C;  4RMF A;  1SMY A;  1USO A;  1J6W A;  2PHC B;  1B4B A;  4AH6 A;  4NOI A;  3GIR A;  1WOO A;  1ISE A;  1C0A A;  1I50 K;  5C4J C;  1I6V A;  2R93 C;  1HI9 A;  1VJE A;  4KAR A;  2JA8 K;  1YNJ A;  4X6A K;  1XZP B;  5IYD C;  3GTP A;  3AD8 C;  5C44 C;  3A8J A;  4KM9 A;  3S1N C;  1USM A;  2R92 C;  3BP3 A;  2A69 A;  3GTO C;  4A93 C;  3L4K A;  3TFI A;  4A3G K;  3PO3 C;  5EGH A;  4Y7N K;  1WQH A;  5IYC C;  1Y1W A;  1WSR A;  3S16 C;  4PAB A;  3T00 A;  3S2H C;  5IOR A;  4A3I K;  4KMA A;  4A3K C;  4KAT A;  3S1M C;  2PPB A;  2JA7 A;  1DD5 A;  2WB1 L;  4XSZ A;  2E2J C;  2FQO A;  4BBS C;  4GT9 A;  1TWA K;  4QJV B;  3GTM C;  2YU9 A;  1F93 A;  3M3Y C;  3VA7 A;  1DCO A;  5TMF A;  1F7U A;  2A6E A;  3N3Y A;  1BDF A;  4GFQ A;  1IW7 A;  1SFO A;  2R93 A;  5IOQ A;  2O5J A;  2WAQ D;  4G0U A;  3GEE A;  4P9S A;  4O2D A;  5E68 A;  4A3E K;  1JQW A;  1I50 C;  4M1X A;  2R92 A;  1I3Q K;  3GTO A;  4OIN A;  5EGE A;  4GTE A;  4Q5S A;  4X6A C;  4ZH4 A;  1EI6 A;  2KWA A;  4OIO A;  3S1Q C;  2PMZ D;  4KMU A;  5M3M K;  4G7H A;  1Y1V K;  3HKZ D;  3BP8 C;  5M5X K;  5CJ9 A;  1O24 A;  3QX3 A;  4A3G C;  2E2H A;  1ZVU A;  4Y7N C;  1Y1W C;  2PA8 D;  4C3I K;  1YNN A;  1JVI A;  2E2I K;  2ZFZ A;  3I4M K;  4LOW A;  4AYB D;  3HOX C;  1XXC A;  4A3I C;  3HOZ K;  3HOV C;  4LQY A;  3HOW K;  2VUM K;  4Y52 C;  3T02 A;  4GTF A;  5L46 A;  5FLM K;  4A3D K;  1TWH A;  4KDD A;  2ZUE A;  2Y0S D;  4XCH A;  1XPP A;  4JK1 A;  4OIP A;  1IQ0 A;  2GSO A;  3TFH A;  5D4D A;  4WJ3 M;  1VH2 A;  3RZO K;  1TWG K;  5IP7 K;  3GEH A;  2GAH C;  4PAA A;  4J3N A;  3GSI A;  1V5V A;  3K7A K;  4KAS A;  1I50 A;  1SFO C;  2JA6 K;  3ERE D;  2A6H A;  2CFA B;  4BBR K;  1AB4 A;  3S17 K;  4LR2 A;  3V4G A;  3TTG A;  1XZQ A;  4OIQ A;  1O2F B;  2GSU A;  1IE0 A;  4A3E C;  2EBB A;  1I3Q C;  4BY7 K;  3BUE A;  3HOU K;  2XCR B;  1BS2 A;  4KN4 A;  1TWC K;  4G7O A;  5IP9 K;  5JVO A;  3GTJ K;  1GE9 A;  1Y1V C;  1WCM K;  3AD7 C;  3JST A;  2E2H C;  2NVX K;  5M3F K;  1YCL A;  3CQZ K;  4C3I C;  4P5A A;  2E2I C;  2FQT A;  2R7Z K;  5TMC A;  3I4M C;  4GTD A;  3AQP A;  3HOZ C;  4BKW A;  1TWA A;  1ZBS A;  3HOW C;  2NVT K;  4BLB A;  2VUM C;  3S14 C;  4YG2 A;  1TWH C;  4C3H K;  4A3B K;  5FLM C;  4LJZ A;  4A3M C;  4A3D C;  4C2M K;  5IYB K;  4DDQ A;  1EFW A;  3GTK K;  4YFN A;  3GTQ K;  3EQL A;  4XLN A;  1O25 A;  2Y3P A;  3FKI K;  3LAJ A;  5M5W K;  3AQO A;  4A3C K;  3RZO C;  1L0W A;  1TWG C;  3T01 A;  5IP7 C;  1RU0 A;  3CAG A;  3GTL K;  4YFK A;  3K7A C;  5JFE A;  1WOS A;  2V6U A;  2JA6 C;  1I3Q A;  1TWF K;  4ILD A;  1O29 A;  2JA5 K;  2XCO A;  2JA8 C;  2B63 K;  4KB4 A;  3Q3Q A;  4GTC A;  3S17 C;  4QIW D;  2GAG C;  1B4A A;  1K83 K;  1IS1 A;  5C4X K;  5IOT A;  2ZUF A;  4BY1 K;  3S1N K;  1HQM A;  1Y1V A;  4KM8 A;  1R9T K;  1X31 C;  4A3J K;  4BY7 C;  1G51 A;  1XXA A;  1O26 A;  4KAW X;  4LLG A;  3HOU C;  3A8K A;  4KB2 A;  2V6T A;  1TWC C;  3DXJ A;  5IYC K;  2E2I A;  4YFX A;  3S16 K;  5IP9 C;  5M5Y K;  3GTJ C;  1IBA A;  4KMD A;  1WQF A;  2O5I A;  2NVX C;  1O27 A;  2D6F C;  1ZQ1 C;  3TFJ A;  2VUM A;  2NVY K;  3H0G K;  3L4J A;  3S2D K;  2NVY A;  2R7Z C;  1O28 A;  3GTG K;  1WSV A;  2WAQ L;  1TWA C;  4FZB A;  1PJ6 A;  4KN7 A;  4KC6 A;  1VLO A;  2A68 A;  3FOF A;  1I6H K;  2NVT C;  1XZP A;  3GTM K;  1F7V A;  1VGX A;  1TWG A;  4C3H C;  4C45 A;  3S15 K;  4A3B C;  1J98 A;  3N0B A;  4C3J K;  4BXX K;  1UV7 A;  4C2M C;  2P5M A;  3GTK C;  2JA6 A;  2WB1 D;  4G7Z A;  1PJ5 A;  3S1R K;  1DCP A;  4LK1 A;  3FKI C;  3H3V D;  2PMZ L;  3WOD A;  4A3C C;  1EK8 A;  3GTL C;  1J6V A;  3HKZ L;  1YX2 A;  1TWF C;  3HOY K;  2JA5 C;  3OPF A;  2P8T A;  4BLA A;  3HXA A;  3GDZ A;  2B63 C;  2PA8 L;  3RZD K;  1F9N A;  3AH5 A;  3GTP K;  1EQR A;  2XCQ A;  4AYB L;  1TWC A;  4A3L K;  3FOE A;  3S1Q K;  1K83 C;  5C4X C;  3IPJ A;  4BY1 C;  1INN A;  3GTJ A;  1R9T C;  1WCM A;  4QJV A;  3SZZ A;  4A3J C;  2JH3 A;  4A3F K;  2NVX A;  4MEY A;  3PO2 K;  2Y0S L;  3I4N K;  1XZQ B;  1Y1W K;  3CQZ A;  1VRQ C;  3G4A A;  2R7Z A;  2RH6 A;  3G4C A;  3ORE A;  5C3E K;  1ZXO A;  2NVQ K;  3HOX K;  5CHP A;  1JOE A;  3HOV K;  1WIH A;  2NVY C;  3H0G C;  4Y52 K;  3LAP A;  2JA7 K;  3M4O K;  4GTB A;  3S2D C;  3GTG C;  2V6S A;  3N0C A;  3GTK A;  3GTQ A;  1J6X A;  3ADA C;  2YU9 K;  1I6H C;  1IL2 A;  4WJ4 A;  3FKI A;  3H3V L;  5FJ8 K;  2RGR A;  3NUH A;  3S15 C;  1ZYR A;  3AD9 C;  3GTL A;  4C3J C;  4BXX C;  5C4J K;  1O2A A;  1SFO K;  2R93 K;  1TWF A;  3OEP A;  3MML B;  4BBR C;  3GEI A;  2JA5 A;  3S1R C;  2B63 A;  5IYD K;  4XSX A;  5C44 K;  1O2B A;  3LPX A;  4G0W A;  1K83 A;  1BJT A;  2R92 K;  1KQ4 A;  3GTO K;  4A93 K;  4KMH A;  1R9T A;  3HOY C;  1DCH A;  4G0V A;  2W7V A;  3PO3 K;  3FHZ A;  5IOS A;  3RZD C;  3GTP C;  1WOR A;  4FM9 A;  1PJ7 A;  4A3L C;  3S2H K;  1WCM C;  4P5B A;  1WOP A;  2GSN A; 
#chains in the Genus database with same CATH homology
 2FQT A;  5E68 A;  4XCH A;  1JQW A;  1VGX A;  1J6V A;  1VH2 A;  1JVI A;  1IE0 A;  1J98 A;  1JOE A;  1INN A;  1YCL A;  1VJE A;  1J6X A;  2FQO A;  1J6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...