3AD7C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with methylthio acetate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subunit alpha of sarcosine oxidase
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad7C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad7C01
1WOSA 1WSRA 1VRQC 1WORA 3A8IA 3GEHA 3AD8C 4PAAA 5L46A 1V5VA 2GAGC 3A8KA 3GEIA 1XZQB 3TFHA 1WOOA 1PJ7A 2GAHC 3GSIA 3A8JA 3ADAC 1XZQA 1YX2A 3AD7C 3GIRA 1XZPB 3TFIA 3AD9C 3TTGA 4PABA 1PJ6A 1WSVA 4P9SA 1PJ5A 3GEEA 1WOPA 1XZPA 1VLOA 3TFJA 1X31C
chains in the Genus database with same CATH superfamily
1N6QA 3ET6B 3MPUB 2KT3A 2R7VA 3GE9A 2GO8A 3PV8A 3M9MB 2ZZMA 3FSIA 2H48B 5DGBA 1JLCA 3ENVA 1RHQB 2AIRB 3ILLA 5J2PA 1FVQA 1HNXF 2QL7B 2DPIA 1YRXA 1FRKA 4DR1J 3BGUA 3CGIA 1Y3JA 1D8YA 4LBIA 1ZM2A 3TJ9A 3IM8A 2XY5A 1SIWB 1BQNA 1XEZA 1TWCA 1X5OA 2M8DB 3H20A 4PXBA 1EB0A 2P9GA 1X9SA 2M52A 3CTRA 3KNGA 3HXMA 2GW8A 3DGVA 3K8VA 2XMMA 2XCPA 3JS9A 4BBRK 1AFIA 3RZDK 3K89A 3FBEA 2KZMA 2CNKB 2FTRA 2FJDB 1CJTA 4ZVTB 5BR8F 2JA6A 1VBYA 3KLHB 5A8KA 2V9KA 4HHHA 1G4CA 2JC0A 4BBRC 2OP5A 5DG9A 4DR2J 3OXFA 1V3SA 3RZDC 2UVWA 1Y11A 4EO6A 3DCAA 4GC6A 3RTVA 2J6TA 2BJ9A 3MM6B 2GVDB 1FWKA 5L1IA 3GFXA 2P9CA 3BR9A 1KLMA 3CJ5A 2OPPA 4WFBQ 2HHXA 1UW4A 4NLQA 1WSRA 2V0NA 3CDUA 4TKTA 1Q1KA 1VIXA 3ZFVA 3MMAA 1IBCB 3KTQA 4EFAC 1YI2S 3N0CA 1DCHA 4X4OA 3QO9A 2HBQB 2JFDA 1F3VA 4RBVA 3CULA 1JKHB 1R8BA 4OX7A 2PFFB 1HNIA 2IVMA 4YDDB 2FUG9 3C14B 1NDKA 1R3NA 2B6AA 2DHHA 2RRBA 2W7OA 2D3UA 1JWWA 2B56A 4A3LK 4OYPA 5C2CA 2RNEA 4ECWA 3NXZA 1SC3B 4FKXA 3U1LA 4ECYA 1I94J 4MKYA 4QQBA 3AODA 5CD4A 1FI4A 2ZH9A 4A3LC 3KG1A 1WEZA 3DXBA 3BO4A 4QJVB 3DYAB 3UDCA 2VUGA 2Z57B 4PABA 2QYGA 5KAKA 4XSZA 2XHCA 2VPYB 3GYGA 4Q8FA 2H5JB 3AAWB 3CJQA 4M5GA 3I5BA 1HMVB 1T94A 4IFYA 3D67A 3ZC4A 3GTMA 3DLKB 3EM1A 3ENQA 2F4VF 1RISA 4OLOA 1FKAF 2LA4A 4A3JK 3BGRB 2JA6C 3V4IB 5E41A 1IBLJ 4QWCA 4OIOA 2CPXA 4A3JC 2XCRB 1FKOA 5H9FJ 1F9NA 2IJRA 2W1BA 4Z37A 3W5XA 2AJFE 3G6YA 3C46A 1XMBA 2BM1A 2GSOA 2W4PA 3KG4A 4JV5J 1F1BB 1VI7A 4DV3J 1RHRB 3LAJA 4JI0J 1UA1A 3AXMA 4LF8J 1IJEB 1LV5A 1PSDA 1XQIA 1X31C 5TJ3A 1WQFA 1KOHA 5GAGI 2VPWB 2HK3A 1M1HA 5H1SV 2ZH7A 2BW7A 1C4AA 2UUTA 5GMEA 5ETRA 5DDRC 2CJYB 3W63A 5I3UA 2HHHJ 1TL7A 1U1LA 5LSLA 1RT1B 3DM2A 2Z0GA 4L72B 3CO0P 4CTAB 2ZH3A 5D4DA 4J5OA 5IP9C 2J0WA 4MFBA 4K50A 1BQMB 5B08A 1M90T 5E7OB 4JV2A 3PY8A 3D68A 4OIQA 5AXMA 4O44B 4C8MA 2XY7A 3PYGA 2IVYA 5KFUA 4OIPA 3AOBA 1NEEA 3UPFA 3OPKA 2CAJA 4PG4A 4EBDA 4KGXB 5FDLA 1U1KA 3KHHA 2UXCF 2QL5B 2Z4PA 4DLEA 2YNIB 3GTMK 1JXVA 4JI4F 2BE9B 4WYLA 4EZ6A 4M95A 1U26A 2C42A 2VC0A 3GLJA 2X1AA 2UUCF 3K2YA 3GTMC 4LVOP 3M2RA 1RAFB 1Q95G 2VQFF 4EI2A 4QBUA 5LL6d 1PC4A 1EFWA 1AB4A 3MEDA 4ECZA 2XGQA 1S9GA 1CS4B 2KM8B 1O5JA 4KBIA 1U2FA 4ES3A 3UCZP 4FF4A 3HKZD 3PR5B 1DRZA 3UW1A 5BXIA 1JJ2R 2VG5B 2XNRA 3SCKE 4YHHF 5T14A 4C7QA 4I2PA 1TWFA 2KT5A 3TUIC 1XNRJ 1WORA 3MAAB 3S2HK 1O2AA 2PC6A 1I50K 2WW8A 1RB0A 4BWJA 3M2VB 2UVUA 3S2HC 4PCQA 5HBMB 1H7XA 5L1LA 4JI6J 3TZWA 5DGAA 1I50C 2HNZB 5L38A 2V69A 1FESA 4F02A 2K06A 1TKXA 4ED2A 1LWXA 5C24A 1BDFA 2AU0A 1D8ZA 3GMGA 3SMZA 3RBEA 5DG7A 4Y2AA 3OHAA 3GU0A 2PSZA 3D66A 3MPYA 2CZVC 1S1UB 1HQUB 4X6AK 2IRUA 4J91A 2ZUFA 3A1YG 5IYCK 2DR5A 4X6AC 3VAJA 3KLIB 1O6XA 1Y5IB 4M5HA 1VQOS 2JJ4D 5AXLA 4F0HA 4MK9A 2HVHA 5IYCC 4KN4A 4ZN1A 3U02A 2FZKB 1HHSA 3H3VD 4YY3J 1ACMB 2RILA 4LF9F 3DLGA 2QA2A 2ZNYA 4JI5J 4CLKA 2KB2A 2VL1A 4IFVA 4NPOA 4A47A 3V6JA 1QLNA 3A8IA 1R31A 2QTWA 2AYEA 4E2FB 1TKTA 3CB4A 1VJQA 1NK7A 4TYAA 3O5TB 4JV1A 4N77A 5DLGA 1KR4A 3POTA 1KEKA 1RWWB 1WC3A 4AUKA 3N9UC 1FJGJ 2G0IA 2YX7A 4WK1A 2C3YA 3FZBA 3W8PA 1ZVUA 3W64A 2Z2LA 2BV3A 5KG5A 3HD1A 2RRAA 2I0XA 5I42B 2HG4A 1F2HA 3T9NA 1X9WA 2N4DA 3QIDA 1N36J 3C6TA 1JLGB 2HHPA 3NBPB 4DV0F 1GH8A 1K0TA 2A6OA 3SQGB 5HK4A 3MF5A 3PW5A 1NH8A 4XDDA 1FNOA 4NLWA 1SH3A 1OYDA 3Q24A 1O51A 2YH0A 1TFYA 2K2PA 2RRNA 2YKOA 3WX8A 2KL8A 1NZAA 3FC9A 2YVSA 1KWMA 3QWPA 4J37A 3RB3A 3M30A 4HACB 3OUYB 5A6PA 2IYGA 5H9EK 1FRXA 5IORA 1UAWA 5BYRA 5KFTA 3KLFA 2HQDA 1SC6A 4DDFA 5LOQA 1NPKA 1HYSA 3TQEA 3DFEA 1C1BA 2M70A 2PA8D 1HQ2A 2W9AA 1MROA 1YRTA 2IBKA 3J7AN 3PHEA 3H42A 4NLYA 3DI6B 2EFPA 2P5MA 3SZYA 4NXNJ 3FNNA 2B63A 2NS1B 1HL6A 2XCAA 1VHIA 2HRUA 2COLA 2L3MA 2PI4A 3ZZTA 1Y4ZB 1KP6A 5KFLA 4HEA9 5EUHA 2LKZA 1JVIA 4J9MA 1FVSA 2GVZB 1X4GA 1J6WA 4DV1F 4CNYA 1RACB 4K4UA 2KT2A 4K0KJ 2DIVA 5F0UA 4RBTA 4LF4J 3DU6A 3HHLA 5JVHQ 5GVQA 2A1BA 2V4JB 1VJEA 4LRAA 3I4MK 4ZIVA 5D4NA 1HPZB 3KK3A 4DJBA 5IXUA 5G0RB 1YJRA 3I4MC 4JYAJ 3Q83A 2WRMA 2IY5B 2PEBA 2Q6BA 2V8HA 2WOMA 4L76A 3CCJS 1A9NB 5HQ8A 3D1QA 4ECTA 1A6LA 3MMCA 4CLFA 2B7CB 1XR5A 2JEGA 4PRFA 3W2WB 3SIPB 3LQVA 2VU5A 5F9LA 4A8SA 2ZD1A 4F4KA 2HFUA 2UXDF 4OI4A 4AXIA 3S1TA 3RYLA 1YLXA 1WJ9A 2CJQA 3CDWA 4F3QA 2ZFZA 1IUJA 3QZ8A 4K4TA 1RTHB 1FK9B 2D41A 3M8QB 3TANA 4ZPCA 4P6QA 2B63K 1E6YA 5B0GA 4F3OA 2LLZA 1EH1A 2BYCA 5IQQA 1FFGB 2B43A 4Q8EA 1IE0A 3GJQB 3GEHA 4C6AA 2XLKA 3NMRA 2B63C 5HROA 3P5BP 2LA6A 3H8YA 3UFCX 1TUVA 3CJ3A 3W8GA 3H3VL 2NVYA 2NYIA 3D3BJ 1N88A 2OO4A 2R7WA 1T9YA 1BJTA 2AZ3A 2VONA 1Y1WA 3UO0A 1RI7A 1CJTB 2V5HG 2DISA 2MKIA 3DRYA 4DSLA 4OZ3A 1GXLA 1LXJA 2R7ZA 1B7YB 4L3NA 2Z58B 8AT1B 4ZN3A 4XO0A 1Y9OA 1LW0B 1QJHA 3N5BA 4BY7K 2O1PA 1JLAB 3GTLA 2AGOA 2OPPB 3C15A 3FBFA 4BY7C 3DRPA 5JVGQ 1S1XB 1IN0A 3GCXP 4E98A 3OPFA 3NS6A 4OINA 2ZM6J 5KFWA 1XXBA 4UQTA 2ADCA 3DDIA 3TFHA 1IKVB 3QO9B 3PRVA 4DSEA 1YNNA 4ZCLA 5EGHA 2MGZA 4P2MA 3OTDA 3MUMP 3L4BC 2OPSB 1FFWB 1HNIB 1SB6A 2FY8A 3N3YA 1IR1A 2MMYA 1ELOA 4WJ3M 4NRTA 3W5ZA 1XNQJ 5IZHA 4B02A 2PE8A 1T9TA 4XIUA 1AB8A 2HFNA 1DCOA 4EO8A 1U6FA 4LJZA 1TVRA 3HOWK 4DFMA 1Q79A 4ZCMA 3H59A 3LP0B 3TAPA 3HOWC 4C8NA 4C3LA 3KK2B 2W7PA 4X4SA 1T9VA 3MM8A 2BEFA 3M8PA 1NK4A 3HOYK 1HD1A 3AA9A 5M5XK 3A3PB 4OHZA 2HHQA 2NVYK 1S76D 3O6QA 6FDRA 1NLKL 2VG6B 4U8VA 1Y1WK 4KHPF 3T1HF 2AEFA 5GAEI 2NVYC 3VAKA 2ZOGA 2QG9B 1HLWA 4KARA 3OL6A 4MYUA 1B3TA 1Y1WC 4EK2A 1I6HK 3QMQA 1TWHA 2A68A 3D2WA 2KDOA 2R7ZK 2D74B 4ZHRB 4OX9F 1ZH5A 3JB9k 1I6HC 2GQQA 3GFZA 2R7ZC 1HWJA 1SJ3P 4XCHA 1FKOB 4A46A 1K0VA 2OMOA 4EWTA 1I3QA 2DCUB 5H9EJ 1RT6A 4ZJLA 2CADA 4R8UA 4C8ZA 1A0OB 1DHMA 3UCUP 3CCWA 5THWA 5CYMB 3FJ2A 3DMJB 5DDOC 4UF4A 1IKYB 1DTTA 5GAGU 2JLEA 1AFJA 2ZEJA 4LMZA 3H2VE 2HHVA 3LAPA 1S1VB 1IR2A 1NZ8A 3ZZOA 1RU0A 1Q8BA 3RJMB 4OIRA 4A3IK 3OVSA 1TL7B 1S1TA 4ENOA 2HZAA 3BKTA 3DM2B 4A3IC 3LP1A 4U7UK 1RBLA 1WF2A 4ERDA 4YG2A 1B0VA 2KVIA 4OZJA 3IG1A 2MJUA 2RH3A 4DX6A 3FGVA 4J9UE 3V6KA 2H5IB 4CNZA 4OFZA 3G4SS 1IL2A 2VG7B 2WAQD 4NE9C 2ZH4A 4ZMMA 2VA2A 1T7PA 2NVXK 1HQEA 3HOXK 1WELA 2KXNB 2NVXC 1NB2A 1BMQB 3I56S 3W62A 1RTJA 3HOXC 1RBAA 4QIWL 1TWHK 2OHDA 1VRUA 5A6WA 3OSNA 2KTQA 1TK5A 2V9WA 2EFVA 5F3TA 1LFPA 2VJVA 4WYWA 3HO1A 3W66A 4HT5A 1TWHC 3DLEB 1C0TB 4NI2B 4QIEA 3C16B 3D28A 4W4MA 4LIWA 5IFMA 2EW9A 4JI7F 1S9GB 4OLPA 3G6VA 1K83A 4AE5A 3M6VA 2EBEA 4G0VA 1I3QK 4PUOB 2BJ8A 2HQGA 2OSRA 3ZTPA 4ED6A 1I3QC 1KVKA 2DT9A 1BLUA 5K8MA 1K1QA 3B8HA 1RWUA 1B0PA 3D7SB 2FZGB 1FO1A 2R7TA 1V5IB 2RS2A 2NXCA 2ADBA 4TY8A 2GA7A 2DNKA 5F8JA 2I38A 4X2BA 1DQAA 1RHJB 2MSTA 3GZ7A 1TKXB 3I4HX 1Q7LB 2JL9A 3E01A 4X4NA 5GAHI 1KVIA 4HH1A 3MURP 5HMXA 2PI5A 1WHYA 4RW6B 1T3OA 4OYBA 4RR5A 1WF1A 3MEGA 1VBXA 2XULA 4B9TA 5CYJA 2RDJA 4I67A 1PYSB 3SDEA 5HLFB 1RU1A 1ZPVA 3C8YA 4KO0A 2HS4A 4ZPBA 3PM9A 2OIHA 2HBRB 5MAOA 4ICLB 1S9FA 4JI8J 1VGYA 2E1RA 1GT8A 5IOQA 3DLGB 3R6LB 2VDHA 1N5QA 4OHVA 2HBYB 2Z56B 4IFVB 3J80U 2GMHA 2YKQA 4MAKA 3HJFA 2DGUA 1UL3A 1QM9A 3EDRB 4DHVA 5IOLA 3NP5A 3UDEA 4AYBD 3PW2A 3GEIA 3FSYA 4I64A 2ZWPA 4X4VA 2CQIA 4NMXA 5LJ5Y 1WEXA 3TTGA 5CD4H 4FYXB 5CHCB 2PIIA 2I1RA 5EGEA 1B4BA 1FRLA 3PNIA 5ETTA 3AD7C 4ZA1A 3H25A 2JEJA 3DRRB 2HGNA 5M2RA 3BSAA 3F44A 5HJXA 4TXSA 3UN2A 1S10A 3OR1B 3SFUA 5KG6A 5FD1A 5HMYA 1RT3B 2CZ9A 4X64F 3N6NA 2ZC3A 3C6TB 4B08A 5FIIA 1N32J 3MCNA 3OLBA 3AA8A 1FWLA 4Q44A 1KLNA 2MKSA 1RU2A 4FXDA 2I6WA 3R8YA 2C2ZB 2VA3A 1IVZA 5AXNA 1OWXA 5KFMA 1S57A 2W9BB 4OMFG 5IM0B 4AQYJ 1JXLA 2LDYA 3TVKA 4DR4J 5D3GB 3PJXA 3MPVA 3CQZA 1NUEA 3S14K 5DQGA 4H54A 2Y1IA 3PO3K 4OI0A 1AROP 2ASJA 1KRPA 1UPMB 2MQOA 1R0AA 3T1YJ 2WVDA 1WCMA 7FD1A 1C1BB 2IC3B 3S14C 2QLBB 1XK8A 2RMLA 3PO3C 3BPDA 5J1EA 2WB1L 4OZ1A 3WODA 4BC9A 4KC5A 2AJ1A 3TI0A 4OI2A 1BD6A 4LF5F 3NAIA 3N5FA 4KHMA 1LNQA 5K5MA 3I0RA 3Q89A 4B9MA 3ISZA 2LDIA 2KWAA 3WZ0A 4P2SA 2M3DA 3BM7A 4XPCA 3EXCX 2ZUEA 2YU9A 2ROGA 1HNVA 5E2QA 3PO4A 1RWOB 4XAKA 1IBMJ 2V67A 2LFVA 3QPIA 4USUA 3KMQA 3QT7A 4ZVRB 3HHLB 1U1NA 5C25B 4GKJJ 3QJLA 1IQTA 2DD8S 4Y2KA 1U49A 4FBUA 4LQYA 4MK7A 4NOIA 2XMVA 2VFTA 1Q86T 5GMDA 3RRHA 4R25A 3CD5A 2B4PA 3D0IE 4C9DA 3PYFA 4DZ6A 1QDUB 3CQZK 3RG6A 1W26A 2L41A 3MMCB 2HWHA 2BKNA 1JXEA 4NL5A 2FGOA 3M32A 4P52A 4NXMJ 1WCMK 1XN9A 4H4MB 3CQZC 2GJ2A 2DGVA 2H1YA 3GIKA 4K8RA 3CCZA 1TV6A 1VRTA 3TJ8A 4HHJA 2ALZA 3D6FB 1S7HA 2J6UA 1WCMC 4F36A 4A3BK 3AJ1A 5GADI 2Y1JA 1JB0C 3BSNA 2KYZA 3GILA 1EK8A 4A3BC 3KJVA 3THTA 2DRDA 1KSPA 3Q0AA 2E44A 4O3RA 5HP1B 1E6VA 3R27A 1VR6A 4QWAA 2YU9K 1VQ8S 2FHMA 1Z4UA 2YQ1A 1KFSA 3P6YC 2HNDB 3IGVA 3R2DJ 2LXFA 1S97A 2E5IA 5CA5A 4GTBA 4LSZB 2YU9C 2VQEJ 1RT7A 2HPUA 1OMSA 1TKZA 4CQ1A 3BBBA 3J7A1 3OW2R 2R7RA 4D3GA 1MWZA 3PZPA 3WQPA 1ZM9A 2GGPA 4ZJQA 2FPHX 4ED4A 1HR0J 1WOSA 2UUBF 2AEJA 4ILRA 5IT4A 1UWBB 3FK4A 3A3NB 2OGUA 4MIAA 5J2NA 2ACMA 1FHTA 3BJYA 1UVJA 4LR2A 3GTOK 1O8BA 2RF2A 4B9VA 1PBUA 3KUEA 5IWAJ 3CDEA 4A3KK 4OZ2A 3GTOC 1QD1A 2RHSB 2B9XA 2DR9A 5FJ4A 2JOQA 3QRRA 3JSBA 3M8RA 1HA1A 4A3KC 3CMES 2KRBA 4P7TA 3UN5A 2GMLA 2KKHA 1RAJA 3HMJG 2F7VA 1YSJA 2EK6A 1S49A 1RT4B 2Y1RI 4GVLA 4C11A 4KB7A 1TAQA 2EEYA 4ED1A 1YRUA 4J9OA 1H98A 2VFUA 2BKPA 2JA5A 1Q8KA 3DRSA 2ROEA 1WNEA 1RAIB 2QMUB 1LWFA 1SQEA 4B3SJ 4WIIA 1T05A 1RT2A 4J3NA 2NSCA 5GAEU 4B9UA 2KG1A 4ZVPB 2RUGA 3LP2A 2HHSA 4ZOSA 4A3EK 3HOZK 4CLSA 1JLEB 3KJNB 3SZ2A 2ZBRA 4DSIA 1XBWA 4DR1F 2C2DA 1N5YA 4HHUA 2OPQB 4A3EC 3HOZC 3VVUA 4ZP7A 4FNIA 3QGHA 5KFKA 5EX0A 1SUQB 1GTEA 2DXEA 2MXYA 3HD2A 3JQJA 1J6XA 3FKIA 4LJMA 1YHQS 2FQTA 3SI8A 4GKKJ 3W7BA 4NX9A 1GTHA 5CYQB 1USMA 1RT6B 4CH0S 5DRKA 4R8UB 1KTQA 3EZ5A 1ZETA 5KFXA 3NUHA 4A8FA 1M5VC 3VGSA 4U9RA 4ZVEA 1HI9A 1UVIA 1HNZJ 1RWVB 5F41A 1F6TA 1YVFA 1NK6A 5HANA 4U6PA 1PG5B 4NA3A 2ZVIA 3CNQP 1TL3B 3MM9A 2YNFB 2ZE2A 1YJNS 2R8HA 2HAIA 1QE1A 2NVTK 3PFEA 4EBCA 4LFCJ 1ICEB 3LP1B 2F65A 4WWSA 2KFYA 4LLGA 2R2RA 2HSEB 2B8PA 2NVTC 1WG5A 1PGZA 1X5PA 2W2PP 4DQQA 1XIQA 1CULA 2C22A 1IR0A 4LSLB 3HFVA 1MN7A 2WVEA 2JA5K 1QAJA 4OZNA 3OFEA 3V81A 1G1XA 3J7YU 2WVFA 2AD9A 2ZHOA 4IH6A 4KMDA 2JA5C 5EGYA 3M6WA 2F40A 2FQQB 3IR5B 1CVJA 4USVA 1RTJB 1RCOB 2AYGA 2D9PA 1I94F 1S9EB 3LH2S 4NLVA 2QSFA 4DZDA 3H2UB 1ZQ1C 4PG5A 5CZVA 4OZLA 1NJXA 1TP7A 3JAMY 2Q66A 4JV0A 1U0HB 4ES2A 2E5HA 4FXVA 3KLEB 3QIPA 4GTCA 2VUMA 2XWXA 2DNRA 4JUZA 2MHNA 4M5IA 4KGZB 2W7AA 3FKIC 1T03A 4HTJA 2EG1A 1U8SA 3GIRA 3ZTSA 3LANA 1V3RA 2FVRA 1NPPA 2B4OA 3THVA 2F1FA 2XSJA 4WJ4A 5LT5A 3R2CJ 1TQLA 4YFXA 3LAKA 5E3AA 3BGFA 1J2VA 3R5CA 4U8YA 5GAHU 5EWEA 2FLNA 4U95A 3KHRA 3SXLA 2DH9A 1HBOB 4TVAB 4CLPA 2GZOA 3RU0A 2CJBA 3RB6A 4JV5F 1SBRA 3H7HB 3HF5A 2Q1LA 2CQDA 2H65B 2NLWA 3CT9A 1EKRA 1RAGB 5L9NA 3MEGB 3MPDA 5AXKA 2NUUG 3HVWA 2ZH2A 2HHHF 1XZQB 4DUYJ 4AFFA 1GMUA 4KO0B 2WSEC 3EDQB 1DQ9A 3DGPA 4UOHA 5TMCA 2FC8A 2V6AA 4USJC 3UN3A 3FEXB 3DN9A 4O3SA 1N33J 1RJJA 3MEEB 4NA1A 4M5JA 4MQ9A 3NL0A 1KBRA 3ILIA 4ZLPA 4RW8A 1FTCA 1RZMA 1U1PA 3N01A 2DGWA 3I4NK 2GHWA 3TX0A 5KFJA 2VBYA 2O5DA 2OD4A 4C3IK 3KHLA 3CD6S 1VH2A 1CJUB 1R8PA 1VLOA 5M5YK 2DJWA 1YIJS 4K2JA 3I4NC 3D3CJ 4MIWA 2FLPA 4KATA 4DPWA 4I7FA 4C3IC 1ZZNA 2CFAA 2YWHA 1BE4A 1SL1A 3UNYA 4A8XA 1X5SA 3OQ2A 1DD5A 2RU9A 1IKWA 2DBBA 3GCWP 3I31A 3PX6A 1OSDA 3CIZA 4LF7F 1QSSA 3IA0A 3T1AA 2I8EA 5LMUJ 3TFIA 3TZXA 1XNRF 3IM9A 3T6JA 2RU3A 2KHDA 5EX3A 1WDTA 3HFZB 4XDCA 1N34J 4XLNA 1N5VA 4NLUA 3BN4A 1UCNA 1I5OB 1SV5A 1G6BA 5HATA 2R7UA 1FDBA 4JI6F 1UFLA 3QQCD 4RWXA 5BYSA 5HVGA 1REGX 3Q8UA 4BY1K 1FT8A 3Q8YA 1V5VA 4BY1C 2YKNB 1R27B 1WDDA 4RZRA 1ZM4A 2HFSA 3I4PA 2HHUA 3CUNA 1Q81T 3W9IA 3K5PA 2P2CB 5K14A 5B7WA 4WP8A 1WHXA 2AV5A 2E5GA 5JUMA 4LFAF 1FTRA 4P10A 4P5BA 4OYZA 4YY3F 4WFYA 1CC8A 4OL8A 1KOOA 3BSCA 1SVDA 5KT6A 2E5LJ 1EP4A 4JI5F 4PYAA 3KHGA 4KV8B 1VQ6S 3DNCA 2GIQA 1JLFB 1EHWA 3GQCA 1JLBB 1CC7A 1FDNA 2GNKA 2LYVA 1YNJA 4WJBA 2BW2A 2HFZA 3DKDA 4FS1A 1KDNA 3PYDA 4Q5SA 2H51B 3E2EA 3TARA 1IM6A 5T7LA 4J9VA 1VBZA 1FJGF 2E1PA 3AH6A 2X51A 2EXUA 4ZPVR 2FIUA 2KHCA 3AXKA 2BJEA 3OLAA 1MU2A 1S99A 3HJVA 4GTEA 2F9JA 2A6EA 4CYUA 1FJ7A 4OHXA 3T6BA 2B5JB 3O3LA 4OYAA 2DY1A 2YKMA 3BP8C 3UCGA 4N8OA 1XZPA 1U0SA 3MUTP 1CJVA 1Q7YT 1FRIA 2W7VA 2MKCA 1TK8A 2D9OA 2V94A 4CO3A 2FVCA 5K8OA 5JVOA 5GADU 1NK5A 1VRTB 5E3RA 3EYZA 2BM0A 1FNXH 4X4UA 1KS2A 3Q86A 2NVQK 3CEDA 2XCQA 2MKJA 2MKKA 3ZTQA 1X9MA 1DTQB 4BC7A 1AUSL 3KJVB 2F4VJ 2NVQC 5I4MA 1JJHA 3FVYA 3K7AK 4DQSA 2U1AA 3OL7A 2HRTA 1H72C 3RZAA 3K7AC 5IYDK 1PCAA 3VALA 3IPJA 3EMTA 2M9KA 1S59A 2BABA 4BLGA 1HBUB 1TWAA 3ITHA 1T0TV 4CLWA 3FEZA 3OXGA 3MMLB 4OQJA 5IYDC 1JOEA 4MJKA 2WB4A 2JX2A 1TKZB 3DLLQ 4KJIA 4Y6IA 5F8NA 4LR8A 3FEYB 3PX0A 2WONA 4PQUA 4FP9A 3CDAA 4RU9A 1O27A 2XMAA 1PJ5A 3RB0A 2DGQA 3KK1A 4QWBA 5D0RA 1QVGR 3GTKA 1AZSA 2I5JA 4F26A 3IR6B 4A3GK 1KQ4A 1S0VA 1FXLA 4CH7A 2I9SA 2UZAA 3E8OA 4M8LA 3MD1A 1SXLA 4WP3A 4A3GC 2ZJRQ 5C3EK 4LF4F 1MWQA 1F9FA 5KG0A 3KYLA 2NCKL 2WTFA 4WFXA 4CLYA 4LREA 5C3EC 2IJNA 2V4QA 1RA6A 4B9SA 4O3OA 4KB2A 4EYIB 2FHJA 2K7KA 1ZBTA 4I6AA 4A8WA 2UXCJ 1WF0A 4DX8H 2AEMA 4N8NA 4O4GB 5M3MK 4Y2CA 2E5JA 2DH8A 4A3FK 4HYKA 2ZZNA 2QC3A 4CLUA 2X1BA 1URRA 5KFCA 1K73T 4DL7A 5KG4A 2HURA 2VJUA 4A3FC 2G2ZA 1S1WB 2MZ1A 1CJKB 3BH6B 4Y52K 2HYIB 2VH7A 2MZRA 3CCVS 3R97A 2HVEA 1YGYA 1P9YA 1LWFB 3C6UB 5F8HA 1T05B 4Q7AA 4J9LA 1TWAK 4B3OA 1IXKA 4Y52C 2JWNA 1N48A 3S1NK 2DB1A 2X1FA 1XJWB 2DXFA 3CXCR 2E7XA 4HR2A 4WKYA 1TWAC 1EETA 3S1NC 1R8AA 1IS1A 2WZ1A 4YB7A 2E29A 2E1CA 1ZAXA 1YBUA 2DO4A 4B9LA 4ZLLA 4X66J 3GTKK 4C0HA 1YITS 3QRPA 2CUYA 3EZUA 2VKRA 3HZGA 3OR2B 1HNWF 3GTKC 2RB7A 5D8HB 4RMFA 2C2KB 4G1QB 1YZ7A 3VZIA 3ZNUA 5E0OA 4E0DA 3Q8QB 4QW9A 2CPEA 1C0UB 4WZQA 4M1KA 2GFFA 3NWRA 3NGRA 3GDZA 4C8LA 2MLZA 3PACA 4H4OB 4IDKA 1DARA 3KLGB 2HGMA 3R3TA 3IRXB 3THPA 1WHVA 2ERRA 1N52B 2KZZA 3RBXA 5LM7E 2ZM6F 1TUWA 2GCFA 3EGVA 4F2RA 2Z30B 2IMOA 1RHKB 2VPZB 3ZNJ1 1OS5A 3BO3A 2AHOB 1J5OB 2RDIA 2XMTA 4DSJA 1XNQF 4B17A 1VBKA 4U7UD 3UQSA 1R0CB 3H5UA 2D3O1 3PTWA 2RE1A 4ID5A 3KG0A 3EGZA 4JI2J 2QA4S 2HMIB 3Q8RB 1VLYA 1XC9A 5L9XA 2H54B 5J2QA 4ED8A 3G4AA 2QSWA 4TQSA 4K7QA 3UWTA 3LPYA 4GVBB 2MLYA 3GONA 1QSLA 1SL2A 2C2MB 1FE4A 5E3QA 3NY0A 2BE2A 3TOQA 5F8GA 1T03B 5M2PA 3H5XA 4RO0A 3Q2TC 4I6WA 2HVIA 2YNGB 2DNPA 1VQLS 1HI1A 1NSPA 3NLCA 2XI2A 1XR6A 2DKOB 3G6ES 2MB0B 4IRDA 3DOMA 1N8RT 1G2EA 1LWEB 2RGRA 3H0GK 2G1DA 3MECB 4N76A 3CW2C 1TL5A 3RBDA 1HBMB 2IJFA 1J5EF 1GX5A 3H0GC 4OZ5A 4ER8A 1NK9A 1RTDB 1U4BA 4M1XA 4Z7YA 5HSPA 1CBKA 3O1LA 4L6V3 3PW4A 4GTLA 3FCHA 4V19J 4QWEA 3NAHA 2F63A 4YUDA 5TMFA 5G4DA 4GFQA 4C0OC 2B51A 2EC0A 1TR0A 2C28A 4P2XA 1EI6A 4NZ0A 3ZZZA 1REVA 2PHCB 3J7Z5 4X4QA 1Q78A 1QY7A 1KONA 3LPEA 2JZ5A 1UW9A 1WHWA 1BXNA 1Y5LB 4KIAA 2DNQA 4FPRA 1D9AA 1RKIA 2AT1B 4Q2MA 2ZNZA 1B7FA 2VFSA 1IWGA 1VK3A 1HWUA 3VVTA 2CG4A 1VJWA 1XTZA 1HI8A 3PKYA 2MJNA 3ULHA 2R8JA 4V19X 2GAGC 2GSNA 2Y1LB 2ZBPA 3MWBA 3MI7X 3SZZA 2HLUA 1NDLA 3PW0A 5T41A 6FD1A 2AJ0A 4B9NA 1L3TA 3EZOA 2CQPA 3KFWX 2DXDA 4RNOA 4I7FB 3I0SA 2GQ2A 3DOKB 4A8OA 3PRBA 5DZ7A 5IYBK 2DH7A 3IWLA 4ZVSB 4RPFA 2QMXA 3DOLB 3EUNA 1SPBP 3RW7A 5IYBC 2MHEA 3M7VA 3IN5A 1UMJA 3BKUA 5LJ3Y 2F4FA 3KJQB 1MMNA 1H2UX 5K20B 3RZOK 3D54A 2J9DE 1MLAA 1RWKB 5AE2A 1DLOB 3NS7B 3RZOC 4CCHA 4H4KA 1O2BA 4LBPA 2UXDJ 4CLZA 1UPPA 2VF3A 1FJCA 2R4FA 4CO1A 2G0JA 1VMBA 2RD5C 4DWIA 1U48A 1H2VZ 1U09A 2VZ9A 1EX8A 4D3HA 2RHQB 2PMZL 1RHMB 1U25A 2J5AA 1YKWA 4DG1B 4WXWA 1RTIB 4KY3A 4QIFA 1C1CA 4YS2A 2CPZA 3MCMA 4N5SA 1OSCA 3MMBA 1DAXA 3ICLA 2P9EA 4DU7A 1FJEB 3BP3A 1CEZA 3S7RA 4C8YA 2N7CA 2VFRA 3M4XA 4DCJB 1NSQA 1Z2LA 4ALZA 2HFVA 3TZYA 1YZ6A 3MM7B 3KLVA 2AGPA 3LAMA 3W60A 2E1MC 1DURA 3OTOF 4Q0BA 4HKQA 2BBEA 3V6DA 4KMAA 4YFKA 4A3MK 2M0GB 3D1OA 4FYYB 1WI6A 4N47A 4WU2A 3M8SA 3BQ2A 1R6YA 3M2UB 1M5OC 4FNHA 1KFDA 4A3MC 4DN9A 1RT5A 2CJAA 2ZFHA 4U7CA 3T00A 1IQZA 4AXJA 3S8SA 3G82A 3BQ0A 1N4LA 5B0AA 3RUBL 3WIUA 4RW4A 5F8IA 4QCLA 3Q23A 4UZBA 1VQPS 4W90B 1I50A 4I69A 2DITA 2DR7A 4DF4A 3P3DA 3OHBA 1X4EA 4H4KC 1VDHA 3HSZA 3GIIA 4CYUB 2FB0A 3RR8A 4JI1J 2E9RX 3WBZA 3RR7A 3OXLA 2DNLA 1NBEB 1WI8A 4PEOA 4KFBB 1Y5NB 4DUZJ 1N32F 2W9CA 1HBNB 1M1GA 3PEJA 4A3DK 1F60B 4B3TJ 1FKPB 1KQKA 4ELUA 1S12A 3I96A 1I51B 3M9NB 2JA7A 5KTQA 3VAHA 3TAMA 4A3DC 3ET6A 1RXOB 1Q53A 2AGQA 2YX1A 3T5LA 2CWXA 3T1HJ 1ZA2B 4Z2XA 3UR0A 3IGNA 2LQ5A 2CPIA 4DR4F 1FDAA 2HVDA 4PQAA 1VGXA 1TMMA 1YJTA 5CH7B 4GMKA 1I1GA 4OHWA 3A8JA 3CCTA 1D9FA 3ZZRA 2PD1A 3FBCA 3T1YF 1S77D 3TFJA 2GO9A 3HULA 3M1VB 3QX3A 4G1IA 4FVCA 2HRYA 4E8UA 3HX9A 1D9DA 3OVBA 4O4RA 5M3FK 1WC4A 2KI2A 1XMQJ 5J2MA 1NJWA 3ITHB 1P27B 1Y1VA 5C42B 3IBCB 4FS2A 3KLHA 2Z2ZA 1H6KX 3MR2A 4RU2A 4WK3A 2MQNA 2MPUA 4UOCA 2XWYA 1APSA 1GAOA 1OPIA 2B7BB 2Y3YA 4DX5A 3P8BB 2GVDA 5A8WB 1R9TA 2ZDOA 1TK0A 4PWDA 1LW2B 3CSKA 3RAMA 1HIYA 3D4JA 3BF4A 2IAJA 2NUHA 3K58A 3T01A 5F8MA 2IPOB 1ZAWA 3GPAA 2C2OB 2MQLA 1ZPWX 1IBMF 1WC5A 4KE5A 4DR6J 4X65J 3CMAS 2HVZA 4WKRA 2JA7K 5HL8A 4P74A 4BHQA 2DCLA 3W61A 3UD5A 4ZKAA 2MZQA 3C14A 3GV8B 2V6SA 4GKJF 2XZWA 2G1HA 4YEAA 3EX7B 4EEYA 1ISEA 1X4BA 2JA7C 3L09A 2X3DA 2HHWA 1PKUA 2LCWA 4ZVFA 5KT4A 1WEYA 1ZBSA 1FD8A 1KHVA 1G51A 3V4GA 5A8RB 3HVTB 1S79A 3VQSA 4ECVA 1NO8A 1RUSA 2CPHA 3LWLA 1RP5A 2RH6A 3DYAA 2QLFB 1I3OB 4DQIA 1JQWA 4X84A 2YWFA 4JI7J 4ZVOB 2WK4A 2XMWA 2DK2A 1BGXT 4EZ9A 1HMVA 1Y1VK 5CJ9A 2EFGA 1TU0B 1S6PB 3ENAA 2CFXA 4A8YA 3BSOA 1B64A 3GJSB 3DLKA 2ZH1A 3LF0A 3BYRA 1F9EB 1YJWS 2ZJQQ 1Y1VC 1BWEA 1IWAA 3TX8A 1Q82T 1F2GA 3BGRA 2V8PA 1NPRA 1JNRB 4DXLA 2V4RA 1VQ5S 1R9TK 3OJUA 2CVIA 1Q5YA 4TN2A 1SC4B 3HFKA 3KWMA 4DUTA 4IQMA 1R9TC 2CDRB 2EVZA 1ZYRA 2OD6A 5CHPA 4KM9A 2VPXB 4QIVA 2IRXA 1F5BA 2FZCB 4ETXA 4C3KA 4NCGB 2HQFA 3F41A 3R5DA 3US5A 3BS9A 2YPZA 4PPDA 4W98A 4WCEQ 3JAMU 1WQHA 1D1UA 4K4VA 3FQLA 3AOCA 3SCJE 3OFFA 2XBPA 1RT1A 2RAQA 4CTAA 3OBIA 3QJPA 3TZZA 3IRWP 1UZDA 2VFVA 2A0FB 4KYZA 2WW4A 4EYHB 1VISA 1BQMA 3VZHA 4R5PB 3J81Y 4C3JK 3HLUA 3AQOA 3KDNA 4DV5F 3L4JA 5IWAF 3AD8C 4O44A 2M2BA 2ZH6A 2QN6B 4UY85 4BWMA 2PDAA 1F5AA 1SKUB 3BDPA 4C3JC 3GTGA 4NMLA 4AL5A 4QYZK 1WSVA 4YB5A 3MCSA 2H5EA 4OYOA 2NXJA 4LFBF 5DO2A 4ID5B 2RKIA 3MR7A 3QATA 3PYEA 4NCAA 2ILZA 1M1KT 3WC2A 2X7IA 2IA0A 4HDGA 1TMJA 1ULRA 3CC7S 2DGOA 2V2VA 5JMNA 5KFBA 4ECQA 4G6VB 1CQMA 3HSGA 2FYXA 4ANEA 4RUCA 4JI3J 2HKEA 3JYTB 3I5CA 1CS4A 2K3KA 3OTBA 4B3SF 2DNNA 2PT0A 2BXJA 2BJDA 1S72S 1PAEX 3AT1B 1SCJB 1CQNA 2VG5A 5C5JA 4DI6A 1UVNA 3MAAA 2JHEA 1S4FA 1O25A 5CCLA 3HKZL 3CAGA 5HBMA 2BJ7A 1R0BG 1S6QB 2ZITA 4YN3B 2HNZA 3AB4B 3G4CA 3KKFA 2UP1A 1X4FA 3B4MA 3H5SA 5A0YB 2HIYA 1HNZF 1S1UA 2AJ2A 1BWVA 2C1EB 3E3XA 1HQUA 4KHRA 5DG8A 2W2OP 2EG2A 5AE3A 1RA7A 2IBOA 3GTGK 4Z7CA 1AUDA 4GT9A 4RW9B 2XI3A 1N6QB 2E7VA 1BS2A 3KLIA 2XSFA 3ZZPA 5HMZA 4N7TA 4YFNA 2HAFA 3M6XA 4LFCF 3GTGC 4YOEA 2VICA 4P2FA 4KGMA 1JLCB 5J2PB 4JB8B 2QJ3A 4UTGA 3UNGC 4LF6F 2D3ZA 3RBZA 3Q8VA 4DV7F 3GTQA 4RLEA 4GTAA 1M0SA 4KB4A 1SJRA 1BQNB 1MN9A 3C2PA 3G9CA 1IBKJ 1FXRA 3AOAA 3ILJA 2WVBA 2CNNB 5L39A 4FF2A 2NXUA 2PN6A 4CP5A 3HT3A 4TYBA 2KM8C 1UETA 4MT1A 2KFZA 4LRFA 5KT2A 4KPYA 2QO3A 1VQSA 3K0JA 5A8KB 5E5NA 1V3ZA 3FDSA 3GTJA 2OI2A 1BQXA 3TAQA 3NNAA 3Q2SC 1JLQA 3BEGB 1O2FB 5I42A 1KLMB 2DY9A 1MG7A 2LECA 1QSYA 2H4YB 1K9MT 4J9SA 1BHNA 3C19A 2YPYA 1RK8A 5JXSA 1H7WA 3HCXA 2ASDA 2FY1A 3OFHA 1RAOA 3LW5C 4F04B 1JLGA 3VGTA 2VBZA 3MMAB 1PO6A 3EQLA 3SQGA 2DTJA 1X0PA 3B4DA 4M5LA 4A4JA 2FHOB 1HD0A 4PG6A 4O23A 4RBUA 5D6GA 2GX8A 4LOWA 4CWBA 4TU7A 3EVOA 4NLRA 4ELTA 2B6AB 2ZHBA 3A8KA 4C0BA 1Z1ZA 1VQMS 4OX6A 3K59A 4OV6A 5BYQA 1U47A 4HACA 3OUYA 2VBXA 3D0HE 2CG8A 1B4SA 1PBAA 4ITSA 3GTQK 4LBHA 4IRKA 1WACA 3I32A 4B3RF 1WUUA 1RHUB 1J6VA 2R42A 4NASA 1YCLA 4Y28C 3GTYX 5GMKa 3OEPA 3GTQC 1JX4A 2NVXA 1VC5A 4I68A 1FCAA 3SSRA 3HOYC 4DUYF 2E66A 1JJCB 4IFYB 2D6FC 3LOUA 1H74A 3DI6A 3MGJA 4KC6A 5D4LA 3ZO7A 2LQBA 1I6VA 4PZVA 2PA8L 4GO5X 4LRCA 2VV5A 3T3FA 3GTJK 1UV7A 1KD1T 3L7PA 1N33F 1UFKA 2EBBA 3QGPA 1H73A 2CQ0A 3R5AA 2NR0A 4NLDA 1PJ7A 4KKOA 3GTJC 3W3SA 1SH2A 2R92A 5EWFA 2GVZA 2N3OA 2LMIA 4WBFA 4URGA 3QT6A 3ISNC 1N0UA 2GS8A 2OKQA 1T3NA 3VAIA 4DV2F 4RW4B 4F0KA 1PC5A 4YP3A 2V4JA 3EXYA 2MDAA 1HPZA 1X5TA 5I3UB 4QYZJ 3RW6A 2NYHA 3M8WA 1Q8LA 2ATLA 1G3OA 5DQIA 3MR6A 2PA3A 3SYZA 3H98A 1W2BR 3GSDA 1NU4A 4MFBB 3Q22A 3NEKA 1HW9A 4G0WA 2ZDPA 3B78A 2CW0A 5LMUF 4C48A 2XGPA 2HQIA 1TKDA 3DXSX 1FEHA 3W65A 1KTVA 1TWGA 3H0PA 3W2WA 3ENWA 1N34F 4BS2A 1WTFA 1PYTA 3D6TB 3JTPA 1T95A 3P45B 2JVRA 1VFJA 1RWXB 1YBTA 1WG1A 3J7YI 1NJIT 2V50A 1GEHA 5FDLB 3OD2A 3Q8PB 1RTHA 4TNOA 3SV3A 2R8KA 1FK9A 3M8QA 3J7ZT 3MFHA 3NRBA 2AX0A 5KT5A 3N79A 2W25A 1UTAA 4FKYA 5KFNA 5I3QA 4TLQA 1XPPA 3F56A 3K5LA 4DEZA 3M2RB 3QT8A 1X60A 2XTJP 2VOOA 5AJ3F 3MEDB 4IR9A 5CAAA 4AL6A 2R92K 1NAQA 1LXNA 3D5MA 2V6TA 4C8KA 2YWWA 5J2MB 3OSPA 2AYBA 3A8EA 2R92C 3QAEA 2G13A 4I2PB 2D3OR 3V2UC 3CJ2A 2H3EB 1JK9B 7AT1B 2E5LF 5E3PA 1WC0A 4PXCA 1LW0A 2BE7D 1QUPA 2DO0A 4PWDB 2JA8K 5M5WK 1W25A 1JLAA 3LUYA 1NK8A 1NJYA 1SC1B 2CQBA 5CXTA 2XY6A 2IAJB 4PXEA 3R1LA 2JA8C 2XG8A 1DY3A 1S1XA 5C24B 4UW2A 2FJEB 4PYDA 3TYTA 1SQGA 3S01A 1IKVA 1GMVA 4FM9A 2BANA 2KXHA 1TWGK 2BOPA 1JNZB 2OPSA 2B8QA 4OIXA 3QFWA 1Y3KA 3QLHA 1TWGC 1MMLA 5C4XK 3AJ2A 1LOUA 3UD3P 3W5YA 4OHYA 2Z2YB 1YTYA 2LEAA 5C4XC 4RWWA 2CKWA 3LP0A 4WFAQ 1VHFA 4K59A 1L0WA 3KK2A 3ERED 3BGLA 1NM2A 3CCRS 1UKUA 4TU9A 1L3UA 3M6UA 4DR5J 1NXIA 2BKOA 1TWCK 1RLDA 2JSXA 2L9NA 4LK1A 4NYPA 3I6PA 3MEKA 4B3MF 2QLWA 1YBAA 1N5TA 1VRQC 2KRRA 4ZK7M 1RWMB 2EKNA 2EFNA 1TKTB 2L48A 2VG6A 4YR2A 1TWCC 2QX0A 3ILOA 3A12A 4LRDA 3TEHB 4YFUA 5RUBA 5C4JK 4P9SA 3POTB 1RSCA 4RW7A 4ECUA 2JA6K 1URNA 2XCOA 1NSAA 2XMKA 5E68A 4ZS6A 5C4JC 4ZHRA 4Y2IA 2G2OA 3SSQA 2J7WA 5KFRA 4PG8A 4I0WA 2HIQA 1XMOF 3L7UA 4J7CA 2QL9B 2BE5A 5CABA 2R2SA 2MKHA 4DMZA 5CYMA 3DMJA 1SJFA 3I82A 1IKYA 3ZZUA 2A6HA 3MMJA 4IG3A 2AF6A 2ROPA 1S1VA 4KAIA 3W9JA 1VOMA 4AD6A 5J1NA 2W2NP 5D78A 2O01C 4ZVGA 1KQFB 1PAUB 4WFZA 4K4ZA 5IP9K 4WU3A 1U6BA 2C3PA 5EWGA 4DF8A 3G8SA 1N5SA 4DV4J 2PEHA 3M30B 3MR3A 1GXTA 3TUJC 3R5JB 2HS3A 2V8DA 2OJ3A 3KLFB 4MYTA 4C2MA 5KFAA 3MAHA 3IR7B 3I55S 1HYSB 3AHPA 2K8GA 2C3MA 3N4WA 4M63A 4ED3A 4OV1A 2VG7A 3IFEA 5B0DA 1WIHA 2FHJD 1Y10A 3FMWA 3SCLE 5HVFA 1WKKA 1MROB 2HNYA 3JSTA 3FCWA 4ZP6A 1OIAA 4J9RA 2RKIB 2CJKA 2DR6A 2WAQL 4UOFA 4DL5A 4DV6J 3HSDA 2BX6A 4G7OA 3CO9A 3DLEA 1C0TA 4NI2A 3QNWB 1A7GE 2O5IA 3C16A 4AL7A 2QEXS 3MAQA 1TTHB 4V1Ak 1T11A 2W8LA 4CM2A 2DEJA 2R7XA 1QTNB 4PUOA 2WVCA 2W01A 2F8HA 3IWNC 5C7PA 4LF7J 5DJBA 3KOAA 1OQ6A 1SJ1A 2UUAJ 4IG0A 3P5TL 3OT9A 1YQHA 2ZBCA 2JEFA 5DM7Q 4DDQA 2F9DA 2V2KA 3T5JA 4I6YA 4J9KA 2GJFA 3KK3B 3G86A 2KJWA 2YKAA 4LUBA 3QRQA 1UJ5A 3PVXA 5FJ8K 4Y0FA 4X66F 1O28A 4ANCA 2A18A 3H2LA 3I9ZA 1H0HB 2WOMB 4DQRA 5KFZA 5F0WA 3FFIA 2XMJA 3PIPQ 1U1RA 4YR0A 3GTOA 4C2MK 3DXJA 5SUHA 4RW6A 1ZTTA 4DL4A 1U1MA 1B0TA 5D15A 2POKA 4C2MC 5EHHA 2J0XA 4UZCA 1WOOA 2ZKUA 2ZD1B 5IT9Y 2ZHAA 2CQGA 1YX2A 2DHAA 5HLFA 1FFSB 2FVSA 1DBDA 4R0JA 4J9QA 3EPIA 1HARA 4ICLA 4ELVA 3QT5A 4LFAJ 5IV4A 2HZCA 4JK1A 5IC4B 2AMCB 1E6YB 1XWLA 3HSJA 4KMUA 2V6UA 4DFPA 3SV4A 3VF0B 4CO5A 4YB1P 4C3HK 4F4XA 2WSFC 5HROB 1P6TA 4U67Q 3V6HA 2MQMA 1FRMA 5D0GA 4DN0A 2CJXB 4C3HC 3NGDA 1EQMA 3HXAA 3VWSA 1AT1B 2YKPA 3NNCA 1PIEA 5LMNF 5KG3A 2UU9F 2XEXA 1NH7A 3OREA 5KFOA 3MTKA 4JI2F 1TWFK 2MY7A 2BVZA 5DDPC 5AE1A 2AKWB 2ZC4A 4CDIA 4I1TA 1U8WA 3AQPA 4ZPAA 5D4PA 4AYBL 4DR7F 2EBGA 1TWFC 1L3VA 1JLQB 4DL2A 4FBTA 4NCBA 3DRRA 1NCLA 3CPWR 1KQGB 5ITHA 1C0AA 3PX4A 2GHPA 2AZ1A 3OR1A 4OJHA 5HL7Q 3C15B 1FE0A 4IOCQ 2DNGA 3DRPB 1T9UA 1RT3A 4LQ3A 1LKZA 5IP7K 2CQHA 1OY6A 1PYOB 4Y34A 2ZJPQ 2WBMA 2HS0A 4EMDA 3CJ4A 1RAAB 2MGZB 5IP7C 1RAHB 2FD2A 3VR1A 3G8QA 1J27A 2FJWA 4O3PA 1FA0A 5ETSA 4P72A 2G2YA 1WTBA 2MLXA 4KDDA 3IMQJ 1WKJA 2NSBA 1R8HA 2W9BA 2O67A 1UEUA 1TVRB 4LF2A 5IM0A 2R93A 2QZ8A 1DJ0A 4CT9A 2E2HA 4DR3J 3F73A 4USHA 4GTDA 5D3GA 2UV8G 4USMA 3TVYA 1HKAA 2KFNA 3BPSP 4OI3A 1ZS6A 2HGLA 3MM8B 3VAFA 3M8PB 1F3FA 3MCOA 1IKXA 2IC3A 2NREA 3M05A 4UY8T 3LGHA 3LGMA 1W7WA 1MW7A 3DDNA 3B82A 4LR9A 3GJRB 5ETKA 4IRCA 3S0XA 3L4KA 3CCQS 1INNA 3CMQA 3GFYA 4N56A 2XLIA 4NLSA 5B0BA 4PR6A 1OPZA 2YWEA 4LRBA 3D9BA 4OYIA 4IOAQ 4PG7A 3HOUK 2RQMA 2KN4A 4ANDA 4IO1A 3BGOP 2W2QP 3S2DK 2P8TA 4M5KA 2IM0A 1GE9A 2R3VA 3M8YA 4Y2MA 4KKOB 4WXOA 3HOUC 2ILYA 1RADB 5KFSA 3S2DC 5IV3A 3N28A 1B4AA 1EQ0A 2MQPA 2ASLA 3BB5A 5IT0A 3TW0A 5KFHA 1RDRA 4Y7NK 2B9YA 3UE2A 5F8LA 3BBFA 4DOZA 1DTTB 3IAS9 2R9LA 4DR2F 3VA7A 1X4CA 4Y7NC 5C25A 3U7JA 3GIJA 1AA1B 3EVWA 4MK8A 1Q8IA 2APOA 2VBWA 1S1TB 2R93K 4RNHA 3TQ1A 3VGVA 2E2HK 1SJ4P 4F4WA 3U1MA 2NXNA 4Q43A 3BN7A 5KG7A 2CYYA 4MKAA 2R93C 3CJRA 3IG1B 2E2HC 3BV8A 5M2UA 3N6LA 4H4MA 1U1OA 1WC1A 4QIWD 3D1HA 3VTIA 1KNZA 2UV8A 4DS5A 2XZTB 1HQEB 4HH0A 3K17A 2J0QD 2AP6A 2CNOB 2QLJB 4NA2A 4BDPA 1NB7A 3ONQA 1YJUA 2AX1A 4OYXA 4X62J 2QV6A 2FLLA 1VRUB 4ECSA 4ID8A 4O0NA 4IO9Q 5KOWA 4PAAA 5L46A 4DX7A 3GG0A 4A8KA 5HP1A 2WSCC 3K5OA 2KVQE 3NGKA 4KGVB 3QJJA 3ETMA 4CO2A 3PHTA 4OX8A 3DDKA 2UXBJ 2HNDA 3OJSA 5IC6B 2RQ4A 3IWXA 3N0VA 2MY8A 1HNWJ 1NKEA 2CPDA 1RYSA 2ZUGA 1B99A 4PWUA 1GNKA 5K9FA 2P8IA 3AD9C 3T02A 4J90A 2QLXA 3VHQA 3TEGA 2ZOFA 1RWNB 4Y3CA 3PIOQ 1OY8A 4DFJA 4NLXA 1IBLF 2LQJA 1FDDA 3HHLC 5B0FA 4TY8B 3VV2B 1X4AA 1KHWA 1UWBA 4K5RA 3JSYA 3R9LA 5HQMA 1X4DA 2AQ4A 3E01B 1KKHA 5FLMK 1VK8A 5DLFA 4HDHA 4DCOB 2HK2A 2AYMA 2MYFA 4WZMA 2ZBQA 3NCRA 2D69A 2H4WB 4DV3F 4JI0F 2OMLA 3WIVA 2BANB 5FLMC 4LF8F 3LPXA 4N41A 1IM4A 3WC0A 2BUNA 3O44A 4DL0C 4CI0B 1D0EA 3L7OA 1L3SA 1EIYB 1TUGB 5ETVA 3QLHB 3H4DA 4HTIA 3PO5A 3SDEB 4AT1B 2DEIA 2KH9A 3MOJB 4JP8A 3TUPA 5DDQC 2IYIA 4TY9A 4JI1F 3G2XA 3GEEA 1RT4A 4ZVQB 2L08A 4O2DA 4DUZF 2LQ9A 5SZTA 3HDSA 4B3TF 4FPIA 5A2QY 2DR8A 4RL1A 2QA4G 2YNHA 3MOZA 2GIFA 2AJ4A 2JDJA 5IOTA 2JFKA 3QSIA 3NGTA 2FJXA 4RW7B 1JLEA 5HO4A 3DLHA 1R7IA 3EVMA 2A6MA 3PKMA 3J81U 2VB6A 1SJQA 3L9ZA 2OPQA 4USWA 5ETLA 3OVAA 4PPZA 2OFHX 1SUQA 5HAOA 2N4CA 3D6MB 3TUZC 2QFIA 3GTLK 5LSRA 1J5EJ 1MSWD 3BREA 5A76A 5CYQA 1XMQF 3GTLC 1NMEB 4WE1A 3MR5A 4DSKA 4A3CK 3T9ZA 2R8IA 1HHQA 4QU6A 1SMYA 1DQ8A 4NEYA 4IG3B 3VQTA 4EUVA 3CJKA 2OLWA 3G96A 5BJRA 4DQPA 4F8RA 3LA0A 1GFWB 3OL8A 1ZAVA 4A3CC 1WKLA 4TU8A 1O24A 1TL3A 3G6XA 2YNFA 1OO0B 1TL1A 3GIMA 3KXDA 2CPYA 1SL0A 4MEYA 4OJ3A 2MZJA 3VAMA 4Q45A 4EGLA 3T41A 1U6ZA 4DCPB 1V6HA 5KG1A 3HVAA 3GV5B 1HNXJ 4G3IA 2WB1D 3FQKA 2W24A 4DR6F 4X65F 4KRWA 1UVKA 4LSLA 2EC2A 4DPYA 2MTLA 1R0AB 5KFEA 3TVZA 4F4ZA 2P6TA 3BKFA 1S0OA 3AFGA 3D0GE 4JOUA 2HNYB 4CIOA 3CCSS 5J1EB 2W8KA 2GAHC 2OELA 1ZYQA 1BY9A 1UP1A 3SFGA 2VC1A 2LEBA 1QAIA 3MZIA 2XYHB 2KYXA 5KG2A 4C97A 3NWGA 5BR8J 4NLGA 2BDPA 1BGWA 3I0RB 5KT7A 1S9EA 1WC6A 3R5GA 3GJTB 4F67A 5HJYA 3MM5A 4GTFA 2DVIA 2R2UA 1U0HA 2IHR1 3KLEA 3L95X 1HNVB 3R5BA 4FF3A 1UVMA 1EZZB 3S1RK 2J8SA 3NMAA 4S0MA 1ROFA 4IG0B 4LVNP 5AT1B 4MEXA 1P1TA 2FVPA 1Q16B 3GWCA 5HMWA 2N3LA 3S1RC 1S4EA 2CVEA 1RTZA 4BBYA 1OYEA 2YBVA 3CVKA 3Q8SB 4ZPTR 2DHSA 3KUHA 4OYWA 2HHTA 4UOGA 2OAUA 1YK9A 1SKWA 1X0FA 5ETOA 5D77A 2EFQA 1OQ3A 2MZTA 1YJVA 1HBOA 3TJAA 4W92B 2QRRA 3FFIB 1N36F 1JIHA 4CO0A 3CIMA 5LSOA 4ZCKA 2XS7A 2Y0SD 3C66A 1C4CA 3DHXA 2IM2A 3HZEA 2O66A 2B9WA 3GR1A 3M9OB 3M32B 4CM0A 3PEHA 2J8AA 2BJ3A 3NCPA 1IW7A 1SIZA 4M5MA 1VCTA 3TA0A 3WX4A 2ZOMA 4DFKA 4YDXA 3R6GB 2J9DA 4P75A 4GRSA 1TV6B 2HQ3A 5CQGA 1XZQA 5ETPA 1KC8T 5IQ6A 2GC8A 1Q0NA 1F0XA 3TWZA 3UVJA 1VQ4S 1WQGA 4DLGA 3CJ0A 3K5NA 4ATNA 1SH0A 3PG9A 2C2EA 1QUVA 4C98A 4DU8A 2DRBA 4C3MA 2GMJA 3OTOJ 2PMWA 1FRJA 2J76E 1F9HA 2J0SD 3RRKA 2DPJA 4DL3A 3GYXB 3MEEA 2R7OA 4LQ9A 2CJ9A 4A8MP 3JSRA 1E6VB 2FJVA 1F7UA 3SBMA 3UI3A 1H2TZ 4ZVUB 1K83K 1D09B 1HWKA 3DLJA 1QVFR 3GSIA 4G7HA 4K4YA 4RJVA 4O0IA 1K83C 1F7VA 1YJ9S 1RT7B 1FRHA 1FX2A 4NLOA 4LIRA 4NXNF 5HN0A 1CJUA 4XSXA 2F8EX 1K8AT 2IDLA 3FUYA 1BC6A 4HT7A 1NKBA 2GGPB 3HP6A 4CO4A 4M5DA 1U45A 4URSA 3DU5A 4L74A 2YQ3A 3FZ2A 4JI3F 4BLBA 3KNAA 4Q4ZA 3JSMA 3H4BA 2VODA 4RNNA 2G0CA 5HQLA 1Q4RA 1KQSR 3SSSA 5J2NB 2PMHA 4I2QA 5ETQA 2RF2B 4K0KF 1U2RA 3EGNA 3PJWA 4IR1A 2B0GA 4NLTA 1GMWD 4RNFA 2DRAA 1WWHA 1HW8A 1X7VA 4QOTA 1F93A 2M5YA 2GQCA 1U24A 4CT8A 1Y00A 4JYAF 2YWGA 3BH7B 4FYWB 1O29A 4ZPWR 3CD7A 3NG8A 2QMWA 3CF5Q 2FLOA 3TO8A 4ZLJA 3SCIE 4ECXA 4JI4J 2J7UA 4WTOB 1TAUA 4UQGA 1NSKL 4FN5A 2YKNA 3GTPA 1I6JA 2UUCJ 4JBCA 4C11B 3IC1A 4R0EA 2Q43A 2VQFJ 1IKXB 2BZ2A 3DRSB 2HQCA 4QR2A 2DNHA 1YWXA 2LU1A 3G8TA 2XS2A 1RT2B 2B4VA 3LP2B 4MMOA 1B70B 4NYZA 1RYRA 4YHHJ 1HWLA 2DNYA 4G65A 1UVLA 3PXGa 4A8QA 1FEEA 2JH3A 4PWWA 3IBFB 3HM9A 1N5YB 4KTQA 2XS5A 2GHVC 2FC9A 1VQKS 1N0VC 3CCUS 4ECRA 3IO1A 4KV8A 5FLXU 1H3DA 1JLFA 1ZOTA 1JLBA 3PRDA 3EWGA 2XB2D 1IBKF 2DNZA 2DHGA 2QGFB 4NLPA 3FRZA 4IKAA 1LWCA 2MKYA 5KFGA 2HWIA 2HFOA 1UJ6A 3LO3A 1MWYA 4G0UA 5HI7A 3CCES 4KASA 4HLBA 1NDCA 3RAXA 5DZ6A 2Z2MA 3H0GA 2M7SA 3MM9B 4RKUC 2ZE2B 3RB4A 4KM8A 3ISND 4RUHA 3UDLA 1IJFB 1QE1B 2ALYB 3QAUA 5JJBA 3ETOA 2A3JA 4KMHA 4LR7A 1NRKA 3CD0A 1VIOA 2B5JA 2O3DA 4ETZA 4DPOA 2U2FA 4LF9J 3CC4S 4F4YA 3GTPK 3BQ1A 1CULB 2A2CA 4BLAA 2R7QA 5KFVA 3T5HA 3FOFA 2ABYA 2HBZB 1VQYA 2CPFA 1NHKL 3GTPC 3V81B 1F5CA 4NOHA 2LEPA 1HQMA 4G7ZA 3QBCA 1UA0A 1CPZA 1GK8A 3K5MA 3BDEA 1GXUA 4ZP9A 1S6UA 2Y0SL 2QE5A 1T8EA 2W2MP 2AJQA 1DTQA 4KPCA 1XXAA 4P7VA 4WFNQ 3JTNA 2VKZG 4GC7A 3JXOA 4OJGA 2NPIA 1XR7A 2QFJA 2V8GA 2IM3A 2PFDA 1TFWA 4I4BA 1YG0A 4F0MA 2BJ1A 4M5NA 3QIPB 5CZXA 2XO7A 3ZTRA 2AWZA 4ILMA 1HBUA 4ZPDA 4DV0J 1JMTA 2EI5A 2XO6A 2CQ3A 1S5ZA 2NZ4A 4CH1A 4OYMA 5C2GA 3V4MA 2XSJB 2D1CA 2CWKA 4PXDA 4LSNA 4KN7A 1UZHA 3S15K 1HFEL 3HOVK 2CPJA 2XM3A 1AXQA 2MZSA 4EBEA 3C3LA 1DZ5A 5KFDA 3S15C 4Y65A 3HOVC 4IUFA 1X8DA 2NZCA 3UDVA 4TLRA 3IXQA 4QWDA 4WILA 4DV5J 4TQRA 5CCMA 2N7YA 4C45A 1G7CB 4BBSK 4KAWX 3GYNA 2EFOA 2Q6CA 1ZXOA 3EGWB 1JJ4A 8ATCB 3OFGA 1XERA 2CQCA 4BBSC 4Q2LA 1NHUA 4LFBJ 3DGPB 1VS3A 1NKCA 2C2NA 4O4GA 4FVMA 2E1AA 2UVVA 3IBWA 5L1JA 3E51A 5KFPA 3KJFB 4Y00A 3UD4P 3MUVP 1WD6A 2ZUAA 4GO7X 1S1WA 1CJKA 4RW8B 4U96A 2YNHB 2F3JA 2XNQA 3C6UA 4K4WA 2VDIA 2EK1A 4RUAA 4DV1J 3P49B 2CQ1A 3RRGA 4IH7A 3ZTOA 9RUBA 2HLTA 1YJ7A 2R8GA 4ES1A 1J98A 3BBCA 1HWIA 4ED7A 1UEVA 2CFAB 3I9V9 1KVJA 1Y0HA 2JEIA 4KH0B 2C3UA 2M4MA 1IKWB 2FGCA 2VIHA 2AW0A 3OR2A 4WE1B 4FYVB 1S7IA 1HI0P 2IRYA 4ZCIA 2YWKA 2ZZTA 5ADZA 4G1QA 1ITPA 3CJKB 4QR0A 4KT0C 1UWAA 1C0UA 1VQ9S 3FCVA 4ZJOA 3QWUA 1SV5B 1TL1B 4H4OA 1SKRA 3MHYA 3KLGA 3IRXA 2BACA 5HVHA 3WDOA 3UR3C 9ATCB 2Y0BB 1VYAA 2P5VA 4LF6J 1N56A 1U2CA 3IS9A 3T19A 4DV7J 2P6SA 2CIMA 4QPTA 1OY9A 2A69A 2LP4A 4OI1A 3CJSA 1J5OA 4USIA 2MQQA 3TA1A 3W2VA 1BUXA 4OJ1A 3EICA 5K14B 1M5KC 2OPRA 1FERA 4JI8F 2N82B 1N54B 4F7VA 3JQKA 2Y9HA 2HMIA 3CE8A 3FHZA 1R89A 4O3QA 5DM6Q 2GSUA 5KT3A 2VOPA 2A2DA 2CXEA 4ZIWA 1EP4B 4DR5F 1SFOA 2Q3PA 1LK5A 3MM5B 5IT9U 4GVBA 2OEKA 3FKIK 3P4UB 4A93K 4YR3A 4L3KA 1QAYA 4KGKA 4CRJA 5MLCV 3HT0A 2K1RA 2DNOA 3DC2A 4QU7A 3VGUA 4A93C 3N0BA 1K47A 4LT6A 2YNGA 2BMBA 4UUWA 4WF9Q 4A48A 2VASA 5T7LB 2RQKA 1PJ6A 4Q5VA 3KUGA 1L5UA 1WG4A 2DYAA 4L73A 4ED5A 1JQGA 1LWEA 2HZVA 3QFHA 2Y8YA 3MECA 2JNJA 5L8RC 1MU2B 2ACYA 3AJDA 5DQHA 5KOXA 4IOBA 1HBMA 3M3YK 1XXCA 3LGNA 1RTDA 3PW7A 4DS4A 3M3YC 4RUBA 5DETA 2YKMB 2BRKA 4KR0B 1T02A 3S6EA 2NPFA 2X1GA 4B3RJ 1XZPB 3DHWC 4F25A 1CJVB 2K7JA 2XQCA 5ETNA 2GV1A 2V63A 4NRUA 4IYQA 2LXUA 4FZBA 2SXLA 1EJ7L 1RAEB 2BRLA 1S6OA 2DGTA 4ZH4A 2OEJA 3H90A 4KHPJ 3ELHA 1LEOA 1ZTWA 3UVJB 3SQOP 4OZ0A 4DV4F 1WOPA 2NXEA 4AQYF 1DCPA 1RLCL 5E33A 4IH5A 1V9OA 4X4PA 1SFOK 2XZDB 1FNMA 3NGSA 4OX9J 3CCLS 1IQ0A 3GP9A 2LVWA 2KO1A 1LFWA 1SFOC 1RE1B 2VUMK 3TA2A 5K8PA 3BUEA 1EARA 2R2TA 3FSXA 3N6MA 3CWJA 2BQRA 2LU2A 7FDRA 2UVRA 2VUMC 1L3KA 3A4TA 1QAXA 4EU0A 4DV6F 3BR8A 4DV2J 3LWMA 2KJVA 2XHWA 1SI9A 2E2JK 4K4SA 4ZLNA 4F4AA 2F5GA 3VAGA 2WONB 3AH5A 2G9OA 4J9PA 3QYYA 4M5DB 4PQUB 4USKA 2QA1A 1FXDA 3MM6A 3DOKA 5D0EA 4QPXA 3Q3QA 1O26A 5KFFA 3KK1B 2E2JC 2VD3A 2XLJA 4C4WA 3JSMB 4DSFA 2DGXA 4RX6A 5K8NA 1AZSB 3G71S 1CLFA 2I5JB 3DOLA 3ZZYA 2RT3A 3H5YA 2DIUA 1U1QA 2ZKTA 4I2QB 2UUAF 3P96A 4OI6A 4FYDA 2BOAA 4XLPA 1JKHA 4BCAA 2RIJA 5IS2A 5F9NA 1DLOA 3OTEA 2ZH5A 2X3GA 3S1MK 1T9XA 2MSSA 1S0NA 2M88A 4FZVA 1UEKA 1RWPB 2LQ8A 4MIBA 3S1MC 1ZZFA 5B0EA 1Q5VA 4FDFA 2FHKA 2PO4A 3QZ7A 4F50A 2RS8A 1NJZA 3SEOA 3F0NA 4DG1A 2YY3A 1RTIA 5JFEA 2YX4A 3EE3A 3MDFA 4QJVA 4MKBA 4NXMF 2E9ZA 1TELA 4NWBA 4LK0A 4YB6A 3CJTA 5AJ3J 1W2IA 3NCQA 3DRXA 3R7SB 2HEKA 4B3OB 4X4RA 2HW3A 4WP9A 2H9ZA 3MM7A 1SQFA 2R7SA 2J6SA 1EETB 2D7SA 1CG2A 3O8WA 4YMEA 2OSQA 2GIRA 3V4IA 3GV7B 3LTOA 3TNVA 2J7KA 2C2RA 3NKYA 3IP0A 4BKWA 3M2UA 3VCDA 3HHNB 3HHEA 3R7NB 3NNHA 1EAYC 3GFHA 3K7RA 4FXWA 2IVFB 2YH1A 1FD2A 2B9EA 1R43A 1LWCB 3NOGA 2VQEF 4XTTA 3I5AA 2CZ4A 1OJ4A 3LALA 4P5AA 3J81j 2JVOA 3S16K 3BZQA 2L9DA 2G4BA 5B0CA 5DS7A 1PILA 1GX6A 2CNLB 2OTLS 2RSQA 2YTCA 1RBOB 3NS5A 3QGIA 3S16C 2Y8WA 1M5PC 1HR0F 3CC2S 2C3OA 3WHIA 1T9WA 4ZITA 4IQXA 1RCXB 2RUSA 4IDKB 2XYPB 2LXIA 2KU7A 2FQOA 4UUXA 1S0MA 3O2IA 2IM1A 2WCXA 3X3UA 4KFBA 5IOSA 4DBQA 4WPAA 2JRSA 1KN6A 4KQZA 1NHVA 1HBNA 2V34A 1FKPA 3FKBA 4M94A 1H38A 2FVQA 2EKYA 4HL9A 3MFIA 3FOEA 4B3MJ 3HPOA 2IA6A 3U1NA 1ZA1B 3TP2A 2IIHA 1U02A 4BXXK 2CDQA 2CA9A 4HVZA 2PPBA 2ZVSA 4XK8C 2YNIA 1RQ0A 4DR3F 2E9TA 2YQ0A 4ILDA 5U47A 4BXXC 3S17K 5J2QB 2JLGA 4URQU 3TR5A 3OTCA 3G87A 3S17C 1USOA 4L75A 5KFYA 4AH6A 3M1VA 1U7LA 4O3NA 1SKSA 4LF1A 2V2QA 2BQUA 4HI2A 2BE2B 3KDOA 3W1YC 1XMOJ 3NOCA 3K8WA 5ETMA 2L9WA 1RGVA 2Y3PA 2DGSA 5KFIA 3L3CA 4X64J 2V68A 1LK7A 2KG0A 5C42A 2OTJS 1NDPA 4MTPA 4MKVA 3QGGA 1FWPA 5LXRA 1TL4A 1FX4A 2UUWA 3DOMB 2A10A 5A2QU 5E3CA 3FBBA 3R7BB 4NYOA 3M2VA 5A8WA 1GMWA 4DPTA 1Y7PA 2B4UA 3PR4A 1LW2A 3X1LB 1MNEA 2XYGB 4LSNB 2PGCA 4GKKF 1TZ0A 1S48A 2BA9A 3GB0A 1R8CA 3H40A 3AB2B 3JTOA 2NQPA 2M8HA 2I2YA 3R1HA 2YXLA 3DLBA 2FJBB 3PJ9A 3HHLD 3PFOA 2V2ZA 3ZZ0A 4YQWA 3PCOB 3PO2K 2VHGA 4CLLA 3HI9A 1VC0A 4ZVHA 5EDWA 3NGUA 4QIGA 1O0PA 3PO2C 2E2IA 2CRLA 3FRYA 1REVB 2RVJA 2WBRA 4LF5J 5A8RA 1Z2ZA 2MQ8A 3HVTA 3ZXWA 1NNDA 4K2XA 3ADAC 3D6HB 2OH2A 2CQ2A 3KMSA 2BR0A 2QIFA 2KXFA 5D4OA 2K3IA 1EKSA 2RDDA 1HHTP 4QR1A 2EPIA 3B54A 4MH8A 3IAM9 4QZVB 2F8MA 2MEWA 3HKWA 4F3MA 3GG1A 4RNMA 4WIQA 3FMBA 3HHDA 1S6PA 3A3OB 4CLTA 5I3PA 1X4HA 3V5RA 4X62F 1QTMA 1AYEA 2XMUA 1D3WA 1VQNS 4DL6A 2FJAB 3BYPA 5LXYA 2J9EA 5EN1A 1M5HA 6AT1B 3I0SB 1K44A 3B6BA 1P8GA 1DFDA 5L1KA 2DNMA 1AW0A 2UXBF 3CJ8A 4USTA 1M5SA 4HI1A 3QSYB 2GJIA 3TRGA 3MXHP 3HVRA 2OUGA 4QYRA 2ASYA 2QT7A 3NBPA 2W4CA 4NCGA 4P71A 4DPUA 2WHOA 2OEMA 5D0HA 4G1PA 1UFWA 2OFGX 5J1PA 3J80Y 3M8ZA 1UJ4A 2PMZD 2IFXA 2E2IK 3U27A 3PDNA 5H9FK 4F2SA 3JQMA 3CCMS 4NZ7A 5C44K 2E2IC 2EWHA 3OV7A 4DPXA 4R5PA 3GR0A 3AY0A 1C2PA 4QW8A 5C44C 3K57A 3IS9B 2ZH8A 1RKJA 1C1CB 4K5SA 3MMBB 1NK0A 3I87A 4NZ6A 4K4XA 2DHXA 4PKDB 2B3TB 1YDLA 1P9QC 1P1LA 5LMNJ 5KFQA 3W2VB 3OL9A 1RABB 2UU9J 3M4OK 2OPRB 3RGIA 2IDEA 1LQ9A 3M4OC 1EQRA 4ILLA 4ZDNA 4Q0BB 4DR7J 2ZWOA 3V6DB 1IBAA 8RUCA 1MMDA 2UUBJ 4X4TA 3T5KA 2V8VA 3A13A 2QYCA 3EJMA 3JYTA 5B09A 3CDBA 1RT5B 2Z8QA 4FF1A 2J9CA 2K1RB 3S1QK 1VQ7S 3BO2A 2HWTA 3G82B 4P73A 1CSJA 1VC6A 4J9NA 2JLFA 2CQ4A 3S1QC 2RJZA 4ZP8A 3W9HA 4XPEA 4NEZA 3RAQA 2W4DA 2RQCA 5F3ZA 4C8OA 4CZCA 5G0RA 3MTJA 4I56A 1S6QA 4ED0A 1GQEA 2ZBIA 4UT4A 4KH1B 1FF2A 2O5JA 1R6VA 5A0YA 2XC9A 2ATCB 1K1SA 2W9CB 2E7WA 2BQ3A 2IMWP 3HK2A 2Q79A 2JC1A 3HHKA 3MPWA 4KSEB 2FDNA 4WTYA 4GZYA 5FLXY 1ZM3A 3TAMB 3EPGA 3MD3A 4RW9A
chains in the Genus database with same CATH topology
1WOSA 1WSRA 1VRQC 1WORA 3A8IA 3GEHA 3AD8C 4PAAA 5L46A 1V5VA 2GAGC 3A8KA 3GEIA 1XZQB 3TFHA 1WOOA 1PJ7A 2GAHC 3GSIA 3A8JA 3ADAC 1XZQA 1YX2A 3AD7C 3GIRA 1XZPB 3TFIA 3AD9C 3TTGA 4PABA 1PJ6A 1WSVA 4P9SA 1PJ5A 3GEEA 1WOPA 1XZPA 1VLOA 3TFJA 1X31C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOS A;  1WSR A;  1VRQ C;  1WOR A;  3A8I A;  3GEH A;  3AD8 C;  4PAA A;  5L46 A;  1V5V A;  2GAG C;  3A8K A;  3GEI A;  1XZQ B;  3TFH A;  1WOO A;  1PJ7 A;  2GAH C;  3GSI A;  3A8J A;  3ADA C;  1XZQ A;  1YX2 A;  3AD7 C;  3GIR A;  1XZP B;  3TFI A;  3AD9 C;  3TTG A;  4PAB A;  1PJ6 A;  1WSV A;  4P9S A;  1PJ5 A;  3GEE A;  1WOP A;  1XZP A;  1VLO A;  3TFJ A;  1X31 C; 
#chains in the Genus database with same CATH topology
 1N6Q A;  3ET6 B;  3MPU B;  2KT3 A;  2R7V A;  3GE9 A;  2GO8 A;  3PV8 A;  3M9M B;  2ZZM A;  3FSI A;  2H48 B;  5DGB A;  1JLC A;  3ENV A;  1RHQ B;  2AIR B;  3ILL A;  5J2P A;  1FVQ A;  1HNX F;  2QL7 B;  2DPI A;  1YRX A;  1FRK A;  4DR1 J;  3BGU A;  3CGI A;  1Y3J A;  1D8Y A;  4LBI A;  1ZM2 A;  3TJ9 A;  3IM8 A;  2XY5 A;  1SIW B;  1BQN A;  1XEZ A;  1TWC A;  1X5O A;  2M8D B;  3H20 A;  4PXB A;  1EB0 A;  2P9G A;  1X9S A;  2M52 A;  3CTR A;  3KNG A;  3HXM A;  2GW8 A;  3DGV A;  3K8V A;  2XMM A;  2XCP A;  3JS9 A;  4BBR K;  1AFI A;  3RZD K;  3K89 A;  3FBE A;  2KZM A;  2CNK B;  2FTR A;  2FJD B;  1CJT A;  4ZVT B;  5BR8 F;  2JA6 A;  1VBY A;  3KLH B;  5A8K A;  2V9K A;  4HHH A;  1G4C A;  2JC0 A;  4BBR C;  2OP5 A;  5DG9 A;  4DR2 J;  3OXF A;  1V3S A;  3RZD C;  2UVW A;  1Y11 A;  4EO6 A;  3DCA A;  4GC6 A;  3RTV A;  2J6T A;  2BJ9 A;  3MM6 B;  2GVD B;  1FWK A;  5L1I A;  3GFX A;  2P9C A;  3BR9 A;  1KLM A;  3CJ5 A;  2OPP A;  4WFB Q;  2HHX A;  1UW4 A;  4NLQ A;  1WSR A;  2V0N A;  3CDU A;  4TKT A;  1Q1K A;  1VIX A;  3ZFV A;  3MMA A;  1IBC B;  3KTQ A;  4EFA C;  1YI2 S;  3N0C A;  1DCH A;  4X4O A;  3QO9 A;  2HBQ B;  2JFD A;  1F3V A;  4RBV A;  3CUL A;  1JKH B;  1R8B A;  4OX7 A;  2PFF B;  1HNI A;  2IVM A;  4YDD B;  2FUG 9;  3C14 B;  1NDK A;  1R3N A;  2B6A A;  2DHH A;  2RRB A;  2W7O A;  2D3U A;  1JWW A;  2B56 A;  4A3L K;  4OYP A;  5C2C A;  2RNE A;  4ECW A;  3NXZ A;  1SC3 B;  4FKX A;  3U1L A;  4ECY A;  1I94 J;  4MKY A;  4QQB A;  3AOD A;  5CD4 A;  1FI4 A;  2ZH9 A;  4A3L C;  3KG1 A;  1WEZ A;  3DXB A;  3BO4 A;  4QJV B;  3DYA B;  3UDC A;  2VUG A;  2Z57 B;  4PAB A;  2QYG A;  5KAK A;  4XSZ A;  2XHC A;  2VPY B;  3GYG A;  4Q8F A;  2H5J B;  3AAW B;  3CJQ A;  4M5G A;  3I5B A;  1HMV B;  1T94 A;  4IFY A;  3D67 A;  3ZC4 A;  3GTM A;  3DLK B;  3EM1 A;  3ENQ A;  2F4V F;  1RIS A;  4OLO A;  1FKA F;  2LA4 A;  4A3J K;  3BGR B;  2JA6 C;  3V4I B;  5E41 A;  1IBL J;  4QWC A;  4OIO A;  2CPX A;  4A3J C;  2XCR B;  1FKO A;  5H9F J;  1F9N A;  2IJR A;  2W1B A;  4Z37 A;  3W5X A;  2AJF E;  3G6Y A;  3C46 A;  1XMB A;  2BM1 A;  2GSO A;  2W4P A;  3KG4 A;  4JV5 J;  1F1B B;  1VI7 A;  4DV3 J;  1RHR B;  3LAJ A;  4JI0 J;  1UA1 A;  3AXM A;  4LF8 J;  1IJE B;  1LV5 A;  1PSD A;  1XQI A;  1X31 C;  5TJ3 A;  1WQF A;  1KOH A;  5GAG I;  2VPW B;  2HK3 A;  1M1H A;  5H1S V;  2ZH7 A;  2BW7 A;  1C4A A;  2UUT A;  5GME A;  5ETR A;  5DDR C;  2CJY B;  3W63 A;  5I3U A;  2HHH J;  1TL7 A;  1U1L A;  5LSL A;  1RT1 B;  3DM2 A;  2Z0G A;  4L72 B;  3CO0 P;  4CTA B;  2ZH3 A;  5D4D A;  4J5O A;  5IP9 C;  2J0W A;  4MFB A;  4K50 A;  1BQM B;  5B08 A;  1M90 T;  5E7O B;  4JV2 A;  3PY8 A;  3D68 A;  4OIQ A;  5AXM A;  4O44 B;  4C8M A;  2XY7 A;  3PYG A;  2IVY A;  5KFU A;  4OIP A;  3AOB A;  1NEE A;  3UPF A;  3OPK A;  2CAJ A;  4PG4 A;  4EBD A;  4KGX B;  5FDL A;  1U1K A;  3KHH A;  2UXC F;  2QL5 B;  2Z4P A;  4DLE A;  2YNI B;  3GTM K;  1JXV A;  4JI4 F;  2BE9 B;  4WYL A;  4EZ6 A;  4M95 A;  1U26 A;  2C42 A;  2VC0 A;  3GLJ A;  2X1A A;  2UUC F;  3K2Y A;  3GTM C;  4LVO P;  3M2R A;  1RAF B;  1Q95 G;  2VQF F;  4EI2 A;  4QBU A;  5LL6 d;  1PC4 A;  1EFW A;  1AB4 A;  3MED A;  4ECZ A;  2XGQ A;  1S9G A;  1CS4 B;  2KM8 B;  1O5J A;  4KBI A;  1U2F A;  4ES3 A;  3UCZ P;  4FF4 A;  3HKZ D;  3PR5 B;  1DRZ A;  3UW1 A;  5BXI A;  1JJ2 R;  2VG5 B;  2XNR A;  3SCK E;  4YHH F;  5T14 A;  4C7Q A;  4I2P A;  1TWF A;  2KT5 A;  3TUI C;  1XNR J;  1WOR A;  3MAA B;  3S2H K;  1O2A A;  2PC6 A;  1I50 K;  2WW8 A;  1RB0 A;  4BWJ A;  3M2V B;  2UVU A;  3S2H C;  4PCQ A;  5HBM B;  1H7X A;  5L1L A;  4JI6 J;  3TZW A;  5DGA A;  1I50 C;  2HNZ B;  5L38 A;  2V69 A;  1FES A;  4F02 A;  2K06 A;  1TKX A;  4ED2 A;  1LWX A;  5C24 A;  1BDF A;  2AU0 A;  1D8Z A;  3GMG A;  3SMZ A;  3RBE A;  5DG7 A;  4Y2A A;  3OHA A;  3GU0 A;  2PSZ A;  3D66 A;  3MPY A;  2CZV C;  1S1U B;  1HQU B;  4X6A K;  2IRU A;  4J91 A;  2ZUF A;  3A1Y G;  5IYC K;  2DR5 A;  4X6A C;  3VAJ A;  3KLI B;  1O6X A;  1Y5I B;  4M5H A;  1VQO S;  2JJ4 D;  5AXL A;  4F0H A;  4MK9 A;  2HVH A;  5IYC C;  4KN4 A;  4ZN1 A;  3U02 A;  2FZK B;  1HHS A;  3H3V D;  4YY3 J;  1ACM B;  2RIL A;  4LF9 F;  3DLG A;  2QA2 A;  2ZNY A;  4JI5 J;  4CLK A;  2KB2 A;  2VL1 A;  4IFV A;  4NPO A;  4A47 A;  3V6J A;  1QLN A;  3A8I A;  1R31 A;  2QTW A;  2AYE A;  4E2F B;  1TKT A;  3CB4 A;  1VJQ A;  1NK7 A;  4TYA A;  3O5T B;  4JV1 A;  4N77 A;  5DLG A;  1KR4 A;  3POT A;  1KEK A;  1RWW B;  1WC3 A;  4AUK A;  3N9U C;  1FJG J;  2G0I A;  2YX7 A;  4WK1 A;  2C3Y A;  3FZB A;  3W8P A;  1ZVU A;  3W64 A;  2Z2L A;  2BV3 A;  5KG5 A;  3HD1 A;  2RRA A;  2I0X A;  5I42 B;  2HG4 A;  1F2H A;  3T9N A;  1X9W A;  2N4D A;  3QID A;  1N36 J;  3C6T A;  1JLG B;  2HHP A;  3NBP B;  4DV0 F;  1GH8 A;  1K0T A;  2A6O A;  3SQG B;  5HK4 A;  3MF5 A;  3PW5 A;  1NH8 A;  4XDD A;  1FNO A;  4NLW A;  1SH3 A;  1OYD A;  3Q24 A;  1O51 A;  2YH0 A;  1TFY A;  2K2P A;  2RRN A;  2YKO A;  3WX8 A;  2KL8 A;  1NZA A;  3FC9 A;  2YVS A;  1KWM A;  3QWP A;  4J37 A;  3RB3 A;  3M30 A;  4HAC B;  3OUY B;  5A6P A;  2IYG A;  5H9E K;  1FRX A;  5IOR A;  1UAW A;  5BYR A;  5KFT A;  3KLF A;  2HQD A;  1SC6 A;  4DDF A;  5LOQ A;  1NPK A;  1HYS A;  3TQE A;  3DFE A;  1C1B A;  2M70 A;  2PA8 D;  1HQ2 A;  2W9A A;  1MRO A;  1YRT A;  2IBK A;  3J7A N;  3PHE A;  3H42 A;  4NLY A;  3DI6 B;  2EFP A;  2P5M A;  3SZY A;  4NXN J;  3FNN A;  2B63 A;  2NS1 B;  1HL6 A;  2XCA A;  1VHI A;  2HRU A;  2COL A;  2L3M A;  2PI4 A;  3ZZT A;  1Y4Z B;  1KP6 A;  5KFL A;  4HEA 9;  5EUH A;  2LKZ A;  1JVI A;  4J9M A;  1FVS A;  2GVZ B;  1X4G A;  1J6W A;  4DV1 F;  4CNY A;  1RAC B;  4K4U A;  2KT2 A;  4K0K J;  2DIV A;  5F0U A;  4RBT A;  4LF4 J;  3DU6 A;  3HHL A;  5JVH Q;  5GVQ A;  2A1B A;  2V4J B;  1VJE A;  4LRA A;  3I4M K;  4ZIV A;  5D4N A;  1HPZ B;  3KK3 A;  4DJB A;  5IXU A;  5G0R B;  1YJR A;  3I4M C;  4JYA J;  3Q83 A;  2WRM A;  2IY5 B;  2PEB A;  2Q6B A;  2V8H A;  2WOM A;  4L76 A;  3CCJ S;  1A9N B;  5HQ8 A;  3D1Q A;  4ECT A;  1A6L A;  3MMC A;  4CLF A;  2B7C B;  1XR5 A;  2JEG A;  4PRF A;  3W2W B;  3SIP B;  3LQV A;  2VU5 A;  5F9L A;  4A8S A;  2ZD1 A;  4F4K A;  2HFU A;  2UXD F;  4OI4 A;  4AXI A;  3S1T A;  3RYL A;  1YLX A;  1WJ9 A;  2CJQ A;  3CDW A;  4F3Q A;  2ZFZ A;  1IUJ A;  3QZ8 A;  4K4T A;  1RTH B;  1FK9 B;  2D41 A;  3M8Q B;  3TAN A;  4ZPC A;  4P6Q A;  2B63 K;  1E6Y A;  5B0G A;  4F3O A;  2LLZ A;  1EH1 A;  2BYC A;  5IQQ A;  1FFG B;  2B43 A;  4Q8E A;  1IE0 A;  3GJQ B;  3GEH A;  4C6A A;  2XLK A;  3NMR A;  2B63 C;  5HRO A;  3P5B P;  2LA6 A;  3H8Y A;  3UFC X;  1TUV A;  3CJ3 A;  3W8G A;  3H3V L;  2NVY A;  2NYI A;  3D3B J;  1N88 A;  2OO4 A;  2R7W A;  1T9Y A;  1BJT A;  2AZ3 A;  2VON A;  1Y1W A;  3UO0 A;  1RI7 A;  1CJT B;  2V5H G;  2DIS A;  2MKI A;  3DRY A;  4DSL A;  4OZ3 A;  1GXL A;  1LXJ A;  2R7Z A;  1B7Y B;  4L3N A;  2Z58 B;  8AT1 B;  4ZN3 A;  4XO0 A;  1Y9O A;  1LW0 B;  1QJH A;  3N5B A;  4BY7 K;  2O1P A;  1JLA B;  3GTL A;  2AGO A;  2OPP B;  3C15 A;  3FBF A;  4BY7 C;  3DRP A;  5JVG Q;  1S1X B;  1IN0 A;  3GCX P;  4E98 A;  3OPF A;  3NS6 A;  4OIN A;  2ZM6 J;  5KFW A;  1XXB A;  4UQT A;  2ADC A;  3DDI A;  3TFH A;  1IKV B;  3QO9 B;  3PRV A;  4DSE A;  1YNN A;  4ZCL A;  5EGH A;  2MGZ A;  4P2M A;  3OTD A;  3MUM P;  3L4B C;  2OPS B;  1FFW B;  1HNI B;  1SB6 A;  2FY8 A;  3N3Y A;  1IR1 A;  2MMY A;  1ELO A;  4WJ3 M;  4NRT A;  3W5Z A;  1XNQ J;  5IZH A;  4B02 A;  2PE8 A;  1T9T A;  4XIU A;  1AB8 A;  2HFN A;  1DCO A;  4EO8 A;  1U6F A;  4LJZ A;  1TVR A;  3HOW K;  4DFM A;  1Q79 A;  4ZCM A;  3H59 A;  3LP0 B;  3TAP A;  3HOW C;  4C8N A;  4C3L A;  3KK2 B;  2W7P A;  4X4S A;  1T9V A;  3MM8 A;  2BEF A;  3M8P A;  1NK4 A;  3HOY K;  1HD1 A;  3AA9 A;  5M5X K;  3A3P B;  4OHZ A;  2HHQ A;  2NVY K;  1S76 D;  3O6Q A;  6FDR A;  1NLK L;  2VG6 B;  4U8V A;  1Y1W K;  4KHP F;  3T1H F;  2AEF A;  5GAE I;  2NVY C;  3VAK A;  2ZOG A;  2QG9 B;  1HLW A;  4KAR A;  3OL6 A;  4MYU A;  1B3T A;  1Y1W C;  4EK2 A;  1I6H K;  3QMQ A;  1TWH A;  2A68 A;  3D2W A;  2KDO A;  2R7Z K;  2D74 B;  4ZHR B;  4OX9 F;  1ZH5 A;  3JB9 k;  1I6H C;  2GQQ A;  3GFZ A;  2R7Z C;  1HWJ A;  1SJ3 P;  4XCH A;  1FKO B;  4A46 A;  1K0V A;  2OMO A;  4EWT A;  1I3Q A;  2DCU B;  5H9E J;  1RT6 A;  4ZJL A;  2CAD A;  4R8U A;  4C8Z A;  1A0O B;  1DHM A;  3UCU P;  3CCW A;  5THW A;  5CYM B;  3FJ2 A;  3DMJ B;  5DDO C;  4UF4 A;  1IKY B;  1DTT A;  5GAG U;  2JLE A;  1AFJ A;  2ZEJ A;  4LMZ A;  3H2V E;  2HHV A;  3LAP A;  1S1V B;  1IR2 A;  1NZ8 A;  3ZZO A;  1RU0 A;  1Q8B A;  3RJM B;  4OIR A;  4A3I K;  3OVS A;  1TL7 B;  1S1T A;  4ENO A;  2HZA A;  3BKT A;  3DM2 B;  4A3I C;  3LP1 A;  4U7U K;  1RBL A;  1WF2 A;  4ERD A;  4YG2 A;  1B0V A;  2KVI A;  4OZJ A;  3IG1 A;  2MJU A;  2RH3 A;  4DX6 A;  3FGV A;  4J9U E;  3V6K A;  2H5I B;  4CNZ A;  4OFZ A;  3G4S S;  1IL2 A;  2VG7 B;  2WAQ D;  4NE9 C;  2ZH4 A;  4ZMM A;  2VA2 A;  1T7P A;  2NVX K;  1HQE A;  3HOX K;  1WEL A;  2KXN B;  2NVX C;  1NB2 A;  1BMQ B;  3I56 S;  3W62 A;  1RTJ A;  3HOX C;  1RBA A;  4QIW L;  1TWH K;  2OHD A;  1VRU A;  5A6W A;  3OSN A;  2KTQ A;  1TK5 A;  2V9W A;  2EFV A;  5F3T A;  1LFP A;  2VJV A;  4WYW A;  3HO1 A;  3W66 A;  4HT5 A;  1TWH C;  3DLE B;  1C0T B;  4NI2 B;  4QIE A;  3C16 B;  3D28 A;  4W4M A;  4LIW A;  5IFM A;  2EW9 A;  4JI7 F;  1S9G B;  4OLP A;  3G6V A;  1K83 A;  4AE5 A;  3M6V A;  2EBE A;  4G0V A;  1I3Q K;  4PUO B;  2BJ8 A;  2HQG A;  2OSR A;  3ZTP A;  4ED6 A;  1I3Q C;  1KVK A;  2DT9 A;  1BLU A;  5K8M A;  1K1Q A;  3B8H A;  1RWU A;  1B0P A;  3D7S B;  2FZG B;  1FO1 A;  2R7T A;  1V5I B;  2RS2 A;  2NXC A;  2ADB A;  4TY8 A;  2GA7 A;  2DNK A;  5F8J A;  2I38 A;  4X2B A;  1DQA A;  1RHJ B;  2MST A;  3GZ7 A;  1TKX B;  3I4H X;  1Q7L B;  2JL9 A;  3E01 A;  4X4N A;  5GAH I;  1KVI A;  4HH1 A;  3MUR P;  5HMX A;  2PI5 A;  1WHY A;  4RW6 B;  1T3O A;  4OYB A;  4RR5 A;  1WF1 A;  3MEG A;  1VBX A;  2XUL A;  4B9T A;  5CYJ A;  2RDJ A;  4I67 A;  1PYS B;  3SDE A;  5HLF B;  1RU1 A;  1ZPV A;  3C8Y A;  4KO0 A;  2HS4 A;  4ZPB A;  3PM9 A;  2OIH A;  2HBR B;  5MAO A;  4ICL B;  1S9F A;  4JI8 J;  1VGY A;  2E1R A;  1GT8 A;  5IOQ A;  3DLG B;  3R6L B;  2VDH A;  1N5Q A;  4OHV A;  2HBY B;  2Z56 B;  4IFV B;  3J80 U;  2GMH A;  2YKQ A;  4MAK A;  3HJF A;  2DGU A;  1UL3 A;  1QM9 A;  3EDR B;  4DHV A;  5IOL A;  3NP5 A;  3UDE A;  4AYB D;  3PW2 A;  3GEI A;  3FSY A;  4I64 A;  2ZWP A;  4X4V A;  2CQI A;  4NMX A;  5LJ5 Y;  1WEX A;  3TTG A;  5CD4 H;  4FYX B;  5CHC B;  2PII A;  2I1R A;  5EGE A;  1B4B A;  1FRL A;  3PNI A;  5ETT A;  3AD7 C;  4ZA1 A;  3H25 A;  2JEJ A;  3DRR B;  2HGN A;  5M2R A;  3BSA A;  3F44 A;  5HJX A;  4TXS A;  3UN2 A;  1S10 A;  3OR1 B;  3SFU A;  5KG6 A;  5FD1 A;  5HMY A;  1RT3 B;  2CZ9 A;  4X64 F;  3N6N A;  2ZC3 A;  3C6T B;  4B08 A;  5FII A;  1N32 J;  3MCN A;  3OLB A;  3AA8 A;  1FWL A;  4Q44 A;  1KLN A;  2MKS A;  1RU2 A;  4FXD A;  2I6W A;  3R8Y A;  2C2Z B;  2VA3 A;  1IVZ A;  5AXN A;  1OWX A;  5KFM A;  1S57 A;  2W9B B;  4OMF G;  5IM0 B;  4AQY J;  1JXL A;  2LDY A;  3TVK A;  4DR4 J;  5D3G B;  3PJX A;  3MPV A;  3CQZ A;  1NUE A;  3S14 K;  5DQG A;  4H54 A;  2Y1I A;  3PO3 K;  4OI0 A;  1ARO P;  2ASJ A;  1KRP A;  1UPM B;  2MQO A;  1R0A A;  3T1Y J;  2WVD A;  1WCM A;  7FD1 A;  1C1B B;  2IC3 B;  3S14 C;  2QLB B;  1XK8 A;  2RML A;  3PO3 C;  3BPD A;  5J1E A;  2WB1 L;  4OZ1 A;  3WOD A;  4BC9 A;  4KC5 A;  2AJ1 A;  3TI0 A;  4OI2 A;  1BD6 A;  4LF5 F;  3NAI A;  3N5F A;  4KHM A;  1LNQ A;  5K5M A;  3I0R A;  3Q89 A;  4B9M A;  3ISZ A;  2LDI A;  2KWA A;  3WZ0 A;  4P2S A;  2M3D A;  3BM7 A;  4XPC A;  3EXC X;  2ZUE A;  2YU9 A;  2ROG A;  1HNV A;  5E2Q A;  3PO4 A;  1RWO B;  4XAK A;  1IBM J;  2V67 A;  2LFV A;  3QPI A;  4USU A;  3KMQ A;  3QT7 A;  4ZVR B;  3HHL B;  1U1N A;  5C25 B;  4GKJ J;  3QJL A;  1IQT A;  2DD8 S;  4Y2K A;  1U49 A;  4FBU A;  4LQY A;  4MK7 A;  4NOI A;  2XMV A;  2VFT A;  1Q86 T;  5GMD A;  3RRH A;  4R25 A;  3CD5 A;  2B4P A;  3D0I E;  4C9D A;  3PYF A;  4DZ6 A;  1QDU B;  3CQZ K;  3RG6 A;  1W26 A;  2L41 A;  3MMC B;  2HWH A;  2BKN A;  1JXE A;  4NL5 A;  2FGO A;  3M32 A;  4P52 A;  4NXM J;  1WCM K;  1XN9 A;  4H4M B;  3CQZ C;  2GJ2 A;  2DGV A;  2H1Y A;  3GIK A;  4K8R A;  3CCZ A;  1TV6 A;  1VRT A;  3TJ8 A;  4HHJ A;  2ALZ A;  3D6F B;  1S7H A;  2J6U A;  1WCM C;  4F36 A;  4A3B K;  3AJ1 A;  5GAD I;  2Y1J A;  1JB0 C;  3BSN A;  2KYZ A;  3GIL A;  1EK8 A;  4A3B C;  3KJV A;  3THT A;  2DRD A;  1KSP A;  3Q0A A;  2E44 A;  4O3R A;  5HP1 B;  1E6V A;  3R27 A;  1VR6 A;  4QWA A;  2YU9 K;  1VQ8 S;  2FHM A;  1Z4U A;  2YQ1 A;  1KFS A;  3P6Y C;  2HND B;  3IGV A;  3R2D J;  2LXF A;  1S97 A;  2E5I A;  5CA5 A;  4GTB A;  4LSZ B;  2YU9 C;  2VQE J;  1RT7 A;  2HPU A;  1OMS A;  1TKZ A;  4CQ1 A;  3BBB A;  3J7A 1;  3OW2 R;  2R7R A;  4D3G A;  1MWZ A;  3PZP A;  3WQP A;  1ZM9 A;  2GGP A;  4ZJQ A;  2FPH X;  4ED4 A;  1HR0 J;  1WOS A;  2UUB F;  2AEJ A;  4ILR A;  5IT4 A;  1UWB B;  3FK4 A;  3A3N B;  2OGU A;  4MIA A;  5J2N A;  2ACM A;  1FHT A;  3BJY A;  1UVJ A;  4LR2 A;  3GTO K;  1O8B A;  2RF2 A;  4B9V A;  1PBU A;  3KUE A;  5IWA J;  3CDE A;  4A3K K;  4OZ2 A;  3GTO C;  1QD1 A;  2RHS B;  2B9X A;  2DR9 A;  5FJ4 A;  2JOQ A;  3QRR A;  3JSB A;  3M8R A;  1HA1 A;  4A3K C;  3CME S;  2KRB A;  4P7T A;  3UN5 A;  2GML A;  2KKH A;  1RAJ A;  3HMJ G;  2F7V A;  1YSJ A;  2EK6 A;  1S49 A;  1RT4 B;  2Y1R I;  4GVL A;  4C11 A;  4KB7 A;  1TAQ A;  2EEY A;  4ED1 A;  1YRU A;  4J9O A;  1H98 A;  2VFU A;  2BKP A;  2JA5 A;  1Q8K A;  3DRS A;  2ROE A;  1WNE A;  1RAI B;  2QMU B;  1LWF A;  1SQE A;  4B3S J;  4WII A;  1T05 A;  1RT2 A;  4J3N A;  2NSC A;  5GAE U;  4B9U A;  2KG1 A;  4ZVP B;  2RUG A;  3LP2 A;  2HHS A;  4ZOS A;  4A3E K;  3HOZ K;  4CLS A;  1JLE B;  3KJN B;  3SZ2 A;  2ZBR A;  4DSI A;  1XBW A;  4DR1 F;  2C2D A;  1N5Y A;  4HHU A;  2OPQ B;  4A3E C;  3HOZ C;  3VVU A;  4ZP7 A;  4FNI A;  3QGH A;  5KFK A;  5EX0 A;  1SUQ B;  1GTE A;  2DXE A;  2MXY A;  3HD2 A;  3JQJ A;  1J6X A;  3FKI A;  4LJM A;  1YHQ S;  2FQT A;  3SI8 A;  4GKK J;  3W7B A;  4NX9 A;  1GTH A;  5CYQ B;  1USM A;  1RT6 B;  4CH0 S;  5DRK A;  4R8U B;  1KTQ A;  3EZ5 A;  1ZET A;  5KFX A;  3NUH A;  4A8F A;  1M5V C;  3VGS A;  4U9R A;  4ZVE A;  1HI9 A;  1UVI A;  1HNZ J;  1RWV B;  5F41 A;  1F6T A;  1YVF A;  1NK6 A;  5HAN A;  4U6P A;  1PG5 B;  4NA3 A;  2ZVI A;  3CNQ P;  1TL3 B;  3MM9 A;  2YNF B;  2ZE2 A;  1YJN S;  2R8H A;  2HAI A;  1QE1 A;  2NVT K;  3PFE A;  4EBC A;  4LFC J;  1ICE B;  3LP1 B;  2F65 A;  4WWS A;  2KFY A;  4LLG A;  2R2R A;  2HSE B;  2B8P A;  2NVT C;  1WG5 A;  1PGZ A;  1X5P A;  2W2P P;  4DQQ A;  1XIQ A;  1CUL A;  2C22 A;  1IR0 A;  4LSL B;  3HFV A;  1MN7 A;  2WVE A;  2JA5 K;  1QAJ A;  4OZN A;  3OFE A;  3V81 A;  1G1X A;  3J7Y U;  2WVF A;  2AD9 A;  2ZHO A;  4IH6 A;  4KMD A;  2JA5 C;  5EGY A;  3M6W A;  2F40 A;  2FQQ B;  3IR5 B;  1CVJ A;  4USV A;  1RTJ B;  1RCO B;  2AYG A;  2D9P A;  1I94 F;  1S9E B;  3LH2 S;  4NLV A;  2QSF A;  4DZD A;  3H2U B;  1ZQ1 C;  4PG5 A;  5CZV A;  4OZL A;  1NJX A;  1TP7 A;  3JAM Y;  2Q66 A;  4JV0 A;  1U0H B;  4ES2 A;  2E5H A;  4FXV A;  3KLE B;  3QIP A;  4GTC A;  2VUM A;  2XWX A;  2DNR A;  4JUZ A;  2MHN A;  4M5I A;  4KGZ B;  2W7A A;  3FKI C;  1T03 A;  4HTJ A;  2EG1 A;  1U8S A;  3GIR A;  3ZTS A;  3LAN A;  1V3R A;  2FVR A;  1NPP A;  2B4O A;  3THV A;  2F1F A;  2XSJ A;  4WJ4 A;  5LT5 A;  3R2C J;  1TQL A;  4YFX A;  3LAK A;  5E3A A;  3BGF A;  1J2V A;  3R5C A;  4U8Y A;  5GAH U;  5EWE A;  2FLN A;  4U95 A;  3KHR A;  3SXL A;  2DH9 A;  1HBO B;  4TVA B;  4CLP A;  2GZO A;  3RU0 A;  2CJB A;  3RB6 A;  4JV5 F;  1SBR A;  3H7H B;  3HF5 A;  2Q1L A;  2CQD A;  2H65 B;  2NLW A;  3CT9 A;  1EKR A;  1RAG B;  5L9N A;  3MEG B;  3MPD A;  5AXK A;  2NUU G;  3HVW A;  2ZH2 A;  2HHH F;  1XZQ B;  4DUY J;  4AFF A;  1GMU A;  4KO0 B;  2WSE C;  3EDQ B;  1DQ9 A;  3DGP A;  4UOH A;  5TMC A;  2FC8 A;  2V6A A;  4USJ C;  3UN3 A;  3FEX B;  3DN9 A;  4O3S A;  1N33 J;  1RJJ A;  3MEE B;  4NA1 A;  4M5J A;  4MQ9 A;  3NL0 A;  1KBR A;  3ILI A;  4ZLP A;  4RW8 A;  1FTC A;  1RZM A;  1U1P A;  3N01 A;  2DGW A;  3I4N K;  2GHW A;  3TX0 A;  5KFJ A;  2VBY A;  2O5D A;  2OD4 A;  4C3I K;  3KHL A;  3CD6 S;  1VH2 A;  1CJU B;  1R8P A;  1VLO A;  5M5Y K;  2DJW A;  1YIJ S;  4K2J A;  3I4N C;  3D3C J;  4MIW A;  2FLP A;  4KAT A;  4DPW A;  4I7F A;  4C3I C;  1ZZN A;  2CFA A;  2YWH A;  1BE4 A;  1SL1 A;  3UNY A;  4A8X A;  1X5S A;  3OQ2 A;  1DD5 A;  2RU9 A;  1IKW A;  2DBB A;  3GCW P;  3I31 A;  3PX6 A;  1OSD A;  3CIZ A;  4LF7 F;  1QSS A;  3IA0 A;  3T1A A;  2I8E A;  5LMU J;  3TFI A;  3TZX A;  1XNR F;  3IM9 A;  3T6J A;  2RU3 A;  2KHD A;  5EX3 A;  1WDT A;  3HFZ B;  4XDC A;  1N34 J;  4XLN A;  1N5V A;  4NLU A;  3BN4 A;  1UCN A;  1I5O B;  1SV5 A;  1G6B A;  5HAT A;  2R7U A;  1FDB A;  4JI6 F;  1UFL A;  3QQC D;  4RWX A;  5BYS A;  5HVG A;  1REG X;  3Q8U A;  4BY1 K;  1FT8 A;  3Q8Y A;  1V5V A;  4BY1 C;  2YKN B;  1R27 B;  1WDD A;  4RZR A;  1ZM4 A;  2HFS A;  3I4P A;  2HHU A;  3CUN A;  1Q81 T;  3W9I A;  3K5P A;  2P2C B;  5K14 A;  5B7W A;  4WP8 A;  1WHX A;  2AV5 A;  2E5G A;  5JUM A;  4LFA F;  1FTR A;  4P10 A;  4P5B A;  4OYZ A;  4YY3 F;  4WFY A;  1CC8 A;  4OL8 A;  1KOO A;  3BSC A;  1SVD A;  5KT6 A;  2E5L J;  1EP4 A;  4JI5 F;  4PYA A;  3KHG A;  4KV8 B;  1VQ6 S;  3DNC A;  2GIQ A;  1JLF B;  1EHW A;  3GQC A;  1JLB B;  1CC7 A;  1FDN A;  2GNK A;  2LYV A;  1YNJ A;  4WJB A;  2BW2 A;  2HFZ A;  3DKD A;  4FS1 A;  1KDN A;  3PYD A;  4Q5S A;  2H51 B;  3E2E A;  3TAR A;  1IM6 A;  5T7L A;  4J9V A;  1VBZ A;  1FJG F;  2E1P A;  3AH6 A;  2X51 A;  2EXU A;  4ZPV R;  2FIU A;  2KHC A;  3AXK A;  2BJE A;  3OLA A;  1MU2 A;  1S99 A;  3HJV A;  4GTE A;  2F9J A;  2A6E A;  4CYU A;  1FJ7 A;  4OHX A;  3T6B A;  2B5J B;  3O3L A;  4OYA A;  2DY1 A;  2YKM A;  3BP8 C;  3UCG A;  4N8O A;  1XZP A;  1U0S A;  3MUT P;  1CJV A;  1Q7Y T;  1FRI A;  2W7V A;  2MKC A;  1TK8 A;  2D9O A;  2V94 A;  4CO3 A;  2FVC A;  5K8O A;  5JVO A;  5GAD U;  1NK5 A;  1VRT B;  5E3R A;  3EYZ A;  2BM0 A;  1FNX H;  4X4U A;  1KS2 A;  3Q86 A;  2NVQ K;  3CED A;  2XCQ A;  2MKJ A;  2MKK A;  3ZTQ A;  1X9M A;  1DTQ B;  4BC7 A;  1AUS L;  3KJV B;  2F4V J;  2NVQ C;  5I4M A;  1JJH A;  3FVY A;  3K7A K;  4DQS A;  2U1A A;  3OL7 A;  2HRT A;  1H72 C;  3RZA A;  3K7A C;  5IYD K;  1PCA A;  3VAL A;  3IPJ A;  3EMT A;  2M9K A;  1S59 A;  2BAB A;  4BLG A;  1HBU B;  1TWA A;  3ITH A;  1T0T V;  4CLW A;  3FEZ A;  3OXG A;  3MML B;  4OQJ A;  5IYD C;  1JOE A;  4MJK A;  2WB4 A;  2JX2 A;  1TKZ B;  3DLL Q;  4KJI A;  4Y6I A;  5F8N A;  4LR8 A;  3FEY B;  3PX0 A;  2WON A;  4PQU A;  4FP9 A;  3CDA A;  4RU9 A;  1O27 A;  2XMA A;  1PJ5 A;  3RB0 A;  2DGQ A;  3KK1 A;  4QWB A;  5D0R A;  1QVG R;  3GTK A;  1AZS A;  2I5J A;  4F26 A;  3IR6 B;  4A3G K;  1KQ4 A;  1S0V A;  1FXL A;  4CH7 A;  2I9S A;  2UZA A;  3E8O A;  4M8L A;  3MD1 A;  1SXL A;  4WP3 A;  4A3G C;  2ZJR Q;  5C3E K;  4LF4 F;  1MWQ A;  1F9F A;  5KG0 A;  3KYL A;  2NCK L;  2WTF A;  4WFX A;  4CLY A;  4LRE A;  5C3E C;  2IJN A;  2V4Q A;  1RA6 A;  4B9S A;  4O3O A;  4KB2 A;  4EYI B;  2FHJ A;  2K7K A;  1ZBT A;  4I6A A;  4A8W A;  2UXC J;  1WF0 A;  4DX8 H;  2AEM A;  4N8N A;  4O4G B;  5M3M K;  4Y2C A;  2E5J A;  2DH8 A;  4A3F K;  4HYK A;  2ZZN A;  2QC3 A;  4CLU A;  2X1B A;  1URR A;  5KFC A;  1K73 T;  4DL7 A;  5KG4 A;  2HUR A;  2VJU A;  4A3F C;  2G2Z A;  1S1W B;  2MZ1 A;  1CJK B;  3BH6 B;  4Y52 K;  2HYI B;  2VH7 A;  2MZR A;  3CCV S;  3R97 A;  2HVE A;  1YGY A;  1P9Y A;  1LWF B;  3C6U B;  5F8H A;  1T05 B;  4Q7A A;  4J9L A;  1TWA K;  4B3O A;  1IXK A;  4Y52 C;  2JWN A;  1N48 A;  3S1N K;  2DB1 A;  2X1F A;  1XJW B;  2DXF A;  3CXC R;  2E7X A;  4HR2 A;  4WKY A;  1TWA C;  1EET A;  3S1N C;  1R8A A;  1IS1 A;  2WZ1 A;  4YB7 A;  2E29 A;  2E1C A;  1ZAX A;  1YBU A;  2DO4 A;  4B9L A;  4ZLL A;  4X66 J;  3GTK K;  4C0H A;  1YIT S;  3QRP A;  2CUY A;  3EZU A;  2VKR A;  3HZG A;  3OR2 B;  1HNW F;  3GTK C;  2RB7 A;  5D8H B;  4RMF A;  2C2K B;  4G1Q B;  1YZ7 A;  3VZI A;  3ZNU A;  5E0O A;  4E0D A;  3Q8Q B;  4QW9 A;  2CPE A;  1C0U B;  4WZQ A;  4M1K A;  2GFF A;  3NWR A;  3NGR A;  3GDZ A;  4C8L A;  2MLZ A;  3PAC A;  4H4O B;  4IDK A;  1DAR A;  3KLG B;  2HGM A;  3R3T A;  3IRX B;  3THP A;  1WHV A;  2ERR A;  1N52 B;  2KZZ A;  3RBX A;  5LM7 E;  2ZM6 F;  1TUW A;  2GCF A;  3EGV A;  4F2R A;  2Z30 B;  2IMO A;  1RHK B;  2VPZ B;  3ZNJ 1;  1OS5 A;  3BO3 A;  2AHO B;  1J5O B;  2RDI A;  2XMT A;  4DSJ A;  1XNQ F;  4B17 A;  1VBK A;  4U7U D;  3UQS A;  1R0C B;  3H5U A;  2D3O 1;  3PTW A;  2RE1 A;  4ID5 A;  3KG0 A;  3EGZ A;  4JI2 J;  2QA4 S;  2HMI B;  3Q8R B;  1VLY A;  1XC9 A;  5L9X A;  2H54 B;  5J2Q A;  4ED8 A;  3G4A A;  2QSW A;  4TQS A;  4K7Q A;  3UWT A;  3LPY A;  4GVB B;  2MLY A;  3GON A;  1QSL A;  1SL2 A;  2C2M B;  1FE4 A;  5E3Q A;  3NY0 A;  2BE2 A;  3TOQ A;  5F8G A;  1T03 B;  5M2P A;  3H5X A;  4RO0 A;  3Q2T C;  4I6W A;  2HVI A;  2YNG B;  2DNP A;  1VQL S;  1HI1 A;  1NSP A;  3NLC A;  2XI2 A;  1XR6 A;  2DKO B;  3G6E S;  2MB0 B;  4IRD A;  3DOM A;  1N8R T;  1G2E A;  1LWE B;  2RGR A;  3H0G K;  2G1D A;  3MEC B;  4N76 A;  3CW2 C;  1TL5 A;  3RBD A;  1HBM B;  2IJF A;  1J5E F;  1GX5 A;  3H0G C;  4OZ5 A;  4ER8 A;  1NK9 A;  1RTD B;  1U4B A;  4M1X A;  4Z7Y A;  5HSP A;  1CBK A;  3O1L A;  4L6V 3;  3PW4 A;  4GTL A;  3FCH A;  4V19 J;  4QWE A;  3NAH A;  2F63 A;  4YUD A;  5TMF A;  5G4D A;  4GFQ A;  4C0O C;  2B51 A;  2EC0 A;  1TR0 A;  2C28 A;  4P2X A;  1EI6 A;  4NZ0 A;  3ZZZ A;  1REV A;  2PHC B;  3J7Z 5;  4X4Q A;  1Q78 A;  1QY7 A;  1KON A;  3LPE A;  2JZ5 A;  1UW9 A;  1WHW A;  1BXN A;  1Y5L B;  4KIA A;  2DNQ A;  4FPR A;  1D9A A;  1RKI A;  2AT1 B;  4Q2M A;  2ZNZ A;  1B7F A;  2VFS A;  1IWG A;  1VK3 A;  1HWU A;  3VVT A;  2CG4 A;  1VJW A;  1XTZ A;  1HI8 A;  3PKY A;  2MJN A;  3ULH A;  2R8J A;  4V19 X;  2GAG C;  2GSN A;  2Y1L B;  2ZBP A;  3MWB A;  3MI7 X;  3SZZ A;  2HLU A;  1NDL A;  3PW0 A;  5T41 A;  6FD1 A;  2AJ0 A;  4B9N A;  1L3T A;  3EZO A;  2CQP A;  3KFW X;  2DXD A;  4RNO A;  4I7F B;  3I0S A;  2GQ2 A;  3DOK B;  4A8O A;  3PRB A;  5DZ7 A;  5IYB K;  2DH7 A;  3IWL A;  4ZVS B;  4RPF A;  2QMX A;  3DOL B;  3EUN A;  1SPB P;  3RW7 A;  5IYB C;  2MHE A;  3M7V A;  3IN5 A;  1UMJ A;  3BKU A;  5LJ3 Y;  2F4F A;  3KJQ B;  1MMN A;  1H2U X;  5K20 B;  3RZO K;  3D54 A;  2J9D E;  1MLA A;  1RWK B;  5AE2 A;  1DLO B;  3NS7 B;  3RZO C;  4CCH A;  4H4K A;  1O2B A;  4LBP A;  2UXD J;  4CLZ A;  1UPP A;  2VF3 A;  1FJC A;  2R4F A;  4CO1 A;  2G0J A;  1VMB A;  2RD5 C;  4DWI A;  1U48 A;  1H2V Z;  1U09 A;  2VZ9 A;  1EX8 A;  4D3H A;  2RHQ B;  2PMZ L;  1RHM B;  1U25 A;  2J5A A;  1YKW A;  4DG1 B;  4WXW A;  1RTI B;  4KY3 A;  4QIF A;  1C1C A;  4YS2 A;  2CPZ A;  3MCM A;  4N5S A;  1OSC A;  3MMB A;  1DAX A;  3ICL A;  2P9E A;  4DU7 A;  1FJE B;  3BP3 A;  1CEZ A;  3S7R A;  4C8Y A;  2N7C A;  2VFR A;  3M4X A;  4DCJ B;  1NSQ A;  1Z2L A;  4ALZ A;  2HFV A;  3TZY A;  1YZ6 A;  3MM7 B;  3KLV A;  2AGP A;  3LAM A;  3W60 A;  2E1M C;  1DUR A;  3OTO F;  4Q0B A;  4HKQ A;  2BBE A;  3V6D A;  4KMA A;  4YFK A;  4A3M K;  2M0G B;  3D1O A;  4FYY B;  1WI6 A;  4N47 A;  4WU2 A;  3M8S A;  3BQ2 A;  1R6Y A;  3M2U B;  1M5O C;  4FNH A;  1KFD A;  4A3M C;  4DN9 A;  1RT5 A;  2CJA A;  2ZFH A;  4U7C A;  3T00 A;  1IQZ A;  4AXJ A;  3S8S A;  3G82 A;  3BQ0 A;  1N4L A;  5B0A A;  3RUB L;  3WIU A;  4RW4 A;  5F8I A;  4QCL A;  3Q23 A;  4UZB A;  1VQP S;  4W90 B;  1I50 A;  4I69 A;  2DIT A;  2DR7 A;  4DF4 A;  3P3D A;  3OHB A;  1X4E A;  4H4K C;  1VDH A;  3HSZ A;  3GII A;  4CYU B;  2FB0 A;  3RR8 A;  4JI1 J;  2E9R X;  3WBZ A;  3RR7 A;  3OXL A;  2DNL A;  1NBE B;  1WI8 A;  4PEO A;  4KFB B;  1Y5N B;  4DUZ J;  1N32 F;  2W9C A;  1HBN B;  1M1G A;  3PEJ A;  4A3D K;  1F60 B;  4B3T J;  1FKP B;  1KQK A;  4ELU A;  1S12 A;  3I96 A;  1I51 B;  3M9N B;  2JA7 A;  5KTQ A;  3VAH A;  3TAM A;  4A3D C;  3ET6 A;  1RXO B;  1Q53 A;  2AGQ A;  2YX1 A;  3T5L A;  2CWX A;  3T1H J;  1ZA2 B;  4Z2X A;  3UR0 A;  3IGN A;  2LQ5 A;  2CPI A;  4DR4 F;  1FDA A;  2HVD A;  4PQA A;  1VGX A;  1TMM A;  1YJT A;  5CH7 B;  4GMK A;  1I1G A;  4OHW A;  3A8J A;  3CCT A;  1D9F A;  3ZZR A;  2PD1 A;  3FBC A;  3T1Y F;  1S77 D;  3TFJ A;  2GO9 A;  3HUL A;  3M1V B;  3QX3 A;  4G1I A;  4FVC A;  2HRY A;  4E8U A;  3HX9 A;  1D9D A;  3OVB A;  4O4R A;  5M3F K;  1WC4 A;  2KI2 A;  1XMQ J;  5J2M A;  1NJW A;  3ITH B;  1P27 B;  1Y1V A;  5C42 B;  3IBC B;  4FS2 A;  3KLH A;  2Z2Z A;  1H6K X;  3MR2 A;  4RU2 A;  4WK3 A;  2MQN A;  2MPU A;  4UOC A;  2XWY A;  1APS A;  1GAO A;  1OPI A;  2B7B B;  2Y3Y A;  4DX5 A;  3P8B B;  2GVD A;  5A8W B;  1R9T A;  2ZDO A;  1TK0 A;  4PWD A;  1LW2 B;  3CSK A;  3RAM A;  1HIY A;  3D4J A;  3BF4 A;  2IAJ A;  2NUH A;  3K58 A;  3T01 A;  5F8M A;  2IPO B;  1ZAW A;  3GPA A;  2C2O B;  2MQL A;  1ZPW X;  1IBM F;  1WC5 A;  4KE5 A;  4DR6 J;  4X65 J;  3CMA S;  2HVZ A;  4WKR A;  2JA7 K;  5HL8 A;  4P74 A;  4BHQ A;  2DCL A;  3W61 A;  3UD5 A;  4ZKA A;  2MZQ A;  3C14 A;  3GV8 B;  2V6S A;  4GKJ F;  2XZW A;  2G1H A;  4YEA A;  3EX7 B;  4EEY A;  1ISE A;  1X4B A;  2JA7 C;  3L09 A;  2X3D A;  2HHW A;  1PKU A;  2LCW A;  4ZVF A;  5KT4 A;  1WEY A;  1ZBS A;  1FD8 A;  1KHV A;  1G51 A;  3V4G A;  5A8R B;  3HVT B;  1S79 A;  3VQS A;  4ECV A;  1NO8 A;  1RUS A;  2CPH A;  3LWL A;  1RP5 A;  2RH6 A;  3DYA A;  2QLF B;  1I3O B;  4DQI A;  1JQW A;  4X84 A;  2YWF A;  4JI7 J;  4ZVO B;  2WK4 A;  2XMW A;  2DK2 A;  1BGX T;  4EZ9 A;  1HMV A;  1Y1V K;  5CJ9 A;  2EFG A;  1TU0 B;  1S6P B;  3ENA A;  2CFX A;  4A8Y A;  3BSO A;  1B64 A;  3GJS B;  3DLK A;  2ZH1 A;  3LF0 A;  3BYR A;  1F9E B;  1YJW S;  2ZJQ Q;  1Y1V C;  1BWE A;  1IWA A;  3TX8 A;  1Q82 T;  1F2G A;  3BGR A;  2V8P A;  1NPR A;  1JNR B;  4DXL A;  2V4R A;  1VQ5 S;  1R9T K;  3OJU A;  2CVI A;  1Q5Y A;  4TN2 A;  1SC4 B;  3HFK A;  3KWM A;  4DUT A;  4IQM A;  1R9T C;  2CDR B;  2EVZ A;  1ZYR A;  2OD6 A;  5CHP A;  4KM9 A;  2VPX B;  4QIV A;  2IRX A;  1F5B A;  2FZC B;  4ETX A;  4C3K A;  4NCG B;  2HQF A;  3F41 A;  3R5D A;  3US5 A;  3BS9 A;  2YPZ A;  4PPD A;  4W98 A;  4WCE Q;  3JAM U;  1WQH A;  1D1U A;  4K4V A;  3FQL A;  3AOC A;  3SCJ E;  3OFF A;  2XBP A;  1RT1 A;  2RAQ A;  4CTA A;  3OBI A;  3QJP A;  3TZZ A;  3IRW P;  1UZD A;  2VFV A;  2A0F B;  4KYZ A;  2WW4 A;  4EYH B;  1VIS A;  1BQM A;  3VZH A;  4R5P B;  3J81 Y;  4C3J K;  3HLU A;  3AQO A;  3KDN A;  4DV5 F;  3L4J A;  5IWA F;  3AD8 C;  4O44 A;  2M2B A;  2ZH6 A;  2QN6 B;  4UY8 5;  4BWM A;  2PDA A;  1F5A A;  1SKU B;  3BDP A;  4C3J C;  3GTG A;  4NML A;  4AL5 A;  4QYZ K;  1WSV A;  4YB5 A;  3MCS A;  2H5E A;  4OYO A;  2NXJ A;  4LFB F;  5DO2 A;  4ID5 B;  2RKI A;  3MR7 A;  3QAT A;  3PYE A;  4NCA A;  2ILZ A;  1M1K T;  3WC2 A;  2X7I A;  2IA0 A;  4HDG A;  1TMJ A;  1ULR A;  3CC7 S;  2DGO A;  2V2V A;  5JMN A;  5KFB A;  4ECQ A;  4G6V B;  1CQM A;  3HSG A;  2FYX A;  4ANE A;  4RUC A;  4JI3 J;  2HKE A;  3JYT B;  3I5C A;  1CS4 A;  2K3K A;  3OTB A;  4B3S F;  2DNN A;  2PT0 A;  2BXJ A;  2BJD A;  1S72 S;  1PAE X;  3AT1 B;  1SCJ B;  1CQN A;  2VG5 A;  5C5J A;  4DI6 A;  1UVN A;  3MAA A;  2JHE A;  1S4F A;  1O25 A;  5CCL A;  3HKZ L;  3CAG A;  5HBM A;  2BJ7 A;  1R0B G;  1S6Q B;  2ZIT A;  4YN3 B;  2HNZ A;  3AB4 B;  3G4C A;  3KKF A;  2UP1 A;  1X4F A;  3B4M A;  3H5S A;  5A0Y B;  2HIY A;  1HNZ F;  1S1U A;  2AJ2 A;  1BWV A;  2C1E B;  3E3X A;  1HQU A;  4KHR A;  5DG8 A;  2W2O P;  2EG2 A;  5AE3 A;  1RA7 A;  2IBO A;  3GTG K;  4Z7C A;  1AUD A;  4GT9 A;  4RW9 B;  2XI3 A;  1N6Q B;  2E7V A;  1BS2 A;  3KLI A;  2XSF A;  3ZZP A;  5HMZ A;  4N7T A;  4YFN A;  2HAF A;  3M6X A;  4LFC F;  3GTG C;  4YOE A;  2VIC A;  4P2F A;  4KGM A;  1JLC B;  5J2P B;  4JB8 B;  2QJ3 A;  4UTG A;  3UNG C;  4LF6 F;  2D3Z A;  3RBZ A;  3Q8V A;  4DV7 F;  3GTQ A;  4RLE A;  4GTA A;  1M0S A;  4KB4 A;  1SJR A;  1BQN B;  1MN9 A;  3C2P A;  3G9C A;  1IBK J;  1FXR A;  3AOA A;  3ILJ A;  2WVB A;  2CNN B;  5L39 A;  4FF2 A;  2NXU A;  2PN6 A;  4CP5 A;  3HT3 A;  4TYB A;  2KM8 C;  1UET A;  4MT1 A;  2KFZ A;  4LRF A;  5KT2 A;  4KPY A;  2QO3 A;  1VQS A;  3K0J A;  5A8K B;  5E5N A;  1V3Z A;  3FDS A;  3GTJ A;  2OI2 A;  1BQX A;  3TAQ A;  3NNA A;  3Q2S C;  1JLQ A;  3BEG B;  1O2F B;  5I42 A;  1KLM B;  2DY9 A;  1MG7 A;  2LEC A;  1QSY A;  2H4Y B;  1K9M T;  4J9S A;  1BHN A;  3C19 A;  2YPY A;  1RK8 A;  5JXS A;  1H7W A;  3HCX A;  2ASD A;  2FY1 A;  3OFH A;  1RAO A;  3LW5 C;  4F04 B;  1JLG A;  3VGT A;  2VBZ A;  3MMA B;  1PO6 A;  3EQL A;  3SQG A;  2DTJ A;  1X0P A;  3B4D A;  4M5L A;  4A4J A;  2FHO B;  1HD0 A;  4PG6 A;  4O23 A;  4RBU A;  5D6G A;  2GX8 A;  4LOW A;  4CWB A;  4TU7 A;  3EVO A;  4NLR A;  4ELT A;  2B6A B;  2ZHB A;  3A8K A;  4C0B A;  1Z1Z A;  1VQM S;  4OX6 A;  3K59 A;  4OV6 A;  5BYQ A;  1U47 A;  4HAC A;  3OUY A;  2VBX A;  3D0H E;  2CG8 A;  1B4S A;  1PBA A;  4ITS A;  3GTQ K;  4LBH A;  4IRK A;  1WAC A;  3I32 A;  4B3R F;  1WUU A;  1RHU B;  1J6V A;  2R42 A;  4NAS A;  1YCL A;  4Y28 C;  3GTY X;  5GMK a;  3OEP A;  3GTQ C;  1JX4 A;  2NVX A;  1VC5 A;  4I68 A;  1FCA A;  3SSR A;  3HOY C;  4DUY F;  2E66 A;  1JJC B;  4IFY B;  2D6F C;  3LOU A;  1H74 A;  3DI6 A;  3MGJ A;  4KC6 A;  5D4L A;  3ZO7 A;  2LQB A;  1I6V A;  4PZV A;  2PA8 L;  4GO5 X;  4LRC A;  2VV5 A;  3T3F A;  3GTJ K;  1UV7 A;  1KD1 T;  3L7P A;  1N33 F;  1UFK A;  2EBB A;  3QGP A;  1H73 A;  2CQ0 A;  3R5A A;  2NR0 A;  4NLD A;  1PJ7 A;  4KKO A;  3GTJ C;  3W3S A;  1SH2 A;  2R92 A;  5EWF A;  2GVZ A;  2N3O A;  2LMI A;  4WBF A;  4URG A;  3QT6 A;  3ISN C;  1N0U A;  2GS8 A;  2OKQ A;  1T3N A;  3VAI A;  4DV2 F;  4RW4 B;  4F0K A;  1PC5 A;  4YP3 A;  2V4J A;  3EXY A;  2MDA A;  1HPZ A;  1X5T A;  5I3U B;  4QYZ J;  3RW6 A;  2NYH A;  3M8W A;  1Q8L A;  2ATL A;  1G3O A;  5DQI A;  3MR6 A;  2PA3 A;  3SYZ A;  3H98 A;  1W2B R;  3GSD A;  1NU4 A;  4MFB B;  3Q22 A;  3NEK A;  1HW9 A;  4G0W A;  2ZDP A;  3B78 A;  2CW0 A;  5LMU F;  4C48 A;  2XGP A;  2HQI A;  1TKD A;  3DXS X;  1FEH A;  3W65 A;  1KTV A;  1TWG A;  3H0P A;  3W2W A;  3ENW A;  1N34 F;  4BS2 A;  1WTF A;  1PYT A;  3D6T B;  3JTP A;  1T95 A;  3P45 B;  2JVR A;  1VFJ A;  1RWX B;  1YBT A;  1WG1 A;  3J7Y I;  1NJI T;  2V50 A;  1GEH A;  5FDL B;  3OD2 A;  3Q8P B;  1RTH A;  4TNO A;  3SV3 A;  2R8K A;  1FK9 A;  3M8Q A;  3J7Z T;  3MFH A;  3NRB A;  2AX0 A;  5KT5 A;  3N79 A;  2W25 A;  1UTA A;  4FKY A;  5KFN A;  5I3Q A;  4TLQ A;  1XPP A;  3F56 A;  3K5L A;  4DEZ A;  3M2R B;  3QT8 A;  1X60 A;  2XTJ P;  2VOO A;  5AJ3 F;  3MED B;  4IR9 A;  5CAA A;  4AL6 A;  2R92 K;  1NAQ A;  1LXN A;  3D5M A;  2V6T A;  4C8K A;  2YWW A;  5J2M B;  3OSP A;  2AYB A;  3A8E A;  2R92 C;  3QAE A;  2G13 A;  4I2P B;  2D3O R;  3V2U C;  3CJ2 A;  2H3E B;  1JK9 B;  7AT1 B;  2E5L F;  5E3P A;  1WC0 A;  4PXC A;  1LW0 A;  2BE7 D;  1QUP A;  2DO0 A;  4PWD B;  2JA8 K;  5M5W K;  1W25 A;  1JLA A;  3LUY A;  1NK8 A;  1NJY A;  1SC1 B;  2CQB A;  5CXT A;  2XY6 A;  2IAJ B;  4PXE A;  3R1L A;  2JA8 C;  2XG8 A;  1DY3 A;  1S1X A;  5C24 B;  4UW2 A;  2FJE B;  4PYD A;  3TYT A;  1SQG A;  3S01 A;  1IKV A;  1GMV A;  4FM9 A;  2BAN A;  2KXH A;  1TWG K;  2BOP A;  1JNZ B;  2OPS A;  2B8Q A;  4OIX A;  3QFW A;  1Y3K A;  3QLH A;  1TWG C;  1MML A;  5C4X K;  3AJ2 A;  1LOU A;  3UD3 P;  3W5Y A;  4OHY A;  2Z2Y B;  1YTY A;  2LEA A;  5C4X C;  4RWW A;  2CKW A;  3LP0 A;  4WFA Q;  1VHF A;  4K59 A;  1L0W A;  3KK2 A;  3ERE D;  3BGL A;  1NM2 A;  3CCR S;  1UKU A;  4TU9 A;  1L3U A;  3M6U A;  4DR5 J;  1NXI A;  2BKO A;  1TWC K;  1RLD A;  2JSX A;  2L9N A;  4LK1 A;  4NYP A;  3I6P A;  3MEK A;  4B3M F;  2QLW A;  1YBA A;  1N5T A;  1VRQ C;  2KRR A;  4ZK7 M;  1RWM B;  2EKN A;  2EFN A;  1TKT B;  2L48 A;  2VG6 A;  4YR2 A;  1TWC C;  2QX0 A;  3ILO A;  3A12 A;  4LRD A;  3TEH B;  4YFU A;  5RUB A;  5C4J K;  4P9S A;  3POT B;  1RSC A;  4RW7 A;  4ECU A;  2JA6 K;  1URN A;  2XCO A;  1NSA A;  2XMK A;  5E68 A;  4ZS6 A;  5C4J C;  4ZHR A;  4Y2I A;  2G2O A;  3SSQ A;  2J7W A;  5KFR A;  4PG8 A;  4I0W A;  2HIQ A;  1XMO F;  3L7U A;  4J7C A;  2QL9 B;  2BE5 A;  5CAB A;  2R2S A;  2MKH A;  4DMZ A;  5CYM A;  3DMJ A;  1SJF A;  3I82 A;  1IKY A;  3ZZU A;  2A6H A;  3MMJ A;  4IG3 A;  2AF6 A;  2ROP A;  1S1V A;  4KAI A;  3W9J A;  1VOM A;  4AD6 A;  5J1N A;  2W2N P;  5D78 A;  2O01 C;  4ZVG A;  1KQF B;  1PAU B;  4WFZ A;  4K4Z A;  5IP9 K;  4WU3 A;  1U6B A;  2C3P A;  5EWG A;  4DF8 A;  3G8S A;  1N5S A;  4DV4 J;  2PEH A;  3M30 B;  3MR3 A;  1GXT A;  3TUJ C;  3R5J B;  2HS3 A;  2V8D A;  2OJ3 A;  3KLF B;  4MYT A;  4C2M A;  5KFA A;  3MAH A;  3IR7 B;  3I55 S;  1HYS B;  3AHP A;  2K8G A;  2C3M A;  3N4W A;  4M63 A;  4ED3 A;  4OV1 A;  2VG7 A;  3IFE A;  5B0D A;  1WIH A;  2FHJ D;  1Y10 A;  3FMW A;  3SCL E;  5HVF A;  1WKK A;  1MRO B;  2HNY A;  3JST A;  3FCW A;  4ZP6 A;  1OIA A;  4J9R A;  2RKI B;  2CJK A;  2DR6 A;  2WAQ L;  4UOF A;  4DL5 A;  4DV6 J;  3HSD A;  2BX6 A;  4G7O A;  3CO9 A;  3DLE A;  1C0T A;  4NI2 A;  3QNW B;  1A7G E;  2O5I A;  3C16 A;  4AL7 A;  2QEX S;  3MAQ A;  1TTH B;  4V1A k;  1T11 A;  2W8L A;  4CM2 A;  2DEJ A;  2R7X A;  1QTN B;  4PUO A;  2WVC A;  2W01 A;  2F8H A;  3IWN C;  5C7P A;  4LF7 J;  5DJB A;  3KOA A;  1OQ6 A;  1SJ1 A;  2UUA J;  4IG0 A;  3P5T L;  3OT9 A;  1YQH A;  2ZBC A;  2JEF A;  5DM7 Q;  4DDQ A;  2F9D A;  2V2K A;  3T5J A;  4I6Y A;  4J9K A;  2GJF A;  3KK3 B;  3G86 A;  2KJW A;  2YKA A;  4LUB A;  3QRQ A;  1UJ5 A;  3PVX A;  5FJ8 K;  4Y0F A;  4X66 F;  1O28 A;  4ANC A;  2A18 A;  3H2L A;  3I9Z A;  1H0H B;  2WOM B;  4DQR A;  5KFZ A;  5F0W A;  3FFI A;  2XMJ A;  3PIP Q;  1U1R A;  4YR0 A;  3GTO A;  4C2M K;  3DXJ A;  5SUH A;  4RW6 A;  1ZTT A;  4DL4 A;  1U1M A;  1B0T A;  5D15 A;  2POK A;  4C2M C;  5EHH A;  2J0X A;  4UZC A;  1WOO A;  2ZKU A;  2ZD1 B;  5IT9 Y;  2ZHA A;  2CQG A;  1YX2 A;  2DHA A;  5HLF A;  1FFS B;  2FVS A;  1DBD A;  4R0J A;  4J9Q A;  3EPI A;  1HAR A;  4ICL A;  4ELV A;  3QT5 A;  4LFA J;  5IV4 A;  2HZC A;  4JK1 A;  5IC4 B;  2AMC B;  1E6Y B;  1XWL A;  3HSJ A;  4KMU A;  2V6U A;  4DFP A;  3SV4 A;  3VF0 B;  4CO5 A;  4YB1 P;  4C3H K;  4F4X A;  2WSF C;  5HRO B;  1P6T A;  4U67 Q;  3V6H A;  2MQM A;  1FRM A;  5D0G A;  4DN0 A;  2CJX B;  4C3H C;  3NGD A;  1EQM A;  3HXA A;  3VWS A;  1AT1 B;  2YKP A;  3NNC A;  1PIE A;  5LMN F;  5KG3 A;  2UU9 F;  2XEX A;  1NH7 A;  3ORE A;  5KFO A;  3MTK A;  4JI2 F;  1TWF K;  2MY7 A;  2BVZ A;  5DDP C;  5AE1 A;  2AKW B;  2ZC4 A;  4CDI A;  4I1T A;  1U8W A;  3AQP A;  4ZPA A;  5D4P A;  4AYB L;  4DR7 F;  2EBG A;  1TWF C;  1L3V A;  1JLQ B;  4DL2 A;  4FBT A;  4NCB A;  3DRR A;  1NCL A;  3CPW R;  1KQG B;  5ITH A;  1C0A A;  3PX4 A;  2GHP A;  2AZ1 A;  3OR1 A;  4OJH A;  5HL7 Q;  3C15 B;  1FE0 A;  4IOC Q;  2DNG A;  3DRP B;  1T9U A;  1RT3 A;  4LQ3 A;  1LKZ A;  5IP7 K;  2CQH A;  1OY6 A;  1PYO B;  4Y34 A;  2ZJP Q;  2WBM A;  2HS0 A;  4EMD A;  3CJ4 A;  1RAA B;  2MGZ B;  5IP7 C;  1RAH B;  2FD2 A;  3VR1 A;  3G8Q A;  1J27 A;  2FJW A;  4O3P A;  1FA0 A;  5ETS A;  4P72 A;  2G2Y A;  1WTB A;  2MLX A;  4KDD A;  3IMQ J;  1WKJ A;  2NSB A;  1R8H A;  2W9B A;  2O67 A;  1UEU A;  1TVR B;  4LF2 A;  5IM0 A;  2R93 A;  2QZ8 A;  1DJ0 A;  4CT9 A;  2E2H A;  4DR3 J;  3F73 A;  4USH A;  4GTD A;  5D3G A;  2UV8 G;  4USM A;  3TVY A;  1HKA A;  2KFN A;  3BPS P;  4OI3 A;  1ZS6 A;  2HGL A;  3MM8 B;  3VAF A;  3M8P B;  1F3F A;  3MCO A;  1IKX A;  2IC3 A;  2NRE A;  3M05 A;  4UY8 T;  3LGH A;  3LGM A;  1W7W A;  1MW7 A;  3DDN A;  3B82 A;  4LR9 A;  3GJR B;  5ETK A;  4IRC A;  3S0X A;  3L4K A;  3CCQ S;  1INN A;  3CMQ A;  3GFY A;  4N56 A;  2XLI A;  4NLS A;  5B0B A;  4PR6 A;  1OPZ A;  2YWE A;  4LRB A;  3D9B A;  4OYI A;  4IOA Q;  4PG7 A;  3HOU K;  2RQM A;  2KN4 A;  4AND A;  4IO1 A;  3BGO P;  2W2Q P;  3S2D K;  2P8T A;  4M5K A;  2IM0 A;  1GE9 A;  2R3V A;  3M8Y A;  4Y2M A;  4KKO B;  4WXO A;  3HOU C;  2ILY A;  1RAD B;  5KFS A;  3S2D C;  5IV3 A;  3N28 A;  1B4A A;  1EQ0 A;  2MQP A;  2ASL A;  3BB5 A;  5IT0 A;  3TW0 A;  5KFH A;  1RDR A;  4Y7N K;  2B9Y A;  3UE2 A;  5F8L A;  3BBF A;  4DOZ A;  1DTT B;  3IAS 9;  2R9L A;  4DR2 F;  3VA7 A;  1X4C A;  4Y7N C;  5C25 A;  3U7J A;  3GIJ A;  1AA1 B;  3EVW A;  4MK8 A;  1Q8I A;  2APO A;  2VBW A;  1S1T B;  2R93 K;  4RNH A;  3TQ1 A;  3VGV A;  2E2H K;  1SJ4 P;  4F4W A;  3U1M A;  2NXN A;  4Q43 A;  3BN7 A;  5KG7 A;  2CYY A;  4MKA A;  2R93 C;  3CJR A;  3IG1 B;  2E2H C;  3BV8 A;  5M2U A;  3N6L A;  4H4M A;  1U1O A;  1WC1 A;  4QIW D;  3D1H A;  3VTI A;  1KNZ A;  2UV8 A;  4DS5 A;  2XZT B;  1HQE B;  4HH0 A;  3K17 A;  2J0Q D;  2AP6 A;  2CNO B;  2QLJ B;  4NA2 A;  4BDP A;  1NB7 A;  3ONQ A;  1YJU A;  2AX1 A;  4OYX A;  4X62 J;  2QV6 A;  2FLL A;  1VRU B;  4ECS A;  4ID8 A;  4O0N A;  4IO9 Q;  5KOW A;  4PAA A;  5L46 A;  4DX7 A;  3GG0 A;  4A8K A;  5HP1 A;  2WSC C;  3K5O A;  2KVQ E;  3NGK A;  4KGV B;  3QJJ A;  3ETM A;  4CO2 A;  3PHT A;  4OX8 A;  3DDK A;  2UXB J;  2HND A;  3OJS A;  5IC6 B;  2RQ4 A;  3IWX A;  3N0V A;  2MY8 A;  1HNW J;  1NKE A;  2CPD A;  1RYS A;  2ZUG A;  1B99 A;  4PWU A;  1GNK A;  5K9F A;  2P8I A;  3AD9 C;  3T02 A;  4J90 A;  2QLX A;  3VHQ A;  3TEG A;  2ZOF A;  1RWN B;  4Y3C A;  3PIO Q;  1OY8 A;  4DFJ A;  4NLX A;  1IBL F;  2LQJ A;  1FDD A;  3HHL C;  5B0F A;  4TY8 B;  3VV2 B;  1X4A A;  1KHW A;  1UWB A;  4K5R A;  3JSY A;  3R9L A;  5HQM A;  1X4D A;  2AQ4 A;  3E01 B;  1KKH A;  5FLM K;  1VK8 A;  5DLF A;  4HDH A;  4DCO B;  2HK2 A;  2AYM A;  2MYF A;  4WZM A;  2ZBQ A;  3NCR A;  2D69 A;  2H4W B;  4DV3 F;  4JI0 F;  2OML A;  3WIV A;  2BAN B;  5FLM C;  4LF8 F;  3LPX A;  4N41 A;  1IM4 A;  3WC0 A;  2BUN A;  3O44 A;  4DL0 C;  4CI0 B;  1D0E A;  3L7O A;  1L3S A;  1EIY B;  1TUG B;  5ETV A;  3QLH B;  3H4D A;  4HTI A;  3PO5 A;  3SDE B;  4AT1 B;  2DEI A;  2KH9 A;  3MOJ B;  4JP8 A;  3TUP A;  5DDQ C;  2IYI A;  4TY9 A;  4JI1 F;  3G2X A;  3GEE A;  1RT4 A;  4ZVQ B;  2L08 A;  4O2D A;  4DUZ F;  2LQ9 A;  5SZT A;  3HDS A;  4B3T F;  4FPI A;  5A2Q Y;  2DR8 A;  4RL1 A;  2QA4 G;  2YNH A;  3MOZ A;  2GIF A;  2AJ4 A;  2JDJ A;  5IOT A;  2JFK A;  3QSI A;  3NGT A;  2FJX A;  4RW7 B;  1JLE A;  5HO4 A;  3DLH A;  1R7I A;  3EVM A;  2A6M A;  3PKM A;  3J81 U;  2VB6 A;  1SJQ A;  3L9Z A;  2OPQ A;  4USW A;  5ETL A;  3OVA A;  4PPZ A;  2OFH X;  1SUQ A;  5HAO A;  2N4C A;  3D6M B;  3TUZ C;  2QFI A;  3GTL K;  5LSR A;  1J5E J;  1MSW D;  3BRE A;  5A76 A;  5CYQ A;  1XMQ F;  3GTL C;  1NME B;  4WE1 A;  3MR5 A;  4DSK A;  4A3C K;  3T9Z A;  2R8I A;  1HHQ A;  4QU6 A;  1SMY A;  1DQ8 A;  4NEY A;  4IG3 B;  3VQT A;  4EUV A;  3CJK A;  2OLW A;  3G96 A;  5BJR A;  4DQP A;  4F8R A;  3LA0 A;  1GFW B;  3OL8 A;  1ZAV A;  4A3C C;  1WKL A;  4TU8 A;  1O24 A;  1TL3 A;  3G6X A;  2YNF A;  1OO0 B;  1TL1 A;  3GIM A;  3KXD A;  2CPY A;  1SL0 A;  4MEY A;  4OJ3 A;  2MZJ A;  3VAM A;  4Q45 A;  4EGL A;  3T41 A;  1U6Z A;  4DCP B;  1V6H A;  5KG1 A;  3HVA A;  3GV5 B;  1HNX J;  4G3I A;  2WB1 D;  3FQK A;  2W24 A;  4DR6 F;  4X65 F;  4KRW A;  1UVK A;  4LSL A;  2EC2 A;  4DPY A;  2MTL A;  1R0A B;  5KFE A;  3TVZ A;  4F4Z A;  2P6T A;  3BKF A;  1S0O A;  3AFG A;  3D0G E;  4JOU A;  2HNY B;  4CIO A;  3CCS S;  5J1E B;  2W8K A;  2GAH C;  2OEL A;  1ZYQ A;  1BY9 A;  1UP1 A;  3SFG A;  2VC1 A;  2LEB A;  1QAI A;  3MZI A;  2XYH B;  2KYX A;  5KG2 A;  4C97 A;  3NWG A;  5BR8 J;  4NLG A;  2BDP A;  1BGW A;  3I0R B;  5KT7 A;  1S9E A;  1WC6 A;  3R5G A;  3GJT B;  4F67 A;  5HJY A;  3MM5 A;  4GTF A;  2DVI A;  2R2U A;  1U0H A;  2IHR 1;  3KLE A;  3L95 X;  1HNV B;  3R5B A;  4FF3 A;  1UVM A;  1EZZ B;  3S1R K;  2J8S A;  3NMA A;  4S0M A;  1ROF A;  4IG0 B;  4LVN P;  5AT1 B;  4MEX A;  1P1T A;  2FVP A;  1Q16 B;  3GWC A;  5HMW A;  2N3L A;  3S1R C;  1S4E A;  2CVE A;  1RTZ A;  4BBY A;  1OYE A;  2YBV A;  3CVK A;  3Q8S B;  4ZPT R;  2DHS A;  3KUH A;  4OYW A;  2HHT A;  4UOG A;  2OAU A;  1YK9 A;  1SKW A;  1X0F A;  5ETO A;  5D77 A;  2EFQ A;  1OQ3 A;  2MZT A;  1YJV A;  1HBO A;  3TJA A;  4W92 B;  2QRR A;  3FFI B;  1N36 F;  1JIH A;  4CO0 A;  3CIM A;  5LSO A;  4ZCK A;  2XS7 A;  2Y0S D;  3C66 A;  1C4C A;  3DHX A;  2IM2 A;  3HZE A;  2O66 A;  2B9W A;  3GR1 A;  3M9O B;  3M32 B;  4CM0 A;  3PEH A;  2J8A A;  2BJ3 A;  3NCP A;  1IW7 A;  1SIZ A;  4M5M A;  1VCT A;  3TA0 A;  3WX4 A;  2ZOM A;  4DFK A;  4YDX A;  3R6G B;  2J9D A;  4P75 A;  4GRS A;  1TV6 B;  2HQ3 A;  5CQG A;  1XZQ A;  5ETP A;  1KC8 T;  5IQ6 A;  2GC8 A;  1Q0N A;  1F0X A;  3TWZ A;  3UVJ A;  1VQ4 S;  1WQG A;  4DLG A;  3CJ0 A;  3K5N A;  4ATN A;  1SH0 A;  3PG9 A;  2C2E A;  1QUV A;  4C98 A;  4DU8 A;  2DRB A;  4C3M A;  2GMJ A;  3OTO J;  2PMW A;  1FRJ A;  2J76 E;  1F9H A;  2J0S D;  3RRK A;  2DPJ A;  4DL3 A;  3GYX B;  3MEE A;  2R7O A;  4LQ9 A;  2CJ9 A;  4A8M P;  3JSR A;  1E6V B;  2FJV A;  1F7U A;  3SBM A;  3UI3 A;  1H2T Z;  4ZVU B;  1K83 K;  1D09 B;  1HWK A;  3DLJ A;  1QVF R;  3GSI A;  4G7H A;  4K4Y A;  4RJV A;  4O0I A;  1K83 C;  1F7V A;  1YJ9 S;  1RT7 B;  1FRH A;  1FX2 A;  4NLO A;  4LIR A;  4NXN F;  5HN0 A;  1CJU A;  4XSX A;  2F8E X;  1K8A T;  2IDL A;  3FUY A;  1BC6 A;  4HT7 A;  1NKB A;  2GGP B;  3HP6 A;  4CO4 A;  4M5D A;  1U45 A;  4URS A;  3DU5 A;  4L74 A;  2YQ3 A;  3FZ2 A;  4JI3 F;  4BLB A;  3KNA A;  4Q4Z A;  3JSM A;  3H4B A;  2VOD A;  4RNN A;  2G0C A;  5HQL A;  1Q4R A;  1KQS R;  3SSS A;  5J2N B;  2PMH A;  4I2Q A;  5ETQ A;  2RF2 B;  4K0K F;  1U2R A;  3EGN A;  3PJW A;  4IR1 A;  2B0G A;  4NLT A;  1GMW D;  4RNF A;  2DRA A;  1WWH A;  1HW8 A;  1X7V A;  4QOT A;  1F93 A;  2M5Y A;  2GQC A;  1U24 A;  4CT8 A;  1Y00 A;  4JYA F;  2YWG A;  3BH7 B;  4FYW B;  1O29 A;  4ZPW R;  3CD7 A;  3NG8 A;  2QMW A;  3CF5 Q;  2FLO A;  3TO8 A;  4ZLJ A;  3SCI E;  4ECX A;  4JI4 J;  2J7U A;  4WTO B;  1TAU A;  4UQG A;  1NSK L;  4FN5 A;  2YKN A;  3GTP A;  1I6J A;  2UUC J;  4JBC A;  4C11 B;  3IC1 A;  4R0E A;  2Q43 A;  2VQF J;  1IKX B;  2BZ2 A;  3DRS B;  2HQC A;  4QR2 A;  2DNH A;  1YWX A;  2LU1 A;  3G8T A;  2XS2 A;  1RT2 B;  2B4V A;  3LP2 B;  4MMO A;  1B70 B;  4NYZ A;  1RYR A;  4YHH J;  1HWL A;  2DNY A;  4G65 A;  1UVL A;  3PXG a;  4A8Q A;  1FEE A;  2JH3 A;  4PWW A;  3IBF B;  3HM9 A;  1N5Y B;  4KTQ A;  2XS5 A;  2GHV C;  2FC9 A;  1VQK S;  1N0V C;  3CCU S;  4ECR A;  3IO1 A;  4KV8 A;  5FLX U;  1H3D A;  1JLF A;  1ZOT A;  1JLB A;  3PRD A;  3EWG A;  2XB2 D;  1IBK F;  2DNZ A;  2DHG A;  2QGF B;  4NLP A;  3FRZ A;  4IKA A;  1LWC A;  2MKY A;  5KFG A;  2HWI A;  2HFO A;  1UJ6 A;  3LO3 A;  1MWY A;  4G0U A;  5HI7 A;  3CCE S;  4KAS A;  4HLB A;  1NDC A;  3RAX A;  5DZ6 A;  2Z2M A;  3H0G A;  2M7S A;  3MM9 B;  4RKU C;  2ZE2 B;  3RB4 A;  4KM8 A;  3ISN D;  4RUH A;  3UDL A;  1IJF B;  1QE1 B;  2ALY B;  3QAU A;  5JJB A;  3ETO A;  2A3J A;  4KMH A;  4LR7 A;  1NRK A;  3CD0 A;  1VIO A;  2B5J A;  2O3D A;  4ETZ A;  4DPO A;  2U2F A;  4LF9 J;  3CC4 S;  4F4Y A;  3GTP K;  3BQ1 A;  1CUL B;  2A2C A;  4BLA A;  2R7Q A;  5KFV A;  3T5H A;  3FOF A;  2ABY A;  2HBZ B;  1VQY A;  2CPF A;  1NHK L;  3GTP C;  3V81 B;  1F5C A;  4NOH A;  2LEP A;  1HQM A;  4G7Z A;  3QBC A;  1UA0 A;  1CPZ A;  1GK8 A;  3K5M A;  3BDE A;  1GXU A;  4ZP9 A;  1S6U A;  2Y0S L;  2QE5 A;  1T8E A;  2W2M P;  2AJQ A;  1DTQ A;  4KPC A;  1XXA A;  4P7V A;  4WFN Q;  3JTN A;  2VKZ G;  4GC7 A;  3JXO A;  4OJG A;  2NPI A;  1XR7 A;  2QFJ A;  2V8G A;  2IM3 A;  2PFD A;  1TFW A;  4I4B A;  1YG0 A;  4F0M A;  2BJ1 A;  4M5N A;  3QIP B;  5CZX A;  2XO7 A;  3ZTR A;  2AWZ A;  4ILM A;  1HBU A;  4ZPD A;  4DV0 J;  1JMT A;  2EI5 A;  2XO6 A;  2CQ3 A;  1S5Z A;  2NZ4 A;  4CH1 A;  4OYM A;  5C2G A;  3V4M A;  2XSJ B;  2D1C A;  2CWK A;  4PXD A;  4LSN A;  4KN7 A;  1UZH A;  3S15 K;  1HFE L;  3HOV K;  2CPJ A;  2XM3 A;  1AXQ A;  2MZS A;  4EBE A;  3C3L A;  1DZ5 A;  5KFD A;  3S15 C;  4Y65 A;  3HOV C;  4IUF A;  1X8D A;  2NZC A;  3UDV A;  4TLR A;  3IXQ A;  4QWD A;  4WIL A;  4DV5 J;  4TQR A;  5CCM A;  2N7Y A;  4C45 A;  1G7C B;  4BBS K;  4KAW X;  3GYN A;  2EFO A;  2Q6C A;  1ZXO A;  3EGW B;  1JJ4 A;  8ATC B;  3OFG A;  1XER A;  2CQC A;  4BBS C;  4Q2L A;  1NHU A;  4LFB J;  3DGP B;  1VS3 A;  1NKC A;  2C2N A;  4O4G A;  4FVM A;  2E1A A;  2UVV A;  3IBW A;  5L1J A;  3E51 A;  5KFP A;  3KJF B;  4Y00 A;  3UD4 P;  3MUV P;  1WD6 A;  2ZUA A;  4GO7 X;  1S1W A;  1CJK A;  4RW8 B;  4U96 A;  2YNH B;  2F3J A;  2XNQ A;  3C6U A;  4K4W A;  2VDI A;  2EK1 A;  4RUA A;  4DV1 J;  3P49 B;  2CQ1 A;  3RRG A;  4IH7 A;  3ZTO A;  9RUB A;  2HLT A;  1YJ7 A;  2R8G A;  4ES1 A;  1J98 A;  3BBC A;  1HWI A;  4ED7 A;  1UEV A;  2CFA B;  3I9V 9;  1KVJ A;  1Y0H A;  2JEI A;  4KH0 B;  2C3U A;  2M4M A;  1IKW B;  2FGC A;  2VIH A;  2AW0 A;  3OR2 A;  4WE1 B;  4FYV B;  1S7I A;  1HI0 P;  2IRY A;  4ZCI A;  2YWK A;  2ZZT A;  5ADZ A;  4G1Q A;  1ITP A;  3CJK B;  4QR0 A;  4KT0 C;  1UWA A;  1C0U A;  1VQ9 S;  3FCV A;  4ZJO A;  3QWU A;  1SV5 B;  1TL1 B;  4H4O A;  1SKR A;  3MHY A;  3KLG A;  3IRX A;  2BAC A;  5HVH A;  3WDO A;  3UR3 C;  9ATC B;  2Y0B B;  1VYA A;  2P5V A;  4LF6 J;  1N56 A;  1U2C A;  3IS9 A;  3T19 A;  4DV7 J;  2P6S A;  2CIM A;  4QPT A;  1OY9 A;  2A69 A;  2LP4 A;  4OI1 A;  3CJS A;  1J5O A;  4USI A;  2MQQ A;  3TA1 A;  3W2V A;  1BUX A;  4OJ1 A;  3EIC A;  5K14 B;  1M5K C;  2OPR A;  1FER A;  4JI8 F;  2N82 B;  1N54 B;  4F7V A;  3JQK A;  2Y9H A;  2HMI A;  3CE8 A;  3FHZ A;  1R89 A;  4O3Q A;  5DM6 Q;  2GSU A;  5KT3 A;  2VOP A;  2A2D A;  2CXE A;  4ZIW A;  1EP4 B;  4DR5 F;  1SFO A;  2Q3P A;  1LK5 A;  3MM5 B;  5IT9 U;  4GVB A;  2OEK A;  3FKI K;  3P4U B;  4A93 K;  4YR3 A;  4L3K A;  1QAY A;  4KGK A;  4CRJ A;  5MLC V;  3HT0 A;  2K1R A;  2DNO A;  3DC2 A;  4QU7 A;  3VGU A;  4A93 C;  3N0B A;  1K47 A;  4LT6 A;  2YNG A;  2BMB A;  4UUW A;  4WF9 Q;  4A48 A;  2VAS A;  5T7L B;  2RQK A;  1PJ6 A;  4Q5V A;  3KUG A;  1L5U A;  1WG4 A;  2DYA A;  4L73 A;  4ED5 A;  1JQG A;  1LWE A;  2HZV A;  3QFH A;  2Y8Y A;  3MEC A;  2JNJ A;  5L8R C;  1MU2 B;  2ACY A;  3AJD A;  5DQH A;  5KOX A;  4IOB A;  1HBM A;  3M3Y K;  1XXC A;  3LGN A;  1RTD A;  3PW7 A;  4DS4 A;  3M3Y C;  4RUB A;  5DET A;  2YKM B;  2BRK A;  4KR0 B;  1T02 A;  3S6E A;  2NPF A;  2X1G A;  4B3R J;  1XZP B;  3DHW C;  4F25 A;  1CJV B;  2K7J A;  2XQC A;  5ETN A;  2GV1 A;  2V63 A;  4NRU A;  4IYQ A;  2LXU A;  4FZB A;  2SXL A;  1EJ7 L;  1RAE B;  2BRL A;  1S6O A;  2DGT A;  4ZH4 A;  2OEJ A;  3H90 A;  4KHP J;  3ELH A;  1LEO A;  1ZTW A;  3UVJ B;  3SQO P;  4OZ0 A;  4DV4 F;  1WOP A;  2NXE A;  4AQY F;  1DCP A;  1RLC L;  5E33 A;  4IH5 A;  1V9O A;  4X4P A;  1SFO K;  2XZD B;  1FNM A;  3NGS A;  4OX9 J;  3CCL S;  1IQ0 A;  3GP9 A;  2LVW A;  2KO1 A;  1LFW A;  1SFO C;  1RE1 B;  2VUM K;  3TA2 A;  5K8P A;  3BUE A;  1EAR A;  2R2T A;  3FSX A;  3N6M A;  3CWJ A;  2BQR A;  2LU2 A;  7FDR A;  2UVR A;  2VUM C;  1L3K A;  3A4T A;  1QAX A;  4EU0 A;  4DV6 F;  3BR8 A;  4DV2 J;  3LWM A;  2KJV A;  2XHW A;  1SI9 A;  2E2J K;  4K4S A;  4ZLN A;  4F4A A;  2F5G A;  3VAG A;  2WON B;  3AH5 A;  2G9O A;  4J9P A;  3QYY A;  4M5D B;  4PQU B;  4USK A;  2QA1 A;  1FXD A;  3MM6 A;  3DOK A;  5D0E A;  4QPX A;  3Q3Q A;  1O26 A;  5KFF A;  3KK1 B;  2E2J C;  2VD3 A;  2XLJ A;  4C4W A;  3JSM B;  4DSF A;  2DGX A;  4RX6 A;  5K8N A;  1AZS B;  3G71 S;  1CLF A;  2I5J B;  3DOL A;  3ZZY A;  2RT3 A;  3H5Y A;  2DIU A;  1U1Q A;  2ZKT A;  4I2Q B;  2UUA F;  3P96 A;  4OI6 A;  4FYD A;  2BOA A;  4XLP A;  1JKH A;  4BCA A;  2RIJ A;  5IS2 A;  5F9N A;  1DLO A;  3OTE A;  2ZH5 A;  2X3G A;  3S1M K;  1T9X A;  2MSS A;  1S0N A;  2M88 A;  4FZV A;  1UEK A;  1RWP B;  2LQ8 A;  4MIB A;  3S1M C;  1ZZF A;  5B0E A;  1Q5V A;  4FDF A;  2FHK A;  2PO4 A;  3QZ7 A;  4F50 A;  2RS8 A;  1NJZ A;  3SEO A;  3F0N A;  4DG1 A;  2YY3 A;  1RTI A;  5JFE A;  2YX4 A;  3EE3 A;  3MDF A;  4QJV A;  4MKB A;  4NXM F;  2E9Z A;  1TEL A;  4NWB A;  4LK0 A;  4YB6 A;  3CJT A;  5AJ3 J;  1W2I A;  3NCQ A;  3DRX A;  3R7S B;  2HEK A;  4B3O B;  4X4R A;  2HW3 A;  4WP9 A;  2H9Z A;  3MM7 A;  1SQF A;  2R7S A;  2J6S A;  1EET B;  2D7S A;  1CG2 A;  3O8W A;  4YME A;  2OSQ A;  2GIR A;  3V4I A;  3GV7 B;  3LTO A;  3TNV A;  2J7K A;  2C2R A;  3NKY A;  3IP0 A;  4BKW A;  3M2U A;  3VCD A;  3HHN B;  3HHE A;  3R7N B;  3NNH A;  1EAY C;  3GFH A;  3K7R A;  4FXW A;  2IVF B;  2YH1 A;  1FD2 A;  2B9E A;  1R43 A;  1LWC B;  3NOG A;  2VQE F;  4XTT A;  3I5A A;  2CZ4 A;  1OJ4 A;  3LAL A;  4P5A A;  3J81 j;  2JVO A;  3S16 K;  3BZQ A;  2L9D A;  2G4B A;  5B0C A;  5DS7 A;  1PIL A;  1GX6 A;  2CNL B;  2OTL S;  2RSQ A;  2YTC A;  1RBO B;  3NS5 A;  3QGI A;  3S16 C;  2Y8W A;  1M5P C;  1HR0 F;  3CC2 S;  2C3O A;  3WHI A;  1T9W A;  4ZIT A;  4IQX A;  1RCX B;  2RUS A;  4IDK B;  2XYP B;  2LXI A;  2KU7 A;  2FQO A;  4UUX A;  1S0M A;  3O2I A;  2IM1 A;  2WCX A;  3X3U A;  4KFB A;  5IOS A;  4DBQ A;  4WPA A;  2JRS A;  1KN6 A;  4KQZ A;  1NHV A;  1HBN A;  2V34 A;  1FKP A;  3FKB A;  4M94 A;  1H38 A;  2FVQ A;  2EKY A;  4HL9 A;  3MFI A;  3FOE A;  4B3M J;  3HPO A;  2IA6 A;  3U1N A;  1ZA1 B;  3TP2 A;  2IIH A;  1U02 A;  4BXX K;  2CDQ A;  2CA9 A;  4HVZ A;  2PPB A;  2ZVS A;  4XK8 C;  2YNI A;  1RQ0 A;  4DR3 F;  2E9T A;  2YQ0 A;  4ILD A;  5U47 A;  4BXX C;  3S17 K;  5J2Q B;  2JLG A;  4URQ U;  3TR5 A;  3OTC A;  3G87 A;  3S17 C;  1USO A;  4L75 A;  5KFY A;  4AH6 A;  3M1V A;  1U7L A;  4O3N A;  1SKS A;  4LF1 A;  2V2Q A;  2BQU A;  4HI2 A;  2BE2 B;  3KDO A;  3W1Y C;  1XMO J;  3NOC A;  3K8W A;  5ETM A;  2L9W A;  1RGV A;  2Y3P A;  2DGS A;  5KFI A;  3L3C A;  4X64 J;  2V68 A;  1LK7 A;  2KG0 A;  5C42 A;  2OTJ S;  1NDP A;  4MTP A;  4MKV A;  3QGG A;  1FWP A;  5LXR A;  1TL4 A;  1FX4 A;  2UUW A;  3DOM B;  2A10 A;  5A2Q U;  5E3C A;  3FBB A;  3R7B B;  4NYO A;  3M2V A;  5A8W A;  1GMW A;  4DPT A;  1Y7P A;  2B4U A;  3PR4 A;  1LW2 A;  3X1L B;  1MNE A;  2XYG B;  4LSN B;  2PGC A;  4GKK F;  1TZ0 A;  1S48 A;  2BA9 A;  3GB0 A;  1R8C A;  3H40 A;  3AB2 B;  3JTO A;  2NQP A;  2M8H A;  2I2Y A;  3R1H A;  2YXL A;  3DLB A;  2FJB B;  3PJ9 A;  3HHL D;  3PFO A;  2V2Z A;  3ZZ0 A;  4YQW A;  3PCO B;  3PO2 K;  2VHG A;  4CLL A;  3HI9 A;  1VC0 A;  4ZVH A;  5EDW A;  3NGU A;  4QIG A;  1O0P A;  3PO2 C;  2E2I A;  2CRL A;  3FRY A;  1REV B;  2RVJ A;  2WBR A;  4LF5 J;  5A8R A;  1Z2Z A;  2MQ8 A;  3HVT A;  3ZXW A;  1NND A;  4K2X A;  3ADA C;  3D6H B;  2OH2 A;  2CQ2 A;  3KMS A;  2BR0 A;  2QIF A;  2KXF A;  5D4O A;  2K3I A;  1EKS A;  2RDD A;  1HHT P;  4QR1 A;  2EPI A;  3B54 A;  4MH8 A;  3IAM 9;  4QZV B;  2F8M A;  2MEW A;  3HKW A;  4F3M A;  3GG1 A;  4RNM A;  4WIQ A;  3FMB A;  3HHD A;  1S6P A;  3A3O B;  4CLT A;  5I3P A;  1X4H A;  3V5R A;  4X62 F;  1QTM A;  1AYE A;  2XMU A;  1D3W A;  1VQN S;  4DL6 A;  2FJA B;  3BYP A;  5LXY A;  2J9E A;  5EN1 A;  1M5H A;  6AT1 B;  3I0S B;  1K44 A;  3B6B A;  1P8G A;  1DFD A;  5L1K A;  2DNM A;  1AW0 A;  2UXB F;  3CJ8 A;  4UST A;  1M5S A;  4HI1 A;  3QSY B;  2GJI A;  3TRG A;  3MXH P;  3HVR A;  2OUG A;  4QYR A;  2ASY A;  2QT7 A;  3NBP A;  2W4C A;  4NCG A;  4P71 A;  4DPU A;  2WHO A;  2OEM A;  5D0H A;  4G1P A;  1UFW A;  2OFG X;  5J1P A;  3J80 Y;  3M8Z A;  1UJ4 A;  2PMZ D;  2IFX A;  2E2I K;  3U27 A;  3PDN A;  5H9F K;  4F2S A;  3JQM A;  3CCM S;  4NZ7 A;  5C44 K;  2E2I C;  2EWH A;  3OV7 A;  4DPX A;  4R5P A;  3GR0 A;  3AY0 A;  1C2P A;  4QW8 A;  5C44 C;  3K57 A;  3IS9 B;  2ZH8 A;  1RKJ A;  1C1C B;  4K5S A;  3MMB B;  1NK0 A;  3I87 A;  4NZ6 A;  4K4X A;  2DHX A;  4PKD B;  2B3T B;  1YDL A;  1P9Q C;  1P1L A;  5LMN J;  5KFQ A;  3W2V B;  3OL9 A;  1RAB B;  2UU9 J;  3M4O K;  2OPR B;  3RGI A;  2IDE A;  1LQ9 A;  3M4O C;  1EQR A;  4ILL A;  4ZDN A;  4Q0B B;  4DR7 J;  2ZWO A;  3V6D B;  1IBA A;  8RUC A;  1MMD A;  2UUB J;  4X4T A;  3T5K A;  2V8V A;  3A13 A;  2QYC A;  3EJM A;  3JYT A;  5B09 A;  3CDB A;  1RT5 B;  2Z8Q A;  4FF1 A;  2J9C A;  2K1R B;  3S1Q K;  1VQ7 S;  3BO2 A;  2HWT A;  3G82 B;  4P73 A;  1CSJ A;  1VC6 A;  4J9N A;  2JLF A;  2CQ4 A;  3S1Q C;  2RJZ A;  4ZP8 A;  3W9H A;  4XPE A;  4NEZ A;  3RAQ A;  2W4D A;  2RQC A;  5F3Z A;  4C8O A;  4CZC A;  5G0R A;  3MTJ A;  4I56 A;  1S6Q A;  4ED0 A;  1GQE A;  2ZBI A;  4UT4 A;  4KH1 B;  1FF2 A;  2O5J A;  1R6V A;  5A0Y A;  2XC9 A;  2ATC B;  1K1S A;  2W9C B;  2E7W A;  2BQ3 A;  2IMW P;  3HK2 A;  2Q79 A;  2JC1 A;  3HHK A;  3MPW A;  4KSE B;  2FDN A;  4WTY A;  4GZY A;  5FLX Y;  1ZM3 A;  3TAM B;  3EPG A;  3MD3 A;  4RW9 A; 
#chains in the Genus database with same CATH homology
 1WOS A;  1WSR A;  1VRQ C;  1WOR A;  3A8I A;  3GEH A;  3AD8 C;  4PAA A;  5L46 A;  1V5V A;  2GAG C;  3A8K A;  3GEI A;  1XZQ B;  3TFH A;  1WOO A;  1PJ7 A;  2GAH C;  3GSI A;  3A8J A;  3ADA C;  1XZQ A;  1YX2 A;  3AD7 C;  3GIR A;  1XZP B;  3TFI A;  3AD9 C;  3TTG A;  4PAB A;  1PJ6 A;  1WSV A;  4P9S A;  1PJ5 A;  3GEE A;  1WOP A;  1XZP A;  1VLO A;  3TFJ A;  1X31 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...