2FQOA

Crystal structure of b. subtilis luxs in complex with (2s)-2-amino-4-[(2r,3r)-2,3-dihydroxy-3-n- hydroxycarbamoyl-propylmercapto]butyric acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
b'VESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteine lyase
publication title Design and Synthesis of Substrate and Intermediate Analogue Inhibitors of S-Ribosylhomocysteinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 45
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2006-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 2fqoA00
1J6WA 4XCHA 2FQTA 1VJEA 1VH2A 5E68A 1YCLA 1J98A 1IE0A 2FQOA 1J6XA 1JOEA 1VGXA 1INNA 1J6VA 1JVIA 1JQWA
chains in the Genus database with same CATH superfamily
4QIWD 2VUMK 3S16C 2GSUA 1IE0A 1O2AA 2GAGC 2NVQC 2A68A 5IYCC 4LK0A 2JA6A 3TFJA 1TWAK 4A3JK 3N0BA 1TWHC 2NVYA 3GTGC 5CJ9A 1O2BA 1WQHA 2YU9A 4YG2A 3CAGA 1J6WA 1XZPA 3T02A 3HKZD 5D4DA 3HOUC 1I6HK 3RZDC 4G0UA 4YFKA 5M5YK 4RMFA 1R9TA 5IP7C 1TWGA 3N0CA 3M4OK 4LK1A 4BY7K 4BLAA 4BBRC 2R93K 5TMCA 4BKWA 2JA7A 4Y52C 4BBSC 1O26A 4KAWX 2VUMC 3S1RC 1GE9A 4XLNA 1Y1VA 2XCQA 1TWAC 4A3JC 4KMDA 3GTMK 5JVOA 4A3FC 3I4MK 3OREA 4YFNA 4AYBD 4QJVB 3GTLK 1Y1WA 4BY1C 4AH6A 2A6HA 1I6HC 3GTOK 3T01A 3FKIA 3HOVK 1AB4A 5JFEA 1I3QA 4GT9A 4DDQA 3M4OC 1I50A 4BY7C 1WCMA 3HOWC 1TWFA 1X31C 4Q4ZA 2PA8L 2O5IA 2R93C 3ERED 2E2IK 4OIRA 2FQTA 4LR2A 1BGWA 3SZYA 4C45A 4P5BA 2XCRB 4QJVA 3K7AK 5IORA 4X6AK 4NOIA 4ZH4A 4KARA 3QX3A 4KMAA 3GTJK 4FM9A 3Q3QA 4C3HK 3JSTA 3FOFA 3GTMC 4A3IK 1O29A 5IOTA 1WSRA 3GTLC 5FLMK 2JA5A 1XXAA 4GTBA 3HOXC 1DCHA 4GTFA 2R7ZA 3H0GA 3HOVC 2BE5A 5FJ8K 1SFOC 2JA8K 3BP3A 3BP8C 4P9SA 5C4JC 1WOSA 1BS2A 3A8JA 2E2IC 1EK8A 4XCHA 3GEEA 1YX2A 1TWHA 2PMZD 5IP9K 3GTGA 4BXXK 1HI9A 3K7AC 4M1XA 4KATA 4A3BK 5IYDK 1O2FB 1O24A 5IYBK 3EQLA 4KN7A 3GTJC 4C3HC 4G7ZA 4A3IC 4KB4A 2WB1D 3GTPK 1O25A 1ZXOA 4KB2A 3V4GA 1F9NA 5FLMC 3TFHA 4GFQA 3S1NK 3S0XA 1B4BA 2E2JK 2VUMA 1XPPA 4G7OA 1UV7A 2Y3PA 4KDDA 2JA8C 5E68A 3CQZK 1J6XA 1YNJA 4J3NA 1TWAA 3AQPA 5IOSA 1VGXA 5IP9C 3H3VL 1BDFA 2R92K 1ZQ1C 3NUHA 4GTDA 4BXXC 4GTCA 4C3JK 3GSIA 3GTQA 4A3BC 4WJ3M 1XXBA 5EGHA 5IYDC 1INNA 3A8KA 2P8TA 5IYBC 4BLBA 5HL8A 3GTPC 3FHZA 5CHPA 3L4KA 3S15C 4JK1A 2NVYK 2Y0SD 4G7HA 4OINA 1F7UA 2E2JC 1O27A 4LJZA 2YU9K 4PABA 1DCPA 3CQZC 2P5MA 1R9TK 1XXCA 2E2HK 3AD7C 3HOZK 1VLOA 1VJEA 5C3EK 2R92C 3MMLB 3M3YK 4QIWL 3G4CA 3OEPA 3GEHA 4Q5SA 3GTLA 4C3JC 3BUEA 3LPXA 5TMFA 2FQOA 4KM8A 4OIQA 1V5VA 4WILA 1SFOA 4PAAA 1WIHA 4KN4A 3FOEA 1EI6A 3HOYK 4KMHA 1Y1WK 4LOWA 4A3LK 3S1QK 3FKIK 4MQ9A 4KM9A 2E2HC 1I50K 3HOZC 1WCMK 1TWFK 5C3EC 1SMYA 3LAPA 3I4MC 5IOQA 3A8IA 3M3YC 5M3FK 4MEYA 1J98A 4GZYA 3GTOC 2WAQL 1I6VA 3GTKK 2PHCB 1YCLA 4A3KK 2A6EA 4AYBL 2B63K 3S2HK 1DD5A 3HOYC 1C0AA 5C4XK 3WODA 3S2DK 4KC6A 4X6AC 3IPJA 3S1QC 3H3VD 1USMA 1K83K 5L46A 2PPBA 1WCMC 1TWFC 1RU0A 1ISEA 2V6TA 1G51A 3ADAC 1ZVUA 1TWCK 5TJ3A 3TFIA 3GTKC 4LLGA 4G0VA 3RZOK 1IS1A 3CQZA 1JVIA 1WSVA 2GSOA 5M5XK 4MEXA 1DCOA 3G4AA 2NVXK 2B63C 2D6FC 1F93A 3S2HC 4LQYA 1KQ4A 5C4XC 1WQGA 1EH1A 3S2DC 5EGEA 4OIOA 1WOOA 1K83C 3GDZA 4A3EK 3S1RK 1B4AA 2RH6A 3AD9C 1WQFA 4G0WA 4C2MK 2O5JA 2RGRA 2PMZL 4XSZA 2JA6K 2R93A 3S17K 2A69A 1TWCC 4FZBA 3S1NC 2PA8D 4A3DK 4A3FK 1VH2A 1BJTA 4YFXA 4WJ4A 3VA7A 4BY1K 2EBBA 3GTQK 4O2DA 3RZOC 4KMUA 1TWGK 2WB1L 4OIPA 2E2HA 2NVXC 2ZUEA 2GAHC 1USOA 4GTAA 3HOWK 1IQ0A 3GTMA 2JA7K 3PO2K 2CW0A 4KASA 4GTEA 3GTOA 4A3EC 3S14K 4C2MC 1PJ6A 2WAQD 5C44K 1F7VA 1XZQB 1Y1VK 1JQWA 2JA6C 3S17C 2E2IA 2NVYC 3HKZL 4A3DC 3GIRA 2ZUFA 2YU9C 3N3YA 3HOXK 3GTQC 1J6VA 1R9TC 1I3QK 1TWGC 1WOPA 1ZBSA 3GTJA 1SFOK 1PJ7A 3SZZA 3S1MK 2NVTK 5C4JK 2Y0SL 1IBAA 1XZQA 2W7VA 4A3CK 2JA7C 3PO2C 3PO3K 1JOEA 4A93K 3TTGA 4A3MK 3GTKA 2CFAB 3OPFA 3S14C 1EQRA 3HXAA 1WORA 4A3GK 5C44C 1Y1VC 5M5WK 3I4NK 2V6UA 2B63A 4Y7NK 1EFWA 1PJ5A 2XCOA 4C3IK 1ZYRA 2JA5K 1Y1WC 4A3LC 2R7ZK 3H0GK 2V6SA 3FKIC 2KWAA 1I3QC 1K83A 1IL2A 3S16K 1L0WA 3LAJA 1I50C 1VRQC 2CFAA 2NVQK 3GEIA 3S1MC 5IYCK 4ILDA 2NVTC 4GTLA 4XLPA 2ZFZA 3GTPA 3AH5A 4A3CC 3PO3C 3T00A 4XSXA 1O28A 4A93C 1TWHK 1TWCA 3GTGK 3AD8C 4A3MC 3DXJA 1IW7A 4A3GC 3HOUK 4P5AA 3RZDK 3I4NC 4A3KC 5IP7K 1HQMA 1YNNA 2NVXA 3AQOA 4Y7NC 4BBRK 4C3IC 3L4JA 2JA5C 2JH3A 2R92A 1XZPB 5M3MK 2GSNA 3S15K 4Y52K 4BBSK 2R7ZC 3H0GC
chains in the Genus database with same CATH topology
1J6WA 4XCHA 2FQTA 1VJEA 1VH2A 5E68A 1YCLA 1J98A 1IE0A 2FQOA 1J6XA 1JOEA 1VGXA 1INNA 1J6VA 1JVIA 1JQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6W A;  4XCH A;  2FQT A;  1VJE A;  1VH2 A;  5E68 A;  1YCL A;  1J98 A;  1IE0 A;  2FQO A;  1J6X A;  1JOE A;  1VGX A;  1INN A;  1J6V A;  1JVI A;  1JQW A; 
#chains in the Genus database with same CATH topology
 4QIW D;  2VUM K;  3S16 C;  2GSU A;  1IE0 A;  1O2A A;  2GAG C;  2NVQ C;  2A68 A;  5IYC C;  4LK0 A;  2JA6 A;  3TFJ A;  1TWA K;  4A3J K;  3N0B A;  1TWH C;  2NVY A;  3GTG C;  5CJ9 A;  1O2B A;  1WQH A;  2YU9 A;  4YG2 A;  3CAG A;  1J6W A;  1XZP A;  3T02 A;  3HKZ D;  5D4D A;  3HOU C;  1I6H K;  3RZD C;  4G0U A;  4YFK A;  5M5Y K;  4RMF A;  1R9T A;  5IP7 C;  1TWG A;  3N0C A;  3M4O K;  4LK1 A;  4BY7 K;  4BLA A;  4BBR C;  2R93 K;  5TMC A;  4BKW A;  2JA7 A;  4Y52 C;  4BBS C;  1O26 A;  4KAW X;  2VUM C;  3S1R C;  1GE9 A;  4XLN A;  1Y1V A;  2XCQ A;  1TWA C;  4A3J C;  4KMD A;  3GTM K;  5JVO A;  4A3F C;  3I4M K;  3ORE A;  4YFN A;  4AYB D;  4QJV B;  3GTL K;  1Y1W A;  4BY1 C;  4AH6 A;  2A6H A;  1I6H C;  3GTO K;  3T01 A;  3FKI A;  3HOV K;  1AB4 A;  5JFE A;  1I3Q A;  4GT9 A;  4DDQ A;  3M4O C;  1I50 A;  4BY7 C;  1WCM A;  3HOW C;  1TWF A;  1X31 C;  4Q4Z A;  2PA8 L;  2O5I A;  2R93 C;  3ERE D;  2E2I K;  4OIR A;  2FQT A;  4LR2 A;  1BGW A;  3SZY A;  4C45 A;  4P5B A;  2XCR B;  4QJV A;  3K7A K;  5IOR A;  4X6A K;  4NOI A;  4ZH4 A;  4KAR A;  3QX3 A;  4KMA A;  3GTJ K;  4FM9 A;  3Q3Q A;  4C3H K;  3JST A;  3FOF A;  3GTM C;  4A3I K;  1O29 A;  5IOT A;  1WSR A;  3GTL C;  5FLM K;  2JA5 A;  1XXA A;  4GTB A;  3HOX C;  1DCH A;  4GTF A;  2R7Z A;  3H0G A;  3HOV C;  2BE5 A;  5FJ8 K;  1SFO C;  2JA8 K;  3BP3 A;  3BP8 C;  4P9S A;  5C4J C;  1WOS A;  1BS2 A;  3A8J A;  2E2I C;  1EK8 A;  4XCH A;  3GEE A;  1YX2 A;  1TWH A;  2PMZ D;  5IP9 K;  3GTG A;  4BXX K;  1HI9 A;  3K7A C;  4M1X A;  4KAT A;  4A3B K;  5IYD K;  1O2F B;  1O24 A;  5IYB K;  3EQL A;  4KN7 A;  3GTJ C;  4C3H C;  4G7Z A;  4A3I C;  4KB4 A;  2WB1 D;  3GTP K;  1O25 A;  1ZXO A;  4KB2 A;  3V4G A;  1F9N A;  5FLM C;  3TFH A;  4GFQ A;  3S1N K;  3S0X A;  1B4B A;  2E2J K;  2VUM A;  1XPP A;  4G7O A;  1UV7 A;  2Y3P A;  4KDD A;  2JA8 C;  5E68 A;  3CQZ K;  1J6X A;  1YNJ A;  4J3N A;  1TWA A;  3AQP A;  5IOS A;  1VGX A;  5IP9 C;  3H3V L;  1BDF A;  2R92 K;  1ZQ1 C;  3NUH A;  4GTD A;  4BXX C;  4GTC A;  4C3J K;  3GSI A;  3GTQ A;  4A3B C;  4WJ3 M;  1XXB A;  5EGH A;  5IYD C;  1INN A;  3A8K A;  2P8T A;  5IYB C;  4BLB A;  5HL8 A;  3GTP C;  3FHZ A;  5CHP A;  3L4K A;  3S15 C;  4JK1 A;  2NVY K;  2Y0S D;  4G7H A;  4OIN A;  1F7U A;  2E2J C;  1O27 A;  4LJZ A;  2YU9 K;  4PAB A;  1DCP A;  3CQZ C;  2P5M A;  1R9T K;  1XXC A;  2E2H K;  3AD7 C;  3HOZ K;  1VLO A;  1VJE A;  5C3E K;  2R92 C;  3MML B;  3M3Y K;  4QIW L;  3G4C A;  3OEP A;  3GEH A;  4Q5S A;  3GTL A;  4C3J C;  3BUE A;  3LPX A;  5TMF A;  2FQO A;  4KM8 A;  4OIQ A;  1V5V A;  4WIL A;  1SFO A;  4PAA A;  1WIH A;  4KN4 A;  3FOE A;  1EI6 A;  3HOY K;  4KMH A;  1Y1W K;  4LOW A;  4A3L K;  3S1Q K;  3FKI K;  4MQ9 A;  4KM9 A;  2E2H C;  1I50 K;  3HOZ C;  1WCM K;  1TWF K;  5C3E C;  1SMY A;  3LAP A;  3I4M C;  5IOQ A;  3A8I A;  3M3Y C;  5M3F K;  4MEY A;  1J98 A;  4GZY A;  3GTO C;  2WAQ L;  1I6V A;  3GTK K;  2PHC B;  1YCL A;  4A3K K;  2A6E A;  4AYB L;  2B63 K;  3S2H K;  1DD5 A;  3HOY C;  1C0A A;  5C4X K;  3WOD A;  3S2D K;  4KC6 A;  4X6A C;  3IPJ A;  3S1Q C;  3H3V D;  1USM A;  1K83 K;  5L46 A;  2PPB A;  1WCM C;  1TWF C;  1RU0 A;  1ISE A;  2V6T A;  1G51 A;  3ADA C;  1ZVU A;  1TWC K;  5TJ3 A;  3TFI A;  3GTK C;  4LLG A;  4G0V A;  3RZO K;  1IS1 A;  3CQZ A;  1JVI A;  1WSV A;  2GSO A;  5M5X K;  4MEX A;  1DCO A;  3G4A A;  2NVX K;  2B63 C;  2D6F C;  1F93 A;  3S2H C;  4LQY A;  1KQ4 A;  5C4X C;  1WQG A;  1EH1 A;  3S2D C;  5EGE A;  4OIO A;  1WOO A;  1K83 C;  3GDZ A;  4A3E K;  3S1R K;  1B4A A;  2RH6 A;  3AD9 C;  1WQF A;  4G0W A;  4C2M K;  2O5J A;  2RGR A;  2PMZ L;  4XSZ A;  2JA6 K;  2R93 A;  3S17 K;  2A69 A;  1TWC C;  4FZB A;  3S1N C;  2PA8 D;  4A3D K;  4A3F K;  1VH2 A;  1BJT A;  4YFX A;  4WJ4 A;  3VA7 A;  4BY1 K;  2EBB A;  3GTQ K;  4O2D A;  3RZO C;  4KMU A;  1TWG K;  2WB1 L;  4OIP A;  2E2H A;  2NVX C;  2ZUE A;  2GAH C;  1USO A;  4GTA A;  3HOW K;  1IQ0 A;  3GTM A;  2JA7 K;  3PO2 K;  2CW0 A;  4KAS A;  4GTE A;  3GTO A;  4A3E C;  3S14 K;  4C2M C;  1PJ6 A;  2WAQ D;  5C44 K;  1F7V A;  1XZQ B;  1Y1V K;  1JQW A;  2JA6 C;  3S17 C;  2E2I A;  2NVY C;  3HKZ L;  4A3D C;  3GIR A;  2ZUF A;  2YU9 C;  3N3Y A;  3HOX K;  3GTQ C;  1J6V A;  1R9T C;  1I3Q K;  1TWG C;  1WOP A;  1ZBS A;  3GTJ A;  1SFO K;  1PJ7 A;  3SZZ A;  3S1M K;  2NVT K;  5C4J K;  2Y0S L;  1IBA A;  1XZQ A;  2W7V A;  4A3C K;  2JA7 C;  3PO2 C;  3PO3 K;  1JOE A;  4A93 K;  3TTG A;  4A3M K;  3GTK A;  2CFA B;  3OPF A;  3S14 C;  1EQR A;  3HXA A;  1WOR A;  4A3G K;  5C44 C;  1Y1V C;  5M5W K;  3I4N K;  2V6U A;  2B63 A;  4Y7N K;  1EFW A;  1PJ5 A;  2XCO A;  4C3I K;  1ZYR A;  2JA5 K;  1Y1W C;  4A3L C;  2R7Z K;  3H0G K;  2V6S A;  3FKI C;  2KWA A;  1I3Q C;  1K83 A;  1IL2 A;  3S16 K;  1L0W A;  3LAJ A;  1I50 C;  1VRQ C;  2CFA A;  2NVQ K;  3GEI A;  3S1M C;  5IYC K;  4ILD A;  2NVT C;  4GTL A;  4XLP A;  2ZFZ A;  3GTP A;  3AH5 A;  4A3C C;  3PO3 C;  3T00 A;  4XSX A;  1O28 A;  4A93 C;  1TWH K;  1TWC A;  3GTG K;  3AD8 C;  4A3M C;  3DXJ A;  1IW7 A;  4A3G C;  3HOU K;  4P5A A;  3RZD K;  3I4N C;  4A3K C;  5IP7 K;  1HQM A;  1YNN A;  2NVX A;  3AQO A;  4Y7N C;  4BBR K;  4C3I C;  3L4J A;  2JA5 C;  2JH3 A;  2R92 A;  1XZP B;  5M3M K;  2GSN A;  3S15 K;  4Y52 K;  4BBS K;  2R7Z C;  3H0G C; 
#chains in the Genus database with same CATH homology
 1J6W A;  4XCH A;  2FQT A;  1VJE A;  1VH2 A;  5E68 A;  1YCL A;  1J98 A;  1IE0 A;  2FQO A;  1J6X A;  1JOE A;  1VGX A;  1INN A;  1J6V A;  1JVI A;  1JQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...