4C45A

Crystal structure of human pterin-4-alpha-carbinolamine dehydratase 2 (pcbd2)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
THRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE 2
publication title Crystal Structure of Human Pterin-4-Alpha- Carbinolamine Dehydratase 2 (Pcbd2)
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 37
structure length 99
sequence length 99
ec nomenclature ec 4.2.1.96: 4a-hydroxytetrahydrobiopterin dehydratase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01329 Pterin_4a Pterin 4 alpha carbinolamine dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.20 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Transcriptional coactivator/pterin dehydratase 4c45A00
1F93A 1RU0A 1USOA 2V6UA 4WILA 4C45A 1DCOA 3HXAA 4LOWA 1USMA 3JSTA 1DCPA 2EBBA 1DCHA 2V6SA 2V6TA
chains in the Genus database with same CATH superfamily
1G51A 2WAQD 2RGRA 3HOYK 3S1RK 2A69A 3HOZC 3ADAC 5EGHA 4NOIA 3S1QC 3GEIA 4MQ9A 4PAAA 3BUEA 4BY7K 1J6WA 2E2IA 5M3MK 4MEYA 4RMFA 4A3FK 4GFQA 4DDQA 4C3HK 4Q5SA 1WOOA 2NVYK 4LJZA 3GTQC 3H0GK 3AD7C 3PO2K 2B63A 3FKIC 3HOVC 4OIRA 1HQMA 3TTGA 4O2DA 4P5BA 4BY1K 1VGXA 4A3BK 2O5JA 4Y7NC 4JK1A 3RZOK 4KB4A 3I4NK 1XXCA 4XLNA 4LOWA 3GTMA 1TWFK 1I3QC 3TFJA 2R92K 4A3KC 1TWCA 4A3LC 4KASA 1ZYRA 3HOWC 1EQRA 3TFHA 1WCMK 5FLMC 2NVYA 4G7OA 1JQWA 4Y52K 3H0GA 2JA7K 2E2HK 3S2DC 4ILDA 2FQTA 1O24A 4M1XA 2NVXK 1ZVUA 4A3MK 4C2MC 5C4JC 2V6SA 1F93A 3PO3C 3HOXK 5C3EC 1TWFA 3GTGC 3WODA 2BE5A 1B4AA 5IOTA 2PMZL 2YU9C 3HOZK 1J98A 3CAGA 4OIPA 2JA7A 1WIHA 2E2HA 4KB2A 2PHCB 3HOUK 1R9TK 3GTKC 1YCLA 4GTLA 2NVXA 4AH6A 3HOYC 3L4KA 2R7ZA 3SZYA 1Y1VK 1XPPA 5IYCK 3FHZA 4BY7C 3HKZD 4OINA 3RZDK 4Y7NK 3QX3A 4C3HC 1ZXOA 2NVYC 4C3IK 2NVQK 1DCHA 4A3MC 1WOSA 4BY1C 3GTQA 4A3BC 1PJ5A 1Y1VA 4KATA 3RZOC 3I4NC 2WAQL 2E2JK 1TWFC 4AYBD 2R92C 3EQLA 3K7AC 2Y0SD 1WCMC 5C3EK 3GTGK 5C44K 3BP8C 1EH1A 2JA7C 3AD8C 3MMLB 3GEEA 3FOFA 4WILA 1WORA 1PJ7A 3DXJA 4A3EC 3GTKK 4A3GK 4KM9A 3HOXC 1DCOA 4MEXA 1I6VA 2W7VA 3GTLK 4P5AA 1TWHK 3H3VD 3GTGA 1AB4A 3G4AA 5CJ9A 3GDZA 4LQYA 4WJ4A 3HOUC 1R9TC 2YU9A 1XZPA 2EBBA 4A3JK 1USOA 2FQOA 1O26A 4A3CK 1Y1WK 3GTKA 3OREA 3M4OK 4BBSC 2R93C 3S1MK 1Y1VC 3GTLA 5IYCC 5IP7C 4KM8A 4A3DC 1TWHA 5TMCA 1VRQC 1WQFA 4LLGA 3RZDC 2ZFZA 2XCQA 3GIRA 1X31C 3AH5A 3NUHA 3LPXA 4C3IC 2NVQC 2JH3A 1XZPB 5IYBK 3S14K 1B4BA 3K7AK 5D4DA 2O5IA 3GTPK 4XCHA 4KAWX 1YNNA 4G0WA 4GZYA 3N0CA 4PABA 3A8IA 2JA8K 1J6XA 2E2JC 1V5VA 1XXBA 4GTEA 4A3EK 2XCRB 2XCOA 1BJTA 1IQ0A 5C44C 2R92A 2PA8D 1BS2A 3AQOA 1F7UA 4KC6A 1XXAA 1WCMA 1ZBSA 4BBRK 5TJ3A 1VJEA 4GTFA 5M5WK 4G7HA 4GTDA 1XZQA 4A3GC 4BLAA 1IE0A 1HI9A 1INNA 1ISEA 3GTLC 3S16C 4BKWA 4KMUA 3GTOC 1O25A 1TWHC 4BBSK 4C3JK 2V6TA 2R93K 5IP7K 4AYBL 1TWAK 4A3DK 3Q3QA 2JA5C 1VH2A 1IL2A 3S17K 4YFKA 4WJ3M 4X6AK 4A3JC 2JA6K 3M3YK 1R9TA 1XZQB 4QIWD 1Y1WC 4A3CC 4A93K 3SZZA 3M4OC 3S1NC 2GAHC 5TMFA 2A68A 4BXXC 3A8JA 3S1MC 4YG2A 4LK1A 5C4XK 1F9NA 1DD5A 2R93A 2NVTC 1EFWA 2VUMK 3T02A 3AD9C 3BP3A 3G4CA 2WB1D 5IYBC 1O2AA 1K83C 3S14C 1I6HK 2A6EA 2JA6A 4GTCA 3GTPC 3H3VL 5CHPA 4BLBA 1EI6A 1ZQ1C 2ZUEA 1JVIA 4GT9A 3CQZC 3FOEA 3AQPA 5M5YK 2JA8C 4KMAA 4LR2A 4YFXA 4FZBA 3L4JA 2VUMA 2D6FC 4A3IC 3S16K 3GTOK 4XSXA 3T01A 4BBRC 1DCPA 1O27A 4QJVA 5M5XK 3OPFA 3GTJK 1KQ4A 1O28A 2P8TA 1IS1A 2JA5K 3ERED 1L0WA 5EGEA 2P5MA 1WQHA 4XLPA 3OEPA 3S1NK 1SFOK 2B63K 4C3JC 4BXXK 3GEHA 4Q4ZA 3GTOA 1TWAC 1IBAA 3I4MK 3S17C 4QJVB 3VA7A 4X6AC 2JA6C 3GTJA 2NVTK 3M3YC 4KN4A 4YFNA 5IYDK 2PA8L 3GTMK 4A93C 4KMHA 1WOPA 2JA5A 1I50K 3N3YA 1TWCK 1K83K 1J6VA 5M3FK 1C0AA 5IP9K 3T00A 5FJ8K 1Y1WA 2CW0A 5C4XC 3CQZK 5JVOA 1SFOA 3IPJA 2VUMC 3S15K 5IORA 3S2HK 1TWGK 2PPBA 2RH6A 1I6HC 5HL8A 3V4GA 1I50A 1O2FB 3GSIA 4J3NA 1BGWA 1K83A 4A3IK 3HKZL 3GTPA 3LAJA 4LK0A 3CQZA 2KWAA 1WSVA 1WSRA 4QIWL 3LAPA 5E68A 1F7VA 4GTAA 1YX2A 1TWGA 4GTBA 2R7ZK 1UV7A 5IOSA 1BDFA 1O29A 4KMDA 5JFEA 3GTJC 2GAGC 2WB1L 2E2IC 3JSTA 2Y0SL 3S1QK 2ZUFA 4OIOA 1SFOC 2B63C 1USMA 3S1RC 4KARA 2GSOA 2CFAA 3N0BA 1YNJA 3I4MC 3GTQK 4C45A 5L46A 3FKIK 1EK8A 1WQGA 3HOVK 3TFIA 5IYDC 1TWAA 3GTMC 4A3FC 4G0VA 1I50C 4P9SA 2PMZD 1TWCC 2Y3PA 5IP9C 4FM9A 4KN7A 1I3QK 4A3LK 3H0GC 4A3KK 1O2BA 3PO2C 3HOWK 4XSZA 3S15C 4ZH4A 2CFAB 5FLMK 3S2HC 1TWGC 3FKIA 3S2DK 3S0XA 1JOEA 5IOQA 4OIQA 2GSNA 4G7ZA 3HXAA 4C2MK 5C4JK 3PO3K 2GSUA 1I3QA 1VLOA 4Y52C 4G0UA 2E2HC 1SMYA 2E2IK 4KDDA 2YU9K 1PJ6A 2NVXC 3A8KA 1RU0A 2V6UA 2R7ZC 1IW7A 2A6HA 1GE9A
chains in the Genus database with same CATH topology
1F93A 1RU0A 1USOA 2V6UA 4WILA 4C45A 1DCOA 3HXAA 4LOWA 1USMA 3JSTA 1DCPA 2EBBA 1DCHA 2V6SA 2V6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F93 A;  1RU0 A;  1USO A;  2V6U A;  4WIL A;  4C45 A;  1DCO A;  3HXA A;  4LOW A;  1USM A;  3JST A;  1DCP A;  2EBB A;  1DCH A;  2V6S A;  2V6T A; 
#chains in the Genus database with same CATH topology
 1G51 A;  2WAQ D;  2RGR A;  3HOY K;  3S1R K;  2A69 A;  3HOZ C;  3ADA C;  5EGH A;  4NOI A;  3S1Q C;  3GEI A;  4MQ9 A;  4PAA A;  3BUE A;  4BY7 K;  1J6W A;  2E2I A;  5M3M K;  4MEY A;  4RMF A;  4A3F K;  4GFQ A;  4DDQ A;  4C3H K;  4Q5S A;  1WOO A;  2NVY K;  4LJZ A;  3GTQ C;  3H0G K;  3AD7 C;  3PO2 K;  2B63 A;  3FKI C;  3HOV C;  4OIR A;  1HQM A;  3TTG A;  4O2D A;  4P5B A;  4BY1 K;  1VGX A;  4A3B K;  2O5J A;  4Y7N C;  4JK1 A;  3RZO K;  4KB4 A;  3I4N K;  1XXC A;  4XLN A;  4LOW A;  3GTM A;  1TWF K;  1I3Q C;  3TFJ A;  2R92 K;  4A3K C;  1TWC A;  4A3L C;  4KAS A;  1ZYR A;  3HOW C;  1EQR A;  3TFH A;  1WCM K;  5FLM C;  2NVY A;  4G7O A;  1JQW A;  4Y52 K;  3H0G A;  2JA7 K;  2E2H K;  3S2D C;  4ILD A;  2FQT A;  1O24 A;  4M1X A;  2NVX K;  1ZVU A;  4A3M K;  4C2M C;  5C4J C;  2V6S A;  1F93 A;  3PO3 C;  3HOX K;  5C3E C;  1TWF A;  3GTG C;  3WOD A;  2BE5 A;  1B4A A;  5IOT A;  2PMZ L;  2YU9 C;  3HOZ K;  1J98 A;  3CAG A;  4OIP A;  2JA7 A;  1WIH A;  2E2H A;  4KB2 A;  2PHC B;  3HOU K;  1R9T K;  3GTK C;  1YCL A;  4GTL A;  2NVX A;  4AH6 A;  3HOY C;  3L4K A;  2R7Z A;  3SZY A;  1Y1V K;  1XPP A;  5IYC K;  3FHZ A;  4BY7 C;  3HKZ D;  4OIN A;  3RZD K;  4Y7N K;  3QX3 A;  4C3H C;  1ZXO A;  2NVY C;  4C3I K;  2NVQ K;  1DCH A;  4A3M C;  1WOS A;  4BY1 C;  3GTQ A;  4A3B C;  1PJ5 A;  1Y1V A;  4KAT A;  3RZO C;  3I4N C;  2WAQ L;  2E2J K;  1TWF C;  4AYB D;  2R92 C;  3EQL A;  3K7A C;  2Y0S D;  1WCM C;  5C3E K;  3GTG K;  5C44 K;  3BP8 C;  1EH1 A;  2JA7 C;  3AD8 C;  3MML B;  3GEE A;  3FOF A;  4WIL A;  1WOR A;  1PJ7 A;  3DXJ A;  4A3E C;  3GTK K;  4A3G K;  4KM9 A;  3HOX C;  1DCO A;  4MEX A;  1I6V A;  2W7V A;  3GTL K;  4P5A A;  1TWH K;  3H3V D;  3GTG A;  1AB4 A;  3G4A A;  5CJ9 A;  3GDZ A;  4LQY A;  4WJ4 A;  3HOU C;  1R9T C;  2YU9 A;  1XZP A;  2EBB A;  4A3J K;  1USO A;  2FQO A;  1O26 A;  4A3C K;  1Y1W K;  3GTK A;  3ORE A;  3M4O K;  4BBS C;  2R93 C;  3S1M K;  1Y1V C;  3GTL A;  5IYC C;  5IP7 C;  4KM8 A;  4A3D C;  1TWH A;  5TMC A;  1VRQ C;  1WQF A;  4LLG A;  3RZD C;  2ZFZ A;  2XCQ A;  3GIR A;  1X31 C;  3AH5 A;  3NUH A;  3LPX A;  4C3I C;  2NVQ C;  2JH3 A;  1XZP B;  5IYB K;  3S14 K;  1B4B A;  3K7A K;  5D4D A;  2O5I A;  3GTP K;  4XCH A;  4KAW X;  1YNN A;  4G0W A;  4GZY A;  3N0C A;  4PAB A;  3A8I A;  2JA8 K;  1J6X A;  2E2J C;  1V5V A;  1XXB A;  4GTE A;  4A3E K;  2XCR B;  2XCO A;  1BJT A;  1IQ0 A;  5C44 C;  2R92 A;  2PA8 D;  1BS2 A;  3AQO A;  1F7U A;  4KC6 A;  1XXA A;  1WCM A;  1ZBS A;  4BBR K;  5TJ3 A;  1VJE A;  4GTF A;  5M5W K;  4G7H A;  4GTD A;  1XZQ A;  4A3G C;  4BLA A;  1IE0 A;  1HI9 A;  1INN A;  1ISE A;  3GTL C;  3S16 C;  4BKW A;  4KMU A;  3GTO C;  1O25 A;  1TWH C;  4BBS K;  4C3J K;  2V6T A;  2R93 K;  5IP7 K;  4AYB L;  1TWA K;  4A3D K;  3Q3Q A;  2JA5 C;  1VH2 A;  1IL2 A;  3S17 K;  4YFK A;  4WJ3 M;  4X6A K;  4A3J C;  2JA6 K;  3M3Y K;  1R9T A;  1XZQ B;  4QIW D;  1Y1W C;  4A3C C;  4A93 K;  3SZZ A;  3M4O C;  3S1N C;  2GAH C;  5TMF A;  2A68 A;  4BXX C;  3A8J A;  3S1M C;  4YG2 A;  4LK1 A;  5C4X K;  1F9N A;  1DD5 A;  2R93 A;  2NVT C;  1EFW A;  2VUM K;  3T02 A;  3AD9 C;  3BP3 A;  3G4C A;  2WB1 D;  5IYB C;  1O2A A;  1K83 C;  3S14 C;  1I6H K;  2A6E A;  2JA6 A;  4GTC A;  3GTP C;  3H3V L;  5CHP A;  4BLB A;  1EI6 A;  1ZQ1 C;  2ZUE A;  1JVI A;  4GT9 A;  3CQZ C;  3FOE A;  3AQP A;  5M5Y K;  2JA8 C;  4KMA A;  4LR2 A;  4YFX A;  4FZB A;  3L4J A;  2VUM A;  2D6F C;  4A3I C;  3S16 K;  3GTO K;  4XSX A;  3T01 A;  4BBR C;  1DCP A;  1O27 A;  4QJV A;  5M5X K;  3OPF A;  3GTJ K;  1KQ4 A;  1O28 A;  2P8T A;  1IS1 A;  2JA5 K;  3ERE D;  1L0W A;  5EGE A;  2P5M A;  1WQH A;  4XLP A;  3OEP A;  3S1N K;  1SFO K;  2B63 K;  4C3J C;  4BXX K;  3GEH A;  4Q4Z A;  3GTO A;  1TWA C;  1IBA A;  3I4M K;  3S17 C;  4QJV B;  3VA7 A;  4X6A C;  2JA6 C;  3GTJ A;  2NVT K;  3M3Y C;  4KN4 A;  4YFN A;  5IYD K;  2PA8 L;  3GTM K;  4A93 C;  4KMH A;  1WOP A;  2JA5 A;  1I50 K;  3N3Y A;  1TWC K;  1K83 K;  1J6V A;  5M3F K;  1C0A A;  5IP9 K;  3T00 A;  5FJ8 K;  1Y1W A;  2CW0 A;  5C4X C;  3CQZ K;  5JVO A;  1SFO A;  3IPJ A;  2VUM C;  3S15 K;  5IOR A;  3S2H K;  1TWG K;  2PPB A;  2RH6 A;  1I6H C;  5HL8 A;  3V4G A;  1I50 A;  1O2F B;  3GSI A;  4J3N A;  1BGW A;  1K83 A;  4A3I K;  3HKZ L;  3GTP A;  3LAJ A;  4LK0 A;  3CQZ A;  2KWA A;  1WSV A;  1WSR A;  4QIW L;  3LAP A;  5E68 A;  1F7V A;  4GTA A;  1YX2 A;  1TWG A;  4GTB A;  2R7Z K;  1UV7 A;  5IOS A;  1BDF A;  1O29 A;  4KMD A;  5JFE A;  3GTJ C;  2GAG C;  2WB1 L;  2E2I C;  3JST A;  2Y0S L;  3S1Q K;  2ZUF A;  4OIO A;  1SFO C;  2B63 C;  1USM A;  3S1R C;  4KAR A;  2GSO A;  2CFA A;  3N0B A;  1YNJ A;  3I4M C;  3GTQ K;  4C45 A;  5L46 A;  3FKI K;  1EK8 A;  1WQG A;  3HOV K;  3TFI A;  5IYD C;  1TWA A;  3GTM C;  4A3F C;  4G0V A;  1I50 C;  4P9S A;  2PMZ D;  1TWC C;  2Y3P A;  5IP9 C;  4FM9 A;  4KN7 A;  1I3Q K;  4A3L K;  3H0G C;  4A3K K;  1O2B A;  3PO2 C;  3HOW K;  4XSZ A;  3S15 C;  4ZH4 A;  2CFA B;  5FLM K;  3S2H C;  1TWG C;  3FKI A;  3S2D K;  3S0X A;  1JOE A;  5IOQ A;  4OIQ A;  2GSN A;  4G7Z A;  3HXA A;  4C2M K;  5C4J K;  3PO3 K;  2GSU A;  1I3Q A;  1VLO A;  4Y52 C;  4G0U A;  2E2H C;  1SMY A;  2E2I K;  4KDD A;  2YU9 K;  1PJ6 A;  2NVX C;  3A8K A;  1RU0 A;  2V6U A;  2R7Z C;  1IW7 A;  2A6H A;  1GE9 A; 
#chains in the Genus database with same CATH homology
 1F93 A;  1RU0 A;  1USO A;  2V6U A;  4WIL A;  4C45 A;  1DCO A;  3HXA A;  4LOW A;  1USM A;  3JST A;  1DCP A;  2EBB A;  1DCH A;  2V6S A;  2V6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...