4C45A

Crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
THRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE 2
publication title Crystal Structure of Human Pterin-4-Alpha- Carbinolamine Dehydratase 2 (Pcbd2)
rcsb
source organism Homo sapiens
total genus 37
structure length 99
sequence length 99
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4c45A00
3HXAA 4C45A 1RU0A 1USMA 2V6SA 1DCOA 4LOWA 2EBBA 2V6UA 1DCHA 1F93A 1DCPA 1USOA 4WILA 2V6TA 3JSTA
chains in the Genus database with same CATH superfamily
3GTLC 2P8TA 3GTGC 1Y1WC 3G4CA 4A3JK 1WCMA 4Y52C 2WAQD 2PPBA 2PHCB 1EK8A 2GAGC 1J6VA 3GIRA 5C4JK 4Q4ZA 3M3YK 4YFKA 4FM9A 2O5JA 3S1RC 1O25A 4YFNA 2BE5A 4KATA 5IP9C 3TFHA 1XZPA 2R93K 5C44C 3GTPC 4GFQA 1BGWA 3PO2C 4KB4A 1EFWA 2D6FC 1O2BA 3M4OK 3LPXA 4AYBL 5M3FK 3S1QC 4KASA 2VUMA 1IE0A 3CAGA 2A68A 3CQZK 2JA6K 2NVXK 4BY1K 3TFIA 3A8KA 4A3MC 4A3DC 3TFJA 4A3KC 2R93A 3HOUC 1I50K 3AQOA 1BJTA 3FKIC 1WSRA 3GEEA 4C3HC 2JA7C 5IYCK 5CHPA 3S16K 1R9TA 3S1NC 3GTMA 3HOZC 3CQZA 4J3NA 1TWHA 1K83C 3H0GK 2RGRA 3GTQK 3GTOK 3SZZA 2R7ZC 1J6WA 4A3IC 2YU9C 5C3EK 4P9SA 3BUEA 3QX3A 3I4MK 3HKZD 1SFOC 3GTLK 3S2HK 3HOVC 3GTGK 4Y52K 1PJ7A 1ZXOA 4YFXA 2CFAB 3L4KA 3S1RK 4BLBA 3GTQA 2NVYC 5IP9K 1WSVA 3S2DK 1TWGC 2RH6A 2Y0SL 3GTPK 1DCHA 4OIQA 5IOSA 2JA5C 3PO2K 4BBRC 2CW0A 3WODA 3OEPA 3GTJC 3FOFA 5M5XK 3GDZA 1XZQA 5IORA 2R92A 5IYDC 3HXAA 4A3BK 1PJ6A 4GTEA 1VJEA 4A3DK 4Y7NC 1EH1A 4A3KK 4KARA 4AYBD 2E2HC 4LK1A 3OPFA 4LK0A 4KB2A 3HOYC 3FKIK 5IP7C 1JQWA 3Q3QA 2JA7K 3BP8C 2A6HA 3K7AK 3S1NK 3HOZK 3BP3A 4LJZA 3VA7A 1K83K 4RMFA 2R7ZK 1I6VA 4A3IK 3ERED 4BKWA 2Y3PA 1SFOK 3HOVK 1O24A 1EI6A 3RZOK 4A3GC 4KM9A 4C3JC 3T00A 5L46A 5FLMC 5FJ8K 4A3FK 3GEIA 3PO3C 3ADAC 3GSIA 1O27A 2NVYK 2B63K 3HOXC 1TWCC 1VGXA 4QJVB 1L0WA 1B4AA 1TWAK 3AD8C 3GTJK 5EGHA 1F9NA 3N0BA 1ZBSA 2V6UA 3T01A 1O2FB 2W7VA 4KAWX 2Y0SD 1ZYRA 1TWFC 2B63A 3RZDK 4O2DA 1IS1A 4Y7NK 4BBSC 2E2IC 1TWAA 3S14C 4KDDA 2E2HK 2WB1L 1VH2A 1BS2A 3HOYK 3V4GA 4G7ZA 5IP7K 4MQ9A 4XCHA 3S15C 2JA6A 1I3QC 3GTKC 2NVXA 3MMLB 4OIOA 1WIHA 4A3LK 3EQLA 2E2JC 4XLNA 3FHZA 1I50A 1WCMC 1DCPA 5IOTA 1PJ5A 1Y1WK 4QIWD 4OINA 4C2MC 1IL2A 3HOWC 1USMA 4KN7A 4DDQA 4A3GK 3H0GA 3GTOA 5M3MK 5TMCA 3G4AA 1G51A 5FLMK 3PO3K 4OIPA 4KMDA 3GTLA 5C4JC 1WOOA 3GTGA 3M3YC 1Y1WA 5C44K 1TWCK 2VUMC 1IBAA 1X31C 4G7OA 4X6AC 1B4BA 3S1QK 5IOQA 5CJ9A 3AD9C 3GEHA 2V6TA 2R93C 1IQ0A 3LAJA 5TMFA 4GTCA 4A3MK 3HOUK 3M4OC 1TWFK 1F7UA 4G0UA 3GTPA 1R9TC 1XPPA 4QIWL 1ISEA 4C3HK 3GTMC 2NVQC 2CFAA 3CQZC 4BY1C 2PA8D 1TWHC 3DXJA 4BXXC 1VRQC 1HI9A 3S15K 1I3QK 3GTKK 4YG2A 5IYBC 4MEXA 1XZPB 1DCOA 5EGEA 3H3VL 2E2JK 2YU9K 1TWFA 2WB1D 5IYCC 2P5MA 3FKIA 3N3YA 3S16C 1O29A 1BDFA 2JA7A 1YCLA 1ZVUA 4C45A 4C2MK 1F7VA 4JK1A 4XSXA 4KM8A 5JVOA 2O5IA 3HOWK 3GTQC 4BY7C 3NUHA 2JA8C 4PAAA 1AB4A 1I3QA 4WJ3M 2FQOA 3AD7C 1YX2A 1K83A 1I6HC 4GTDA 1WOSA 1WORA 3L4JA 4G0WA 2R7ZA 2YU9A 3S2HC 1TWGK 4ZH4A 1SFOA 4GT9A 4FZBA 4G0VA 3I4NC 2A6EA 2JA5K 4BBRK 4P5AA 2VUMK 2R92C 5E68A 4X6AK 1JOEA 4M1XA 2PMZD 2PA8L 3A8IA 4KMAA 5C4XC 3S2DC 5IYDK 3A8JA 1SMYA 2A69A 4GTBA 1EQRA 2NVYA 2XCRB 1HQMA 3S17C 4OIRA 1XXAA 2GSUA 1TWGA 4LR2A 1GE9A 1DD5A 2XCOA 5TJ3A 4MEYA 4KMHA 4A3CC 4KN4A 2JA5A 1R9TK 4XLPA 3IPJA 4NOIA 4XSZA 4KC6A 3GTJA 3GTMK 2NVQK 2KWAA 4A3BC 4ILDA 3S1MC 1INNA 1TWHK 4BXXK 3TTGA 1Y1VC 4Q5SA 4GZYA 4A3EC 1USOA 5IYBK 4G7HA 5JFEA 2JH3A 3AQPA 1YNNA 1YNJA 4A93C 4GTFA 3AH5A 4QJVA 4WJ4A 2FQTA 2E2HA 4GTAA 2WAQL 3K7AC 1RU0A 4P5BA 2ZUEA 1VLOA 4LLGA 4WILA 4C3IC 1XZQB 4C3JK 2ZFZA 1J6XA 3N0CA 2NVTC 4BY7K 2JA8K 4LOWA 3H3VD 2GSNA 2PMZL 4GTLA 4PABA 1WQHA 4A3JC 3JSTA 4KMUA 1I6HK 2GSOA 1IW7A 2GAHC 3RZOC 3HOXK 1WQGA 1XXCA 5D4DA 3FOEA 4A3FC 3I4NK 2R92K 1UV7A 5M5WK 1J98A 5M5YK 1WQFA 1XXBA 5C4XK 2B63C 3LAPA 1F93A 3S0XA 1WOPA 1O28A 1TWAC 3S17K 1TWCA 4LQYA 4BBSK 1ZQ1C 2E2IK 3S14K 2ZUFA 2JA6C 2NVXC 2XCQA 4A3CK 4AH6A 3S1MK 2V6SA 1I50C 1C0AA 2EBBA 4BLAA 3RZDC 1Y1VK 1O2AA 1O26A 4A3EK 1WCMK 3T02A 3HKZL 4A93K 2E2IA 1JVIA 1V5VA 3SZYA 3H0GC 3OREA 3GTOC 4A3LC 4C3IK 3GTKA 5C3EC 5HL8A 1Y1VA 2NVTK 1KQ4A 3I4MC
chains in the Genus database with same CATH topology
3HXAA 4C45A 1RU0A 1USMA 2V6SA 1DCOA 4LOWA 2EBBA 2V6UA 1DCHA 1F93A 1DCPA 1USOA 4WILA 2V6TA 3JSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXA A;  4C45 A;  1RU0 A;  1USM A;  2V6S A;  1DCO A;  4LOW A;  2EBB A;  2V6U A;  1DCH A;  1F93 A;  1DCP A;  1USO A;  4WIL A;  2V6T A;  3JST A; 
#chains in the Genus database with same CATH topology
 3GTL C;  2P8T A;  3GTG C;  1Y1W C;  3G4C A;  4A3J K;  1WCM A;  4Y52 C;  2WAQ D;  2PPB A;  2PHC B;  1EK8 A;  2GAG C;  1J6V A;  3GIR A;  5C4J K;  4Q4Z A;  3M3Y K;  4YFK A;  4FM9 A;  2O5J A;  3S1R C;  1O25 A;  4YFN A;  2BE5 A;  4KAT A;  5IP9 C;  3TFH A;  1XZP A;  2R93 K;  5C44 C;  3GTP C;  4GFQ A;  1BGW A;  3PO2 C;  4KB4 A;  1EFW A;  2D6F C;  1O2B A;  3M4O K;  3LPX A;  4AYB L;  5M3F K;  3S1Q C;  4KAS A;  2VUM A;  1IE0 A;  3CAG A;  2A68 A;  3CQZ K;  2JA6 K;  2NVX K;  4BY1 K;  3TFI A;  3A8K A;  4A3M C;  4A3D C;  3TFJ A;  4A3K C;  2R93 A;  3HOU C;  1I50 K;  3AQO A;  1BJT A;  3FKI C;  1WSR A;  3GEE A;  4C3H C;  2JA7 C;  5IYC K;  5CHP A;  3S16 K;  1R9T A;  3S1N C;  3GTM A;  3HOZ C;  3CQZ A;  4J3N A;  1TWH A;  1K83 C;  3H0G K;  2RGR A;  3GTQ K;  3GTO K;  3SZZ A;  2R7Z C;  1J6W A;  4A3I C;  2YU9 C;  5C3E K;  4P9S A;  3BUE A;  3QX3 A;  3I4M K;  3HKZ D;  1SFO C;  3GTL K;  3S2H K;  3HOV C;  3GTG K;  4Y52 K;  1PJ7 A;  1ZXO A;  4YFX A;  2CFA B;  3L4K A;  3S1R K;  4BLB A;  3GTQ A;  2NVY C;  5IP9 K;  1WSV A;  3S2D K;  1TWG C;  2RH6 A;  2Y0S L;  3GTP K;  1DCH A;  4OIQ A;  5IOS A;  2JA5 C;  3PO2 K;  4BBR C;  2CW0 A;  3WOD A;  3OEP A;  3GTJ C;  3FOF A;  5M5X K;  3GDZ A;  1XZQ A;  5IOR A;  2R92 A;  5IYD C;  3HXA A;  4A3B K;  1PJ6 A;  4GTE A;  1VJE A;  4A3D K;  4Y7N C;  1EH1 A;  4A3K K;  4KAR A;  4AYB D;  2E2H C;  4LK1 A;  3OPF A;  4LK0 A;  4KB2 A;  3HOY C;  3FKI K;  5IP7 C;  1JQW A;  3Q3Q A;  2JA7 K;  3BP8 C;  2A6H A;  3K7A K;  3S1N K;  3HOZ K;  3BP3 A;  4LJZ A;  3VA7 A;  1K83 K;  4RMF A;  2R7Z K;  1I6V A;  4A3I K;  3ERE D;  4BKW A;  2Y3P A;  1SFO K;  3HOV K;  1O24 A;  1EI6 A;  3RZO K;  4A3G C;  4KM9 A;  4C3J C;  3T00 A;  5L46 A;  5FLM C;  5FJ8 K;  4A3F K;  3GEI A;  3PO3 C;  3ADA C;  3GSI A;  1O27 A;  2NVY K;  2B63 K;  3HOX C;  1TWC C;  1VGX A;  4QJV B;  1L0W A;  1B4A A;  1TWA K;  3AD8 C;  3GTJ K;  5EGH A;  1F9N A;  3N0B A;  1ZBS A;  2V6U A;  3T01 A;  1O2F B;  2W7V A;  4KAW X;  2Y0S D;  1ZYR A;  1TWF C;  2B63 A;  3RZD K;  4O2D A;  1IS1 A;  4Y7N K;  4BBS C;  2E2I C;  1TWA A;  3S14 C;  4KDD A;  2E2H K;  2WB1 L;  1VH2 A;  1BS2 A;  3HOY K;  3V4G A;  4G7Z A;  5IP7 K;  4MQ9 A;  4XCH A;  3S15 C;  2JA6 A;  1I3Q C;  3GTK C;  2NVX A;  3MML B;  4OIO A;  1WIH A;  4A3L K;  3EQL A;  2E2J C;  4XLN A;  3FHZ A;  1I50 A;  1WCM C;  1DCP A;  5IOT A;  1PJ5 A;  1Y1W K;  4QIW D;  4OIN A;  4C2M C;  1IL2 A;  3HOW C;  1USM A;  4KN7 A;  4DDQ A;  4A3G K;  3H0G A;  3GTO A;  5M3M K;  5TMC A;  3G4A A;  1G51 A;  5FLM K;  3PO3 K;  4OIP A;  4KMD A;  3GTL A;  5C4J C;  1WOO A;  3GTG A;  3M3Y C;  1Y1W A;  5C44 K;  1TWC K;  2VUM C;  1IBA A;  1X31 C;  4G7O A;  4X6A C;  1B4B A;  3S1Q K;  5IOQ A;  5CJ9 A;  3AD9 C;  3GEH A;  2V6T A;  2R93 C;  1IQ0 A;  3LAJ A;  5TMF A;  4GTC A;  4A3M K;  3HOU K;  3M4O C;  1TWF K;  1F7U A;  4G0U A;  3GTP A;  1R9T C;  1XPP A;  4QIW L;  1ISE A;  4C3H K;  3GTM C;  2NVQ C;  2CFA A;  3CQZ C;  4BY1 C;  2PA8 D;  1TWH C;  3DXJ A;  4BXX C;  1VRQ C;  1HI9 A;  3S15 K;  1I3Q K;  3GTK K;  4YG2 A;  5IYB C;  4MEX A;  1XZP B;  1DCO A;  5EGE A;  3H3V L;  2E2J K;  2YU9 K;  1TWF A;  2WB1 D;  5IYC C;  2P5M A;  3FKI A;  3N3Y A;  3S16 C;  1O29 A;  1BDF A;  2JA7 A;  1YCL A;  1ZVU A;  4C45 A;  4C2M K;  1F7V A;  4JK1 A;  4XSX A;  4KM8 A;  5JVO A;  2O5I A;  3HOW K;  3GTQ C;  4BY7 C;  3NUH A;  2JA8 C;  4PAA A;  1AB4 A;  1I3Q A;  4WJ3 M;  2FQO A;  3AD7 C;  1YX2 A;  1K83 A;  1I6H C;  4GTD A;  1WOS A;  1WOR A;  3L4J A;  4G0W A;  2R7Z A;  2YU9 A;  3S2H C;  1TWG K;  4ZH4 A;  1SFO A;  4GT9 A;  4FZB A;  4G0V A;  3I4N C;  2A6E A;  2JA5 K;  4BBR K;  4P5A A;  2VUM K;  2R92 C;  5E68 A;  4X6A K;  1JOE A;  4M1X A;  2PMZ D;  2PA8 L;  3A8I A;  4KMA A;  5C4X C;  3S2D C;  5IYD K;  3A8J A;  1SMY A;  2A69 A;  4GTB A;  1EQR A;  2NVY A;  2XCR B;  1HQM A;  3S17 C;  4OIR A;  1XXA A;  2GSU A;  1TWG A;  4LR2 A;  1GE9 A;  1DD5 A;  2XCO A;  5TJ3 A;  4MEY A;  4KMH A;  4A3C C;  4KN4 A;  2JA5 A;  1R9T K;  4XLP A;  3IPJ A;  4NOI A;  4XSZ A;  4KC6 A;  3GTJ A;  3GTM K;  2NVQ K;  2KWA A;  4A3B C;  4ILD A;  3S1M C;  1INN A;  1TWH K;  4BXX K;  3TTG A;  1Y1V C;  4Q5S A;  4GZY A;  4A3E C;  1USO A;  5IYB K;  4G7H A;  5JFE A;  2JH3 A;  3AQP A;  1YNN A;  1YNJ A;  4A93 C;  4GTF A;  3AH5 A;  4QJV A;  4WJ4 A;  2FQT A;  2E2H A;  4GTA A;  2WAQ L;  3K7A C;  1RU0 A;  4P5B A;  2ZUE A;  1VLO A;  4LLG A;  4WIL A;  4C3I C;  1XZQ B;  4C3J K;  2ZFZ A;  1J6X A;  3N0C A;  2NVT C;  4BY7 K;  2JA8 K;  4LOW A;  3H3V D;  2GSN A;  2PMZ L;  4GTL A;  4PAB A;  1WQH A;  4A3J C;  3JST A;  4KMU A;  1I6H K;  2GSO A;  1IW7 A;  2GAH C;  3RZO C;  3HOX K;  1WQG A;  1XXC A;  5D4D A;  3FOE A;  4A3F C;  3I4N K;  2R92 K;  1UV7 A;  5M5W K;  1J98 A;  5M5Y K;  1WQF A;  1XXB A;  5C4X K;  2B63 C;  3LAP A;  1F93 A;  3S0X A;  1WOP A;  1O28 A;  1TWA C;  3S17 K;  1TWC A;  4LQY A;  4BBS K;  1ZQ1 C;  2E2I K;  3S14 K;  2ZUF A;  2JA6 C;  2NVX C;  2XCQ A;  4A3C K;  4AH6 A;  3S1M K;  2V6S A;  1I50 C;  1C0A A;  2EBB A;  4BLA A;  3RZD C;  1Y1V K;  1O2A A;  1O26 A;  4A3E K;  1WCM K;  3T02 A;  3HKZ L;  4A93 K;  2E2I A;  1JVI A;  1V5V A;  3SZY A;  3H0G C;  3ORE A;  3GTO C;  4A3L C;  4C3I K;  3GTK A;  5C3E C;  5HL8 A;  1Y1V A;  2NVT K;  1KQ4 A;  3I4M C; 
#chains in the Genus database with same CATH homology
 3HXA A;  4C45 A;  1RU0 A;  1USM A;  2V6S A;  1DCO A;  4LOW A;  2EBB A;  2V6U A;  1DCH A;  1F93 A;  1DCP A;  1USO A;  4WIL A;  2V6T A;  3JST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...