4C45A

Crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'THRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE 2
publication title Crystal Structure of Human Pterin-4-Alpha- Carbinolamine Dehydratase 2 (Pcbd2)
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 37
structure length 99
sequence length 99
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4c45A00
1DCPA 3HXAA 1DCHA 2V6UA 1USOA 2EBBA 2V6TA 4WILA 4C45A 1USMA 3JSTA 2V6SA 1DCOA 4LOWA 1RU0A 1F93A
chains in the Genus database with same CATH superfamily
3A8KA 1ISEA 4ILDA 2A6EA 3H3VL 3IPJA 3H0GC 4G0UA 5IYDK 1O2AA 3GTGC 5JFEA 3GTJK 1EQRA 3GTQC 5E68A 4YG2A 1IBAA 2W7VA 2XCOA 2NVXC 3AH5A 4AYBL 2JA8C 2GSNA 3AQOA 3CQZA 5IYBC 4A3FC 4A3DC 1IW7A 3GTMC 4A3GK 4KB4A 2R7ZK 3HKZL 2PMZD 4YFKA 1XXCA 2NVQK 3N3YA 1R9TA 1WCMK 2P5MA 2VUMC 2YU9K 4OINA 4KAWX 3EQLA 3OREA 4C3JC 2B63K 4Y52K 5JVOA 4G7ZA 1VJEA 1ZYRA 2A6HA 4GT9A 1YNNA 4BLAA 2R93K 2A68A 1EK8A 2WB1D 1TWAK 5EGHA 1I50K 5C3EC 3HOYK 3FKIK 1XZPA 3HOVC 2PA8D 1TWGA 2WAQL 2FQOA 3GTOC 3HOXC 4BBRC 4KARA 3GTPA 5IOQA 3RZDK 3CQZK 4KDDA 3HOUK 2D6FC 4A3CC 3H0GA 1BJTA 1DCPA 3K7AC 3GTGA 4GTFA 3GTQA 2XCRB 2NVXA 3DXJA 4KMAA 5TMCA 3GSIA 1R9TK 3S17K 3GTMA 1L0WA 1O29A 5IP7K 4PABA 4QIWL 4A3LC 4MQ9A 3S2HC 3I4MC 3S1NK 3ADAC 5FLMC 4OIQA 1XZPB 3LAPA 2VUMA 1EH1A 2RGRA 5C44C 4GTAA 4XLNA 3GIRA 4OIOA 4GTCA 4BBSK 2O5IA 1I6HK 3BP8C 2NVYK 1JQWA 3S16C 3N0CA 3TFHA 1TWGK 1DCOA 3VA7A 1BGWA 1SFOC 1TWHC 3CAGA 1AB4A 3GTPK 4MEXA 1IQ0A 3A8IA 4WJ3M 3BUEA 3GTOA 1O2FB 1O24A 1O28A 3S14C 3S2DC 3HOZC 3H0GK 2NVTC 4BXXC 4GTEA 4G0VA 3GTGK 3TTGA 5D4DA 3HOWC 1J98A 2NVXK 2V6UA 2JA8K 4Y7NC 5IYBK 4A3FK 4A3BC 4A3DK 3GTMK 4KN7A 2EBBA 3V4GA 4KMUA 1INNA 3L4JA 1WQFA 4C2MC 1WOPA 1XXBA 2GAGC 4XLPA 3N0BA 2JA6C 4LJZA 2VUMK 1UV7A 2O5JA 1GE9A 3AD7C 3AQPA 5HL8A 1WOSA 3G4AA 1XZQA 3WODA 1WSVA 1JVIA 3FOEA 2JA7C 1F93A 1K83C 1YNJA 5C3EK 2PPBA 2E2HC 3H3VD 3HOVK 2V6SA 4A93C 2GAHC 1SFOA 1TWHA 2Y0SD 3GTOK 5EGEA 3HOXK 4Q4ZA 4AYBD 4P5BA 4X6AC 3SZZA 1Y1VC 1C0AA 1ZBSA 2BE5A 4C3HC 4GFQA 3K7AK 4A3EC 4FM9A 1B4AA 2WB1L 3A8JA 1PJ6A 1XZQB 4WILA 5L46A 4BY1C 4ZH4A 4KATA 5TJ3A 2ZFZA 4A3LK 4A3KC 1WOOA 3SZYA 3S2HK 3I4MK 1HI9A 5FLMK 2JA6A 2GSUA 1F9NA 4A3GC 5C44K 5IOTA 4P5AA 3GTLC 4KM9A 2R7ZC 2RH6A 2P8TA 4YFNA 3PO3C 4WJ4A 3RZOC 2WAQD 3L4KA 3S1QC 2V6TA 1Y1WC 1ZXOA 2GSOA 3S16K 2JA7A 3S1RC 1K83A 4RMFA 2E2IC 2E2HA 4KN4A 3FHZA 3M4OC 1WORA 1VH2A 1VGXA 4BLBA 3S2DK 1TWAC 3S14K 3HOZK 3HOYC 2NVTK 1PJ5A 4BXXK 1VRQC 2E2JC 3S15K 3HOWK 1USMA 4QIWD 2ZUFA 2FQTA 3GTKC 1Y1VA 4JK1A 3PO2C 4Y7NK 2JH3A 4A3BK 4GTDA 5IP9C 3M3YC 3GEEA 1X31C 3AD8C 3MMLB 3NUHA 5C4JK 3RZDC 1I6VA 4A3MC 2CFAA 5TMFA 1KQ4A 3LPXA 1XXAA 3GTQK 3AD9C 3S17C 5IP7C 3GTLA 2R7ZA 4GZYA 4C45A 1Y1WA 2Y3PA 1K83K 1JOEA 3GDZA 1TWCC 3S0XA 2E2HK 3GEHA 4A93K 3JSTA 4M1XA 1RU0A 5M5XK 1EI6A 4C3JK 5IYCC 1DCHA 1ZVUA 3LAJA 1DD5A 4A3IC 2E2IA 4BY7C 2NVYC 1YCLA 4QJVA 2R92C 1O27A 4X6AK 4C3IC 3BP3A 1Y1VK 2A69A 1F7VA 5C4XC 1TWAA 1I3QC 2CFAB 4FZBA 4GTBA 4AH6A 4KB2A 4C3HK 1EFWA 4A3EK 2PMZL 1ZQ1C 4LK1A 1G51A 3GTKA 3T02A 1BS2A 3Q3QA 5CHPA 1V5VA 4OIPA 4BY1K 5IORA 4GTLA 4XSZA 1SMYA 4A3JC 4LK0A 4G7HA 4BBRK 4A3KK 4KMHA 2Y0SL 5FJ8K 3HKZD 4LOWA 4DDQA 2JA5C 3GTLK 1IE0A 3PO3K 3S1MC 1TWFC 2PHCB 3GEIA 4A3CK 3RZOK 3S1QK 4PAAA 1Y1WK 4OIRA 4XSXA 3I4NC 4QJVB 4G7OA 3T01A 1PJ7A 2CW0A 2PA8L 5IYDC 1IS1A 3S1RK 3GTJC 1J6WA 1VLOA 2E2IK 1TWCA 3FOFA 1J6VA 5CJ9A 3M4OK 2NVYA 2NVQC 2R92A 1WCMC 3G4CA 4KM8A 2E2JK 2YU9C 3GTKK 3OPFA 2B63C 4KASA 4Y52C 3PO2K 4Q5SA 1I3QA 1YX2A 4XCHA 5IP9K 1SFOK 1TWHK 3M3YK 4LLGA 3HXAA 1USOA 1WQHA 2R93C 4A3MK 5M5YK 3OEPA 1I50C 1O25A 2KWAA 3FKIC 3ERED 2JA5A 4G0WA 1TWFA 4P9SA 2XCQA 5M3MK 1TWCK 4C2MK 1WQGA 1WIHA 4KMDA 2JA6K 3CQZC 3HOUC 3GTJA 5IYCK 4A3IK 4BY7K 1F7UA 2R92K 1R9TC 1HQMA 4C3IK 4LQYA 4LR2A 4NOIA 5C4XK 1I3QK 4BKWA 3S1NC 2JA7K 4O2DA 1J6XA 1WCMA 2YU9A 1O26A 1O2BA 5M3FK 4MEYA 2B63A 3TFJA 1B4BA 3T00A 4A3JK 4BBSC 3S15C 1I6HC 4YFXA 5M5WK 1IL2A 1TWGC 5IOSA 3QX3A 2R93A 3TFIA 1XPPA 2ZUEA 2JA5K 4J3NA 1BDFA 4KC6A 3S1MK 1I50A 1TWFK 3FKIA 5C4JC 3GTPC 1WSRA 3I4NK
chains in the Genus database with same CATH topology
1DCPA 3HXAA 1DCHA 2V6UA 1USOA 2EBBA 2V6TA 4WILA 4C45A 1USMA 3JSTA 2V6SA 1DCOA 4LOWA 1RU0A 1F93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCP A;  3HXA A;  1DCH A;  2V6U A;  1USO A;  2EBB A;  2V6T A;  4WIL A;  4C45 A;  1USM A;  3JST A;  2V6S A;  1DCO A;  4LOW A;  1RU0 A;  1F93 A; 
#chains in the Genus database with same CATH topology
 3A8K A;  1ISE A;  4ILD A;  2A6E A;  3H3V L;  3IPJ A;  3H0G C;  4G0U A;  5IYD K;  1O2A A;  3GTG C;  5JFE A;  3GTJ K;  1EQR A;  3GTQ C;  5E68 A;  4YG2 A;  1IBA A;  2W7V A;  2XCO A;  2NVX C;  3AH5 A;  4AYB L;  2JA8 C;  2GSN A;  3AQO A;  3CQZ A;  5IYB C;  4A3F C;  4A3D C;  1IW7 A;  3GTM C;  4A3G K;  4KB4 A;  2R7Z K;  3HKZ L;  2PMZ D;  4YFK A;  1XXC A;  2NVQ K;  3N3Y A;  1R9T A;  1WCM K;  2P5M A;  2VUM C;  2YU9 K;  4OIN A;  4KAW X;  3EQL A;  3ORE A;  4C3J C;  2B63 K;  4Y52 K;  5JVO A;  4G7Z A;  1VJE A;  1ZYR A;  2A6H A;  4GT9 A;  1YNN A;  4BLA A;  2R93 K;  2A68 A;  1EK8 A;  2WB1 D;  1TWA K;  5EGH A;  1I50 K;  5C3E C;  3HOY K;  3FKI K;  1XZP A;  3HOV C;  2PA8 D;  1TWG A;  2WAQ L;  2FQO A;  3GTO C;  3HOX C;  4BBR C;  4KAR A;  3GTP A;  5IOQ A;  3RZD K;  3CQZ K;  4KDD A;  3HOU K;  2D6F C;  4A3C C;  3H0G A;  1BJT A;  1DCP A;  3K7A C;  3GTG A;  4GTF A;  3GTQ A;  2XCR B;  2NVX A;  3DXJ A;  4KMA A;  5TMC A;  3GSI A;  1R9T K;  3S17 K;  3GTM A;  1L0W A;  1O29 A;  5IP7 K;  4PAB A;  4QIW L;  4A3L C;  4MQ9 A;  3S2H C;  3I4M C;  3S1N K;  3ADA C;  5FLM C;  4OIQ A;  1XZP B;  3LAP A;  2VUM A;  1EH1 A;  2RGR A;  5C44 C;  4GTA A;  4XLN A;  3GIR A;  4OIO A;  4GTC A;  4BBS K;  2O5I A;  1I6H K;  3BP8 C;  2NVY K;  1JQW A;  3S16 C;  3N0C A;  3TFH A;  1TWG K;  1DCO A;  3VA7 A;  1BGW A;  1SFO C;  1TWH C;  3CAG A;  1AB4 A;  3GTP K;  4MEX A;  1IQ0 A;  3A8I A;  4WJ3 M;  3BUE A;  3GTO A;  1O2F B;  1O24 A;  1O28 A;  3S14 C;  3S2D C;  3HOZ C;  3H0G K;  2NVT C;  4BXX C;  4GTE A;  4G0V A;  3GTG K;  3TTG A;  5D4D A;  3HOW C;  1J98 A;  2NVX K;  2V6U A;  2JA8 K;  4Y7N C;  5IYB K;  4A3F K;  4A3B C;  4A3D K;  3GTM K;  4KN7 A;  2EBB A;  3V4G A;  4KMU A;  1INN A;  3L4J A;  1WQF A;  4C2M C;  1WOP A;  1XXB A;  2GAG C;  4XLP A;  3N0B A;  2JA6 C;  4LJZ A;  2VUM K;  1UV7 A;  2O5J A;  1GE9 A;  3AD7 C;  3AQP A;  5HL8 A;  1WOS A;  3G4A A;  1XZQ A;  3WOD A;  1WSV A;  1JVI A;  3FOE A;  2JA7 C;  1F93 A;  1K83 C;  1YNJ A;  5C3E K;  2PPB A;  2E2H C;  3H3V D;  3HOV K;  2V6S A;  4A93 C;  2GAH C;  1SFO A;  1TWH A;  2Y0S D;  3GTO K;  5EGE A;  3HOX K;  4Q4Z A;  4AYB D;  4P5B A;  4X6A C;  3SZZ A;  1Y1V C;  1C0A A;  1ZBS A;  2BE5 A;  4C3H C;  4GFQ A;  3K7A K;  4A3E C;  4FM9 A;  1B4A A;  2WB1 L;  3A8J A;  1PJ6 A;  1XZQ B;  4WIL A;  5L46 A;  4BY1 C;  4ZH4 A;  4KAT A;  5TJ3 A;  2ZFZ A;  4A3L K;  4A3K C;  1WOO A;  3SZY A;  3S2H K;  3I4M K;  1HI9 A;  5FLM K;  2JA6 A;  2GSU A;  1F9N A;  4A3G C;  5C44 K;  5IOT A;  4P5A A;  3GTL C;  4KM9 A;  2R7Z C;  2RH6 A;  2P8T A;  4YFN A;  3PO3 C;  4WJ4 A;  3RZO C;  2WAQ D;  3L4K A;  3S1Q C;  2V6T A;  1Y1W C;  1ZXO A;  2GSO A;  3S16 K;  2JA7 A;  3S1R C;  1K83 A;  4RMF A;  2E2I C;  2E2H A;  4KN4 A;  3FHZ A;  3M4O C;  1WOR A;  1VH2 A;  1VGX A;  4BLB A;  3S2D K;  1TWA C;  3S14 K;  3HOZ K;  3HOY C;  2NVT K;  1PJ5 A;  4BXX K;  1VRQ C;  2E2J C;  3S15 K;  3HOW K;  1USM A;  4QIW D;  2ZUF A;  2FQT A;  3GTK C;  1Y1V A;  4JK1 A;  3PO2 C;  4Y7N K;  2JH3 A;  4A3B K;  4GTD A;  5IP9 C;  3M3Y C;  3GEE A;  1X31 C;  3AD8 C;  3MML B;  3NUH A;  5C4J K;  3RZD C;  1I6V A;  4A3M C;  2CFA A;  5TMF A;  1KQ4 A;  3LPX A;  1XXA A;  3GTQ K;  3AD9 C;  3S17 C;  5IP7 C;  3GTL A;  2R7Z A;  4GZY A;  4C45 A;  1Y1W A;  2Y3P A;  1K83 K;  1JOE A;  3GDZ A;  1TWC C;  3S0X A;  2E2H K;  3GEH A;  4A93 K;  3JST A;  4M1X A;  1RU0 A;  5M5X K;  1EI6 A;  4C3J K;  5IYC C;  1DCH A;  1ZVU A;  3LAJ A;  1DD5 A;  4A3I C;  2E2I A;  4BY7 C;  2NVY C;  1YCL A;  4QJV A;  2R92 C;  1O27 A;  4X6A K;  4C3I C;  3BP3 A;  1Y1V K;  2A69 A;  1F7V A;  5C4X C;  1TWA A;  1I3Q C;  2CFA B;  4FZB A;  4GTB A;  4AH6 A;  4KB2 A;  4C3H K;  1EFW A;  4A3E K;  2PMZ L;  1ZQ1 C;  4LK1 A;  1G51 A;  3GTK A;  3T02 A;  1BS2 A;  3Q3Q A;  5CHP A;  1V5V A;  4OIP A;  4BY1 K;  5IOR A;  4GTL A;  4XSZ A;  1SMY A;  4A3J C;  4LK0 A;  4G7H A;  4BBR K;  4A3K K;  4KMH A;  2Y0S L;  5FJ8 K;  3HKZ D;  4LOW A;  4DDQ A;  2JA5 C;  3GTL K;  1IE0 A;  3PO3 K;  3S1M C;  1TWF C;  2PHC B;  3GEI A;  4A3C K;  3RZO K;  3S1Q K;  4PAA A;  1Y1W K;  4OIR A;  4XSX A;  3I4N C;  4QJV B;  4G7O A;  3T01 A;  1PJ7 A;  2CW0 A;  2PA8 L;  5IYD C;  1IS1 A;  3S1R K;  3GTJ C;  1J6W A;  1VLO A;  2E2I K;  1TWC A;  3FOF A;  1J6V A;  5CJ9 A;  3M4O K;  2NVY A;  2NVQ C;  2R92 A;  1WCM C;  3G4C A;  4KM8 A;  2E2J K;  2YU9 C;  3GTK K;  3OPF A;  2B63 C;  4KAS A;  4Y52 C;  3PO2 K;  4Q5S A;  1I3Q A;  1YX2 A;  4XCH A;  5IP9 K;  1SFO K;  1TWH K;  3M3Y K;  4LLG A;  3HXA A;  1USO A;  1WQH A;  2R93 C;  4A3M K;  5M5Y K;  3OEP A;  1I50 C;  1O25 A;  2KWA A;  3FKI C;  3ERE D;  2JA5 A;  4G0W A;  1TWF A;  4P9S A;  2XCQ A;  5M3M K;  1TWC K;  4C2M K;  1WQG A;  1WIH A;  4KMD A;  2JA6 K;  3CQZ C;  3HOU C;  3GTJ A;  5IYC K;  4A3I K;  4BY7 K;  1F7U A;  2R92 K;  1R9T C;  1HQM A;  4C3I K;  4LQY A;  4LR2 A;  4NOI A;  5C4X K;  1I3Q K;  4BKW A;  3S1N C;  2JA7 K;  4O2D A;  1J6X A;  1WCM A;  2YU9 A;  1O26 A;  1O2B A;  5M3F K;  4MEY A;  2B63 A;  3TFJ A;  1B4B A;  3T00 A;  4A3J K;  4BBS C;  3S15 C;  1I6H C;  4YFX A;  5M5W K;  1IL2 A;  1TWG C;  5IOS A;  3QX3 A;  2R93 A;  3TFI A;  1XPP A;  2ZUE A;  2JA5 K;  4J3N A;  1BDF A;  4KC6 A;  3S1M K;  1I50 A;  1TWF K;  3FKI A;  5C4J C;  3GTP C;  1WSR A;  3I4N K; 
#chains in the Genus database with same CATH homology
 1DCP A;  3HXA A;  1DCH A;  2V6U A;  1USO A;  2EBB A;  2V6T A;  4WIL A;  4C45 A;  1USM A;  3JST A;  2V6S A;  1DCO A;  4LOW A;  1RU0 A;  1F93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...