4C45A

Crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
THRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE 2
publication title Crystal Structure of Human Pterin-4-Alpha- Carbinolamine Dehydratase 2 (Pcbd2)
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 37
structure length 99
sequence length 99
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4c45A00
1DCPA 1USOA 2V6TA 2EBBA 1F93A 3JSTA 1DCHA 4WILA 4LOWA 2V6SA 4C45A 1RU0A 3HXAA 2V6UA 1USMA 1DCOA
chains in the Genus database with same CATH superfamily
4YG2A 4G7HA 2PMZD 4G7OA 3S16K 3HOZK 4C2MK 2JA7K 3SZZA 4A3DK 4A3FC 3I4NK 4A93K 1WQHA 1I6HC 2O5JA 3GTKK 4C3HK 3LAJA 3GTQA 2E2IA 4LJZA 3H0GC 1XPPA 3FKIC 3CQZA 4KASA 3TFIA 3GTMA 3GSIA 4QIWL 5TMCA 4XLPA 2NVXC 3LPXA 2R92A 4LOWA 3SZYA 4G0UA 4AYBL 4XSXA 3JSTA 4GTEA 3LAPA 2YU9K 3WODA 4KDDA 1ZYRA 3DXJA 4FZBA 2KWAA 2B63K 3G4AA 3HOWC 2JA7A 1Y1VK 3OREA 4NOIA 4G7ZA 4PAAA 3GTPK 4A3BC 1J98A 1HI9A 1UV7A 3FOEA 5IP7K 4A3GC 5IP9C 1R9TK 2NVTC 4A3LC 3A8IA 2XCRB 4X6AC 3AQPA 4MEXA 2V6TA 4A3EC 4GTBA 3EQLA 3GTQC 4BY7C 2E2IC 5M3FK 1XZQB 4WJ4A 4LK1A 5IYCC 4A3FK 1I6HK 1TWHC 2B63A 3K7AC 1F7UA 2WB1L 2R92C 1PJ6A 1Y1VA 5CHPA 3VA7A 5M5WK 3T01A 4A3CC 1WQGA 3FKIK 1DCOA 3OPFA 2E2JC 1R9TA 1TWGC 2NVXK 4YFNA 2A69A 5C44C 2Y0SD 1O2FB 3L4KA 3AD9C 1GE9A 3S17C 5HL8A 3HOWK 5TMFA 3I4MC 4KM8A 1WOPA 3GTOC 1XXAA 3QX3A 4A3BK 3S1QC 5C4XC 3AQOA 2GSUA 3S2DC 5IP9K 2NVTK 4KMUA 4A3LK 1XZPB 2R93C 4X6AK 3H0GA 1X31C 2V6SA 3TFHA 3BUEA 4A3IC 1SFOA 1WORA 1J6WA 5EGHA 1ISEA 4A3EK 2NVXA 3GTQK 4BY7K 2E2IK 4G0WA 3CQZK 4RMFA 5IYCK 4KMHA 5IOTA 3GTMK 1Y1WC 2JH3A 1TWHK 2O5IA 3K7AK 2R92K 4Y7NC 1WSRA 4A3CK 3PO2C 4KB4A 2WAQD 3HXAA 2JA8C 2W7VA 1BDFA 4QJVB 2E2JK 3NUHA 1TWGK 3TFJA 2GSOA 2V6UA 1O24A 2VUMA 5C44K 1XXBA 1K83C 4C3IC 1I6VA 3S17K 1XXCA 4A3MC 2P8TA 1XZQA 3I4MK 3H3VL 1SFOC 1PJ5A 3S1QK 1O2BA 5C4XK 4GTCA 3BP3A 1TWHA 3S2DK 3GDZA 3T02A 2R93K 5M5XK 3MMLB 2PA8L 4Y52C 4KC6A 3S2HC 1TWFC 4A3IK 1I3QC 2Y3PA 2CW0A 1TWCC 4YFKA 2RGRA 1TWGA 4KM9A 2NVQC 1JOEA 3S1NC 3AH5A 4MEYA 3HOVC 1Y1WK 1YNNA 5C4JC 4KAWX 2A6HA 2GAGC 4ZH4A 4Y7NK 3PO2K 4BY1C 3GTOA 2VUMC 3HKZD 1VRQC 2JA8K 3PO3C 4ILDA 3S1RC 2D6FC 3S15C 2R93A 3ADAC 1XZPA 3BP8C 4M1XA 4KATA 2PHCB 4P5BA 2P5MA 1K83K 2ZFZA 3H0GK 4A3MK 3HOXC 1JQWA 1DCPA 3S1MC 4OIRA 1SFOK 1Y1WA 4GFQA 4O2DA 1AB4A 4GTAA 1O29A 3N0BA 2E2HC 4BXXC 1B4BA 1WCMC 4Y52K 3S2HK 4QIWD 5E68A 3S14C 1I3QK 3CAGA 4Q5SA 2PMZL 1TWCK 4QJVA 3HOUC 4AYBD 2ZUEA 4LR2A 1WQFA 3G4CA 3GEEA 2NVQK 3S1NK 1O2AA 3HOVK 1YCLA 4MQ9A 4A3GK 4KN4A 3HOZC 1K83A 3GEHA 1EQRA 5L46A 4A93C 4BY1K 4C3HC 2VUMK 3N3YA 5IOQA 3PO3K 4GZYA 1F9NA 2FQOA 3S1RK 3S15K 4G0VA 2BE5A 3GIRA 1TWAC 4BLAA 1TWFA 2A68A 1I3QA 4XSZA 2NVYC 5IORA 1TWCA 3L4JA 4OIQA 5IOSA 5C3EC 2ZUFA 4BBSC 4JK1A 3HOXK 1IL2A 3S1MK 5EGEA 1VJEA 1I50A 2JA6C 3GTLC 1F7VA 1KQ4A 2WB1D 2R7ZA 4LQYA 1EI6A 5M5YK 2E2HK 4BXXK 2PPBA 3RZDC 1BS2A 1G51A 3GEIA 1WCMK 1ZXOA 5FLMC 3S14K 3HOYC 2A6EA 1USMA 2RH6A 1SMYA 2CFAB 5IYBC 3Q3QA 3HOUK 4OIPA 3GTOK 4DDQA 4GT9A 4GTDA 3ERED 1ZBSA 1VLOA 4BKWA 1WOOA 2E2HA 5JVOA 1O25A 3GTGC 1USOA 4WJ3M 1WCMA 1TWAK 4LLGA 4XLNA 1I50C 2R7ZC 4KARA 2NVYK 1WIHA 5JFEA 1PJ7A 3T00A 4Q4ZA 3M4OC 3GTJC 2Y0SL 1YNJA 3A8KA 1IE0A 1VGXA 1INNA 1J6VA 3N0CA 1J6XA 5C3EK 4BBSK 1IBAA 2JA6K 3GTLK 4OIOA 1WSVA 3M3YC 4C3JC 3AD8C 4A3JC 2JA5C 4WILA 1IW7A 4BBRC 5M3MK 3RZDK 1BGWA 4BLBA 5FLMK 3GTKA 3HOYK 3AD7C 1L0WA 3FOFA 2XCOA 4P5AA 1VH2A 4C3IK 2XCQA 5IYBK 1TWAA 3RZOC 1IQ0A 1WOSA 4LK0A 1RU0A 1ZQ1C 3IPJA 2NVYA 5IYDC 4A3KC 3H3VD 1EK8A 3CQZC 3OEPA 4XCHA 3GTMC 1TWFK 1F93A 2JA6A 3GTLA 2YU9A 2WAQL 2PA8D 1B4AA 1DCHA 3GTPA 1C0AA 1V5VA 3GTGK 4C45A 2FQTA 1I50K 1O27A 1DD5A 3S16C 2R7ZK 1IS1A 5C4JK 4C2MC 4YFXA 2JA7C 4J3NA 3GTJK 4AH6A 1EFWA 3M4OK 1HQMA 5FJ8K 2CFAA 4A3DC 1YX2A 3I4NC 1ZVUA 3GTKC 4GTFA 4KMAA 5D4DA 3M3YK 1O26A 4C3JK 4KMDA 4A3JK 2JA5K 1BJTA 3FHZA 4BBRK 4KN7A 4FM9A 3A8JA 3TTGA 4GTLA 3FKIA 5TJ3A 1O28A 3GTGA 4KB2A 3V4GA 3RZOK 2YU9C 4PABA 3S0XA 2B63C 1Y1VC 3GTJA 4A3KK 5IYDK 1JVIA 1EH1A 3GTPC 4OINA 5IP7C 2EBBA 2GSNA 1R9TC 3HKZL 5CJ9A 2JA5A 4P9SA 2GAHC
chains in the Genus database with same CATH topology
1DCPA 1USOA 2V6TA 2EBBA 1F93A 3JSTA 1DCHA 4WILA 4LOWA 2V6SA 4C45A 1RU0A 3HXAA 2V6UA 1USMA 1DCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  1USO A;  2V6T A;  2EBB A;  1F93 A;  3JST A;  1DCH A;  4WIL A;  4LOW A;  2V6S A;  4C45 A;  1RU0 A;  3HXA A;  2V6U A;  1USM A;  1DCO A; 
#chains in the Genus database with same CATH topology
 4YG2 A;  4G7H A;  2PMZ D;  4G7O A;  3S16 K;  3HOZ K;  4C2M K;  2JA7 K;  3SZZ A;  4A3D K;  4A3F C;  3I4N K;  4A93 K;  1WQH A;  1I6H C;  2O5J A;  3GTK K;  4C3H K;  3LAJ A;  3GTQ A;  2E2I A;  4LJZ A;  3H0G C;  1XPP A;  3FKI C;  3CQZ A;  4KAS A;  3TFI A;  3GTM A;  3GSI A;  4QIW L;  5TMC A;  4XLP A;  2NVX C;  3LPX A;  2R92 A;  4LOW A;  3SZY A;  4G0U A;  4AYB L;  4XSX A;  3JST A;  4GTE A;  3LAP A;  2YU9 K;  3WOD A;  4KDD A;  1ZYR A;  3DXJ A;  4FZB A;  2KWA A;  2B63 K;  3G4A A;  3HOW C;  2JA7 A;  1Y1V K;  3ORE A;  4NOI A;  4G7Z A;  4PAA A;  3GTP K;  4A3B C;  1J98 A;  1HI9 A;  1UV7 A;  3FOE A;  5IP7 K;  4A3G C;  5IP9 C;  1R9T K;  2NVT C;  4A3L C;  3A8I A;  2XCR B;  4X6A C;  3AQP A;  4MEX A;  2V6T A;  4A3E C;  4GTB A;  3EQL A;  3GTQ C;  4BY7 C;  2E2I C;  5M3F K;  1XZQ B;  4WJ4 A;  4LK1 A;  5IYC C;  4A3F K;  1I6H K;  1TWH C;  2B63 A;  3K7A C;  1F7U A;  2WB1 L;  2R92 C;  1PJ6 A;  1Y1V A;  5CHP A;  3VA7 A;  5M5W K;  3T01 A;  4A3C C;  1WQG A;  3FKI K;  1DCO A;  3OPF A;  2E2J C;  1R9T A;  1TWG C;  2NVX K;  4YFN A;  2A69 A;  5C44 C;  2Y0S D;  1O2F B;  3L4K A;  3AD9 C;  1GE9 A;  3S17 C;  5HL8 A;  3HOW K;  5TMF A;  3I4M C;  4KM8 A;  1WOP A;  3GTO C;  1XXA A;  3QX3 A;  4A3B K;  3S1Q C;  5C4X C;  3AQO A;  2GSU A;  3S2D C;  5IP9 K;  2NVT K;  4KMU A;  4A3L K;  1XZP B;  2R93 C;  4X6A K;  3H0G A;  1X31 C;  2V6S A;  3TFH A;  3BUE A;  4A3I C;  1SFO A;  1WOR A;  1J6W A;  5EGH A;  1ISE A;  4A3E K;  2NVX A;  3GTQ K;  4BY7 K;  2E2I K;  4G0W A;  3CQZ K;  4RMF A;  5IYC K;  4KMH A;  5IOT A;  3GTM K;  1Y1W C;  2JH3 A;  1TWH K;  2O5I A;  3K7A K;  2R92 K;  4Y7N C;  1WSR A;  4A3C K;  3PO2 C;  4KB4 A;  2WAQ D;  3HXA A;  2JA8 C;  2W7V A;  1BDF A;  4QJV B;  2E2J K;  3NUH A;  1TWG K;  3TFJ A;  2GSO A;  2V6U A;  1O24 A;  2VUM A;  5C44 K;  1XXB A;  1K83 C;  4C3I C;  1I6V A;  3S17 K;  1XXC A;  4A3M C;  2P8T A;  1XZQ A;  3I4M K;  3H3V L;  1SFO C;  1PJ5 A;  3S1Q K;  1O2B A;  5C4X K;  4GTC A;  3BP3 A;  1TWH A;  3S2D K;  3GDZ A;  3T02 A;  2R93 K;  5M5X K;  3MML B;  2PA8 L;  4Y52 C;  4KC6 A;  3S2H C;  1TWF C;  4A3I K;  1I3Q C;  2Y3P A;  2CW0 A;  1TWC C;  4YFK A;  2RGR A;  1TWG A;  4KM9 A;  2NVQ C;  1JOE A;  3S1N C;  3AH5 A;  4MEY A;  3HOV C;  1Y1W K;  1YNN A;  5C4J C;  4KAW X;  2A6H A;  2GAG C;  4ZH4 A;  4Y7N K;  3PO2 K;  4BY1 C;  3GTO A;  2VUM C;  3HKZ D;  1VRQ C;  2JA8 K;  3PO3 C;  4ILD A;  3S1R C;  2D6F C;  3S15 C;  2R93 A;  3ADA C;  1XZP A;  3BP8 C;  4M1X A;  4KAT A;  2PHC B;  4P5B A;  2P5M A;  1K83 K;  2ZFZ A;  3H0G K;  4A3M K;  3HOX C;  1JQW A;  1DCP A;  3S1M C;  4OIR A;  1SFO K;  1Y1W A;  4GFQ A;  4O2D A;  1AB4 A;  4GTA A;  1O29 A;  3N0B A;  2E2H C;  4BXX C;  1B4B A;  1WCM C;  4Y52 K;  3S2H K;  4QIW D;  5E68 A;  3S14 C;  1I3Q K;  3CAG A;  4Q5S A;  2PMZ L;  1TWC K;  4QJV A;  3HOU C;  4AYB D;  2ZUE A;  4LR2 A;  1WQF A;  3G4C A;  3GEE A;  2NVQ K;  3S1N K;  1O2A A;  3HOV K;  1YCL A;  4MQ9 A;  4A3G K;  4KN4 A;  3HOZ C;  1K83 A;  3GEH A;  1EQR A;  5L46 A;  4A93 C;  4BY1 K;  4C3H C;  2VUM K;  3N3Y A;  5IOQ A;  3PO3 K;  4GZY A;  1F9N A;  2FQO A;  3S1R K;  3S15 K;  4G0V A;  2BE5 A;  3GIR A;  1TWA C;  4BLA A;  1TWF A;  2A68 A;  1I3Q A;  4XSZ A;  2NVY C;  5IOR A;  1TWC A;  3L4J A;  4OIQ A;  5IOS A;  5C3E C;  2ZUF A;  4BBS C;  4JK1 A;  3HOX K;  1IL2 A;  3S1M K;  5EGE A;  1VJE A;  1I50 A;  2JA6 C;  3GTL C;  1F7V A;  1KQ4 A;  2WB1 D;  2R7Z A;  4LQY A;  1EI6 A;  5M5Y K;  2E2H K;  4BXX K;  2PPB A;  3RZD C;  1BS2 A;  1G51 A;  3GEI A;  1WCM K;  1ZXO A;  5FLM C;  3S14 K;  3HOY C;  2A6E A;  1USM A;  2RH6 A;  1SMY A;  2CFA B;  5IYB C;  3Q3Q A;  3HOU K;  4OIP A;  3GTO K;  4DDQ A;  4GT9 A;  4GTD A;  3ERE D;  1ZBS A;  1VLO A;  4BKW A;  1WOO A;  2E2H A;  5JVO A;  1O25 A;  3GTG C;  1USO A;  4WJ3 M;  1WCM A;  1TWA K;  4LLG A;  4XLN A;  1I50 C;  2R7Z C;  4KAR A;  2NVY K;  1WIH A;  5JFE A;  1PJ7 A;  3T00 A;  4Q4Z A;  3M4O C;  3GTJ C;  2Y0S L;  1YNJ A;  3A8K A;  1IE0 A;  1VGX A;  1INN A;  1J6V A;  3N0C A;  1J6X A;  5C3E K;  4BBS K;  1IBA A;  2JA6 K;  3GTL K;  4OIO A;  1WSV A;  3M3Y C;  4C3J C;  3AD8 C;  4A3J C;  2JA5 C;  4WIL A;  1IW7 A;  4BBR C;  5M3M K;  3RZD K;  1BGW A;  4BLB A;  5FLM K;  3GTK A;  3HOY K;  3AD7 C;  1L0W A;  3FOF A;  2XCO A;  4P5A A;  1VH2 A;  4C3I K;  2XCQ A;  5IYB K;  1TWA A;  3RZO C;  1IQ0 A;  1WOS A;  4LK0 A;  1RU0 A;  1ZQ1 C;  3IPJ A;  2NVY A;  5IYD C;  4A3K C;  3H3V D;  1EK8 A;  3CQZ C;  3OEP A;  4XCH A;  3GTM C;  1TWF K;  1F93 A;  2JA6 A;  3GTL A;  2YU9 A;  2WAQ L;  2PA8 D;  1B4A A;  1DCH A;  3GTP A;  1C0A A;  1V5V A;  3GTG K;  4C45 A;  2FQT A;  1I50 K;  1O27 A;  1DD5 A;  3S16 C;  2R7Z K;  1IS1 A;  5C4J K;  4C2M C;  4YFX A;  2JA7 C;  4J3N A;  3GTJ K;  4AH6 A;  1EFW A;  3M4O K;  1HQM A;  5FJ8 K;  2CFA A;  4A3D C;  1YX2 A;  3I4N C;  1ZVU A;  3GTK C;  4GTF A;  4KMA A;  5D4D A;  3M3Y K;  1O26 A;  4C3J K;  4KMD A;  4A3J K;  2JA5 K;  1BJT A;  3FHZ A;  4BBR K;  4KN7 A;  4FM9 A;  3A8J A;  3TTG A;  4GTL A;  3FKI A;  5TJ3 A;  1O28 A;  3GTG A;  4KB2 A;  3V4G A;  3RZO K;  2YU9 C;  4PAB A;  3S0X A;  2B63 C;  1Y1V C;  3GTJ A;  4A3K K;  5IYD K;  1JVI A;  1EH1 A;  3GTP C;  4OIN A;  5IP7 C;  2EBB A;  2GSN A;  1R9T C;  3HKZ L;  5CJ9 A;  2JA5 A;  4P9S A;  2GAH C; 
#chains in the Genus database with same CATH homology
 1DCP A;  1USO A;  2V6T A;  2EBB A;  1F93 A;  3JST A;  1DCH A;  4WIL A;  4LOW A;  2V6S A;  4C45 A;  1RU0 A;  3HXA A;  2V6U A;  1USM A;  1DCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...