2FQOA

Crystal structure of b. subtilis luxs in complex with (2s)-2-amino-4-[(2r,3r)-2,3-dihydroxy-3-n- hydroxycarbamoyl-propylmercapto]butyric acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords S-ribosylhomocysteine lyase
publication title Design and Synthesis of Substrate and Intermediate Analogue Inhibitors of S-Ribosylhomocysteinase
pubmed doi rcsb
source organism Bacillus subtilis
total genus 45
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 2fqoA00
1JQWA 1JOEA 2FQTA 1VJEA 1IE0A 5E68A 1J6WA 1JVIA 4XCHA 1YCLA 1J6VA 1VGXA 1INNA 1VH2A 1J98A 1J6XA 2FQOA
chains in the Genus database with same CATH superfamily
5C3EC 3HOXK 5IOTA 1IQ0A 1I6HC 2E2JK 2W7VA 1SFOA 2A68A 2PPBA 4OIPA 3GTMK 1DCOA 2E2HC 3I4MK 1I50C 3GTJC 3OREA 1WSVA 3A8IA 1KQ4A 1WCMK 4A93C 4QIWD 5CJ9A 1VGXA 2A69A 1ZBSA 4LLGA 4GTCA 5C4XC 2V6TA 1VRQC 1TWFC 2RGRA 1IW7A 4A3IK 1BJTA 5IYBK 5HL8A 2B63C 3BP3A 3HOYC 3FKIA 2JH3A 3ADAC 4BXXC 4QJVB 3TTGA 1AB4A 1C0AA 4Q5SA 3K7AC 4KASA 2JA8C 1Y1VK 3RZOC 1WOOA 1XXAA 3TFIA 3S15K 3H3VD 2JA5C 1SFOK 3S2DK 1TWCC 3GTQC 4MQ9A 3M4OK 3AD8C 3JSTA 5IP9C 2ZFZA 3HKZD 3GTLC 3V4GA 3RZDK 4GTLA 3I4NC 1XZPA 4BBRK 4KC6A 1PJ5A 4MEYA 3GTGA 4C45A 1EI6A 4BKWA 4BBSC 5C44C 3BUEA 1TWAK 4DDQA 3GEHA 4PABA 2PMZL 4MEXA 2NVXC 3HOZC 4ILDA 1TWHA 3WODA 4A3CK 3HOXC 2E2JC 5FLMK 1EQRA 2NVTK 3S14C 3GTMC 3FKIK 3I4MC 4G7OA 1USOA 3HOUK 4KM9A 4OIRA 4AYBD 4G0VA 2VUMA 4BY7K 1J6WA 3S1NC 2A6EA 2GAHC 2WB1L 1F7VA 3M3YK 2JA6C 2P5MA 4GTBA 4GTEA 4KAWX 3S1MK 2R7ZA 4LQYA 3HOWC 1O2FB 3GTGK 4WILA 2XCOA 4C3IC 4A3IC 5IYBC 3CQZK 3IPJA 3GTPA 2V6SA 3S0XA 2Y0SL 5M5YK 4G0WA 1TWHK 4OINA 1I6VA 3A8KA 1TWGA 4A3JK 2R92A 1Y1VC 3AD9C 1Y1WK 3GTOK 4C3HK 3GTKA 1SFOC 4BY1K 2KWAA 1WQGA 1HQMA 3M4OC 2ZUEA 4GT9A 3OPFA 4GZYA 2ZUFA 4BBRC 3PO2K 4G7ZA 4BLAA 2VUMK 4LOWA 2E2IA 2NVYA 1B4BA 4QIWL 4WJ4A 4LJZA 4NOIA 1TWAC 2XCRB 2R7ZK 4YFXA 4P5BA 1WORA 1YCLA 4G7HA 3GEIA 4GTFA 1BS2A 1PJ7A 1R9TA 4A3BK 1XXCA 4A3CC 4Y52K 3NUHA 3CAGA 4A3LK 2FQOA 5M5XK 4A3MC 2JA7A 3LAPA 1XZPB 5FLMC 2NVTC 4Y7NK 3FKIC 4KARA 3GSIA 4A3KC 3HOUC 1TWGK 2Y3PA 3AQPA 5IORA 5IP7C 5JFEA 3H3VL 4LR2A 4BY7C 4X6AC 3M3YC 4GTDA 2E2HA 3HKZL 3S1MC 1JOEA 1XPPA 4G0UA 3S16K 3S2HC 3GTGC 1J98A 2EBBA 2E2IK 1EH1A 2NVYK 3CQZC 4RMFA 1BDFA 1O2BA 3MMLB 4KN7A 1O28A 1IE0A 3OEPA 1TWHC 5TMCA 1TWFA 1F93A 1R9TK 3T00A 3HOVK 2R93A 4A3JC 1WOSA 3LPXA 4XCHA 1Y1WC 1VH2A 4OIOA 2JA7K 3GTOC 4C3HC 2B63A 5IOQA 1IBAA 4BY1C 5EGEA 4LK0A 1O27A 3A8JA 5C3EK 5M5WK 1GE9A 4AYBL 3PO2C 2VUMC 1PJ6A 2O5JA 1TWCA 2XCQA 3GTQA 5IYDK 1USMA 2GSOA 3AD7C 3DXJA 1WQHA 1JVIA 5CHPA 3S1RK 1F7UA 1WCMC 3L4KA 4Y52C 4A3LC 5M3FK 3T01A 4Q4ZA 3AQOA 1RU0A 5EGHA 1YX2A 2NVXA 1TWFK 1IS1A 4Y7NC 5M3MK 1O26A 3FOFA 1J6XA 4AH6A 2CFAA 2R93K 1TWGC 2D6FC 5IOSA 4A3DK 2B63K 4GTAA 4KMUA 3S17K 1HI9A 1I3QA 3S16C 4XSXA 1K83A 3S15C 4C2MK 2PA8D 1DD5A 1INNA 2E2IC 3S2DC 2A6HA 2WAQD 3GTQK 2JA6A 5L46A 4XSZA 3RZDC 1O25A 1F9NA 3FOEA 3FHZA 1EFWA 2YU9A 3N0BA 1V5VA 4KB2A 1R9TC 4YFNA 3QX3A 4A3FK 2CW0A 2P8TA 4ZH4A 2JA7C 4LK1A 2PHCB 3GDZA 1G51A 1SMYA 2NVXK 1XZQA 3H0GA 3ERED 4KB4A 1DCHA 1YNNA 1L0WA 4KM8A 3G4AA 1Y1VA 2FQTA 3GTPK 5C4JK 4XLPA 3S14K 3Q3QA 5IYDC 5D4DA 1I3QK 2R92K 1BGWA 1K83K 4C3JK 1ZQ1C 1XXBA 2NVQK 3GTKK 4YFKA 3S1RC 3TFJA 1WOPA 3S1NK 2RH6A 2JA6K 4A3EK 4A3GK 1JQWA 1I50A 3S1QK 3GTJA 5TJ3A 1DCPA 1TWAA 4O2DA 3HOWK 3G4CA 3PO3K 1WSRA 2YU9K 5IYCK 4C3IK 4YG2A 2GSUA 4JK1A 2R93C 4A3DC 5E68A 1ZYRA 3H0GK 2BE5A 3S17C 3TFHA 4XLNA 1X31C 1VJEA 4C2MC 3SZYA 3N0CA 4M1XA 3N3YA 2CFAB 4KDDA 1I6HK 3VA7A 2JA5A 1O29A 2E2HK 1I50K 3CQZA 3GTJK 4KMHA 4A3FC 3GTLA 2R7ZC 1IL2A 4P9SA 1WQFA 3AH5A 1ZVUA 4QJVA 4A3BC 4A93K 1ZXOA 4KMAA 5FJ8K 4A3MK 1UV7A 4KATA 3GTPC 4KMDA 1Y1WA 5C4JC 3GTOA 4J3NA 4BLBA 4KN4A 2PMZD 5C4XK 4A3KK 4OIQA 1I3QC 4PAAA 2R92C 1K83C 4C3JC 2O5IA 1O24A 5IP7K 2NVQC 3GTKC 2PA8L 3BP8C 4WJ3M 4X6AK 3HOYK 2WAQL 3GTMA 4A3EC 4BXXK 4A3GC 3S1QC 1XZQB 3GIRA 4GFQA 1VLOA 3K7AK 2GAGC 2JA8K 3RZOK 5JVOA 3S2HK 3PO3C 1ISEA 2JA5K 2YU9C 5IYCC 2NVYC 1TWCK 4P5AA 1WCMA 2WB1D 2V6UA 3GEEA 5IP9K 1J6VA 3GTLK 3EQLA 4FM9A 3I4NK 1WIHA 3H0GC 3HOVC 3LAJA 4BBSK 2GSNA 5C44K 5TMFA 3T02A 3HXAA 1YNJA 2Y0SD 3HOZK 1B4AA 3L4JA 4FZBA 3SZZA 1O2AA 1EK8A
chains in the Genus database with same CATH topology
1JQWA 1JOEA 2FQTA 1VJEA 1IE0A 5E68A 1J6WA 1JVIA 4XCHA 1YCLA 1J6VA 1VGXA 1INNA 1VH2A 1J98A 1J6XA 2FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQW A;  1JOE A;  2FQT A;  1VJE A;  1IE0 A;  5E68 A;  1J6W A;  1JVI A;  4XCH A;  1YCL A;  1J6V A;  1VGX A;  1INN A;  1VH2 A;  1J98 A;  1J6X A;  2FQO A; 
#chains in the Genus database with same CATH topology
 5C3E C;  3HOX K;  5IOT A;  1IQ0 A;  1I6H C;  2E2J K;  2W7V A;  1SFO A;  2A68 A;  2PPB A;  4OIP A;  3GTM K;  1DCO A;  2E2H C;  3I4M K;  1I50 C;  3GTJ C;  3ORE A;  1WSV A;  3A8I A;  1KQ4 A;  1WCM K;  4A93 C;  4QIW D;  5CJ9 A;  1VGX A;  2A69 A;  1ZBS A;  4LLG A;  4GTC A;  5C4X C;  2V6T A;  1VRQ C;  1TWF C;  2RGR A;  1IW7 A;  4A3I K;  1BJT A;  5IYB K;  5HL8 A;  2B63 C;  3BP3 A;  3HOY C;  3FKI A;  2JH3 A;  3ADA C;  4BXX C;  4QJV B;  3TTG A;  1AB4 A;  1C0A A;  4Q5S A;  3K7A C;  4KAS A;  2JA8 C;  1Y1V K;  3RZO C;  1WOO A;  1XXA A;  3TFI A;  3S15 K;  3H3V D;  2JA5 C;  1SFO K;  3S2D K;  1TWC C;  3GTQ C;  4MQ9 A;  3M4O K;  3AD8 C;  3JST A;  5IP9 C;  2ZFZ A;  3HKZ D;  3GTL C;  3V4G A;  3RZD K;  4GTL A;  3I4N C;  1XZP A;  4BBR K;  4KC6 A;  1PJ5 A;  4MEY A;  3GTG A;  4C45 A;  1EI6 A;  4BKW A;  4BBS C;  5C44 C;  3BUE A;  1TWA K;  4DDQ A;  3GEH A;  4PAB A;  2PMZ L;  4MEX A;  2NVX C;  3HOZ C;  4ILD A;  1TWH A;  3WOD A;  4A3C K;  3HOX C;  2E2J C;  5FLM K;  1EQR A;  2NVT K;  3S14 C;  3GTM C;  3FKI K;  3I4M C;  4G7O A;  1USO A;  3HOU K;  4KM9 A;  4OIR A;  4AYB D;  4G0V A;  2VUM A;  4BY7 K;  1J6W A;  3S1N C;  2A6E A;  2GAH C;  2WB1 L;  1F7V A;  3M3Y K;  2JA6 C;  2P5M A;  4GTB A;  4GTE A;  4KAW X;  3S1M K;  2R7Z A;  4LQY A;  3HOW C;  1O2F B;  3GTG K;  4WIL A;  2XCO A;  4C3I C;  4A3I C;  5IYB C;  3CQZ K;  3IPJ A;  3GTP A;  2V6S A;  3S0X A;  2Y0S L;  5M5Y K;  4G0W A;  1TWH K;  4OIN A;  1I6V A;  3A8K A;  1TWG A;  4A3J K;  2R92 A;  1Y1V C;  3AD9 C;  1Y1W K;  3GTO K;  4C3H K;  3GTK A;  1SFO C;  4BY1 K;  2KWA A;  1WQG A;  1HQM A;  3M4O C;  2ZUE A;  4GT9 A;  3OPF A;  4GZY A;  2ZUF A;  4BBR C;  3PO2 K;  4G7Z A;  4BLA A;  2VUM K;  4LOW A;  2E2I A;  2NVY A;  1B4B A;  4QIW L;  4WJ4 A;  4LJZ A;  4NOI A;  1TWA C;  2XCR B;  2R7Z K;  4YFX A;  4P5B A;  1WOR A;  1YCL A;  4G7H A;  3GEI A;  4GTF A;  1BS2 A;  1PJ7 A;  1R9T A;  4A3B K;  1XXC A;  4A3C C;  4Y52 K;  3NUH A;  3CAG A;  4A3L K;  2FQO A;  5M5X K;  4A3M C;  2JA7 A;  3LAP A;  1XZP B;  5FLM C;  2NVT C;  4Y7N K;  3FKI C;  4KAR A;  3GSI A;  4A3K C;  3HOU C;  1TWG K;  2Y3P A;  3AQP A;  5IOR A;  5IP7 C;  5JFE A;  3H3V L;  4LR2 A;  4BY7 C;  4X6A C;  3M3Y C;  4GTD A;  2E2H A;  3HKZ L;  3S1M C;  1JOE A;  1XPP A;  4G0U A;  3S16 K;  3S2H C;  3GTG C;  1J98 A;  2EBB A;  2E2I K;  1EH1 A;  2NVY K;  3CQZ C;  4RMF A;  1BDF A;  1O2B A;  3MML B;  4KN7 A;  1O28 A;  1IE0 A;  3OEP A;  1TWH C;  5TMC A;  1TWF A;  1F93 A;  1R9T K;  3T00 A;  3HOV K;  2R93 A;  4A3J C;  1WOS A;  3LPX A;  4XCH A;  1Y1W C;  1VH2 A;  4OIO A;  2JA7 K;  3GTO C;  4C3H C;  2B63 A;  5IOQ A;  1IBA A;  4BY1 C;  5EGE A;  4LK0 A;  1O27 A;  3A8J A;  5C3E K;  5M5W K;  1GE9 A;  4AYB L;  3PO2 C;  2VUM C;  1PJ6 A;  2O5J A;  1TWC A;  2XCQ A;  3GTQ A;  5IYD K;  1USM A;  2GSO A;  3AD7 C;  3DXJ A;  1WQH A;  1JVI A;  5CHP A;  3S1R K;  1F7U A;  1WCM C;  3L4K A;  4Y52 C;  4A3L C;  5M3F K;  3T01 A;  4Q4Z A;  3AQO A;  1RU0 A;  5EGH A;  1YX2 A;  2NVX A;  1TWF K;  1IS1 A;  4Y7N C;  5M3M K;  1O26 A;  3FOF A;  1J6X A;  4AH6 A;  2CFA A;  2R93 K;  1TWG C;  2D6F C;  5IOS A;  4A3D K;  2B63 K;  4GTA A;  4KMU A;  3S17 K;  1HI9 A;  1I3Q A;  3S16 C;  4XSX A;  1K83 A;  3S15 C;  4C2M K;  2PA8 D;  1DD5 A;  1INN A;  2E2I C;  3S2D C;  2A6H A;  2WAQ D;  3GTQ K;  2JA6 A;  5L46 A;  4XSZ A;  3RZD C;  1O25 A;  1F9N A;  3FOE A;  3FHZ A;  1EFW A;  2YU9 A;  3N0B A;  1V5V A;  4KB2 A;  1R9T C;  4YFN A;  3QX3 A;  4A3F K;  2CW0 A;  2P8T A;  4ZH4 A;  2JA7 C;  4LK1 A;  2PHC B;  3GDZ A;  1G51 A;  1SMY A;  2NVX K;  1XZQ A;  3H0G A;  3ERE D;  4KB4 A;  1DCH A;  1YNN A;  1L0W A;  4KM8 A;  3G4A A;  1Y1V A;  2FQT A;  3GTP K;  5C4J K;  4XLP A;  3S14 K;  3Q3Q A;  5IYD C;  5D4D A;  1I3Q K;  2R92 K;  1BGW A;  1K83 K;  4C3J K;  1ZQ1 C;  1XXB A;  2NVQ K;  3GTK K;  4YFK A;  3S1R C;  3TFJ A;  1WOP A;  3S1N K;  2RH6 A;  2JA6 K;  4A3E K;  4A3G K;  1JQW A;  1I50 A;  3S1Q K;  3GTJ A;  5TJ3 A;  1DCP A;  1TWA A;  4O2D A;  3HOW K;  3G4C A;  3PO3 K;  1WSR A;  2YU9 K;  5IYC K;  4C3I K;  4YG2 A;  2GSU A;  4JK1 A;  2R93 C;  4A3D C;  5E68 A;  1ZYR A;  3H0G K;  2BE5 A;  3S17 C;  3TFH A;  4XLN A;  1X31 C;  1VJE A;  4C2M C;  3SZY A;  3N0C A;  4M1X A;  3N3Y A;  2CFA B;  4KDD A;  1I6H K;  3VA7 A;  2JA5 A;  1O29 A;  2E2H K;  1I50 K;  3CQZ A;  3GTJ K;  4KMH A;  4A3F C;  3GTL A;  2R7Z C;  1IL2 A;  4P9S A;  1WQF A;  3AH5 A;  1ZVU A;  4QJV A;  4A3B C;  4A93 K;  1ZXO A;  4KMA A;  5FJ8 K;  4A3M K;  1UV7 A;  4KAT A;  3GTP C;  4KMD A;  1Y1W A;  5C4J C;  3GTO A;  4J3N A;  4BLB A;  4KN4 A;  2PMZ D;  5C4X K;  4A3K K;  4OIQ A;  1I3Q C;  4PAA A;  2R92 C;  1K83 C;  4C3J C;  2O5I A;  1O24 A;  5IP7 K;  2NVQ C;  3GTK C;  2PA8 L;  3BP8 C;  4WJ3 M;  4X6A K;  3HOY K;  2WAQ L;  3GTM A;  4A3E C;  4BXX K;  4A3G C;  3S1Q C;  1XZQ B;  3GIR A;  4GFQ A;  1VLO A;  3K7A K;  2GAG C;  2JA8 K;  3RZO K;  5JVO A;  3S2H K;  3PO3 C;  1ISE A;  2JA5 K;  2YU9 C;  5IYC C;  2NVY C;  1TWC K;  4P5A A;  1WCM A;  2WB1 D;  2V6U A;  3GEE A;  5IP9 K;  1J6V A;  3GTL K;  3EQL A;  4FM9 A;  3I4N K;  1WIH A;  3H0G C;  3HOV C;  3LAJ A;  4BBS K;  2GSN A;  5C44 K;  5TMF A;  3T02 A;  3HXA A;  1YNJ A;  2Y0S D;  3HOZ K;  1B4A A;  3L4J A;  4FZB A;  3SZZ A;  1O2A A;  1EK8 A; 
#chains in the Genus database with same CATH homology
 1JQW A;  1JOE A;  2FQT A;  1VJE A;  1IE0 A;  5E68 A;  1J6W A;  1JVI A;  4XCH A;  1YCL A;  1J6V A;  1VGX A;  1INN A;  1VH2 A;  1J98 A;  1J6X A;  2FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...