2FQOA

Crystal structure of b. subtilis luxs in complex with (2s)-2-amino-4-[(2r,3r)-2,3-dihydroxy-3-n- hydroxycarbamoyl-propylmercapto]butyric acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteine lyase
publication title Design and Synthesis of Substrate and Intermediate Analogue Inhibitors of S-Ribosylhomocysteinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 45
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 2fqoA00
1IE0A 1VH2A 1JOEA 1JQWA 5E68A 1JVIA 1VGXA 2FQOA 1VJEA 1J6XA 1INNA 2FQTA 4XCHA 1J6WA 1YCLA 1J98A 1J6VA
chains in the Genus database with same CATH superfamily
1TWAC 3I4MC 5M3FK 1VLOA 2PA8L 2NVTC 3FKIA 3T00A 2RH6A 1O29A 3GTLA 1BGWA 4G0VA 4A3LK 3GTQA 1I3QA 3N0BA 1EK8A 4ILDA 4GTAA 4BLBA 2A68A 3S1RC 4Y52C 4A93K 2NVYC 5IOQA 4XSXA 4A3CC 4LQYA 3HOUC 4C3HC 4A3IC 4LOWA 5CHPA 5HL8A 3L4JA 2B63C 1J6VA 1WOPA 1O2AA 4A3MK 5IYDC 5TMCA 3H0GK 4XLPA 3HOYK 1F7VA 3TFJA 3RZDC 3GEEA 1TWCC 5IOTA 1TWAA 1J6WA 2XCOA 4A3FC 1TWFK 3JSTA 4KM9A 2O5JA 2V6TA 2CFAB 1WQGA 1WQFA 3AQOA 4X6AC 1EFWA 1HI9A 4C3JC 3PO2K 3HKZL 3Q3QA 4P5BA 4WJ3M 2FQOA 2R93K 2JA7C 1J98A 4A3LC 5C4XK 2VUMK 2JA5K 3S17K 3GTJA 3VA7A 5IYBK 4BXXK 3GTGC 4Y7NC 1SFOK 3WODA 4MEXA 3AD8C 1O25A 3S16K 3GTKK 3OEPA 4YFNA 1IW7A 4C2MK 4KASA 3FKIC 4BLAA 1TWGC 4AYBD 3S14C 3GTLC 3ERED 1EI6A 1WSRA 5D4DA 4GZYA 2WAQD 3CQZC 1TWCA 3S1MK 1R9TK 1PJ6A 1WQHA 3H0GC 5M5YK 3RZOK 4KMUA 1ZVUA 3S1NC 2NVXA 1WOOA 3H3VD 3G4CA 3S0XA 4J3NA 4KB4A 2JA8K 3HOVK 4KN7A 5IORA 3N3YA 3S2HK 4BKWA 2JH3A 3S15K 1DD5A 5C4JC 1WSVA 3M3YK 4MEYA 4KARA 3GTOK 5FLMK 1Y1WK 3NUHA 4KMHA 5TJ3A 4BBSK 3GTPC 1UV7A 2PMZD 1DCHA 4O2DA 3FOEA 3HOZK 5C4XC 3K7AK 4C3IC 4A3DC 1TWGA 4PABA 2NVQK 5IYBC 1YCLA 1SFOC 4KM8A 3I4NK 5IP7C 3S16C 3GTKC 4OIRA 3CQZA 4A3EK 2CFAA 3AQPA 1ZBSA 4C2MC 1B4AA 4A3KC 4RMFA 3M4OC 3H0GA 4GTCA 3S1QK 1Y1VK 1V5VA 1VH2A 2P5MA 4GTBA 3GTJC 3TTGA 2R92C 1TWFA 1XXBA 2E2IK 3AD7C 3RZOC 4KAWX 3LPXA 3DXJA 2JA6K 4Q4ZA 3EQLA 2CW0A 1O26A 4QJVB 3GTMK 3A8KA 4LK1A 1WIHA 4OIPA 2GAGC 2R93A 3S15C 1I50C 3TFHA 4BBRK 3GTPA 1L0WA 1IE0A 4FM9A 4BY7C 2R7ZK 1VRQC 3ADAC 3OPFA 4LJZA 1USMA 2VUMA 1O24A 4KATA 4A3JC 2NVXC 5IP9C 3PO3C 4WILA 1SFOA 1BDFA 3FOFA 4G0WA 3GTKA 3S2DK 3AD9C 4WJ4A 2E2JK 1XZPB 4NOIA 3BUEA 2WB1D 2XCRB 1I6HK 4A3EC 1VJEA 5FJ8K 4JK1A 2R92A 3N0CA 2Y0SD 1DCOA 4A93C 1RU0A 3IPJA 4G0UA 4YG2A 3SZYA 4MQ9A 5C3EK 1TWAK 3I4MK 1C0AA 3QX3A 5M5XK 2A6HA 1WOSA 5IOSA 2NVTK 1K83K 1JVIA 1ISEA 1I50A 4A3MC 2E2HK 2WB1L 4KB2A 3GTOA 2GSUA 3HOYC 1INNA 4XCHA 4DDQA 2KWAA 3T02A 1I6VA 4GT9A 2EBBA 4BBRC 3LAPA 4GTDA 4KN4A 4QIWD 1TWFC 3S1RK 4Y52K 2NVYK 4KMDA 2W7VA 3LAJA 5EGHA 4A3CK 3GDZA 1GE9A 4AYBL 1F9NA 1JOEA 3HOUK 5C44K 3BP3A 2PA8D 4M1XA 3PO2C 2WAQL 2D6FC 2B63K 2R93C 5IYDK 1YX2A 1ZYRA 5L46A 4XSZA 4QJVA 1Y1VA 4LLGA 1XXAA 3GIRA 2VUMC 1WORA 1ZXOA 2JA5C 3H3VL 3S17C 1I6HC 1IS1A 1TWCK 4BXXC 1O27A 4A3FK 2E2IA 4G7OA 4G7HA 5TMFA 5M3MK 3TFIA 3A8JA 4X6AK 2GSNA 2JA6A 1XZQB 5C3EC 4FZBA 3HOWK 3GTMA 4C3JK 1DCPA 5IYCK 1F7UA 3FHZA 1EH1A 1K83C 3S1MC 2JA7K 1R9TC 4P5AA 4YFXA 3BP8C 1XZPA 2E2HC 2R7ZA 2PMZL 2GAHC 3V4GA 1TWHK 2YU9K 1VGXA 4GFQA 1WCMK 2A6EA 3GTGK 3GEHA 4Y7NK 4Q5SA 5E68A 3CAGA 2BE5A 4KMAA 2ZFZA 2JA8C 1IL2A 2O5IA 3HOVC 2FQTA 3G4AA 3S2HC 1XPPA 3FKIK 1TWGK 4GTLA 1PJ7A 3S14K 3M3YC 5C44C 3MMLB 1B4BA 3GTLK 1HQMA 3GTOC 3HKZD 5FLMC 4KDDA 3CQZK 3GTQK 2JA5A 1I3QK 1Y1WC 1BJTA 2V6UA 5M5WK 4A3BK 4OIQA 4BBSC 1O28A 2XCQA 2A69A 4PAAA 3S1NK 2Y3PA 3HOZC 2PHCB 1XXCA 4BY1K 3K7AC 3A8IA 2NVQC 1YNJA 3I4NC 1K83A 1X31C 1J6XA 1EQRA 3SZZA 1R9TA 2E2HA 4GTFA 5C4JK 2GSOA 3HOXK 3HOWC 3S1QC 1Y1VC 4AH6A 5IYCC 4A3GK 3OREA 1SMYA 1G51A 5JVOA 3GTPK 3AH5A 4XLNA 1KQ4A 1YNNA 4C45A 5JFEA 2E2IC 3GEIA 1BS2A 2NVYA 4G7ZA 1TWHC 1AB4A 2YU9C 4C3IK 1O2FB 4A3DK 1WCMC 2JA6C 2P8TA 5IP7K 3GTMC 1F93A 2PPBA 4GTEA 1Y1WA 2B63A 2ZUEA 4A3KK 3M4OK 1XZQA 2R7ZC 2Y0SL 4YFKA 2V6SA 3GTQC 1JQWA 1I3QC 3GTJK 1ZQ1C 4LK0A 2R92K 4A3BC 4C3HK 3L4KA 3GSIA 2ZUFA 5CJ9A 4ZH4A 4A3IK 3S2DC 1PJ5A 1IQ0A 4LR2A 3T01A 4OIOA 4BY1C 3HXAA 2E2JC 4P9SA 3RZDK 4OINA 2JA7A 1I50K 2RGRA 4QIWL 4BY7K 5EGEA 3HOXC 1TWHA 2YU9A 1O2BA 1IBAA 4A3JK 4A3GC 1WCMA 2NVXK 5IP9K 3PO3K 3GTGA 4KC6A 1USOA
chains in the Genus database with same CATH topology
1IE0A 1VH2A 1JOEA 1JQWA 5E68A 1JVIA 1VGXA 2FQOA 1VJEA 1J6XA 1INNA 2FQTA 4XCHA 1J6WA 1YCLA 1J98A 1J6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IE0 A;  1VH2 A;  1JOE A;  1JQW A;  5E68 A;  1JVI A;  1VGX A;  2FQO A;  1VJE A;  1J6X A;  1INN A;  2FQT A;  4XCH A;  1J6W A;  1YCL A;  1J98 A;  1J6V A; 
#chains in the Genus database with same CATH topology
 1TWA C;  3I4M C;  5M3F K;  1VLO A;  2PA8 L;  2NVT C;  3FKI A;  3T00 A;  2RH6 A;  1O29 A;  3GTL A;  1BGW A;  4G0V A;  4A3L K;  3GTQ A;  1I3Q A;  3N0B A;  1EK8 A;  4ILD A;  4GTA A;  4BLB A;  2A68 A;  3S1R C;  4Y52 C;  4A93 K;  2NVY C;  5IOQ A;  4XSX A;  4A3C C;  4LQY A;  3HOU C;  4C3H C;  4A3I C;  4LOW A;  5CHP A;  5HL8 A;  3L4J A;  2B63 C;  1J6V A;  1WOP A;  1O2A A;  4A3M K;  5IYD C;  5TMC A;  3H0G K;  4XLP A;  3HOY K;  1F7V A;  3TFJ A;  3RZD C;  3GEE A;  1TWC C;  5IOT A;  1TWA A;  1J6W A;  2XCO A;  4A3F C;  1TWF K;  3JST A;  4KM9 A;  2O5J A;  2V6T A;  2CFA B;  1WQG A;  1WQF A;  3AQO A;  4X6A C;  1EFW A;  1HI9 A;  4C3J C;  3PO2 K;  3HKZ L;  3Q3Q A;  4P5B A;  4WJ3 M;  2FQO A;  2R93 K;  2JA7 C;  1J98 A;  4A3L C;  5C4X K;  2VUM K;  2JA5 K;  3S17 K;  3GTJ A;  3VA7 A;  5IYB K;  4BXX K;  3GTG C;  4Y7N C;  1SFO K;  3WOD A;  4MEX A;  3AD8 C;  1O25 A;  3S16 K;  3GTK K;  3OEP A;  4YFN A;  1IW7 A;  4C2M K;  4KAS A;  3FKI C;  4BLA A;  1TWG C;  4AYB D;  3S14 C;  3GTL C;  3ERE D;  1EI6 A;  1WSR A;  5D4D A;  4GZY A;  2WAQ D;  3CQZ C;  1TWC A;  3S1M K;  1R9T K;  1PJ6 A;  1WQH A;  3H0G C;  5M5Y K;  3RZO K;  4KMU A;  1ZVU A;  3S1N C;  2NVX A;  1WOO A;  3H3V D;  3G4C A;  3S0X A;  4J3N A;  4KB4 A;  2JA8 K;  3HOV K;  4KN7 A;  5IOR A;  3N3Y A;  3S2H K;  4BKW A;  2JH3 A;  3S15 K;  1DD5 A;  5C4J C;  1WSV A;  3M3Y K;  4MEY A;  4KAR A;  3GTO K;  5FLM K;  1Y1W K;  3NUH A;  4KMH A;  5TJ3 A;  4BBS K;  3GTP C;  1UV7 A;  2PMZ D;  1DCH A;  4O2D A;  3FOE A;  3HOZ K;  5C4X C;  3K7A K;  4C3I C;  4A3D C;  1TWG A;  4PAB A;  2NVQ K;  5IYB C;  1YCL A;  1SFO C;  4KM8 A;  3I4N K;  5IP7 C;  3S16 C;  3GTK C;  4OIR A;  3CQZ A;  4A3E K;  2CFA A;  3AQP A;  1ZBS A;  4C2M C;  1B4A A;  4A3K C;  4RMF A;  3M4O C;  3H0G A;  4GTC A;  3S1Q K;  1Y1V K;  1V5V A;  1VH2 A;  2P5M A;  4GTB A;  3GTJ C;  3TTG A;  2R92 C;  1TWF A;  1XXB A;  2E2I K;  3AD7 C;  3RZO C;  4KAW X;  3LPX A;  3DXJ A;  2JA6 K;  4Q4Z A;  3EQL A;  2CW0 A;  1O26 A;  4QJV B;  3GTM K;  3A8K A;  4LK1 A;  1WIH A;  4OIP A;  2GAG C;  2R93 A;  3S15 C;  1I50 C;  3TFH A;  4BBR K;  3GTP A;  1L0W A;  1IE0 A;  4FM9 A;  4BY7 C;  2R7Z K;  1VRQ C;  3ADA C;  3OPF A;  4LJZ A;  1USM A;  2VUM A;  1O24 A;  4KAT A;  4A3J C;  2NVX C;  5IP9 C;  3PO3 C;  4WIL A;  1SFO A;  1BDF A;  3FOF A;  4G0W A;  3GTK A;  3S2D K;  3AD9 C;  4WJ4 A;  2E2J K;  1XZP B;  4NOI A;  3BUE A;  2WB1 D;  2XCR B;  1I6H K;  4A3E C;  1VJE A;  5FJ8 K;  4JK1 A;  2R92 A;  3N0C A;  2Y0S D;  1DCO A;  4A93 C;  1RU0 A;  3IPJ A;  4G0U A;  4YG2 A;  3SZY A;  4MQ9 A;  5C3E K;  1TWA K;  3I4M K;  1C0A A;  3QX3 A;  5M5X K;  2A6H A;  1WOS A;  5IOS A;  2NVT K;  1K83 K;  1JVI A;  1ISE A;  1I50 A;  4A3M C;  2E2H K;  2WB1 L;  4KB2 A;  3GTO A;  2GSU A;  3HOY C;  1INN A;  4XCH A;  4DDQ A;  2KWA A;  3T02 A;  1I6V A;  4GT9 A;  2EBB A;  4BBR C;  3LAP A;  4GTD A;  4KN4 A;  4QIW D;  1TWF C;  3S1R K;  4Y52 K;  2NVY K;  4KMD A;  2W7V A;  3LAJ A;  5EGH A;  4A3C K;  3GDZ A;  1GE9 A;  4AYB L;  1F9N A;  1JOE A;  3HOU K;  5C44 K;  3BP3 A;  2PA8 D;  4M1X A;  3PO2 C;  2WAQ L;  2D6F C;  2B63 K;  2R93 C;  5IYD K;  1YX2 A;  1ZYR A;  5L46 A;  4XSZ A;  4QJV A;  1Y1V A;  4LLG A;  1XXA A;  3GIR A;  2VUM C;  1WOR A;  1ZXO A;  2JA5 C;  3H3V L;  3S17 C;  1I6H C;  1IS1 A;  1TWC K;  4BXX C;  1O27 A;  4A3F K;  2E2I A;  4G7O A;  4G7H A;  5TMF A;  5M3M K;  3TFI A;  3A8J A;  4X6A K;  2GSN A;  2JA6 A;  1XZQ B;  5C3E C;  4FZB A;  3HOW K;  3GTM A;  4C3J K;  1DCP A;  5IYC K;  1F7U A;  3FHZ A;  1EH1 A;  1K83 C;  3S1M C;  2JA7 K;  1R9T C;  4P5A A;  4YFX A;  3BP8 C;  1XZP A;  2E2H C;  2R7Z A;  2PMZ L;  2GAH C;  3V4G A;  1TWH K;  2YU9 K;  1VGX A;  4GFQ A;  1WCM K;  2A6E A;  3GTG K;  3GEH A;  4Y7N K;  4Q5S A;  5E68 A;  3CAG A;  2BE5 A;  4KMA A;  2ZFZ A;  2JA8 C;  1IL2 A;  2O5I A;  3HOV C;  2FQT A;  3G4A A;  3S2H C;  1XPP A;  3FKI K;  1TWG K;  4GTL A;  1PJ7 A;  3S14 K;  3M3Y C;  5C44 C;  3MML B;  1B4B A;  3GTL K;  1HQM A;  3GTO C;  3HKZ D;  5FLM C;  4KDD A;  3CQZ K;  3GTQ K;  2JA5 A;  1I3Q K;  1Y1W C;  1BJT A;  2V6U A;  5M5W K;  4A3B K;  4OIQ A;  4BBS C;  1O28 A;  2XCQ A;  2A69 A;  4PAA A;  3S1N K;  2Y3P A;  3HOZ C;  2PHC B;  1XXC A;  4BY1 K;  3K7A C;  3A8I A;  2NVQ C;  1YNJ A;  3I4N C;  1K83 A;  1X31 C;  1J6X A;  1EQR A;  3SZZ A;  1R9T A;  2E2H A;  4GTF A;  5C4J K;  2GSO A;  3HOX K;  3HOW C;  3S1Q C;  1Y1V C;  4AH6 A;  5IYC C;  4A3G K;  3ORE A;  1SMY A;  1G51 A;  5JVO A;  3GTP K;  3AH5 A;  4XLN A;  1KQ4 A;  1YNN A;  4C45 A;  5JFE A;  2E2I C;  3GEI A;  1BS2 A;  2NVY A;  4G7Z A;  1TWH C;  1AB4 A;  2YU9 C;  4C3I K;  1O2F B;  4A3D K;  1WCM C;  2JA6 C;  2P8T A;  5IP7 K;  3GTM C;  1F93 A;  2PPB A;  4GTE A;  1Y1W A;  2B63 A;  2ZUE A;  4A3K K;  3M4O K;  1XZQ A;  2R7Z C;  2Y0S L;  4YFK A;  2V6S A;  3GTQ C;  1JQW A;  1I3Q C;  3GTJ K;  1ZQ1 C;  4LK0 A;  2R92 K;  4A3B C;  4C3H K;  3L4K A;  3GSI A;  2ZUF A;  5CJ9 A;  4ZH4 A;  4A3I K;  3S2D C;  1PJ5 A;  1IQ0 A;  4LR2 A;  3T01 A;  4OIO A;  4BY1 C;  3HXA A;  2E2J C;  4P9S A;  3RZD K;  4OIN A;  2JA7 A;  1I50 K;  2RGR A;  4QIW L;  4BY7 K;  5EGE A;  3HOX C;  1TWH A;  2YU9 A;  1O2B A;  1IBA A;  4A3J K;  4A3G C;  1WCM A;  2NVX K;  5IP9 K;  3PO3 K;  3GTG A;  4KC6 A;  1USO A; 
#chains in the Genus database with same CATH homology
 1IE0 A;  1VH2 A;  1JOE A;  1JQW A;  5E68 A;  1JVI A;  1VGX A;  2FQO A;  1VJE A;  1J6X A;  1INN A;  2FQT A;  4XCH A;  1J6W A;  1YCL A;  1J98 A;  1J6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...