2FQOA

Crystal structure of b. subtilis luxs in complex with (2s)-2-amino-4-[(2r,3r)-2,3-dihydroxy-3-n- hydroxycarbamoyl-propylmercapto]butyric acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Substrate and Intermediate Analogue Inhibitors of S-Ribosylhomocysteinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords S-ribosylhomocysteine lyase
total genus 45
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 2fqoA00
2FQOA 1IE0A 1JOEA 1JVIA 1VGXA 1J6WA 1INNA 4XCHA 5E68A 1YCLA 1J98A 1VJEA 2FQTA 1J6XA 1J6VA 1VH2A 1JQWA
chains in the Genus database with same CATH superfamily
1TWCC 4C3JC 4Y52C 2NVXK 4GTDA 4KC6A 4KMHA 4A3CK 3TFHA 2D6FC 3GTGA 4C3IK 2XCQA 5C44K 4GFQA 1R9TK 4ZH4A 2JA8K 1TWGC 4LJZA 5IYCC 4KB4A 1TWGK 3VA7A 2P5MA 1EI6A 4BKWA 3GTLK 1TWGA 3GTLC 3TFJA 1TWFK 1XZQA 1O2BA 1R9TA 3L4JA 2A68A 3GTGK 4KN4A 2B63K 3GEIA 4NOIA 5IYDC 4KASA 2E2JK 4M1XA 2GAGC 4O2DA 1Y1VA 3SZZA 4KN7A 2ZUFA 2VUMK 4A93C 3GTMC 3GTMK 3GTQK 1B4BA 3HOYK 1SFOA 4XLPA 3OREA 2NVTK 1TWHC 4YFNA 5C3EK 4ILDA 3A8IA 3Q3QA 1SFOC 1SFOK 1TWAA 3HOZC 3GTMA 4A3GK 3ADAC 4G7ZA 4A3IC 4A3GC 1F7UA 2JH3A 1ZBSA 1ZYRA 3V4GA 2VUMA 3HOUC 5TMFA 2NVQK 4WILA 1Y1VK 1JOEA 1V5VA 4A3CC 2R93C 5L46A 5IP9C 1UV7A 1WOPA 4P5AA 5IYCK 3FKIK 5HL8A 3S1QC 5C4JK 4FZBA 5C4JC 3AD9C 4GTCA 2R92A 2B63A 3H0GK 2CW0A 1TWFA 5JVOA 4BBSC 4KAWX 4WJ4A 1VGXA 5IORA 3GTLA 1PJ5A 3HOVC 4C2MC 1GE9A 4BY1C 4BY1K 3GTPA 4FM9A 2Y0SD 1B4AA 1VRQC 2NVXA 2Y0SL 5C44C 2CFAA 5E68A 2R7ZC 2JA8C 2VUMC 2Y3PA 1USMA 3PO2K 4BY7K 1WCMA 1C0AA 3S1MK 4GTEA 1I3QK 3S15C 2PPBA 2E2HC 4KMUA 4A3MC 2V6SA 4KARA 1VJEA 1IBAA 2JA5A 4PAAA 3I4NK 1IW7A 3GTJC 3I4NC 2O5JA 4OINA 3HOZK 3GTJK 2E2JC 4PABA 5IYDK 5M5WK 3DXJA 3AH5A 1O29A 1IQ0A 1EH1A 4A3JC 1ZVUA 4BLAA 1J6VA 3I4MC 3I4MK 3SZYA 1Y1WC 3HKZD 1Y1WK 3RZDC 3S1NC 3GTQC 3AQPA 3S1QK 3RZOC 4OIPA 2YU9A 3HOYC 3HKZL 3S2DK 2NVTC 5D4DA 1INNA 1K83A 1WORA 3AD8C 3S0XA 1IS1A 2NVYK 1XZQB 4BBSK 4AH6A 1EFWA 4BLBA 1O2AA 3A8KA 4GTBA 3T02A 1DCOA 3HOVK 2JA7C 4C3JK 4Y52K 3CQZC 3HOUK 3TTGA 4P5BA 2NVXC 5CJ9A 3OPFA 1Y1VC 2PA8D 1EQRA 1I50C 4AYBL 5IOTA 1I6HK 4GTLA 1I50K 2ZUEA 1TWCA 2WB1D 4X6AC 3FKIC 3PO2C 4BY7C 2WB1L 3S15K 1O2FB 3LPXA 3GTOA 2E2HK 1PJ7A 1XXCA 4YFKA 2B63C 3WODA 4G0WA 4KDDA 3HOWK 3N0CA 4Q5SA 5EGEA 3CQZA 2EBBA 4C2MK 3GDZA 4QIWL 4A3JK 3MMLB 2E2IC 3H3VL 1KQ4A 4XLNA 3L4KA 3S2HK 1YNNA 3GSIA 2JA6C 3LAPA 4WJ3M 4Q4ZA 2R7ZK 5FLMC 2JA6K 3ERED 1WCMC 5FLMK 3AQOA 2FQTA 3G4AA 2PMZL 2YU9C 1WOOA 1WQGA 3GTKA 1BJTA 1O27A 4A3MK 2GAHC 1TWHK 4A3FC 4LR2A 2R93A 1JVIA 2PA8L 2WAQD 2NVYC 1PJ6A 4LK0A 5IYBK 1HQMA 3HXAA 4QJVB 2WAQL 4GTFA 1K83C 1SMYA 2GSUA 4C3HK 2XCRB 2R93K 4C3HC 1TWHA 5IP9K 1I6HC 4LQYA 4OIRA 1L0WA 3RZDK 2RH6A 3FHZA 1O24A 2GSNA 5JFEA 3HOXC 3M4OK 1F93A 3S2DC 3S14K 2JA6A 3S14C 4KM8A 3H0GC 1G51A 3IPJA 1ISEA 1YX2A 2PHCB 4A3EC 1VH2A 4QIWD 3S1RK 4KATA 2JA7K 3JSTA 4A3LC 3CQZK 1WIHA 4A3LK 3M3YK 4BBRC 3GIRA 4BBRK 3T01A 2E2IK 5M3FK 1J98A 4MQ9A 3S2HC 2E2IA 1AB4A 1IL2A 1R9TC 2E2HA 2BE5A 3OEPA 3GTOK 2R92C 3BP3A 3GTOC 2JA7A 3G4CA 4X6AK 1DCHA 4A3DC 5EGHA 1YNJA 4A3DK 2GSOA 4AYBD 1I50A 4J3NA 4BXXK 3GEHA 2V6UA 3HOWC 4LLGA 5TMCA 2A6HA 5CHPA 1XXBA 1TWAC 1F9NA 3N0BA 3PO3K 1K83K 3PO3C 4Y7NK 2O5IA 1F7VA 1BDFA 4Y7NC 2YU9K 4YFXA 3FOEA 1I6VA 3K7AC 4DDQA 3RZOK 3K7AK 1VLOA 1RU0A 3EQLA 4KMAA 5C3EC 3GTKK 3H3VD 1DCPA 4OIOA 1WQHA 1JQWA 2PMZD 3S17K 5C4XK 3BP8C 2W7VA 5C4XC 1XZPA 1X31C 4KM9A 3AD7C 3M3YC 2R7ZA 2JA5C 3N3YA 3S16K 2JA5K 3S16C 4LOWA 4YG2A 4JK1A 2P8TA 3FOFA 2V6TA 1ZQ1C 1IE0A 1J6WA 2A69A 1I3QA 4GT9A 4OIQA 1DD5A 3HOXK 5IP7K 1O26A 3M4OC 4GZYA 5IP7C 2CFAB 5IOSA 1TWFC 4P9SA 3GTGC 3QX3A 4A3EK 2XCOA 3GTPK 3GTPC 4A3KC 4A3KK 1TWCK 4KB2A 5FJ8K 4A3BK 3BUEA 1ZXOA 4G0VA 4A3BC 1WQFA 2RGRA 5IOQA 2ZFZA 5M5XK 4C3IC 4XCHA 3H0GA 4XSZA 4KMDA 2R92K 5M3MK 5TJ3A 3FKIA 3S1MC 1I3QC 2FQOA 2NVYA 4A3FK 1XZPB 4BXXC 4G0UA 1WSRA 3TFIA 4MEXA 1BS2A 2A6EA 2KWAA 4C45A 5IYBC 1USOA 4G7OA 3NUHA 3S17C 1Y1WA 2NVQC 3LAJA 1TWAK 3CAGA 5M5YK 1YCLA 3GEEA 1WSVA 1EK8A 4A93K 1XPPA 1O28A 3S1NK 3GTQA 3GTJA 4RMFA 1J6XA 1HI9A 4LK1A 3T00A 4G7HA 4QJVA 1BGWA 1WOSA 3A8JA 4XSXA 3GTKC 1XXAA 4A3IK 1WCMK 4GTAA 3S1RC 1O25A 4MEYA
chains in the Genus database with same CATH topology
2FQOA 1IE0A 1JOEA 1JVIA 1VGXA 1J6WA 1INNA 4XCHA 5E68A 1YCLA 1J98A 1VJEA 2FQTA 1J6XA 1J6VA 1VH2A 1JQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQO A;  1IE0 A;  1JOE A;  1JVI A;  1VGX A;  1J6W A;  1INN A;  4XCH A;  5E68 A;  1YCL A;  1J98 A;  1VJE A;  2FQT A;  1J6X A;  1J6V A;  1VH2 A;  1JQW A; 
#chains in the Genus database with same CATH topology
 1TWC C;  4C3J C;  4Y52 C;  2NVX K;  4GTD A;  4KC6 A;  4KMH A;  4A3C K;  3TFH A;  2D6F C;  3GTG A;  4C3I K;  2XCQ A;  5C44 K;  4GFQ A;  1R9T K;  4ZH4 A;  2JA8 K;  1TWG C;  4LJZ A;  5IYC C;  4KB4 A;  1TWG K;  3VA7 A;  2P5M A;  1EI6 A;  4BKW A;  3GTL K;  1TWG A;  3GTL C;  3TFJ A;  1TWF K;  1XZQ A;  1O2B A;  1R9T A;  3L4J A;  2A68 A;  3GTG K;  4KN4 A;  2B63 K;  3GEI A;  4NOI A;  5IYD C;  4KAS A;  2E2J K;  4M1X A;  2GAG C;  4O2D A;  1Y1V A;  3SZZ A;  4KN7 A;  2ZUF A;  2VUM K;  4A93 C;  3GTM C;  3GTM K;  3GTQ K;  1B4B A;  3HOY K;  1SFO A;  4XLP A;  3ORE A;  2NVT K;  1TWH C;  4YFN A;  5C3E K;  4ILD A;  3A8I A;  3Q3Q A;  1SFO C;  1SFO K;  1TWA A;  3HOZ C;  3GTM A;  4A3G K;  3ADA C;  4G7Z A;  4A3I C;  4A3G C;  1F7U A;  2JH3 A;  1ZBS A;  1ZYR A;  3V4G A;  2VUM A;  3HOU C;  5TMF A;  2NVQ K;  4WIL A;  1Y1V K;  1JOE A;  1V5V A;  4A3C C;  2R93 C;  5L46 A;  5IP9 C;  1UV7 A;  1WOP A;  4P5A A;  5IYC K;  3FKI K;  5HL8 A;  3S1Q C;  5C4J K;  4FZB A;  5C4J C;  3AD9 C;  4GTC A;  2R92 A;  2B63 A;  3H0G K;  2CW0 A;  1TWF A;  5JVO A;  4BBS C;  4KAW X;  4WJ4 A;  1VGX A;  5IOR A;  3GTL A;  1PJ5 A;  3HOV C;  4C2M C;  1GE9 A;  4BY1 C;  4BY1 K;  3GTP A;  4FM9 A;  2Y0S D;  1B4A A;  1VRQ C;  2NVX A;  2Y0S L;  5C44 C;  2CFA A;  5E68 A;  2R7Z C;  2JA8 C;  2VUM C;  2Y3P A;  1USM A;  3PO2 K;  4BY7 K;  1WCM A;  1C0A A;  3S1M K;  4GTE A;  1I3Q K;  3S15 C;  2PPB A;  2E2H C;  4KMU A;  4A3M C;  2V6S A;  4KAR A;  1VJE A;  1IBA A;  2JA5 A;  4PAA A;  3I4N K;  1IW7 A;  3GTJ C;  3I4N C;  2O5J A;  4OIN A;  3HOZ K;  3GTJ K;  2E2J C;  4PAB A;  5IYD K;  5M5W K;  3DXJ A;  3AH5 A;  1O29 A;  1IQ0 A;  1EH1 A;  4A3J C;  1ZVU A;  4BLA A;  1J6V A;  3I4M C;  3I4M K;  3SZY A;  1Y1W C;  3HKZ D;  1Y1W K;  3RZD C;  3S1N C;  3GTQ C;  3AQP A;  3S1Q K;  3RZO C;  4OIP A;  2YU9 A;  3HOY C;  3HKZ L;  3S2D K;  2NVT C;  5D4D A;  1INN A;  1K83 A;  1WOR A;  3AD8 C;  3S0X A;  1IS1 A;  2NVY K;  1XZQ B;  4BBS K;  4AH6 A;  1EFW A;  4BLB A;  1O2A A;  3A8K A;  4GTB A;  3T02 A;  1DCO A;  3HOV K;  2JA7 C;  4C3J K;  4Y52 K;  3CQZ C;  3HOU K;  3TTG A;  4P5B A;  2NVX C;  5CJ9 A;  3OPF A;  1Y1V C;  2PA8 D;  1EQR A;  1I50 C;  4AYB L;  5IOT A;  1I6H K;  4GTL A;  1I50 K;  2ZUE A;  1TWC A;  2WB1 D;  4X6A C;  3FKI C;  3PO2 C;  4BY7 C;  2WB1 L;  3S15 K;  1O2F B;  3LPX A;  3GTO A;  2E2H K;  1PJ7 A;  1XXC A;  4YFK A;  2B63 C;  3WOD A;  4G0W A;  4KDD A;  3HOW K;  3N0C A;  4Q5S A;  5EGE A;  3CQZ A;  2EBB A;  4C2M K;  3GDZ A;  4QIW L;  4A3J K;  3MML B;  2E2I C;  3H3V L;  1KQ4 A;  4XLN A;  3L4K A;  3S2H K;  1YNN A;  3GSI A;  2JA6 C;  3LAP A;  4WJ3 M;  4Q4Z A;  2R7Z K;  5FLM C;  2JA6 K;  3ERE D;  1WCM C;  5FLM K;  3AQO A;  2FQT A;  3G4A A;  2PMZ L;  2YU9 C;  1WOO A;  1WQG A;  3GTK A;  1BJT A;  1O27 A;  4A3M K;  2GAH C;  1TWH K;  4A3F C;  4LR2 A;  2R93 A;  1JVI A;  2PA8 L;  2WAQ D;  2NVY C;  1PJ6 A;  4LK0 A;  5IYB K;  1HQM A;  3HXA A;  4QJV B;  2WAQ L;  4GTF A;  1K83 C;  1SMY A;  2GSU A;  4C3H K;  2XCR B;  2R93 K;  4C3H C;  1TWH A;  5IP9 K;  1I6H C;  4LQY A;  4OIR A;  1L0W A;  3RZD K;  2RH6 A;  3FHZ A;  1O24 A;  2GSN A;  5JFE A;  3HOX C;  3M4O K;  1F93 A;  3S2D C;  3S14 K;  2JA6 A;  3S14 C;  4KM8 A;  3H0G C;  1G51 A;  3IPJ A;  1ISE A;  1YX2 A;  2PHC B;  4A3E C;  1VH2 A;  4QIW D;  3S1R K;  4KAT A;  2JA7 K;  3JST A;  4A3L C;  3CQZ K;  1WIH A;  4A3L K;  3M3Y K;  4BBR C;  3GIR A;  4BBR K;  3T01 A;  2E2I K;  5M3F K;  1J98 A;  4MQ9 A;  3S2H C;  2E2I A;  1AB4 A;  1IL2 A;  1R9T C;  2E2H A;  2BE5 A;  3OEP A;  3GTO K;  2R92 C;  3BP3 A;  3GTO C;  2JA7 A;  3G4C A;  4X6A K;  1DCH A;  4A3D C;  5EGH A;  1YNJ A;  4A3D K;  2GSO A;  4AYB D;  1I50 A;  4J3N A;  4BXX K;  3GEH A;  2V6U A;  3HOW C;  4LLG A;  5TMC A;  2A6H A;  5CHP A;  1XXB A;  1TWA C;  1F9N A;  3N0B A;  3PO3 K;  1K83 K;  3PO3 C;  4Y7N K;  2O5I A;  1F7V A;  1BDF A;  4Y7N C;  2YU9 K;  4YFX A;  3FOE A;  1I6V A;  3K7A C;  4DDQ A;  3RZO K;  3K7A K;  1VLO A;  1RU0 A;  3EQL A;  4KMA A;  5C3E C;  3GTK K;  3H3V D;  1DCP A;  4OIO A;  1WQH A;  1JQW A;  2PMZ D;  3S17 K;  5C4X K;  3BP8 C;  2W7V A;  5C4X C;  1XZP A;  1X31 C;  4KM9 A;  3AD7 C;  3M3Y C;  2R7Z A;  2JA5 C;  3N3Y A;  3S16 K;  2JA5 K;  3S16 C;  4LOW A;  4YG2 A;  4JK1 A;  2P8T A;  3FOF A;  2V6T A;  1ZQ1 C;  1IE0 A;  1J6W A;  2A69 A;  1I3Q A;  4GT9 A;  4OIQ A;  1DD5 A;  3HOX K;  5IP7 K;  1O26 A;  3M4O C;  4GZY A;  5IP7 C;  2CFA B;  5IOS A;  1TWF C;  4P9S A;  3GTG C;  3QX3 A;  4A3E K;  2XCO A;  3GTP K;  3GTP C;  4A3K C;  4A3K K;  1TWC K;  4KB2 A;  5FJ8 K;  4A3B K;  3BUE A;  1ZXO A;  4G0V A;  4A3B C;  1WQF A;  2RGR A;  5IOQ A;  2ZFZ A;  5M5X K;  4C3I C;  4XCH A;  3H0G A;  4XSZ A;  4KMD A;  2R92 K;  5M3M K;  5TJ3 A;  3FKI A;  3S1M C;  1I3Q C;  2FQO A;  2NVY A;  4A3F K;  1XZP B;  4BXX C;  4G0U A;  1WSR A;  3TFI A;  4MEX A;  1BS2 A;  2A6E A;  2KWA A;  4C45 A;  5IYB C;  1USO A;  4G7O A;  3NUH A;  3S17 C;  1Y1W A;  2NVQ C;  3LAJ A;  1TWA K;  3CAG A;  5M5Y K;  1YCL A;  3GEE A;  1WSV A;  1EK8 A;  4A93 K;  1XPP A;  1O28 A;  3S1N K;  3GTQ A;  3GTJ A;  4RMF A;  1J6X A;  1HI9 A;  4LK1 A;  3T00 A;  4G7H A;  4QJV A;  1BGW A;  1WOS A;  3A8J A;  4XSX A;  3GTK C;  1XXA A;  4A3I K;  1WCM K;  4GTA A;  3S1R C;  1O25 A;  4MEY A; 
#chains in the Genus database with same CATH homology
 2FQO A;  1IE0 A;  1JOE A;  1JVI A;  1VGX A;  1J6W A;  1INN A;  4XCH A;  5E68 A;  1YCL A;  1J98 A;  1VJE A;  2FQT A;  1J6X A;  1J6V A;  1VH2 A;  1JQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...