4C45A

Crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
THRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Pterin-4-Alpha- Carbinolamine Dehydratase 2 (Pcbd2)
rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE 2
total genus 37
structure length 99
sequence length 99
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4c45A00
2V6UA 1DCOA 1RU0A 2EBBA 4LOWA 3HXAA 2V6TA 4C45A 2V6SA 1DCHA 1DCPA 1USOA 1F93A 3JSTA 1USMA 4WILA
chains in the Genus database with same CATH superfamily
3HOZC 1ISEA 4BXXC 2Y0SD 5IOSA 4A93C 4GTCA 3CAGA 2A68A 3AQPA 4XSZA 2Y0SL 4KM8A 3GEIA 2JA7K 1JOEA 3GTGK 3K7AC 4PAAA 1I50K 3PO2C 3ADAC 1XZQA 3GTPK 4GTDA 2R93K 2E2HK 3PO3K 1B4BA 1XZPA 5CJ9A 1F7VA 1SFOA 4P5AA 3GTPC 1HQMA 3HOXK 5EGHA 3T02A 4QIWD 3H3VL 5C4XK 4G0VA 4AH6A 1ZXOA 2NVXA 1WSRA 1Y1VK 1I3QK 3S1RC 1TWAA 2GSOA 5D4DA 4QJVB 3S1QC 4LQYA 1O28A 4BLBA 3GTJA 3VA7A 2R92K 5IORA 4BKWA 2NVQK 4KATA 2ZFZA 2JA8K 3S1NK 3HOYC 2NVXK 2PA8L 2A6EA 1J98A 5JVOA 2R7ZK 4BBSC 2PA8D 1AB4A 3GSIA 1TWHC 3S16K 4WJ3M 4OIOA 2E2HA 2JA5K 2JH3A 3N0BA 2JA6C 4BY1C 1O2BA 2GAHC 4C2MC 4A3EK 1TWHA 1J6XA 4A3IC 3HOWC 3S17K 3CQZA 4KARA 4OIPA 3HOVC 3GIRA 1UV7A 4C3JC 1J6VA 4A3MK 3FKIC 1USMA 3GTLK 3FHZA 3T01A 1XXAA 2W7VA 3G4CA 4C3IC 3GTJC 1R9TK 2JA6K 3A8JA 4O2DA 3PO2K 4BY7K 1I50A 3CQZK 4QIWL 4KMUA 1Y1WC 4A3GC 3GTOA 3AD8C 4XSXA 4A3FK 1I3QC 3GTMK 1WOPA 5IYDK 4YFXA 1DCOA 1ZQ1C 4C45A 2YU9K 2JA5A 4DDQA 3JSTA 4MQ9A 4G0WA 1I6HK 1WIHA 1Y1WA 2RH6A 3QX3A 1L0WA 2XCOA 3GTQA 1VLOA 3H0GA 1SMYA 4BBRK 3S15K 1EI6A 2P8TA 5C3EC 1IS1A 5IYCK 2ZUFA 5TMFA 3I4MC 2WAQL 2R92A 3EQLA 3I4NK 2PHCB 3OREA 3HOVK 1J6WA 4LR2A 1I6VA 4G7HA 3GTMA 1HI9A 3A8KA 1JVIA 3S14C 1TWCA 3HOYK 1Y1VA 2WB1D 3HOZK 3HOWK 1TWFA 2EBBA 3N0CA 3RZDC 1IL2A 2NVYC 4GTLA 2B63A 3LPXA 1XXBA 1SFOC 1K83K 1IW7A 2GSNA 4GFQA 4A3LC 1VRQC 4LJZA 3SZZA 1WOSA 3HKZL 4Y7NK 3S1RK 4OIQA 3GTKC 3HKZD 3GEHA 2BE5A 5CHPA 1PJ5A 5JFEA 2NVQC 1IE0A 3AQOA 5HL8A 4GTFA 4BLAA 1XXCA 3WODA 5M5XK 1TWAC 3GTLC 1R9TC 4WJ4A 1TWFC 3K7AK 4MEXA 2ZUEA 1INNA 3L4KA 5TJ3A 1XPPA 3GTLA 3ERED 1EH1A 4YFKA 2RGRA 4KDDA 3GTMC 1TWFK 3L4JA 3GTPA 5C3EK 2A69A 4OINA 4KC6A 2A6HA 1F93A 3HOXC 3SZYA 2V6UA 4AYBL 4A3IK 1VGXA 5EGEA 4A3BC 4C3IK 2WAQD 2CFAB 1V5VA 3FOEA 2E2IK 3H0GC 1YNJA 4GTBA 1PJ6A 1K83A 3TTGA 4Y7NC 5C4JC 1EQRA 1TWGC 2WB1L 1JQWA 3H0GK 5C4XC 3AH5A 3S0XA 3M4OC 2VUMK 2V6SA 5FLMK 4KMDA 1O25A 1BS2A 4A3LK 1O29A 2E2IA 3AD9C 4KAWX 5M5WK 1KQ4A 2GAGC 4J3NA 5FLMC 2NVTK 4LK0A 1O24A 3N3YA 3TFJA 4JK1A 2JA7C 3GTGC 4GZYA 2O5JA 3I4NC 4C3HK 5IOTA 2YU9C 5C4JK 2R7ZC 3GTQK 1XZPB 4A3JK 4BXXK 3S15C 3CQZC 1VH2A 5M5YK 2JA8C 1O26A 5C44C 2E2JC 2PPBA 1IBAA 1WSVA 3S1MK 5M3MK 1Y1WK 2NVYA 3S1QK 2CW0A 3BP3A 5IP9K 1IQ0A 3GTJK 5L46A 1X31C 4KMHA 5C44K 2E2JK 4XLPA 2FQOA 3S2HC 1Y1VC 3RZOC 1TWCC 3T00A 3GTOC 1G51A 3G4AA 4XCHA 4AYBD 4BBSK 4YFNA 4Y52C 5FJ8K 2NVYK 1B4AA 2R92C 4C2MK 1F9NA 3V4GA 5IYCC 5IYBC 1USOA 5IP7C 5M3FK 2R93C 3M3YC 2V6TA 1I6HC 1WCMC 1O2FB 1WOOA 1ZYRA 4OIRA 1DCPA 3M4OK 4KM9A 1TWHK 4A3DK 2GSUA 4FZBA 5E68A 3AD7C 2D6FC 3BUEA 1TWCK 3S17C 4C3HC 4KB2A 4A93K 5IYDC 4A3MC 1WQHA 4ZH4A 4A3DC 4LK1A 4RMFA 1DCHA 3S1NC 4MEYA 1I3QA 3BP8C 2E2HC 2NVTC 4KASA 1VJEA 2XCQA 3GDZA 4QJVA 1I50C 1WCMA 1EFWA 4LLGA 4GTEA 2R7ZA 2B63K 4Q4ZA 4G7OA 3HOUC 4A3JC 3FOFA 1O27A 3RZOK 3S16C 1WQFA 3FKIA 1ZBSA 3GTKK 4A3KC 4FM9A 4BY7C 1BJTA 3NUHA 1XZQB 1TWAK 4WILA 4X6AK 4A3FC 2E2IC 1C0AA 3MMLB 2JA5C 3GEEA 2XCRB 1R9TA 3RZDK 4YG2A 2JA6A 3FKIK 4GTAA 1EK8A 4Y52K 1TWGA 4P5BA 1BGWA 3I4MK 1TWGK 3OPFA 1WQGA 3IPJA 1DD5A 4XLNA 2KWAA 1RU0A 3TFIA 2P5MA 5IP7K 4C3JK 2R93A 1WORA 1F7UA 2YU9A 4BBRC 2O5IA 1O2AA 4BY1K 4ILDA 4A3GK 3GTGA 2JA7A 1YCLA 4Q5SA 3S1MC 4NOIA 4A3EC 4KMAA 4KB4A 3DXJA 3S2DC 1PJ7A 1YX2A 1ZVUA 3S2HK 2VUMA 4PABA 2NVXC 3H3VD 3HXAA 4KN7A 3M3YK 1WCMK 2PMZD 4GT9A 5TMCA 3A8IA 1K83C 4X6AC 1BDFA 4A3CC 4P9SA 2PMZL 5IYBK 4A3BK 1YNNA 2Y3PA 4M1XA 3TFHA 4G7ZA 4A3KK 3Q3QA 3GTKA 3S14K 3OEPA 3GTQC 3GTOK 3S2DK 3HOUK 4G0UA 3LAJA 4KN4A 2CFAA 3LAPA 2B63C 3PO3C 1GE9A 1SFOK 5IP9C 4LOWA 2VUMC 5IOQA 2FQTA 4A3CK
chains in the Genus database with same CATH topology
2V6UA 1DCOA 1RU0A 2EBBA 4LOWA 3HXAA 2V6TA 4C45A 2V6SA 1DCHA 1DCPA 1USOA 1F93A 3JSTA 1USMA 4WILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6U A;  1DCO A;  1RU0 A;  2EBB A;  4LOW A;  3HXA A;  2V6T A;  4C45 A;  2V6S A;  1DCH A;  1DCP A;  1USO A;  1F93 A;  3JST A;  1USM A;  4WIL A; 
#chains in the Genus database with same CATH topology
 3HOZ C;  1ISE A;  4BXX C;  2Y0S D;  5IOS A;  4A93 C;  4GTC A;  3CAG A;  2A68 A;  3AQP A;  4XSZ A;  2Y0S L;  4KM8 A;  3GEI A;  2JA7 K;  1JOE A;  3GTG K;  3K7A C;  4PAA A;  1I50 K;  3PO2 C;  3ADA C;  1XZQ A;  3GTP K;  4GTD A;  2R93 K;  2E2H K;  3PO3 K;  1B4B A;  1XZP A;  5CJ9 A;  1F7V A;  1SFO A;  4P5A A;  3GTP C;  1HQM A;  3HOX K;  5EGH A;  3T02 A;  4QIW D;  3H3V L;  5C4X K;  4G0V A;  4AH6 A;  1ZXO A;  2NVX A;  1WSR A;  1Y1V K;  1I3Q K;  3S1R C;  1TWA A;  2GSO A;  5D4D A;  4QJV B;  3S1Q C;  4LQY A;  1O28 A;  4BLB A;  3GTJ A;  3VA7 A;  2R92 K;  5IOR A;  4BKW A;  2NVQ K;  4KAT A;  2ZFZ A;  2JA8 K;  3S1N K;  3HOY C;  2NVX K;  2PA8 L;  2A6E A;  1J98 A;  5JVO A;  2R7Z K;  4BBS C;  2PA8 D;  1AB4 A;  3GSI A;  1TWH C;  3S16 K;  4WJ3 M;  4OIO A;  2E2H A;  2JA5 K;  2JH3 A;  3N0B A;  2JA6 C;  4BY1 C;  1O2B A;  2GAH C;  4C2M C;  4A3E K;  1TWH A;  1J6X A;  4A3I C;  3HOW C;  3S17 K;  3CQZ A;  4KAR A;  4OIP A;  3HOV C;  3GIR A;  1UV7 A;  4C3J C;  1J6V A;  4A3M K;  3FKI C;  1USM A;  3GTL K;  3FHZ A;  3T01 A;  1XXA A;  2W7V A;  3G4C A;  4C3I C;  3GTJ C;  1R9T K;  2JA6 K;  3A8J A;  4O2D A;  3PO2 K;  4BY7 K;  1I50 A;  3CQZ K;  4QIW L;  4KMU A;  1Y1W C;  4A3G C;  3GTO A;  3AD8 C;  4XSX A;  4A3F K;  1I3Q C;  3GTM K;  1WOP A;  5IYD K;  4YFX A;  1DCO A;  1ZQ1 C;  4C45 A;  2YU9 K;  2JA5 A;  4DDQ A;  3JST A;  4MQ9 A;  4G0W A;  1I6H K;  1WIH A;  1Y1W A;  2RH6 A;  3QX3 A;  1L0W A;  2XCO A;  3GTQ A;  1VLO A;  3H0G A;  1SMY A;  4BBR K;  3S15 K;  1EI6 A;  2P8T A;  5C3E C;  1IS1 A;  5IYC K;  2ZUF A;  5TMF A;  3I4M C;  2WAQ L;  2R92 A;  3EQL A;  3I4N K;  2PHC B;  3ORE A;  3HOV K;  1J6W A;  4LR2 A;  1I6V A;  4G7H A;  3GTM A;  1HI9 A;  3A8K A;  1JVI A;  3S14 C;  1TWC A;  3HOY K;  1Y1V A;  2WB1 D;  3HOZ K;  3HOW K;  1TWF A;  2EBB A;  3N0C A;  3RZD C;  1IL2 A;  2NVY C;  4GTL A;  2B63 A;  3LPX A;  1XXB A;  1SFO C;  1K83 K;  1IW7 A;  2GSN A;  4GFQ A;  4A3L C;  1VRQ C;  4LJZ A;  3SZZ A;  1WOS A;  3HKZ L;  4Y7N K;  3S1R K;  4OIQ A;  3GTK C;  3HKZ D;  3GEH A;  2BE5 A;  5CHP A;  1PJ5 A;  5JFE A;  2NVQ C;  1IE0 A;  3AQO A;  5HL8 A;  4GTF A;  4BLA A;  1XXC A;  3WOD A;  5M5X K;  1TWA C;  3GTL C;  1R9T C;  4WJ4 A;  1TWF C;  3K7A K;  4MEX A;  2ZUE A;  1INN A;  3L4K A;  5TJ3 A;  1XPP A;  3GTL A;  3ERE D;  1EH1 A;  4YFK A;  2RGR A;  4KDD A;  3GTM C;  1TWF K;  3L4J A;  3GTP A;  5C3E K;  2A69 A;  4OIN A;  4KC6 A;  2A6H A;  1F93 A;  3HOX C;  3SZY A;  2V6U A;  4AYB L;  4A3I K;  1VGX A;  5EGE A;  4A3B C;  4C3I K;  2WAQ D;  2CFA B;  1V5V A;  3FOE A;  2E2I K;  3H0G C;  1YNJ A;  4GTB A;  1PJ6 A;  1K83 A;  3TTG A;  4Y7N C;  5C4J C;  1EQR A;  1TWG C;  2WB1 L;  1JQW A;  3H0G K;  5C4X C;  3AH5 A;  3S0X A;  3M4O C;  2VUM K;  2V6S A;  5FLM K;  4KMD A;  1O25 A;  1BS2 A;  4A3L K;  1O29 A;  2E2I A;  3AD9 C;  4KAW X;  5M5W K;  1KQ4 A;  2GAG C;  4J3N A;  5FLM C;  2NVT K;  4LK0 A;  1O24 A;  3N3Y A;  3TFJ A;  4JK1 A;  2JA7 C;  3GTG C;  4GZY A;  2O5J A;  3I4N C;  4C3H K;  5IOT A;  2YU9 C;  5C4J K;  2R7Z C;  3GTQ K;  1XZP B;  4A3J K;  4BXX K;  3S15 C;  3CQZ C;  1VH2 A;  5M5Y K;  2JA8 C;  1O26 A;  5C44 C;  2E2J C;  2PPB A;  1IBA A;  1WSV A;  3S1M K;  5M3M K;  1Y1W K;  2NVY A;  3S1Q K;  2CW0 A;  3BP3 A;  5IP9 K;  1IQ0 A;  3GTJ K;  5L46 A;  1X31 C;  4KMH A;  5C44 K;  2E2J K;  4XLP A;  2FQO A;  3S2H C;  1Y1V C;  3RZO C;  1TWC C;  3T00 A;  3GTO C;  1G51 A;  3G4A A;  4XCH A;  4AYB D;  4BBS K;  4YFN A;  4Y52 C;  5FJ8 K;  2NVY K;  1B4A A;  2R92 C;  4C2M K;  1F9N A;  3V4G A;  5IYC C;  5IYB C;  1USO A;  5IP7 C;  5M3F K;  2R93 C;  3M3Y C;  2V6T A;  1I6H C;  1WCM C;  1O2F B;  1WOO A;  1ZYR A;  4OIR A;  1DCP A;  3M4O K;  4KM9 A;  1TWH K;  4A3D K;  2GSU A;  4FZB A;  5E68 A;  3AD7 C;  2D6F C;  3BUE A;  1TWC K;  3S17 C;  4C3H C;  4KB2 A;  4A93 K;  5IYD C;  4A3M C;  1WQH A;  4ZH4 A;  4A3D C;  4LK1 A;  4RMF A;  1DCH A;  3S1N C;  4MEY A;  1I3Q A;  3BP8 C;  2E2H C;  2NVT C;  4KAS A;  1VJE A;  2XCQ A;  3GDZ A;  4QJV A;  1I50 C;  1WCM A;  1EFW A;  4LLG A;  4GTE A;  2R7Z A;  2B63 K;  4Q4Z A;  4G7O A;  3HOU C;  4A3J C;  3FOF A;  1O27 A;  3RZO K;  3S16 C;  1WQF A;  3FKI A;  1ZBS A;  3GTK K;  4A3K C;  4FM9 A;  4BY7 C;  1BJT A;  3NUH A;  1XZQ B;  1TWA K;  4WIL A;  4X6A K;  4A3F C;  2E2I C;  1C0A A;  3MML B;  2JA5 C;  3GEE A;  2XCR B;  1R9T A;  3RZD K;  4YG2 A;  2JA6 A;  3FKI K;  4GTA A;  1EK8 A;  4Y52 K;  1TWG A;  4P5B A;  1BGW A;  3I4M K;  1TWG K;  3OPF A;  1WQG A;  3IPJ A;  1DD5 A;  4XLN A;  2KWA A;  1RU0 A;  3TFI A;  2P5M A;  5IP7 K;  4C3J K;  2R93 A;  1WOR A;  1F7U A;  2YU9 A;  4BBR C;  2O5I A;  1O2A A;  4BY1 K;  4ILD A;  4A3G K;  3GTG A;  2JA7 A;  1YCL A;  4Q5S A;  3S1M C;  4NOI A;  4A3E C;  4KMA A;  4KB4 A;  3DXJ A;  3S2D C;  1PJ7 A;  1YX2 A;  1ZVU A;  3S2H K;  2VUM A;  4PAB A;  2NVX C;  3H3V D;  3HXA A;  4KN7 A;  3M3Y K;  1WCM K;  2PMZ D;  4GT9 A;  5TMC A;  3A8I A;  1K83 C;  4X6A C;  1BDF A;  4A3C C;  4P9S A;  2PMZ L;  5IYB K;  4A3B K;  1YNN A;  2Y3P A;  4M1X A;  3TFH A;  4G7Z A;  4A3K K;  3Q3Q A;  3GTK A;  3S14 K;  3OEP A;  3GTQ C;  3GTO K;  3S2D K;  3HOU K;  4G0U A;  3LAJ A;  4KN4 A;  2CFA A;  3LAP A;  2B63 C;  3PO3 C;  1GE9 A;  1SFO K;  5IP9 C;  4LOW A;  2VUM C;  5IOQ A;  2FQT A;  4A3C K; 
#chains in the Genus database with same CATH homology
 2V6U A;  1DCO A;  1RU0 A;  2EBB A;  4LOW A;  3HXA A;  2V6T A;  4C45 A;  2V6S A;  1DCH A;  1DCP A;  1USO A;  1F93 A;  3JST A;  1USM A;  4WIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...