2FQOA

Crystal structure of b. subtilis luxs in complex with (2s)-2-amino-4-[(2r,3r)-2,3-dihydroxy-3-n- hydroxycarbamoyl-propylmercapto]butyric acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Substrate and Intermediate Analogue Inhibitors of S-Ribosylhomocysteinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords S-ribosylhomocysteine lyase
total genus 45
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 2fqoA00
1YCLA 1INNA 5E68A 1J6XA 1VGXA 1VH2A 1VJEA 1J98A 1JOEA 1IE0A 2FQTA 1J6WA 1J6VA 1JQWA 4XCHA 1JVIA 2FQOA
chains in the Genus database with same CATH superfamily
3TFIA 3AQOA 1F9NA 3S14K 4AYBD 2E2IK 4G7OA 2ZUEA 1R9TA 3HOYK 2JA7A 3RZDK 1Y1WA 3AD8C 1O26A 2GAGC 1F7UA 2YU9A 4WILA 5D4DA 2A69A 3M3YK 5IP9K 3L4KA 4BY7C 2XCRB 5FLMC 2NVXA 3Q3QA 4O2DA 3IPJA 2Y0SL 4GTBA 3HOZC 2GSUA 2E2JK 3GTLA 4GZYA 3LAJA 1XXBA 4BKWA 4BY1K 3AD7C 4C3JC 1J6VA 1VRQC 1DCOA 4BBSK 2W7VA 2E2IA 5JFEA 4QIWL 2GSOA 3T02A 3PO3K 5HL8A 1JOEA 1XXAA 4Q5SA 3H0GC 5M5XK 3A8KA 4BBRC 3RZOC 2FQTA 4A3MK 3HOZK 4G0WA 5IYCC 4A93C 4KN7A 5EGHA 1VGXA 1O28A 1TWFK 4A3GC 3BP3A 2E2HC 4GTAA 4A3GK 5IOQA 4KMDA 3G4AA 3HOVC 1Y1WK 2R7ZK 2WAQL 3T00A 1WSVA 3L4JA 4C3HK 3GTPK 4FZBA 2NVQC 1WOOA 4A3EC 1VLOA 4YFXA 1AB4A 3GTOK 1XXCA 3S15C 1XZPA 1VJEA 5TJ3A 3K7AC 3ADAC 1J6WA 4GFQA 4KB2A 5C4JC 3GTGK 4KM8A 4BXXK 4BY1C 1BS2A 1BDFA 3S2HK 4A3BC 1BGWA 2ZFZA 3S16C 1USMA 3S2HC 3OPFA 4A3DC 2R7ZA 5EGEA 1SFOK 1EQRA 2V6UA 5JVOA 5FLMK 5IP9C 1XZQA 1K83A 1TWAC 1O2BA 1TWAK 5TMCA 1Y1VK 1I6VA 1Y1VA 4KN4A 1WOSA 2PA8D 4QJVB 3GTPC 3I4NK 3DXJA 4A3FC 4X6AC 4A3FK 2WB1L 1GE9A 3GTQA 1EK8A 3S17K 4PABA 1G51A 4DDQA 1RU0A 4XSXA 4LQYA 4OIQA 4OIRA 2VUMK 2CW0A 3H0GK 3PO2C 1YX2A 4NOIA 3FOEA 1EFWA 3HOUK 3GTOC 2D6FC 2V6SA 4C3JK 2GAHC 4A3JK 3AQPA 2B63K 4C3IK 4A3KK 1SFOA 3A8JA 3SZZA 4C3HC 1TWGK 4KATA 4KAWX 2R92K 3HXAA 2VUMC 2YU9C 1DD5A 4Y52C 4QIWD 1DCPA 2CFAB 3TFJA 4MQ9A 4KMAA 3GTLC 2NVTC 4ILDA 4LR2A 1PJ6A 1YNJA 1ZBSA 5L46A 3S1NC 2NVYA 3S1QK 5IP7K 5TMFA 4MEYA 3GTOA 4BLBA 4KMUA 5IYBK 2JA6A 1TWHK 4KB4A 1WCMC 4OIOA 1ZXOA 4KARA 4G7HA 4OIPA 4C2MC 1B4BA 1J98A 3H3VD 1YCLA 4A3IK 3HOWK 3H3VL 1I50K 5C44K 4YFKA 2R93K 2CFAA 1V5VA 2E2JC 4A93K 2RH6A 3HKZL 4GTEA 4KC6A 3S1QC 1L0WA 1WOPA 4BXXC 3I4MK 3M4OC 1YNNA 3GTGA 4GTLA 2NVXK 4Y7NK 2O5IA 5CHPA 1K83K 4GT9A 4RMFA 2Y0SD 4XLPA 4XCHA 5M3MK 3A8IA 1O24A 2A68A 4C45A 1I6HC 3CQZK 3FKIK 5IYDC 1O2AA 1PJ7A 3GTMC 5C4XC 1UV7A 3FHZA 1X31C 1IQ0A 2FQOA 1IS1A 1B4AA 1XPPA 2P5MA 1IW7A 3GTJA 4OINA 1WSRA 3BUEA 1HI9A 1I50A 3HOYC 3N0CA 3S2DK 1F93A 3AH5A 4A3LK 2JA5A 1ISEA 3HOXC 4MEXA 1O25A 1WORA 3T01A 2JA8K 3GEEA 3G4CA 3S1RK 3HOUC 2XCOA 2P8TA 4LLGA 5IORA 2JA7C 1WCMK 4YG2A 3NUHA 2E2HK 1WQHA 4Y52K 4WJ4A 3TTGA 4M1XA 4X6AK 3N0BA 1R9TK 3GTQC 3S1MK 3CQZA 3FKIA 2ZUFA 3M3YC 4BY7K 4A3MC 3SZYA 2Y3PA 1TWFA 3AD9C 2R93C 3LPXA 1EI6A 2E2IC 4P9SA 5E68A 1I3QC 1O2FB 3HKZD 4A3JC 2PHCB 3I4MC 5M5WK 4XLNA 3M4OK 1TWHC 1SFOC 2PA8L 3VA7A 4WJ3M 3S16K 3S2DC 2A6HA 4LK0A 2NVYC 3GTQK 1ZVUA 1SMYA 1IBAA 2NVTK 2JH3A 3GEIA 3GTLK 2V6TA 2JA6C 1ZQ1C 3LAPA 4KDDA 1TWFC 2R93A 1WCMA 1WQFA 1ZYRA 3TFHA 2RGRA 1IL2A 4G0UA 1TWCA 4LOWA 3JSTA 3S0XA 4GTCA 4AH6A 2A6EA 4ZH4A 3S1MC 4P5BA 2NVXC 1R9TC 1INNA 3WODA 3N3YA 4G0VA 4YFNA 1USOA 3PO2K 4P5AA 3QX3A 4LK1A 3GTGC 2XCQA 3K7AK 3BP8C 1I3QK 5FJ8K 4C3IC 4A3KC 4C2MK 2B63C 1WQGA 5M3FK 5IOTA 4JK1A 4LJZA 5M5YK 3PO3C 4GTDA 4A3EK 1XZPB 2NVQK 2EBBA 3GTKC 2WB1D 5IP7C 3S1NK 2VUMA 3H0GA 5CJ9A 2JA6K 2JA5K 1JQWA 4AYBL 2E2HA 5C3EK 3OEPA 3GTJC 4PAAA 3GTJK 3I4NC 5C3EC 2JA7K 1XZQB 4A3BK 2B63A 1BJTA 1VH2A 2BE5A 4A3CK 3RZDC 1I50C 1TWGC 3EQLA 4GTFA 5C44C 2R92C 1C0AA 3GTKK 4Y7NC 2GSNA 4A3LC 3S15K 4BBRK 3GTKA 4KM9A 3HOXK 3V4GA 3GEHA 2KWAA 3ERED 1HQMA 5C4XK 3GTMK 2R7ZC 3HOVK 1O27A 4KMHA 3HOWC 3FOFA 2PPBA 4A3IC 3OREA 1DCHA 2YU9K 1TWGA 1EH1A 2R92A 4XSZA 5IYCK 1K83C 3CQZC 3FKIC 5IYDK 3S1RC 2WAQD 3GIRA 2JA8C 5IYBC 1Y1VC 1TWCK 3MMLB 1TWAA 3GTPA 3GDZA 2PMZD 4BLAA 4BBSC 3S14C 5IOSA 1I3QA 1Y1WC 1JVIA 1PJ5A 1WIHA 4A3DK 1O29A 1F7VA 3GTMA 1TWHA 1IE0A 4A3CC 3GSIA 4J3NA 2PMZL 4KASA 4QJVA 1KQ4A 4Q4ZA 2O5JA 4G7ZA 1J6XA 2NVYK 3S17C 3RZOK 1I6HK 5C4JK 3CAGA 4FM9A 1TWCC 2JA5C
chains in the Genus database with same CATH topology
1YCLA 1INNA 5E68A 1J6XA 1VGXA 1VH2A 1VJEA 1J98A 1JOEA 1IE0A 2FQTA 1J6WA 1J6VA 1JQWA 4XCHA 1JVIA 2FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCL A;  1INN A;  5E68 A;  1J6X A;  1VGX A;  1VH2 A;  1VJE A;  1J98 A;  1JOE A;  1IE0 A;  2FQT A;  1J6W A;  1J6V A;  1JQW A;  4XCH A;  1JVI A;  2FQO A; 
#chains in the Genus database with same CATH topology
 3TFI A;  3AQO A;  1F9N A;  3S14 K;  4AYB D;  2E2I K;  4G7O A;  2ZUE A;  1R9T A;  3HOY K;  2JA7 A;  3RZD K;  1Y1W A;  3AD8 C;  1O26 A;  2GAG C;  1F7U A;  2YU9 A;  4WIL A;  5D4D A;  2A69 A;  3M3Y K;  5IP9 K;  3L4K A;  4BY7 C;  2XCR B;  5FLM C;  2NVX A;  3Q3Q A;  4O2D A;  3IPJ A;  2Y0S L;  4GTB A;  3HOZ C;  2GSU A;  2E2J K;  3GTL A;  4GZY A;  3LAJ A;  1XXB A;  4BKW A;  4BY1 K;  3AD7 C;  4C3J C;  1J6V A;  1VRQ C;  1DCO A;  4BBS K;  2W7V A;  2E2I A;  5JFE A;  4QIW L;  2GSO A;  3T02 A;  3PO3 K;  5HL8 A;  1JOE A;  1XXA A;  4Q5S A;  3H0G C;  5M5X K;  3A8K A;  4BBR C;  3RZO C;  2FQT A;  4A3M K;  3HOZ K;  4G0W A;  5IYC C;  4A93 C;  4KN7 A;  5EGH A;  1VGX A;  1O28 A;  1TWF K;  4A3G C;  3BP3 A;  2E2H C;  4GTA A;  4A3G K;  5IOQ A;  4KMD A;  3G4A A;  3HOV C;  1Y1W K;  2R7Z K;  2WAQ L;  3T00 A;  1WSV A;  3L4J A;  4C3H K;  3GTP K;  4FZB A;  2NVQ C;  1WOO A;  4A3E C;  1VLO A;  4YFX A;  1AB4 A;  3GTO K;  1XXC A;  3S15 C;  1XZP A;  1VJE A;  5TJ3 A;  3K7A C;  3ADA C;  1J6W A;  4GFQ A;  4KB2 A;  5C4J C;  3GTG K;  4KM8 A;  4BXX K;  4BY1 C;  1BS2 A;  1BDF A;  3S2H K;  4A3B C;  1BGW A;  2ZFZ A;  3S16 C;  1USM A;  3S2H C;  3OPF A;  4A3D C;  2R7Z A;  5EGE A;  1SFO K;  1EQR A;  2V6U A;  5JVO A;  5FLM K;  5IP9 C;  1XZQ A;  1K83 A;  1TWA C;  1O2B A;  1TWA K;  5TMC A;  1Y1V K;  1I6V A;  1Y1V A;  4KN4 A;  1WOS A;  2PA8 D;  4QJV B;  3GTP C;  3I4N K;  3DXJ A;  4A3F C;  4X6A C;  4A3F K;  2WB1 L;  1GE9 A;  3GTQ A;  1EK8 A;  3S17 K;  4PAB A;  1G51 A;  4DDQ A;  1RU0 A;  4XSX A;  4LQY A;  4OIQ A;  4OIR A;  2VUM K;  2CW0 A;  3H0G K;  3PO2 C;  1YX2 A;  4NOI A;  3FOE A;  1EFW A;  3HOU K;  3GTO C;  2D6F C;  2V6S A;  4C3J K;  2GAH C;  4A3J K;  3AQP A;  2B63 K;  4C3I K;  4A3K K;  1SFO A;  3A8J A;  3SZZ A;  4C3H C;  1TWG K;  4KAT A;  4KAW X;  2R92 K;  3HXA A;  2VUM C;  2YU9 C;  1DD5 A;  4Y52 C;  4QIW D;  1DCP A;  2CFA B;  3TFJ A;  4MQ9 A;  4KMA A;  3GTL C;  2NVT C;  4ILD A;  4LR2 A;  1PJ6 A;  1YNJ A;  1ZBS A;  5L46 A;  3S1N C;  2NVY A;  3S1Q K;  5IP7 K;  5TMF A;  4MEY A;  3GTO A;  4BLB A;  4KMU A;  5IYB K;  2JA6 A;  1TWH K;  4KB4 A;  1WCM C;  4OIO A;  1ZXO A;  4KAR A;  4G7H A;  4OIP A;  4C2M C;  1B4B A;  1J98 A;  3H3V D;  1YCL A;  4A3I K;  3HOW K;  3H3V L;  1I50 K;  5C44 K;  4YFK A;  2R93 K;  2CFA A;  1V5V A;  2E2J C;  4A93 K;  2RH6 A;  3HKZ L;  4GTE A;  4KC6 A;  3S1Q C;  1L0W A;  1WOP A;  4BXX C;  3I4M K;  3M4O C;  1YNN A;  3GTG A;  4GTL A;  2NVX K;  4Y7N K;  2O5I A;  5CHP A;  1K83 K;  4GT9 A;  4RMF A;  2Y0S D;  4XLP A;  4XCH A;  5M3M K;  3A8I A;  1O24 A;  2A68 A;  4C45 A;  1I6H C;  3CQZ K;  3FKI K;  5IYD C;  1O2A A;  1PJ7 A;  3GTM C;  5C4X C;  1UV7 A;  3FHZ A;  1X31 C;  1IQ0 A;  2FQO A;  1IS1 A;  1B4A A;  1XPP A;  2P5M A;  1IW7 A;  3GTJ A;  4OIN A;  1WSR A;  3BUE A;  1HI9 A;  1I50 A;  3HOY C;  3N0C A;  3S2D K;  1F93 A;  3AH5 A;  4A3L K;  2JA5 A;  1ISE A;  3HOX C;  4MEX A;  1O25 A;  1WOR A;  3T01 A;  2JA8 K;  3GEE A;  3G4C A;  3S1R K;  3HOU C;  2XCO A;  2P8T A;  4LLG A;  5IOR A;  2JA7 C;  1WCM K;  4YG2 A;  3NUH A;  2E2H K;  1WQH A;  4Y52 K;  4WJ4 A;  3TTG A;  4M1X A;  4X6A K;  3N0B A;  1R9T K;  3GTQ C;  3S1M K;  3CQZ A;  3FKI A;  2ZUF A;  3M3Y C;  4BY7 K;  4A3M C;  3SZY A;  2Y3P A;  1TWF A;  3AD9 C;  2R93 C;  3LPX A;  1EI6 A;  2E2I C;  4P9S A;  5E68 A;  1I3Q C;  1O2F B;  3HKZ D;  4A3J C;  2PHC B;  3I4M C;  5M5W K;  4XLN A;  3M4O K;  1TWH C;  1SFO C;  2PA8 L;  3VA7 A;  4WJ3 M;  3S16 K;  3S2D C;  2A6H A;  4LK0 A;  2NVY C;  3GTQ K;  1ZVU A;  1SMY A;  1IBA A;  2NVT K;  2JH3 A;  3GEI A;  3GTL K;  2V6T A;  2JA6 C;  1ZQ1 C;  3LAP A;  4KDD A;  1TWF C;  2R93 A;  1WCM A;  1WQF A;  1ZYR A;  3TFH A;  2RGR A;  1IL2 A;  4G0U A;  1TWC A;  4LOW A;  3JST A;  3S0X A;  4GTC A;  4AH6 A;  2A6E A;  4ZH4 A;  3S1M C;  4P5B A;  2NVX C;  1R9T C;  1INN A;  3WOD A;  3N3Y A;  4G0V A;  4YFN A;  1USO A;  3PO2 K;  4P5A A;  3QX3 A;  4LK1 A;  3GTG C;  2XCQ A;  3K7A K;  3BP8 C;  1I3Q K;  5FJ8 K;  4C3I C;  4A3K C;  4C2M K;  2B63 C;  1WQG A;  5M3F K;  5IOT A;  4JK1 A;  4LJZ A;  5M5Y K;  3PO3 C;  4GTD A;  4A3E K;  1XZP B;  2NVQ K;  2EBB A;  3GTK C;  2WB1 D;  5IP7 C;  3S1N K;  2VUM A;  3H0G A;  5CJ9 A;  2JA6 K;  2JA5 K;  1JQW A;  4AYB L;  2E2H A;  5C3E K;  3OEP A;  3GTJ C;  4PAA A;  3GTJ K;  3I4N C;  5C3E C;  2JA7 K;  1XZQ B;  4A3B K;  2B63 A;  1BJT A;  1VH2 A;  2BE5 A;  4A3C K;  3RZD C;  1I50 C;  1TWG C;  3EQL A;  4GTF A;  5C44 C;  2R92 C;  1C0A A;  3GTK K;  4Y7N C;  2GSN A;  4A3L C;  3S15 K;  4BBR K;  3GTK A;  4KM9 A;  3HOX K;  3V4G A;  3GEH A;  2KWA A;  3ERE D;  1HQM A;  5C4X K;  3GTM K;  2R7Z C;  3HOV K;  1O27 A;  4KMH A;  3HOW C;  3FOF A;  2PPB A;  4A3I C;  3ORE A;  1DCH A;  2YU9 K;  1TWG A;  1EH1 A;  2R92 A;  4XSZ A;  5IYC K;  1K83 C;  3CQZ C;  3FKI C;  5IYD K;  3S1R C;  2WAQ D;  3GIR A;  2JA8 C;  5IYB C;  1Y1V C;  1TWC K;  3MML B;  1TWA A;  3GTP A;  3GDZ A;  2PMZ D;  4BLA A;  4BBS C;  3S14 C;  5IOS A;  1I3Q A;  1Y1W C;  1JVI A;  1PJ5 A;  1WIH A;  4A3D K;  1O29 A;  1F7V A;  3GTM A;  1TWH A;  1IE0 A;  4A3C C;  3GSI A;  4J3N A;  2PMZ L;  4KAS A;  4QJV A;  1KQ4 A;  4Q4Z A;  2O5J A;  4G7Z A;  1J6X A;  2NVY K;  3S17 C;  3RZO K;  1I6H K;  5C4J K;  3CAG A;  4FM9 A;  1TWC C;  2JA5 C; 
#chains in the Genus database with same CATH homology
 1YCL A;  1INN A;  5E68 A;  1J6X A;  1VGX A;  1VH2 A;  1VJE A;  1J98 A;  1JOE A;  1IE0 A;  2FQT A;  1J6W A;  1J6V A;  1JQW A;  4XCH A;  1JVI A;  2FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...