3AD7C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with methylthio acetate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
molecule keywords Subunit alpha of sarcosine oxidase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad7C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad7C01
3GSIA 4PAAA 1WOSA 1VLOA 3GEEA 3TFIA 2GAHC 1XZPA 1XZPB 3GEIA 1PJ5A 1XZQA 4P9SA 3GIRA 1X31C 3TFJA 1WOPA 1WSVA 3AD8C 1YX2A 3AD7C 1V5VA 3A8KA 1WOOA 3A8JA 3TFHA 3A8IA 3ADAC 3GEHA 1PJ7A 4PABA 5L46A 1WORA 1XZQB 1VRQC 2GAGC 3TTGA 1PJ6A 1WSRA 3AD9C
chains in the Genus database with same CATH superfamily
1VC6A 1YZ6A 3RRHA 3WODA 1S76D 3MM6B 2B4OA 3NUHA 3L95X 1VS3A 2PPBA 1TWHA 4PYAA 4GTAA 2AP6A 5DM7Q 2V9WA 2NVYC 2HWIA 4OHZA 4OJHA 2E5GA 3RUBL 2E2IA 5K8OA 2G4BA 2J76E 2RHQB 3LQVA 5ETSA 4IR9A 1WC0A 1X4CA 2VONA 3GTOK 1JJHA 1JX4A 3M2VA 1D9FA 3JQMA 1WEXA 5IM0A 2ZUAA 3DOMB 4ZLPA 1EK8A 4JI6F 2VKRA 1S57A 1RWPB 4P9SA 4DN0A 4FYVB 4C3JC 5KG0A 3C16A 4BXXK 4O4GA 3EZOA 2RVJA 3AXMA 5CQGA 1EJ7L 1RT5A 3H90A 3PYDA 1YK9A 2EFPA 4DF4A 1ZYQA 2UUBF 5GADI 2F5GA 3D3BJ 1USOA 3O6QA 2E9ZA 4X4UA 1H98A 1UV7A 5ETKA 1QDUB 5J2NB 4DX7A 3OVBA 4S0MA 4ECQA 4CYUB 2YNHB 3HULA 4C0HA 3KJQB 2CNNB 2QMXA 3EGWB 2KKHA 1RWUA 2GQCA 5BYSA 4R8UA 2HHUA 2XMVA 2UXBF 2LDIA 2OMOA 4DV0J 3NNHA 3QGIA 1LEOA 3ADAC 1BJTA 1TK0A 1TKZA 1SH3A 1QM9A 4HEA9 3HHNB 1FNXH 3L4KA 5I4MA 2HBQB 3TYTA 5A6WA 2A3JA 1XMQF 3NMRA 4YEAA 2DO0A 1NKEA 2ROEA 1NJIT 4ED5A 3MCSA 4NLRA 3KXDA 4QPTA 3D3CJ 1SJ3P 1KBRA 1X4AA 1PG5B 2CNLB 5IQQA 3S2HK 2KFYA 4OHYA 2HURA 3MZIA 3L3CA 2FJAB 3DFEA 4LJZA 2DGTA 2PO4A 4DPTA 2QN6B 1RE1B 3BPDA 3D0IE 1GMVA 1XR6A 4NASA 4LF7J 3GTYX 4X4QA 2RU3A 2FQOA 2MQPA 4FM9A 5I42A 2NXNA 2FVCA 4IOCQ 2VUGA 2H5JB 1HMVA 1EETA 2KZMA 1Q8BA 3MOZA 4ANCA 1SL2A 1VQ6S 4O3NA 3AQOA 3L7OA 2FHKA 4BBSK 4A8YA 5DDPC 1B4SA 4RKUC 3T41A 2HGLA 4E8UA 1APSA 2JFKA 5C4JC 4KY3A 4IFVA 4O0NA 1SL1A 4NA3A 4PABA 2DGSA 4MQ9A 2W4DA 1EAYC 5EDWA 3RZDK 2Y3YA 2XQCA 4YFKA 3CC4S 5E5NA 4NZ6A 1H0HB 1RAAB 3NGUA 1PGZA 4QYRA 4ZJQA 4FBUA 1K83A 5CCMA 2BJ3A 2AYEA 3S1RK 2PT0A 1N6QA 2R9LA 4C98A 1JXEA 3CGIA 2O66A 3OLAA 2E29A 2DHGA 4RPFA 2IJNA 2DISA 2IY5B 1RAFB 2XCQA 5IP9K 5D4NA 1TVRB 1WHWA 4PAAA 4YDDB 3T9ZA 2PEHA 4ZLJA 4DBQA 3T5HA 2XHWA 1VBZA 2GV1A 1JK9B 2Q66A 4KFBA 5D0GA 2I5JA 2BMBA 2M8DB 4B3RF 2LVWA 1U1PA 3AAWB 2AW0A 4B3SJ 3H40A 2WBMA 4O3SA 5D6GA 1NJWA 4ZPVR 4BC7A 3BV8A 3ZC4A 4CLFA 2ASJA 2HWTA 4J3NA 4X6AC 1FKOB 2VC0A 2E2IK 2E1AA 5L46A 3ILJA 3SV4A 2NQPA 1QE1B 1UWAA 4DL0C 2CFXA 3AD7C 3EX7B 4U96A 2IYGA 3V6DA 2VOOA 1F0XA 2YWWA 2EFOA 2ZE2A 1BGWA 4Y2AA 1SQEA 4EBEA 2E5LJ 3SDEB 2GJ2A 2KT3A 3BBBA 4JYAF 1RWOB 3D1OA 5KFKA 4KMHA 2CAJA 2HFNA 4JI4J 3Q0AA 1AFIA 3AA9A 4TU9A 2OIHA 1K83K 4C9DA 5GMEA 4K4VA 4O3OA 2YY3A 1TAQA 4DV4F 1FERA 1OQ6A 2AU0A 4PWWA 1S12A 2VA3A 2OSQA 3J7A1 3M2UB 4MH8A 1NUEA 2DK2A 2B3TB 3H5UA 2E2JC 1Q95G 5J1EB 5J2MA 1SKUB 2VJUA 5C44C 3KHHA 3LOUA 5JVHQ 4F4WA 1YBAA 3S17C 3SQOP 2R7ZA 5DG8A 3MD3A 2XSJB 1JLEA 2MHEA 5K8MA 1RSCA 1WD6A 1S49A 1F5AA 1KR4A 1LW2A 4A3CK 4OI0A 1R9TC 3DU5A 2R7RA 4B9SA 1RU2A 3OD2A 3VAJA 2PSZA 3PW0A 5LJ3Y 1MSWD 1NB2A 3CCRS 3AA8A 4C45A 3K7AC 5G0RA 3NKYA 1WOPA 5DG7A 3HOVC 2JX2A 3LWLA 5D4DA 4YOEA 1JJ4A 1K8AT 4NLQA 1IBAA 3R5DA 1GH8A 2R7XA 3OXFA 4DV3F 2RF2A 2E9RX 4X4TA 1DFDA 1RT4A 4DG1B 3A8JA 3I0RB 2MGZB 4DR6F 4LF6J 1HYSB 4RZRA 2V69A 4C48A 2UXBJ 1B7YB 3P6YC 1QY7A 1VFJA 1RT4B 3LWMA 1KONA 1I3QA 4QOTA 2BKNA 3W8PA 2QC3A 4HLBA 2MY8A 2D9OA 4FS2A 2V6UA 2DRBA 2R93A 3DC2A 3M9NB 3CCTA 3CCJS 3BO2A 1SPBP 3W2VA 1VK8A 4ID5B 4Q2MA 3GTLK 3AD8C 4OYXA 1RK8A 3FNNA 5IP7C 2LKZA 1GMUA 1P1TA 3SSQA 2W7PA 3THTA 2CQIA 4UOGA 3PHEA 3R7NB 4DPOA 1XWLA 4WYLA 5HN0A 2E5JA 4ES1A 4ZLNA 2OGUA 2EFQA 5KFPA 2EG1A 3N79A 3HOYC 3S1QC 4CLTA 1J6XA 2YNFB 1A7GE 3BN4A 3SI8A 2CQ0A 2QFJA 5IWAF 1H72C 2DBBA 1ROFA 1ZH5A 2HZVA 2XY7A 3PV8A 1N88A 3AQPA 5GMKa 3L7UA 1OJ4A 4IG0B 4LF8J 2JA6A 3I4NK 3RW6A 1VC5A 1XTZA 3OTBA 3F41A 2R7TA 2GO9A 2DXDA 4ELUA 2GGPB 3K8WA 3IRWP 3CQZK 3H0PA 3NGTA 4JB8B 3UDLA 4HL9A 4HI1A 1F7VA 1BMQB 1UPMB 4GC7A 1FDNA 3D9BA 2W4PA 4DV7J 3D2WA 2MQOA 3T1YJ 1VOMA 3UE2A 1P6TA 2Z57B 1UZDA 4JP8A 4OYMA 1C0TB 2XLIA 4I68A 2Y1JA 3C14A 4OLOA 3BBCA 4QIVA 1EZZB 4IQXA 3DRRB 3LAMA 2VDHA 5IOQA 2KXHA 4ES3A 1TKDA 4PR6A 4DL3A 5A0YA 3A3PB 1WDTA 2LLZA 3PIOQ 4FVMA 3R7BB 4FKXA 3MEKA 2ROGA 4A8FA 2PMZL 2IVMA 4WPAA 2DNZA 2B5JA 1T3OA 2R7OA 2N7YA 3WC0A 2IJFA 4EI2A 3J81Y 5LXYA 2JLFA 1BE4A 4ERDA 2J6TA 4LRBA 5IM0B 3H2VE 3A8IA 4LF7F 2OI2A 4NRTA 3QMQA 1MROB 1PSDA 5IT9Y 1SC6A 1FRMA 2ZHOA 2X1BA 2YBVA 3RBDA 2JA6K 4A3DK 3WDOA 2OKQA 5EGYA 2LFVA 4CDIA 2RDDA 2YWEA 5A8WA 3TAMB 3QNWB 4MKYA 4MT1A 2K1RA 4NWBA 1FWPA 5B09A 5F0UA 3D28A 1M0SA 4Q5VA 4UOCA 1NPPA 4ZVSB 4A3FC 2GHWA 3KLFA 3S1MC 1R7IA 3LH2S 2R3VA 4YY3J 2Z2ZA 2M2BA 4ZIVA 4P2SA 3SXLA 2Y8WA 4USMA 1HNVA 3PYGA 5L8RC 1WQHA 3ZZZA 5L38A 2OTJS 4CCHA 1S79A 2Y0SL 1FK9B 2VPZB 1VQ9S 1NPKA 4ED0A 1WC4A 3UO0A 1TKXB 3TA1A 4X4PA 4ECVA 3C6TB 3I87A 5IQ6A 3OJSA 2RRBA 3PHTA 4LF2A 5IV4A 1OS5A 2FPHX 4FF1A 4FS1A 3ZZ0A 4XSZA 2R7SA 4RUHA 1HBOA 1VBKA 5JVOA 2F8MA 4RU9A 1Y5IB 1HW9A 4YB5A 1Q5VA 1OSDA 3D1QA 3BGOP 2GAGC 1TQLA 1SFOA 3C6TA 3EICA 4FXDA 3W2WA 2BE2B 2HKEA 3LW5C 3M8PB 2BKOA 2UV8G 1KQGB 3BDEA 3CDUA 3Q8QB 4XLNA 4RL1A 3MM8A 4ZIWA 1QUVA 4PUOB 2HVHA 1BS2A 2DGVA 4UUWA 2Z58B 2R4FA 2DO4A 1WWHA 1UVMA 3ULHA 1EQMA 3IGVA 4JV2A 5CXTA 4ETZA 3CT9A 4AUKA 4YR2A 3D54A 2M8HA 1OPZA 3PKMA 4A3DC 4U8VA 4WZMA 5IYDC 5F9NA 4KPCA 4J9SA 2GSUA 5AJ3F 1CBKA 3PW7A 1U45A 2YWKA 3CULA 1GE9A 1HNWJ 3G71S 4HVZA 2DGUA 3D6TB 6FD1A 2YWFA 4KH1B 2M52A 5FDLA 5CAAA 1EARA 3T02A 1UAWA 2C42A 2K1RB 3KLIA 2ZC4A 3AH5A 1RAEB 2DVIA 2O5IA 2ZBIA 1RBLA 3FQLA 2CQGA 2NPIA 2JHEA 2QV6A 5HROA 3MAAA 4GTLA 2WONB 2OUGA 2V50A 4ZCMA 3ZXWA 1EI6A 2A6HA 3SCKE 3IBCB 5J1NA 4Y6IA 1YX2A 3UD3P 4DR6J 2RH6A 3CJRA 2FQQB 3SIPB 1ZBSA 1RB0A 4U95A 1E6YA 4DV1F 3MMBA 3Q89A 3GTOC 4WP9A 1HFEL 3P5TL 3NY0A 2V2VA 4PPZA 1V5VA 1DD5A 1YKWA 3I5AA 4I4BA 2CVEA 1LOUA 1HNZF 4LMZA 2XZWA 5KG5A 3MCMA 2B4VA 3CCWA 1RA7A 2IAJA 4XO0A 1S1VA 3IC1A 5D4PA 1HBOB 1UFWA 1IBKF 2JEFA 1F5BA 4DDFA 2CJAA 4HKQA 3H4DA 4PWDB 3LPXA 4KT0C 5B0DA 2BYCA 4BY1K 3GEEA 4HT7A 2GVZA 4OV6A 4CLPA 1HLWA 1DHMA 2F8EX 3IAS9 3LAKA 4USJC 1SC4B 4BWJA 5EHHA 1CC8A 1JLEB 1RISA 4QR1A 2E5HA 4Q5SA 3CJ3A 5IV3A 2F40A 2IIHA 2I8EA 2HK3A 2HLUA 2VUMK 2FHOB 2ZH7A 2ZDPA 4YMEA 5IOLA 1PCAA 4IR1A 2R7QA 3N6NA 1X4BA 3E8OA 3M2UA 4WK3A 3AB2B 1EQ0A 7AT1B 2HZCA 3DYAA 4KGKA 1S9FA 1V3RA 4J37A 1RT1B 3N0VA 2CJXB 4TU7A 4O3QA 2RD5C 2YNIB 3JSMB 1CS4A 4O3PA 3Q8PB 3VA7A 4LREA 1IKXA 4A3FK 1B99A 2OPQA 5KFNA 3OFGA 3S1RC 5AXMA 1CSJA 1F5CA 5GAEU 1CS4B 2IPOB 2O5JA 1N33J 1S0NA 7FD1A 3H8YA 4RNNA 2JFDA 1VHIA 3N0CA 2OPQB 2HZAA 1WTBA 2D9PA 4M63A 4ZKAA 4I2QA 3Q23A 1WQGA 4QQBA 4HT5A 1DCPA 1L3SA 2RB7A 3C46A 2JH3A 4BC9A 1E6VA 1I3OB 1YLXA 1IR2A 2HGNA 1S99A 4ZP6A 1U2CA 4B3MJ 1B64A 2C22A 2YX1A 4A3JC 2BJDA 3DGVA 2YU9A 2WVDA 5F0WA 3DI6B 3CJ0A 5M2PA 3IPJA 2DPJA 2HNZB 3KK1A 1YJWS 2CNOB 5K14B 2AD9A 4EZ9A 2ZJRQ 4ECRA 4JV1A 3FSIA 1U25A 3GCXP 1O2BA 4WU2A 4A4JA 2W9CA 1ISEA 3HKWA 3K57A 3U02A 2MJUA 4JI5J 3KK3A 3R97A 4L76A 3KOAA 2DR9A 3I4MC 1FD8A 2BVZA 3P5BP 2VFUA 5LT5A 3DLBA 2ZBPA 4I56A 4PPDA 5F8NA 4TY8B 4JUZA 4I6WA 3ZTPA 2MKSA 4GO5X 4DUYF 4FYDA 1HBUB 4N47A 4C8YA 4JOUA 5FLXU 3V81A 5EWGA 4H4MB 4DQQA 1R9TK 2FQTA 4K4WA 1QAJA 4CLKA 3SV3A 3HJVA 3EGNA 5K8NA 3FSYA 1EFWA 3IAM9 2GVZB 2AKWB 1FJCA 3HMJG 1RT2B 5L1JA 1NH7A 1K1SA 3W66A 2PA3A 4O23A 1KS2A 3IWLA 2EBBA 1X0FA 2C2ZB 1HI9A 3EDRB 3DRSB 2K7KA 2YKMB 3IS9A 1ITPA 3HZEA 2A2DA 2IC3A 3HOUC 5KFQA 4DQPA 4U7UK 1N33F 3GTLC 5KFIA 3I5BA 1ZTTA 3GR0A 3QYYA 2VQEJ 2ZH3A 1LW2B 4I69A 1IBLF 4JYAJ 3BJYA 1ZTWA 3S14C 1NSAA 4F4YA 4ZLLA 3HVWA 1L5UA 3CTRA 3J81U 2ZJPQ 1HWKA 3RBEA 4DSIA 2FVRA 4ELTA 4LF5J 3ZTSA 2XZDB 1DRZA 3SEOA 2D7SA 2G1HA 3F56A 4LF9J 1JLAB 1IJEB 1TWGK 2MY7A 3RBZA 1RYSA 4KPYA 3TJAA 1KD1T 3UPFA 3V6KA 4GO7X 2ZHAA 3GR1A 1RXOB 3FEXB 4OHVA 2ROPA 5ITHA 1I3QC 3UFCX 2VG6B 4OZNA 1I94J 5C3EC 2VL1A 2JA7C 3O5TB 2XMTA 4MEYA 2MSSA 2R92K 2L41A 1YJRA 4U9RA 4EYHB 4CO3A 2AYGA 2X1AA 4NCGA 1RTHA 2ASLA 3HHKA 3TFIA 3BZQA 1LXNA 3IWXA 2XNQA 1RTJB 4OHXA 1VYAA 2KXNB 1AB8A 3EGVA 4JI8J 3CAGA 1KFDA 1K47A 1XC9A 3CO0P 2KL8A 2FLOA 2LP4A 1BQNB 5KFUA 2IRYA 2FTRA 4F2SA 4KB2A 3Q86A 4OLPA 4RO0A 4M5HA 4P75A 3QO9B 2PA8D 3V4MA 4E0DA 3ZTOA 3AT1B 1Y7PA 3GTMA 2V6TA 4DCPB 3IN5A 2JNJA 4F0KA 1XZQA 1FRXA 2UUWA 2ZWOA 1C2PA 1WHYA 1XNQJ 2W8LA 2BE2A 5KFYA 2EK6A 1MU2B 3M8ZA 4CQ1A 1NK6A 1ZPVA 1VRUB 2VBYA 1W2BR 1F7UA 4OV1A 2A6EA 1M5PC 2WZ1A 3J80Y 2HVIA 4XLPA 3GTPK 3K5LA 4EYIB 3DN9A 3K17A 1IL2A 4UOFA 4TYAA 1PBAA 7FDRA 5ETMA 1T9VA 1WG5A 2NXCA 2P2CB 2KJVA 3GPAA 3MEDB 2W9BB 3OT9A 1YBTA 1HYSA 4J9VA 4NX9A 2UUTA 1NDKA 4PG8A 2B63A 3QBCA 1RTIB 3HHLB 3AOCA 2Q79A 1RBAA 1AYEA 4FF4A 4KGVB 2A6OA 4NEYA 2J8SA 5CYMA 3GFYA 1EIYB 3MM7B 3R6GB 2HRUA 2RS8A 3LF0A 1XN9A 2QIFA 2HYIB 4CIOA 1S1TB 5AXLA 3TFJA 3KJVB 4IRCA 5EWFA 1WACA 4AL7A 2YNGA 1T03B 4A93K 3CDWA 2MKIA 2VA2A 4OI3A 1LW0A 2P9CA 2CQ3A 3OR2A 1SQFA 4NLTA 2GAHC 1R8BA 3BM7A 1IUJA 2GFFA 3LA0A 1RTJA 1D8YA 1TMMA 2P5MA 2MKJA 2NVQK 4BDPA 3MDFA 5KFLA 5GADU 1Z4UA 4KATA 4ZVOB 5HANA 3LUYA 1YSJA 4MIBA 4W90B 5H9FJ 4CZCA 2NLWA 2ZH8A 2NYHA 3GCWP 3FKBA 4ZHRB 4RUAA 4WJBA 4F50A 3OXLA 4GTFA 3MPYA 3GU0A 1TK5A 3J80U 3AODA 5KFCA 1TELA 2QFIA 1EX8A 2W2NP 1TV6A 5CD4H 4RMFA 1Q5YA 3GYGA 5EX3A 2H51B 1HI8A 2FHJA 2WSEC 2Z56B 2JLEA 4F4KA 1F60B 4KMAA 3GE9A 4RX6A 1IE0A 4ZPDA 4YB7A 1X9SA 4O0IA 3QLHB 2CIMA 3MM7A 1KFSA 2L9NA 1FDBA 1S1WA 3MR5A 2F7VA 2DHAA 2N4DA 1EKRA 4NA2A 2EFVA 3QATA 4M5LA 2DHXA 1RKJA 1QSYA 5FJ8K 5IYBK 2RU9A 3QT5A 4WTOB 3AY0A 4M5MA 5KAKA 3OXGA 1W26A 1YG0A 4DR1F 1U0HB 6AT1B 3G6YA 2X3DA 2I38A 2APOA 3CPWR 1RTDA 2CDRB 2MMYA 2C2KB 1B7FA 3OJUA 1HR0J 4QIWL 4KASA 1LWCA 3CCVS 2ZOGA 2M70A 4WU3A 1URRA 2RDJA 5HL8A 3MEEA 2ZD1B 8ATCB 2Y1LB 2MKKA 3M9OB 5HK4A 3W5ZA 1O8BA 1VLYA 1FJ7A 1VLOA 1C1BA 3CD5A 2BV3A 2CZ4A 2JA5A 1NKCA 2GMHA 3CCZA 1VQ5S 3NCPA 1EP4A 3LGHA 2AX0A 2GIQA 5F3TA 4WF9Q 3W1YC 2XCAA 3B6BA 4OIRA 3GB0A 4KAIA 3GDZA 2J9EA 3SZ2A 3G87A 1QAIA 1RWKB 3KMSA 1KOHA 2YX7A 4KHPF 4A3IC 2MJNA 4ZHRA 1V5IB 4QWAA 3SFUA 3W3SA 1Q8LA 1YRTA 1XMOJ 2GIFA 5C42B 1R0BG 4GMKA 4F02A 3AH6A 2LQJA 4EWTA 3PXGa 4PWDA 4IH5A 3DLJA 2AJ1A 2IVFB 5LSOA 1VQNS 4I6YA 5EUHA 1X60A 5BJRA 4OZ3A 2EBEA 5E0OA 4AQYJ 3LP2B 4IG3B 3B8HA 3QPIA 2YWGA 4YUDA 4ZN3A 1C0TA 4ZA1A 4DFJA 4DR5F 3C14B 5FLXY 1U4BA 5GMDA 3RB6A 1RHKB 5ETTA 3ET6B 4FP9A 2G2YA 5D0RA 3JAMU 2JSXA 3U27A 1TWHK 2OFHX 2GMJA 1OY9A 1IKWB 3ISND 4GVLA 3EXYA 2RRAA 1PC4A 4PG5A 4OX9F 4FKYA 5C5JA 1RWVB 1VQ7S 3FK4A 4A3BC 4B9NA 1FRJA 1DURA 2BW2A 3J7YI 4O44B 1I50K 3I4HX 1N54B 1R8HA 1TWHC 2C2NA 4A8MP 2M5YA 3AJ1A 3EDQB 3GV5B 3FGVA 5A0YB 3QLHA 3E2EA 1UW9A 4A3MC 2OEKA 5BYQA 2BJ7A 4C3HK 2DJWA 2WB1L 2W4CA 3VF0B 3J7AN 2MEWA 3TRGA 3PW2A 1OY8A 5EWEA 3UN3A 5T7LA 4KB4A 1FJEB 5FIIA 1GX5A 2KYXA 3C19A 5D0EA 2NZCA 1YWXA 5AE2A 3HKZD 4X64F 2CKWA 1EQRA 3KHLA 1WOSA 3PO2K 2YKOA 4ENOA 2Y9HA 2UP1A 5DG9A 3MM9A 1UA0A 4N56A 2RH3A 3OR1B 2ZDOA 1XNRJ 3IG1B 5LMUF 3HVAA 2VBXA 1UJ6A 1V3SA 4C0BA 3JTPA 4WZQA 2BDPA 2CPDA 3GTJC 3RR7A 1SI9A 1REGX 1LK5A 3VTIA 1TL1A 1P9QC 3SSSA 2JLGA 2LQBA 1PJ7A 1WEZA 3MAAB 1Y11A 2DNPA 2LYVA 3QJLA 3HVTA 1N5TA 5E3PA 3O3LA 3OW2R 2F9JA 4KQZA 2CPYA 4LRCA 3BKFA 1SBRA 3HF5A 3DOMA 5I3QA 4LR8A 2LU1A 1JQGA 3EMTA 4J9OA 4LQ9A 5E33A 1CPZA 2BRKA 3VGTA 3H5YA 4ED7A 4AYBD 1TUVA 5J2QB 1N5SA 3QAUA 3TUJC 1TWCC 1NK4A 3T6JA 1R3NA 1Q81T 2IM3A 1ZVUA 5J2NA 3ZO7A 2KT5A 1RCXB 4C0OC 1N48A 5CYQA 2NUHA 2Y0BB 2CVIA 5E3AA 4ED1A 1IKYB 5D15A 4YQWA 2BXJA 4CH7A 3HFVA 3MPUB 2FB0A 3CMES 3IRXB 4A8QA 3FEYB 1G1XA 2DB1A 4DL6A 1A0OB 1CLFA 3BUEA 3I32A 4X4VA 4AL5A 2KI2A 3DLEA 4R5PB 4BBRC 2C3OA 5IFMA 2BANB 1U24A 1WC1A 2V4RA 2JA5C 2FLNA 1GTHA 3K5PA 1IQ0A 4I67A 1X9MA 1QUPA 4PCQA 1S9GB 3MR7A 1RT7B 1HW8A 1AFJA 1EP4B 2FDNA 1HNXF 1WEYA 1N32F 3ET6A 4LIWA 1NXIA 1OY6A 3NOGA 2FHMA 4B17A 3OHBA 4M95A 3RW7A 1KOOA 3OTOF 3OV7A 3AOAA 3BDPA 3U1MA 1HWUA 3W9HA 4F3QA 3I96A 1KSPA 3A1YG 3FZBA 2IFXA 2GCFA 4RNMA 2WONA 4B9UA 4URQU 4I2PA 5IYCC 5DQGA 4DI6A 5JXSA 3MHYA 2ZFHA 4RBTA 2QLXA 3BP3A 1HHQA 4DSJA 1EETB 1YGYA 1Y1VK 1HNXJ 4KH0B 4FYWB 2RUSA 4MFBA 2EW9A 2BEFA 1XZQB 4K4XA 2R2UA 3FCVA 2GQQA 2I0XA 2M3DA 1U6BA 3VGSA 2RDIA 4ZCLA 4MK9A 4UUXA 2CJ9A 1JLFB 1I1GA 2FVPA 1N8RT 2IDLA 2CQPA 3SZZA 1M5VC 5M5YK 2HBRB 1HQUB 3LP0A 2Z4PA 9ATCB 1T03A 1JLAA 4R0JA 4KMDA 5AT1B 4IH7A 4LSNB 3W63A 2CFAB 1CEZA 4X66J 4U8YA 4USHA 3G96A 2BBEA 3UCZP 2YU9C 1KN6A 3KUEA 1TKTA 1RYRA 4M1KA 3PEHA 4ETXA 3K89A 4GKKJ 1N56A 1H73A 4P2MA 1RCOB 2NSBA 2EKYA 4WFZA 2UVWA 2ACMA 2N7CA 4KKOB 4OFZA 5D4LA 3M2VB 2E2JK 1SJFA 2MQLA 5FLMK 4GVBB 3NGRA 4F2RA 1RT7A 1O2AA 1TWAC 3TUPA 4LF4J 3TARA 2FLPA 1O29A 1WCMA 2L3MA 2DHHA 2YKAA 3BSNA 2MB0B 3LANA 3JB9k 1WC3A 1S9GA 3MWBA 3EJMA 2ERRA 3S2DC 4FYYB 1KHWA 3ENAA 1FVSA 2D69A 2WOMA 4F0MA 3FOEA 2HIYA 4OZ5A 2HAFA 4PQAA 4YFUA 2ZH9A 1T7PA 3A3NB 1LNQA 5IT4A 4CNYA 1U7LA 3AOBA 2AQ4A 1JIHA 4AYBL 4CLZA 2LQ9A 1GT8A 4NMXA 4UQTA 2X1FA 3S2DK 2ZH2A 1XNRF 5HMZA 3D6HB 5F9LA 1DQ9A 1N34J 3H0GC 1TVRA 2AZ3A 3EVMA 2LA4A 1S0OA 5KTQA 1RHUB 2RQCA 2QGFB 4PXCA 4A48A 2VU5A 1O24A 1VQYA 4JV5J 4TYBA 2JC1A 3KTQA 1XIQA 3CJKA 4PXDA 4M94A 2WRMA 3EUNA 2HNYB 1UJ5A 2DD8S 2AEJA 2V9KA 3MR3A 1VC0A 5A2QY 1WTFA 2DNQA 1TWCA 1J5OB 2CPJA 4MK7A 3W9JA 3CSKA 4DV6J 2QL5B 3QFWA 1I3QK 2ALZA 3DKDA 4DR7J 1RLDA 2R92A 2OPPA 3I0SB 1LWFA 4JI8F 4Y28C 5GAHU 3QAEA 2PMHA 2ATLA 1NM2A 5HATA 5B0FA 2QL7B 4LFCF 2WB1D 2NREA 2PIIA 2FLLA 3K5MA 4ECXA 3BS9A 5DGBA 2HPUA 3PACA 4UY8T 3PX6A 3D1HA 3HKZL 1S4EA 4DUZF 1XBWA 1SFOC 3FZ2A 4TQSA 3T5JA 1CJUA 3CDEA 1DLOB 3BGUA 1EHWA 4CYUA 1N36F 2XGQA 4QYZK 4LF9F 1LFPA 3N28A 4QIEA 3NGKA 3GTGC 4KFBB 3BN7A 3WX8A 2X7IA 2H1YA 1ZBTA 2DPIA 3IS9B 2RT3A 3NLCA 2RRNA 4UT4A 2VPYB 5KFFA 2UXCF 1ZOTA 3CJ8A 3K7RA 5D8HB 4DPUA 4ATNA 4W98A 2UXDJ 1X4HA 1T9WA 3CCLS 5E3CA 1V9OA 2CG8A 4FXWA 3TUIC 2F8HA 2GNKA 2W7VA 4ZVPB 1KLNA 4DV5F 2AJ4A 4X4SA 5E3RA 4NMLA 5E68A 2DHSA 5HMXA 1L0WA 3TOQA 4WFNQ 2O5DA 4U7CA 1J5EJ 4LBPA 1FJGJ 4P52A 5M5XK 4KTQA 4NYPA 2Q3PA 2M9KA 1NSQA 5ADZA 4MKVA 3MAHA 1HARA 2NUUG 4DPYA 1QTMA 3CE8A 4ECYA 2OEMA 3JYTA 2DIUA 2DITA 2V5HG 4XDCA 2HFVA 1JKHB 1URNA 1Y1WA 3M7VA 4JI6J 3G82B 4QPXA 4KO0B 4IDKA 1VJEA 4ILLA 1MMLA 1KKHA 5AXKA 3TP2A 2QSWA 1L3UA 3SZYA 4DMZA 1X8DA 4ES2A 3U1LA 4ZVUB 4OI2A 3TA2A 4KN7A 1W2IA 4JI1J 1N6QB 1B4AA 3PY8A 4FXVA 1NZ8A 2U1AA 5F8HA 4LK1A 3K2YA 4JI0J 2D3OR 4ED8A 3R3TA 3FBBA 1RI7A 1S1UB 1TL4A 4J9NA 4CI0B 3FCHA 3H3VL 2BA9A 5EGEA 4U67Q 1S0VA 2VPWB 1WC5A 1RDRA 1S9EA 3PRDA 4IG3A 2FD2A 4MKAA 5ETPA 3RZAA 3I82A 1AXQA 3IWNC 2JOQA 2C2DA 1CC7A 1MNEA 2MZ1A 3WZ0A 4P2FA 2RAQA 1TK8A 5MLCV 1S0MA 3VHQA 4LRAA 5FDLB 3MM9B 4L73A 2HGMA 3KWMA 1HBMA 2GVDA 1PC5A 4B9MA 3IG1A 3HVRA 2I9SA 4HACA 1SJRA 3POTB 4HDGA 4KMUA 4DG1A 1VJWA 1VRTA 4DXLA 1JOEA 1N52B 4OQJA 1S1VB 3M8QB 4F4XA 2DIVA 4NEZA 2HRYA 1ZA1B 4KJIA 3P8BB 1AB4A 2DRAA 4DOZA 2JRSA 5DS7A 1Y1WK 3BQ0A 2L9DA 4KV8B 1OWXA 1L3TA 2H48B 2WVEA 1WNEA 2B4UA 4UZCA 1REVB 3NBPA 4C2MA 3D0HE 4X2BA 5FLMC 4K4TA 3LP1B 4GKJF 2DR8A 3NNCA 2CQ1A 2ZD1A 3TO8A 4UZBA 2GHPA 5G0RB 4PG7A 3A4TA 4U6PA 5M5WK 2YWHA 3NEKA 3GTOA 1D9AA 2GX8A 2D6FC 1F3FA 1KC8T 3IRXA 4PEOA 1VI7A 4BS2A 3FMBA 3BSAA 1CJVB 5CHCB 4X4OA 3LPEA 4K2JA 3PG9A 2FJEB 3C6UB 3L4BC 5IWAJ 2V8HA 4IFVB 4V19J 3WBZA 4NOHA 1GMWA 1O27A 4YN3B 3KLEA 4NLXA 1S6PB 1W7WA 1A6LA 1VK3A 1HNZJ 2YKPA 1FEHA 1FFWB 4G1QB 2MQMA 2XI2A 3F0NA 3B54A 2SXLA 1YDLA 5F8MA 4UW2A 1C1CA 5A8RB 1R8AA 2JL9A 2RKIB 4UQGA 4PXEA 3UNGC 3NWGA 1YJVA 3BREA 4M5KA 2MPUA 3U7JA 1U0SA 4EUVA 1NU4A 2KFNA 1O2FB 4IFYB 3T1HJ 1XEZA 5HL7Q 1BY9A 4IOBA 1U8WA 1RT6A 1Y1VA 2HFOA 2UVUA 2J7UA 1XNQF 3GFXA 4GTEA 3OVAA 4DJBA 3GYXB 3FMWA 4ZH4A 2HS3A 4RUCA 2A2CA 2W2QP 1D1UA 3R2DJ 4MYUA 3CJQA 1KQSR 4A3LK 4KHRA 2RJZA 4DX6A 2M4MA 5B0AA 2DNLA 4J9RA 1NJYA 1AROP 2R2SA 3D67A 3GEIA 3L9ZA 2PI4A 4FBTA 2KG0A 5HQLA 1ZS6A 3OUYB 1K73T 5HJYA 1RTIA 3HHLA 4DF8A 3MUVP 2NXUA 3VZIA 4BY7K 2VASA 2AX1A 4XIUA 1FXLA 1MWYA 3V4IB 3S14K 4ZP7A 5M3MK 4P6QA 1X7VA 3Q8RB 1HPZA 1YJUA 3CEDA 4HH0A 4QWCA 4F3MA 1KTVA 4KM8A 4Z7YA 5B0BA 3L4JA 1UMJA 1WKKA 4DS4A 2IBOA 5KFSA 2YVSA 2KRRA 3G8SA 2D1CA 5L39A 1KVKA 1ZXOA 3P45B 4CM0A 1JXVA 4MIAA 3T5LA 3O44A 1K0TA 1Y00A 3CDAA 1EH1A 4DV0F 1I6HC 1X4GA 3G6ES 4N8NA 3Q8VA 4Y00A 3QFHA 2J7WA 4FNIA 4I2PB 1LQ9A 1TMJA 1S6QA 5CABA 1JB0C 4NLVA 2QMWA 1FE0A 2YKNA 2V8DA 1M1KT 3PX4A 1HIYA 3N5FA 1RJJA 1FWKA 4MFBB 4YP3A 3OSPA 1YRUA 3RGIA 3GJRB 2W7AA 2VQFJ 2WCXA 3BB5A 3M8SA 2YQ3A 4XPCA 1CJTA 2XSFA 2B56A 4AE5A 1UKUA 1VRQC 1FRIA 1DARA 1NRKA 3AFGA 3GQCA 4QJVA 4OJ1A 5A76A 2Q6CA 3DRXA 2ZBRA 3M9MB 3LAPA 3R7SB 2HHQA 2NVQC 1YIJS 1IQTA 4HR2A 4DUTA 2GGPA 3PR5B 3HOWC 4NRUA 1HD0A 2IYIA 3Q2SC 2C2MB 3D66A 3RTVA 3HSGA 3QT6A 2H3EB 4ZDNA 2R7WA 1VR6A 3PDNA 1WG1A 4I0WA 1CULB 3W5XA 3FFIB 2OTLS 3PO5A 4FF2A 1KTQA 2ADCA 4OHWA 1MW7A 3MPDA 4ID5A 2RUGA 4F3OA 4WIQA 2JJ4D 2R7ZK 2PA8L 1RTHB 4ECZA 3EXCX 5CA5A 1BD6A 2FC8A 4ZVFA 4A8WA 3DGPB 2H4YB 4LLGA 2HFZA 2W24A 3KLGB 3CB4A 1RWXB 3PYFA 3KUHA 1E6YB 2DH9A 1UTAA 1Y1VC 3CCMS 4CM2A 1XR7A 2UU9J 1SH0A 2VD3A 3O8WA 4XCHA 3W64A 2QLFB 4KKOA 2NSCA 2KM8C 2DCLA 2UU9F 4JV5F 1OIAA 4A8OA 2B6AB 2XMJA 4WXOA 4H4MA 3CJ4A 5SZTA 2MDAA 3T5KA 4JI2F 3MECA 1KQFB 1HD1A 1QAYA 3OEPA 4RUBA 1VQMS 1UVKA 2KHDA 1JVIA 3FC9A 3JSYA 2NZ4A 2MLYA 1TWGA 3DLKB 3HOUK 2GSNA 2HQ3A 3D0GE 1KHVA 4LOWA 4RW7A 5DETA 4QIGA 3GLJA 4PQUA 2HNDA 2AF6A 4H4OB 1H2VZ 4OYAA 1RGVA 2MQ8A 2OO4A 1OYEA 2QRRA 1I6VA 5LSLA 2R93K 3ENWA 1VH2A 4IKAA 2IA6A 5L1LA 1M5OC 3MEGB 4AFFA 1JLBB 4A3KK 3MM6A 2GS8A 2V8PA 1AUDA 3C6UA 3MMCB 2VFRA 3TQEA 2QO3A 1FKOA 5IOSA 1FF2A 4KO0A 1P1LA 4PG6A 1HWJA 1MMNA 1BWEA 3BEGB 1JKHA 5C25A 1SJ4P 4G0WA 3ERED 5H9EJ 2XLKA 3RZOC 3B4DA 3E01B 4XAKA 4K2XA 4GKJJ 3FBFA 4M5IA 2K2PA 1Z2ZA 4IRDA 2IVYA 1OPIA 2O67A 4HI2A 3MFIA 4YFNA 2YPYA 2CYYA 4TVAB 3CD6S 3BO3A 2WOMB 2UVVA 4PWUA 2G0JA 4DV1J 4GT9A 4M5DA 3V6JA 2PGCA 2HLTA 1PYSB 4X66F 5M2RA 4G65A 5F8LA 1RQ0A 2IJRA 3VAFA 2CJYB 4BBYA 3ENQA 2ZUEA 3FVYA 3GJTB 2PD1A 2HHHF 5I42B 4K50A 3GG0A 2QZ8A 1N0VC 3HOZC 2CQCA 3ISNC 4XPEA 1F9FA 2O3DA 5C42A 2R93C 2UUCF 3R2CJ 3CD7A 4Y65A 1QSSA 2MTLA 5BR8J 5H1SV 2OPRB 3OHAA 4AL6A 1S77D 4C2MC 4DL4A 2XSJA 1T8EA 4C4WA 3KK3B 2MKHA 3GFHA 2OJ3A 4CNZA 3TZZA 4J5OA 5IORA 1G7CB 1SCJB 3NGDA 1LWEB 4RU2A 4DFPA 1J27A 2C2OB 3H20A 5C2GA 1IBMF 2JC0A 2W7OA 1NEEA 1T05B 1BGXT 5FD1A 1D3WA 2WSCC 1YCLA 5CZXA 3MCOA 3PM9A 4KAWX 1JJCB 1X9WA 2MZSA 2D74B 4TQRA 3PKYA 4NCBA 4ZP8A 4WKRA 2LA6A 1E6VB 3RRKA 3TTGA 4FPIA 4ER8A 1KVIA 4AT1B 2DNNA 3M32B 2VG5B 2HHTA 3NAIA 4OL8A 2Q43A 1UWBA 3M3YC 2UV8A 3HX9A 4YS2A 4CLLA 2HS4A 3R5JB 3TVZA 3HOVK 4C3IK 2BQ3A 4M5GA 3RBXA 2HK2A 4ZVHA 3BP8C 1YHQS 4MYTA 5KFAA 2IMOA 4OJGA 1N5YA 4A8XA 3TUZC 2J0QD 1X31C 3KG4A 4IH6A 5HQMA 4QWBA 2EG2A 4B9TA 2LXFA 2UUCJ 2L08A 2W2MP 2P9EA 3C8YA 1M1HA 3PJ9A 4NLUA 4K4SA 1G4CA 1DCHA 3E3XA 5J2QA 2O01C 3ZZYA 4EBCA 5KOXA 2B7CB 1FT8A 1XXBA 3T1YF 2KO1A 2DNHA 3Q8UA 1U6FA 1VQSA 5T7LB 2J0SD 4JK1A 2UXCJ 2CPIA 3M8RA 4DU8A 3PW5A 2HQCA 1MN9A 5F8JA 4TY9A 2G2OA 4DQSA 2RE1A 1SJ1A 5DQIA 4C3HC 1UVNA 2HVZA 2Z30B 3B4MA 1K83C 4C7QA 3US5A 2YQ1A 1LKZA 3V6HA 2HHPA 2ZNYA 1FD2A 3MMJA 4DR3F 4Y3CA 1NMEB 2ILYA 4Q8FA 1IKVB 4C11B 2VUMC 1HBNB 2MHNA 5KT4A 2MGZA 3M30B 4DPXA 1Q4RA 1U8SA 2XS2A 1IR1A 3W65A 2DYAA 4YG2A 4ECWA 1UL3A 4LFCJ 5M3FK 4Y2IA 3GTJK 3ZZTA 2ZWPA 3LGMA 3RZDC 1TUWA 4GKKF 1UEVA 4J7CA 1OYDA 5C4JK 3HOWK 2BQRA 4KYZA 4DV4J 3ETMA 4WFXA 2IAJB 3NCRA 3MMAB 3W2VB 4F04B 3CVKA 3V4GA 4FZBA 2COLA 2XMMA 2ZFZA 2E5LF 3MECB 1I5OB 2ZZTA 3BR9A 5CD4A 3D7SB 1PAEX 3KJVA 2JA5K 4QBUA 3VAHA 2HBYB 4TLRA 5IOTA 5HAOA 2DGOA 2V6SA 2E1CA 1GNKA 2BQUA 2Y0SD 3JQKA 2OH2A 1QVGR 3G6VA 3ZTQA 3NOCA 4XDDA 1SVDA 1MROA 2B8QA 3NG8A 2POKA 1ELOA 4ZPAA 5RUBA 1HQUA 1VQOS 4YB1P 3M8QA 2XMAA 1J98A 4C8LA 2RS2A 4B3SF 4TN2A 5KFTA 2ILZA 1DTQB 2EI5A 3T3FA 4DSEA 2E2HC 4BLAA 3KG1A 1SUQA 3D4JA 3CJSA 4CLUA 2B7BB 3BO4A 4JI5F 1R0CB 3VVTA 2HFUA 4RBVA 1LK7A 1UFLA 5K20B 1NDCA 3EQLA 1H74A 4OZ0A 1NNDA 3HD1A 3H5SA 1IR0A 3R9LA 5KT6A 4FDFA 4WBFA 2QYCA 1O51A 1HBNA 4HTJA 2PEBA 4DQRA 4UOHA 3VQTA 3RZOK 2QEXS 1CQMA 1HNIB 4J90A 1JLFA 4TU8A 2DNRA 1AZSA 4LF5F 1XMOF 1V6HA 2EPIA 3VAIA 4I7FB 5F8GA 4F4ZA 3C66A 3FKIC 3NAHA 3G4AA 3MCNA 1CVJA 2FJVA 3TW0A 1O28A 2VQEF 1LWFB 2BJEA 2X51A 2HNDB 3KJFB 1U49A 4B3OA 3G6XA 4C2MK 5CCLA 3PO3K 3BGRB 1RHQB 4E2FB 3MUMP 4TY8A 1I50A 3M2RA 2Y3PA 1NJZA 4Z7CA 2ZC3A 2P9GA 1XQIA 2MXYA 3SQGA 1XJWB 4HTIA 1NHUA 4WJ4A 2B9WA 3VCDA 4X65J 1KRPA 4USVA 1B0TA 2AEMA 3G2XA 3L7PA 2CJKA 4EBDA 1RHJB 2QSFA 5DJBA 2XS7A 1IM6A 3TWZA 3KFWX 4DUZJ 1Q53A 1I6JA 2ZH4A 1DLOA 3QWPA 3DXJA 2IHR1 4RW7B 2RF2B 2N3OA 4I1TA 1GFWB 2UUAJ 5DO2A 2UUAF 4FNHA 4ZPCA 2XMWA 4L72B 2D3O1 3I0SA 2E1RA 3VAMA 2B63C 1VQ8S 2VB6A 1UWBB 1XMBA 3BKTA 3J81j 3PR4A 2PHCB 2YNFA 1ZM9A 3BYPA 1INNA 2V8GA 3GJSB 3JQJA 1PJ6A 2DNYA 4NLGA 3CC2S 2J6SA 4NYOA 2LXUA 2V0NA 4G1IA 2VFSA 2G9OA 4ILMA 5C4XK 1RAJA 5B0GA 1ACMB 4DV5J 4RWWA 3THVA 2NVYK 3K5OA 4N7TA 3ZZPA 5IP7K 2B0GA 1F93A 2ZKUA 5JVGQ 5DZ6A 4X62J 1TWFA 5KG2A 5LM7E 3OR2B 2EWHA 1W25A 3VVUA 1ZAWA 4RJVA 1P27B 3RB0A 2CPHA 4NCGB 2HQGA 3KDOA 1X5PA 3FOFA 4UTGA 1FA0A 3HO1A 5C3EK 3ILLA 4C3LA 5IYCK 1XXCA 2AJQA 3GTPC 3HCXA 3RYLA 4RW9B 2F9DA 3KJNB 3BH6B 4IDKB 1Z1ZA 3G82A 4WE1A 2E7WA 1NAQA 1MWZA 2WAQD 4B3OB 1P8GA 1AT1B 2Z2YB 4WP8A 1N5QA 2DNKA 3MFHA 5I3UB 2DR5A 1P9YA 1KLMB 4UY85 1BHNA 4BWMA 2DKOB 2B9EA 1NCLA 2C3UA 4J9MA 2XEXA 1RU0A 4MJKA 1RABB 1PIEA 3EZUA 1R9TA 4ZJOA 2F3JA 1I6HK 2W2OP 2VKZG 4AH6A 4CO5A 4LF1A 2XCRB 5FJ4A 5B0EA 2QE5A 4N77A 1DTTB 3OL9A 5D4OA 4OI4A 3MM5A 1A9NB 3DMJB 5BXIA 2H5EA 3AB4B 4RW8A 1FXDA 2HMIA 3MMCA 3OTDA 4KSEB 3KNGA 4JBCA 1ZPWX 2R8HA 1GXUA 2OEJA 3GYNA 3IR5B 1IWGA 1IVZA 2QT7A 1TWFK 4FYXB 2ZE2B 1Q0NA 4DFMA 1FJGF 3QRPA 3ILOA 1PBUA 2YU9K 1QSLA 4PQUB 1XR5A 1CJKA 1VQKS 3V6DB 4C3JK 4QIFA 3QT7A 2ZBCA 3CJ2A 1UEKA 4LF6F 4HH1A 2LECA 3I4MK 2ASDA 3P49B 2DGXA 3PIPQ 3MAQA 2QTWA 2YTCA 1FKPA 1UVLA 1R0AB 1WUUA 2EXUA 3HOXC 3A12A 1O25A 3GJQB 4LVOP 2CQDA 2EVZA 3CCES 4Y0FA 2J9DA 5KT2A 3QQCD 4Q44A 4M8LA 2QG9B 2X1GA 1NZAA 2HRTA 1KQKA 3JTNA 1NPRA 3N3YA 4NXMJ 4RW4A 1WCMK 5B08A 1FKPB 5DLFA 2HEKA 1R31A 1N36J 4GTDA 3I9ZA 3QWUA 1H2UX 1S1UA 1VMBA 2CXEA 3DDIA 2MZRA 2DNGA 1K0VA 3Q8SB 5M2UA 3IGNA 4Z37A 1Q78A 1S6UA 2PE8A 4XSXA 5KFWA 2GHVC 4GC6A 3T00A 1QAXA 2BRLA 3FDSA 3CDBA 2VG7A 5KFZA 4CP5A 3UVJB 4NXMF 1ZM2A 1FFSB 2B9XA 5LSRA 2A0FB 2V2ZA 5THWA 1U1NA 3BGLA 3CO9A 1G2EA 1WG4A 1R0AA 4Y7NC 3JAMY 3H2UB 2VFVA 1IBLJ 3DM2A 1ZA2B 4EU0A 4ICLA 1S59A 4CLWA 2MQNA 2KFZA 4WJ3M 4WFAQ 5I3PA 3H59A 2FIUA 4G1PA 3UDVA 2HHHJ 5KFXA 1RU1A 4RW6A 2VBWA 4P71A 2FC9A 4IO9Q 4WCEQ 3JTOA 5DRKA 3CCSS 3OUYA 4C3MA 3FBCA 2XO7A 3CWJA 4B3TF 2LDYA 3QT8A 1N34F 1T3NA 3M8YA 1BQMA 1BUXA 3OVSA 3DLGB 4RW9A 4OI1A 1TR0A 1KNZA 5JJBA 3W5YA 3HD2A 1AUSL 4O2DA 4FZVA 1HHSA 3GV7B 3QGHA 3EYZA 1WSVA 2OPSA 3IBWA 2EFNA 2YKQA 4K5RA 4C3IC 1Y3KA 4OIQA 5JFEA 2KN4A 4CO0A 3DYAB 2V4JB 2FJXA 2M88A 2GZOA 1WF0A 3UI3A 4DSFA 5HI7A 4P72A 1NLKL 3QO9A 1PYOB 4KC5A 1RT2A 1JNZB 5K5MA 1CG2A 4AXJA 3KLFB 1FXRA 1R27B 2ZH6A 3S2HC 2HW3A 4NXNJ 4WWSA 2VV5A 4X65F 3F44A 3K58A 2PI5A 1KWMA 4W4MA 3I4PA 5A8RA 3UD4P 1X4EA 2HSEB 3SMZA 3M6UA 2FYXA 4LRFA 2KT2A 3I56S 4BY1C 3CUNA 2R2TA 1S72S 4DQIA 3Q24A 1JLCB 1PJ5A 4IOAQ 2AT1B 1NSPA 4F8RA 2M7SA 2HNYA 4Q0BA 2LMIA 3FQKA 5L9XA 4LFAF 2PFFB 1S1XA 3S7RA 2ABYA 4CT8A 5KFRA 2RILA 4G0VA 3WIUA 2CPXA 5DLGA 1YJTA 4I7FA 3UCUP 2YNIA 4A3LC 2W9BA 1XERA 1XPPA 3FHZA 2FZGB 4K7QA 2HVEA 2CQHA 1NK7A 1U0HA 2E44A 1NSKL 4M1XA 2W9AA 1NK8A 2KWAA 3N0BA 2GW8A 1RBOB 2DR7A 3T01A 2CRLA 4DL5A 5E7OB 1WELA 3RJMB 3RRGA 3V81B 4U7UD 4OMFG 2WVFA 1TWAK 2ZUGA 1RKIA 1WF2A 1O0PA 3M4OK 3HDSA 2X3GA 3BH7B 3BGRA 4CO2A 4WXWA 2NVTC 1WKJA 3T6BA 1ZZFA 4X4RA 2FHJD 3DOKB 2GQ2A 1IBKJ 1S1TA 4ED3A 3QRQA 2W9CB 2KXFA 3PYEA 3OFHA 4L75A 2KM8B 2G13A 4RLEA 4LF4F 4RNOA 3GTKA 1NDLA 1VIXA 4LQYA 5U47A 4IYQA 2C28A 3R5CA 1UA1A 3NCQA 3CW2C 4OIOA 1Q82T 1NHKL 3BQ1A 4LR2A 5J2MB 4C97A 1MN7A 4N5SA 1R43A 3G8QA 1R89A 3A3OB 3HPOA 3MXHP 3UNYA 2G0CA 2GA7A 4IG0A 2VICA 1M5HA 1OO0B 4ILDA 3VAGA 4H54A 3MTJA 1NDPA 5A6PA 4KIAA 3HHEA 1YNNA 1C0AA 1JLCA 2HQFA 2AWZA 4BHQA 1OSCA 1GXLA 2GMLA 3QJPA 2H54B 5CH7B 4WILA 2VG7B 3IXQA 2RGRA 3DMJA 3UW1A 3LPYA 1M5KC 1KDNA 3QSYB 4A46A 4JI3F 3C3LA 4EO8A 5D77A 5T14A 3WC2A 4NLDA 2DR6A 2FJBB 1N5VA 3SCJE 4OJ3A 4I64A 4J9UE 2YH1A 2OAUA 3MEDA 3GTLA 1Q79A 1ICEB 2BE9B 2BKPA 3TEHB 3GZ7A 5TJ3A 4A3GC 3THPA 2B4PA 3ISZA 4B3RJ 3E01A 2CZVC 2BW7A 5JUMA 2U2FA 5H9EK 3IO1A 2OPPB 2YH0A 4Q4ZA 5IZHA 1Q8KA 1GTEA 4XK8C 2KYZA 2ZKTA 1YZ7A 2Y1IA 4PUOA 4J9QA 2BZ2A 2VBZA 3QIDA 3S8SA 1TTHB 3ITHB 3J7YU 2IC3B 4OX6A 4CRJA 4L3KA 4TLQA 4YFXA 3RR8A 2YKNB 3Q2TC 4MAKA 1N32J 5E41A 4ZCIA 1ULRA 1PAUB 2MZQA 1T02A 3TAMA 3H5XA 2OD4A 4QW9A 2E66A 3H98A 1JMTA 2K06A 3JSTA 1TKXA 3MEGA 1UCNA 3IA0A 4MEXA 4QW8A 1TV6B 1IBCB 2Z2MA 3UDEA 3SCLE 3NS5A 2DH7A 5I3UA 2C1EB 3I4NC 3IMQJ 5KG4A 2LQ5A 3DLKA 4GRSA 3ELHA 4X6AK 4WP3A 4W92B 2DRDA 4K5SA 3RB4A 1MMDA 1UVIA 1F9EB 1IW7A 2JDJA 3HSZA 1KVJA 3G86A 3E51A 3NS6A 5DDRC 2DGQA 3ZZOA 2Z8QA 3KLIB 3M1VA 2GC8A 1SQGA 2A6MA 1F1BB 2HNZA 2FJDB 1HPZB 1F9NA 1C1BB 1PO6A 2GJFA 1WI6A 1WKLA 2F4VF 1TL7A 1FO1A 1S5ZA 5KFBA 4NXNF 3DRSA 1YVFA 4ANDA 3GSIA 3VR1A 1WJ9A 2QMUB 3IM9A 3WIVA 5HLFA 3BR8A 4EMDA 4EZ6A 5C24A 5IYBC 3PRBA 3TNVA 1J5OA 9RUBA 3I0RA 4FPRA 3NNAA 4KDDA 4CTAB 4V1Ak 4KE5A 5CYJA 3CQZA 1GX6A 1M1GA 3S17K 2WSFC 1RUSA 3KLEB 3A8KA 1WI8A 1B3TA 4ECUA 3RAXA 3O1LA 3CQZC 3A13A 1BC6A 1N5YB 4OIXA 3WX4A 5LOQA 2BR0A 3KMQA 4PYDA 2ZHBA 1UETA 5HSPA 2LU2A 5EN1A 4DR7F 2QA2A 1F9HA 5IC4B 3KNAA 2XGPA 4QYZJ 3GIIA 3GIRA 4ZN1A 5DQHA 3D6FB 4KV8A 3AJDA 3LALA 2QLJB 1TWGC 2VG5A 2XY5A 2E2HA 3OL7A 3D5MA 4A3BK 4NLOA 4GFQA 1YRXA 4V19X 3H25A 3C2PA 3AJ2A 2JA8C 2J8AA 3BPSP 4WK1A 1HMVB 5D78A 4LQ3A 5ETNA 4B9LA 1MG7A 1YJNS 3UQSA 4Q8EA 1L3VA 3SFGA 1UPPA 2AV5A 2A69A 4QR0A 2MSTA 4OZ2A 4Y52C 4USWA 3B82A 3T19A 3T1AA 2E1PA 3LP2A 3S15K 1HQMA 3DM2B 1IWAA 3OTEA 2IMWP 2MKCA 4QU7A 2Z2LA 4MMOA 1FNMA 4WTYA 3BSOA 1U1QA 5HROB 2R8JA 1BWVA 5GAEI 2ZM6F 3EZ5A 3IP0A 5SUHA 3G4SS 3PO2C 2ZUFA 1RT3A 5E2QA 1Q86T 3A8EA 2N3LA 3RG6A 3GTGK 4P73A 2J0XA 5L9NA 3TJ8A 3GTQC 1I94F 3CMQA 4DR5J 4DZ6A 3DHWC 2LEBA 3IBFB 5AE3A 4DR2F 2Y8YA 1WIHA 2KVQE 4ZJLA 2XNRA 5KFJA 1FHTA 2Q1LA 4OZLA 1JWWA 4TNOA 1KLMA 1TAUA 3FCWA 1BQNA 3C15A 4Q2LA 2W25A 2WW8A 3GTMC 3DHXA 2KH9A 4PKDB 3CC7S 2KRBA 5KOWA 4B08A 2ASYA 2J5AA 1IBMJ 4NA1A 1H6KX 3OFEA 2CQBA 4HACB 1TUGB 2R7ZC 1T94A 3OTCA 3LP0B 4ITSA 4WE1B 4OZJA 2CG4A 4DL2A 4C8NA 1Y10A 4LFBJ 4NCAA 4HHJA 5IXUA 3H7HB 2P8TA 1CQNA 3W62A 4A3EC 1ZZNA 2LEAA 5LJ5Y 3M3YK 3DLGA 1U47A 4GZYA 3RAQA 5D0HA 4NYZA 4LSZB 4A3CC 1NB7A 2W1BA 4YHHF 4R5PA 2ADBA 2ZH1A 3MI7X 3JXOA 1RAGB 2KJWA 2ACYA 3CD0A 2R8KA 2NVXA 2I5JB 3O2IA 3ZZRA 1YBUA 4NLYA 2XLJA 4H4KA 4M5JA 2A10A 3TVYA 4CH0S 4LR7A 3MPWA 5CYQB 5JMNA 1DTQA 1RA6A 2OPRA 3ILIA 3PTWA 3M6XA 1HBUA 2ZNZA 2KHCA 2R42A 3MURP 5HJXA 3R6LB 1O5JA 4J9PA 1FESA 2XYHB 4CH1A 1T05A 1YTYA 4O4RA 2OP5A 5HLFB 4A3IK 2WW4A 2H4WB 1NJXA 4G3IA 5HQ8A 3IFEA 3FRYA 3NWRA 3R5AA 4KBIA 3CJKB 4QU6A 1HWIA 1RT3B 2CNKB 4CO4A 5L1KA 2ZVSA 5J2PA 2QLWA 3TJ9A 1K44A 5K14A 3JS9A 2V2KA 1S1WB 4QJVB 3GTQK 3GTGA 5F8IA 3OBIA 4ZVGA 3K59A 3DGPA 4NLPA 1IKYA 5DZ7A 3TQ1A 1G6BA 3DOKA 4CT9A 3TVKA 1GMWD 4OYWA 2FZKB 2CJBA 1HA1A 1NO8A 3MMAA 4IO1A 4N76A 4DFKA 4DV6F 3QIPA 4K4UA 4ED4A 4IRKA 1YQHA 3OL6A 2EFGA 2DTJA 2B5JB 4Z2XA 1S9EB 3TI0A 4ZOSA 1U1RA 1RHMB 1U1MA 1DQ8A 5KT5A 3HOYK 4R0EA 2FUG9 1VGYA 1FDDA 2AHOB 3CJ5A 3UCGA 1VBYA 3M6VA 2B8PA 2J6UA 3G9CA 2E1MC 2G2ZA 3GG1A 4DV3J 2XY6A 5HVGA 3I6PA 1EKSA 2I1RA 3FKIA 4QWDA 4C8MA 3SBMA 4FN5A 4ED6A 4A47A 4P7TA 3QX3A 2O1PA 2AMCB 4DSLA 3S1TA 1TL5A 4JV0A 2VIHA 4ZPTR 2QLBB 3C15B 4RNHA 2QL9B 2DT9A 5GAGU 4OYBA 3GSDA 2VH7A 1AA1B 2QX0A 4LVNP 2RIJA 4DSKA 1PKUA 2VJVA 2LEPA 2VODA 3CMAS 5HO4A 4ECSA 2YXLA 1Y5NB 4BLGA 3OLBA 3HFZB 3KK2A 2DCUB 3FSXA 3VAKA 2PMWA 3TEGA 5HP1A 1K1QA 3MMLB 2MZTA 3PZPA 4EFAC 4X4NA 2VOPA 3J7Z5 1BLUA 4PRFA 4A3KC 2R7VA 1HI1A 4OYIA 4KHMA 4DV2J 1SH2A 1Y0HA 2CWXA 2IM0A 4JI3J 1VJQA 4X64J 2JVRA 1SL0A 2WHOA 1BDFA 4KM9A 3EE3A 4A93C 3UDCA 3QJJA 2XBPA 4NE9C 1GXTA 1XZPA 3P4UB 4F26A 5AE1A 2HG4A 5KG1A 1C0UB 2JEGA 1DY3A 2IRXA 1Y4ZB 3PVXA 1Q1KA 5A8KB 1SJQA 4P74A 5DDOC 1FEEA 2KTQA 1QLNA 2E2IC 2CFAA 3V4IA 4K0KJ 3ONQA 2D3ZA 2R2RA 1S6OA 4DCOB 4O3RA 3I55S 4DU7A 3QGPA 3HOZK 1KP6A 2ZVIA 3KHRA 3NP5A 2FY8A 5KT7A 1YJ9S 1VBXA 1C1CB 4KC6A 5AJ3J 3SQGB 3CNQP 2XS5A 1Y1WC 2NPFA 4DX8H 2FZCB 3MPVA 1HNVB 2KB2A 4WFYA 3M2RB 4URSA 2P6TA 1H3DA 4ZITA 4JI0F 2MLZA 1R8CA 3RB3A 4P7VA 3HXMA 1IM4A 1G51A 3GILA 2AYMA 3S1MK 2OSRA 1NK9A 2NVXC 2AJ2A 2EC2A 3S1QK 4DR4F 1FCAA 2ZH5A 4RW8B 4J9KA 2RNEA 2ZOMA 2B9YA 4Q0BB 5DM6Q 2N82B 1U2RA 1B70B 3TA0A 4CTAA 1RHRB 3TX0A 4DCJB 2PFDA 5LMUJ 3EGZA 3DXSX 3M8PA 3NRBA 1ZYRA 1SKSA 1UW4A 3HZGA 2HHVA 3D6MB 1RT1A 3OQ2A 5D3GB 4DN9A 3KG0A 2E7XA 1IXKA 4ZVTB 2LQ8A 1NHVA 1HI0P 4RNFA 3BQ2A 3UWTA 1R8PA 3N4WA 1BXNA 5HMWA 2ATCB 2IBKA 2DGWA 4F7VA 1IS1A 3PEJA 2HBZB 2BANA 1VRTB 4GTCA 4M5DB 4ILRA 4NZ7A 2B43A 3ZNUA 3TAQA 3QSIA 3ITHA 1TL7B 3N6MA 1Q7LB 1PYTA 2IDEA 2XTJP 1FDAA 3CXCR 3BYRA 1N4LA 4A3JK 1WDDA 2V4JA 1TU0B 4L3NA 4X62F 2B51A 3JYTB 1IJFB 5ETLA 5KFEA 4NZ0A 2DH8A 4Y52K 3DRPB 3MM8B 2V2QA 2NS1B 2CWKA 3MOJB 2V63A 1F6TA 4BY7C 1D8ZA 3W2WB 2BX6A 1JLBA 3RAMA 5IYDK 2B6AA 2BOAA 1RADB 1FFGB 3PJWA 4F4AA 4DV2F 1TKZB 5LXRA 4HHUA 2V8VA 3UD5A 1NK0A 4P10A 1HQEB 3L09A 5HMYA 4IQMA 5T41A 5D3GA 1FRKA 4KB7A 4DUYJ 4DDQA 1VQ4S 4WKYA 2XB2D 2R7UA 2JZ5A 1U09A 3I31A 4KGZB 1SV5A 3GWCA 4DR3J 5ETVA 2OMLA 5IT9U 3H2LA 1JXLA 1JLQA 1S1XB 3TZWA 5F41A 4AQYF 2XM3A 3R8YA 2XG8A 1XZPB 2P5VA 3FUYA 2VZ9A 2V6AA 4RW4B 3EPIA 1T9UA 4LK0A 8AT1B 1LWXA 3HT0A 2P8IA 2F4FA 3V5RA 4C8OA 4LSLA 3Q8YA 3GFZA 3TR5A 4ICLB 3GIMA 1HQ2A 1CJKB 1QE1A 3KLHA 2R92C 4EK2A 3TFHA 4I2QB 3GTPA 4H4KC 2OD6A 1UZHA 4BCAA 1TWCK 2DXFA 1JQWA 4OYOA 1XXAA 3GTJA 2XCOA 3AD9C 3FJ2A 5KFGA 3VWSA 2VF3A 2F63A 3BGFA 5C24B 4L74A 3WQPA 2EK1A 1VIOA 1M5SA 2CZ9A 4N41A 2HHXA 3GEHA 2XYGB 3NMAA 4HYKA 4YDXA 2CW0A 5GAHI 2UUBJ 4O44A 1UEUA 3JSMA 2IM2A 4K8RA 1NH8A 5DDQC 2J0WA 2ZOFA 4HDHA 2HHWA 5KG7A 4QWEA 1SKWA 4USKA 1QJHA 2Y1RI 2L48A 1SC3B 3OL8A 1HQEA 1S7HA 4LT6A 4AD6A 1SIWB 4MK8A 2NXEA 2AGPA 1NKBA 1U48A 2RKIA 5C4XC 2D3UA 2K3IA 3DLEB 3B78A 2RQKA 1SB6A 3EPGA 4ECTA 4ZK7M 4X84A 1H7WA 1T9YA 2N4CA 3HM9A 2ZM6J 2WBRA 3R1HA 3GMGA 1ZM4A 3HJFA 3HVTB 1XMQJ 4JI7J 5KFMA 3G8TA 2BACA 1D09B 2HS0A 4WYWA 3KUGA 1I50C 3VV2B 4NLWA 1EB0A 5LMNF 3D68A 4I6AA 3MM5B 1GK8A 1QVFR 1R6YA 5BR8F 1J5EF 2V67A 3MR6A 1USMA 5J2PB 2VC1A 2JA6C 4NLSA 3TZYA 3SSRA 2V34A 2LCWA 1HHTP 5J1EA 3DRRA 2JEJA 3HHDA 4PXBA 3N01A 3Q83A 3CF5Q 4LJMA 1H2TZ 1RACB 1J2VA 1U1OA 2I2YA 1JJ2R 2RSQA 3HHLC 3DDNA 2EKNA 4EO6A 2UXDF 4KGMA 1RP5A 1T0TV 1UFKA 4NI2A 5BYRA 3J7ZT 5HVFA 3DOLA 1S10A 4C6AA 3X1LB 1DJ0A 4NPOA 3PO4A 2MYFA 5KG6A 3Q22A 1M90T 4Y7NK 1LFWA 5KT3A 1HBMB 2GVDB 4P2XA 1S7IA 4NI2B 1X5OA 1FRHA 4K4YA 1QTNB 3IM8A 1SMYA 2J7KA 1LV5A 8RUCA 4DX5A 3G4CA 4WIIA 1PILA 4Y2CA 1AZSB 1MU2A 5HVHA 4JI1F 2WVCA 4P5AA 3C16B 3FKIK 4CO1A 1ZETA 2JVOA 5K9FA 5EGHA 3NGSA 4KGXB 4DWIA 2XHCA 3HLUA 1YNJA 1H38A 2WB4A 1U2FA 1TL1B 2K3KA 4MKBA 2L9WA 1FX4A 3I9V9 2VDIA 3EM1A 3HSDA 1VQLS 3IR7B 4CLSA 4QR2A 1RWWB 3AHPA 2DEIA 3CCUS 5ETQA 2VQFF 3DU6A 4LUBA 4BBSC 3KKFA 2C3PA 3MD1A 5J1PA 2PC6A 4M5NA 1TZ0A 5CYMB 1DTTA 2CDQA 3MUTP 1FK9A 4OIPA 5ETRA 1T9TA 4G1QA 3DDKA 4DPWA 3KHGA 2GJIA 1NBEB 2V68A 4G6VB 3SDEA 4G7OA 4J9LA 1DCOA 4TKTA 3PJXA 3GP9A 4L6V3 3R5GA 3EWGA 1B4BA 2NR0A 4LSLB 2FVSA 2HQDA 1VCTA 1O6XA 3LTOA 3R5BA 4KARA 3M4XA 3W9IA 2YX4A 3GONA 1C0UA 5C7PA 1XK8A 1I51B 2F1FA 4DEZA 2CQ4A 3KLVA 3KK2B 2VFTA 4EGLA 1WQFA 2KU7A 2V94A 3OREA 3GTKK 1RT6B 2C3YA 2HWHA 3EVWA 5TMCA 3MGJA 4ED2A 3UVJA 2AIRB 4YR3A 3FFIA 1Z2LA 5A8WB 1REVA 3NBPB 2ZZMA 4QIWD 3BF4A 3GTKC 4DHVA 4DR2J 4OX7A 2VUMA 4QCLA 2BE7D 3N9UC 1FNOA 2ZEJA 3OFFA 3OSNA 4USIA 4K59A 5C44K 2LXIA 1RAOA 4OYZA 1K9MT 1UP1A 3M4OC 2BJ1A 1RWNB 2VPXB 2CADA 4B3MF 2QA4S 1KQ4A 5KG3A 2AGOA 2XZTB 1LWEA 4F25A 2F4VJ 1RTZA 3SYZA 2K7JA 5H9FK 3DRPA 2NVXK 3GIKA 2R8IA 4ZPBA 2RQ4A 2DY9A 3DRYA 2QA1A 1TFWA 3CJTA 1Q7YT 1CJUB 2CUYA 1VRUA 4PG4A 4IFYA 4BKWA 4B9VA 3VZHA 2QYGA 4ZP9A 1B0VA 1U02A 1OQ3A 3SCIE 1Y5LB 1FWLA 2ZITA 3KDNA 5IT0A 2PN6A 5B0CA 3K7AK 3VALA 2J9DE 2E5IA 3ZFVA 4Y2MA 2EBGA 4KRWA 4F36A 2OLWA 2HAIA 1Y3JA 4OYPA 1Y9OA 1VDHA 5C2CA 4H4OA 2HQIA 5ETOA 5L1IA 1NK5A 2RHSB 4LFBF 2BJ9A 1VISA 4DLEA 1VGXA 1S6PA 4Y34A 2AGQA 4TXSA 4LBIA 2IA0A 4B02A 4JI7F 1VQPS 2OHDA 2KG1A 4OI6A 3H3VD 3QZ7A 1WCMC 2A68A 5CZVA 2P6SA 2W01A 1WHVA 3T9NA 3S6EA 3EVOA 3GTQA 1RT5B 1L3KA 1GAOA 2XCPA 2PDAA 1N0UA 2R8GA 2KVIA 1LW0B 3CIMA 4NL5A 3I5CA 3MMBB 3K8VA 5LL6d 4LR9A 5DGAA 2YKMA 2YNGB 1FE4A 2HIQA 3S0XA 3KLHB 1OMSA 2K8GA 1SFOK 4ALZA 1U26A 1GEHA 3PRVA 4J91A 1J6WA 2PMZD 6FDRA 3BBFA 3TAPA 2G0IA 2C2EA 3QGGA 3H4BA 4DLGA 5IS2A 2YQ0A 3S01A 4P5BA 3ZZUA 3P96A 4DS5A 1F3VA 1SXLA 5KFVA 5A2QU 2OFGX 4C3KA 4Q7AA 4K0KF 2CQ2A 1YITS 4C8ZA 4PZVA 3POTA 1S6QB 2NVTK 3K5NA 2RQMA 2XMUA 4E98A 2XMKA 2VHGA 1T9XA 1S97A 1X5TA 3Q3QA 3HOXK 2IRUA 3P3DA 4KR0B 2DY1A 3F73A 3WHIA 3ZTRA 1V3ZA 3FRZA 3MF5A 2V4QA 1B0PA 3M05A 3UR3C 4D3HA 2GIRA 5F3ZA 3ENVA 1HNWF 3DI6A 3S15C 3UN5A 2DEJA 2W2PP 2BOPA 4FF3A 4A3EK 1WC6A 5TMFA 5EX0A 4BXXC 2B63K 1ZQ1C 2E7VA 3DNCA 4DR1J 2NCKL 1S4FA 4R8UB 2HVDA 1CJTB 4MTPA 3BKUA 1SIZA 3M6WA 3X3UA 5KFHA 2H65B 1LWCB 5K8PA 3V2UC 3PNIA 3R1LA 3MEEB 1UJ4A 1U1KA 2JWNA 3AXKA 4IUFA 4LIRA 3W61A 3PX0A 3LGNA 3OTOJ 2A18A 2ALYB 2NVYA 4FVCA 3W60A 2WTFA 1D0EA 2BUNA 4ANEA 2E2HK 1BQXA 3LP1A 2WAQL 3FBEA 1DZ5A 1FVQA 5CJ9A 3R27A 1WORA 4ZVQB 2AJ0A 1SV5B 3HFKA 2XWXA 1ZM3A 4O4GB 1FTRA 3GIJA 4ZCKA 2XWYA 2MKYA 1H7XA 1SKRA 2MLXA 2WVBA 1S48A 4Y2KA 3M32A 1HWLA 4ZS6A 1X4DA 4R25A 4OZ1A 4CLYA 5IC6B 1FX2A 1HL6A 4OINA 3UN2A 2ZBQA 4BBRK 1YJ7A 3CIZA 2BM0A 3N6LA 4USUA 1MWQA 2FJWA 1WHXA 1UVJA 3TX8A 3MR2A 2Q6BA 3OPKA 4JI4F 4USTA 4N8OA 1WSRA 1IKXB 3M8WA 2D41A 2EC0A 2CJQA 3IR6B 3T1HF 3KYLA 2QA4G 3FEZA 4RR5A 1DBDA 1Q8IA 3HXAA 4OX8A 3PCOB 4AXIA 4OX9J 4RW6B 1LXJA 4ELVA 4ZVRB 1MLAA 3S1NK 2BJ8A 1HR0F 1HNIA 2ZZNA 2VG6A 3N5BA 1JLGB 1BQMB 1G3OA 3PFOA 5GAGI 1IQZA 1KEKA 2FGCA 2JA7K 5B7WA 3DLHA 1IN0A 3UR0A 2JEIA 1IKVA 4C11A 2XO6A 1WF1A 5IP9C 5HP1B 1DAXA 1RWMB 4MIWA 5G4DA 1DQAA 2FVQA 3JSBA 3QRRA 1JLGA 3TANA 1D9DA 5CHPA 3H0GK 1T11A 4LRDA 3S1NC 2AZ1A 3PW4A 1TL3A 4RWXA 3HK2A 2J9CA 5KFDA 4DR4J 2YNHA 2OPSB 4WFBQ 1TKTB 1HKAA 4YR0A 5HBMA 3DLLQ 4G7HA 4KN4A 1FI4A 2XULA 2DNMA 1TL3B 2RMLA 2M0GB 1TFYA 3W8GA 4Q45A 4B3TJ 2Z0GA 5C25B 2CA9A 4RBUA 2XI3A 1C4CA 3DOLB 2KDOA 2A1BA 2GO8A 3ICLA 4GVBA 5KFOA 2MZJA 1F2GA 3HSJA 3PFEA 1F2HA 5AXNA 3M30A 4A3GK 1SC1B 3RU0A 3VGUA 1RAIB 1VHFA 4YHHJ 4XTTA 3NXZA 4A8SA 3GV8B 3HT3A 1YI2S 1X5SA 4CWBA 1J6VA 3MTKA 3NS7B 4F0HA 4YY3F 4DV7F 2DXEA 1JLQB 2GSOA 2FY1A 4A3MK 3HI9A 2UVRA 1FRLA 2IM1A 4UF4A 4A8KA 1QD1A 1ZAXA 2BABA 2G1DA 1SUQB 2C3MA 4NOIA 1R6VA 1JNRB 1WOOA 2CPZA 4ZPWR 4GTBA 1U6ZA 3NL0A 2YPZA 1FKAF 4Q43A 4LF8F 1ZAVA 3QZ8A 1RTDB 4LBHA 2MQQA 3H0GA 2AJFE 2BE5A 3ETOA 4DZDA 2I6WA 2BM1A 3CCQS 3VGVA 5MAOA 2C2RA 4BLBA 2ZJQQ 3KK1B 5GVQA 3U1NA 4ZMMA 2XYPB 2HFSA 3LAJA 3ZNJ1 4URGA 3S16K 3OPFA 2H5IB 1RZMA 1TWFC 2JA7A 2QJ3A 3KLGA 1RLCL 1RAHB 1Q16B 4F67A 3JSRA 1TWAA 5E3QA 1C4AA 2XC9A 2WK4A 1CJVA 3VQSA 3PO3C 1IKWA 3K0JA 3W7BA 4ID8A 4LSNA 4K4ZA 2F65A 2NYIA 5A8KA 1FTCA 3DCAA 2EEYA 3BSCA 5HBMB 3S16C 1X4FA 2CPEA 4JI2J 2UZAA 3QIPB 4KHPJ 3OR1A 3HP6A 4C8KA 2AYBA 1CULA 4D3GA 1T95A 3HHLD 4QZVB 2CPFA 4G0UA 4YB6A 4DL7A 3DXBA 2FGOA 3TZXA 4HHHA 2W8KA 2HHSA 4G7ZA 4LFAJ 2JA8K 3M1VB 2AEFA 2DNOA 2NXJA 1O26A 1AW0A 2E9TA 2H9ZA 5LMNJ 1U1LA 2KZZA 4ZVEA 3GTMK 4EEYA 3H42A 2HMIB 2OELA 3LO3A 1TP7A 1X0PA 1GQEA
chains in the Genus database with same CATH topology
3GSIA 4PAAA 1WOSA 1VLOA 3GEEA 3TFIA 2GAHC 1XZPA 1XZPB 3GEIA 1PJ5A 1XZQA 4P9SA 3GIRA 1X31C 3TFJA 1WOPA 1WSVA 3AD8C 1YX2A 3AD7C 1V5VA 3A8KA 1WOOA 3A8JA 3TFHA 3A8IA 3ADAC 3GEHA 1PJ7A 4PABA 5L46A 1WORA 1XZQB 1VRQC 2GAGC 3TTGA 1PJ6A 1WSRA 3AD9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GSI A;  4PAA A;  1WOS A;  1VLO A;  3GEE A;  3TFI A;  2GAH C;  1XZP A;  1XZP B;  3GEI A;  1PJ5 A;  1XZQ A;  4P9S A;  3GIR A;  1X31 C;  3TFJ A;  1WOP A;  1WSV A;  3AD8 C;  1YX2 A;  3AD7 C;  1V5V A;  3A8K A;  1WOO A;  3A8J A;  3TFH A;  3A8I A;  3ADA C;  3GEH A;  1PJ7 A;  4PAB A;  5L46 A;  1WOR A;  1XZQ B;  1VRQ C;  2GAG C;  3TTG A;  1PJ6 A;  1WSR A;  3AD9 C; 
#chains in the Genus database with same CATH topology
 1VC6 A;  1YZ6 A;  3RRH A;  3WOD A;  1S76 D;  3MM6 B;  2B4O A;  3NUH A;  3L95 X;  1VS3 A;  2PPB A;  1TWH A;  4PYA A;  4GTA A;  2AP6 A;  5DM7 Q;  2V9W A;  2NVY C;  2HWI A;  4OHZ A;  4OJH A;  2E5G A;  3RUB L;  2E2I A;  5K8O A;  2G4B A;  2J76 E;  2RHQ B;  3LQV A;  5ETS A;  4IR9 A;  1WC0 A;  1X4C A;  2VON A;  3GTO K;  1JJH A;  1JX4 A;  3M2V A;  1D9F A;  3JQM A;  1WEX A;  5IM0 A;  2ZUA A;  3DOM B;  4ZLP A;  1EK8 A;  4JI6 F;  2VKR A;  1S57 A;  1RWP B;  4P9S A;  4DN0 A;  4FYV B;  4C3J C;  5KG0 A;  3C16 A;  4BXX K;  4O4G A;  3EZO A;  2RVJ A;  3AXM A;  5CQG A;  1EJ7 L;  1RT5 A;  3H90 A;  3PYD A;  1YK9 A;  2EFP A;  4DF4 A;  1ZYQ A;  2UUB F;  5GAD I;  2F5G A;  3D3B J;  1USO A;  3O6Q A;  2E9Z A;  4X4U A;  1H98 A;  1UV7 A;  5ETK A;  1QDU B;  5J2N B;  4DX7 A;  3OVB A;  4S0M A;  4ECQ A;  4CYU B;  2YNH B;  3HUL A;  4C0H A;  3KJQ B;  2CNN B;  2QMX A;  3EGW B;  2KKH A;  1RWU A;  2GQC A;  5BYS A;  4R8U A;  2HHU A;  2XMV A;  2UXB F;  2LDI A;  2OMO A;  4DV0 J;  3NNH A;  3QGI A;  1LEO A;  3ADA C;  1BJT A;  1TK0 A;  1TKZ A;  1SH3 A;  1QM9 A;  4HEA 9;  3HHN B;  1FNX H;  3L4K A;  5I4M A;  2HBQ B;  3TYT A;  5A6W A;  2A3J A;  1XMQ F;  3NMR A;  4YEA A;  2DO0 A;  1NKE A;  2ROE A;  1NJI T;  4ED5 A;  3MCS A;  4NLR A;  3KXD A;  4QPT A;  3D3C J;  1SJ3 P;  1KBR A;  1X4A A;  1PG5 B;  2CNL B;  5IQQ A;  3S2H K;  2KFY A;  4OHY A;  2HUR A;  3MZI A;  3L3C A;  2FJA B;  3DFE A;  4LJZ A;  2DGT A;  2PO4 A;  4DPT A;  2QN6 B;  1RE1 B;  3BPD A;  3D0I E;  1GMV A;  1XR6 A;  4NAS A;  4LF7 J;  3GTY X;  4X4Q A;  2RU3 A;  2FQO A;  2MQP A;  4FM9 A;  5I42 A;  2NXN A;  2FVC A;  4IOC Q;  2VUG A;  2H5J B;  1HMV A;  1EET A;  2KZM A;  1Q8B A;  3MOZ A;  4ANC A;  1SL2 A;  1VQ6 S;  4O3N A;  3AQO A;  3L7O A;  2FHK A;  4BBS K;  4A8Y A;  5DDP C;  1B4S A;  4RKU C;  3T41 A;  2HGL A;  4E8U A;  1APS A;  2JFK A;  5C4J C;  4KY3 A;  4IFV A;  4O0N A;  1SL1 A;  4NA3 A;  4PAB A;  2DGS A;  4MQ9 A;  2W4D A;  1EAY C;  5EDW A;  3RZD K;  2Y3Y A;  2XQC A;  4YFK A;  3CC4 S;  5E5N A;  4NZ6 A;  1H0H B;  1RAA B;  3NGU A;  1PGZ A;  4QYR A;  4ZJQ A;  4FBU A;  1K83 A;  5CCM A;  2BJ3 A;  2AYE A;  3S1R K;  2PT0 A;  1N6Q A;  2R9L A;  4C98 A;  1JXE A;  3CGI A;  2O66 A;  3OLA A;  2E29 A;  2DHG A;  4RPF A;  2IJN A;  2DIS A;  2IY5 B;  1RAF B;  2XCQ A;  5IP9 K;  5D4N A;  1TVR B;  1WHW A;  4PAA A;  4YDD B;  3T9Z A;  2PEH A;  4ZLJ A;  4DBQ A;  3T5H A;  2XHW A;  1VBZ A;  2GV1 A;  1JK9 B;  2Q66 A;  4KFB A;  5D0G A;  2I5J A;  2BMB A;  2M8D B;  4B3R F;  2LVW A;  1U1P A;  3AAW B;  2AW0 A;  4B3S J;  3H40 A;  2WBM A;  4O3S A;  5D6G A;  1NJW A;  4ZPV R;  4BC7 A;  3BV8 A;  3ZC4 A;  4CLF A;  2ASJ A;  2HWT A;  4J3N A;  4X6A C;  1FKO B;  2VC0 A;  2E2I K;  2E1A A;  5L46 A;  3ILJ A;  3SV4 A;  2NQP A;  1QE1 B;  1UWA A;  4DL0 C;  2CFX A;  3AD7 C;  3EX7 B;  4U96 A;  2IYG A;  3V6D A;  2VOO A;  1F0X A;  2YWW A;  2EFO A;  2ZE2 A;  1BGW A;  4Y2A A;  1SQE A;  4EBE A;  2E5L J;  3SDE B;  2GJ2 A;  2KT3 A;  3BBB A;  4JYA F;  1RWO B;  3D1O A;  5KFK A;  4KMH A;  2CAJ A;  2HFN A;  4JI4 J;  3Q0A A;  1AFI A;  3AA9 A;  4TU9 A;  2OIH A;  1K83 K;  4C9D A;  5GME A;  4K4V A;  4O3O A;  2YY3 A;  1TAQ A;  4DV4 F;  1FER A;  1OQ6 A;  2AU0 A;  4PWW A;  1S12 A;  2VA3 A;  2OSQ A;  3J7A 1;  3M2U B;  4MH8 A;  1NUE A;  2DK2 A;  2B3T B;  3H5U A;  2E2J C;  1Q95 G;  5J1E B;  5J2M A;  1SKU B;  2VJU A;  5C44 C;  3KHH A;  3LOU A;  5JVH Q;  4F4W A;  1YBA A;  3S17 C;  3SQO P;  2R7Z A;  5DG8 A;  3MD3 A;  2XSJ B;  1JLE A;  2MHE A;  5K8M A;  1RSC A;  1WD6 A;  1S49 A;  1F5A A;  1KR4 A;  1LW2 A;  4A3C K;  4OI0 A;  1R9T C;  3DU5 A;  2R7R A;  4B9S A;  1RU2 A;  3OD2 A;  3VAJ A;  2PSZ A;  3PW0 A;  5LJ3 Y;  1MSW D;  1NB2 A;  3CCR S;  3AA8 A;  4C45 A;  3K7A C;  5G0R A;  3NKY A;  1WOP A;  5DG7 A;  3HOV C;  2JX2 A;  3LWL A;  5D4D A;  4YOE A;  1JJ4 A;  1K8A T;  4NLQ A;  1IBA A;  3R5D A;  1GH8 A;  2R7X A;  3OXF A;  4DV3 F;  2RF2 A;  2E9R X;  4X4T A;  1DFD A;  1RT4 A;  4DG1 B;  3A8J A;  3I0R B;  2MGZ B;  4DR6 F;  4LF6 J;  1HYS B;  4RZR A;  2V69 A;  4C48 A;  2UXB J;  1B7Y B;  3P6Y C;  1QY7 A;  1VFJ A;  1RT4 B;  3LWM A;  1KON A;  1I3Q A;  4QOT A;  2BKN A;  3W8P A;  2QC3 A;  4HLB A;  2MY8 A;  2D9O A;  4FS2 A;  2V6U A;  2DRB A;  2R93 A;  3DC2 A;  3M9N B;  3CCT A;  3CCJ S;  3BO2 A;  1SPB P;  3W2V A;  1VK8 A;  4ID5 B;  4Q2M A;  3GTL K;  3AD8 C;  4OYX A;  1RK8 A;  3FNN A;  5IP7 C;  2LKZ A;  1GMU A;  1P1T A;  3SSQ A;  2W7P A;  3THT A;  2CQI A;  4UOG A;  3PHE A;  3R7N B;  4DPO A;  1XWL A;  4WYL A;  5HN0 A;  2E5J A;  4ES1 A;  4ZLN A;  2OGU A;  2EFQ A;  5KFP A;  2EG1 A;  3N79 A;  3HOY C;  3S1Q C;  4CLT A;  1J6X A;  2YNF B;  1A7G E;  3BN4 A;  3SI8 A;  2CQ0 A;  2QFJ A;  5IWA F;  1H72 C;  2DBB A;  1ROF A;  1ZH5 A;  2HZV A;  2XY7 A;  3PV8 A;  1N88 A;  3AQP A;  5GMK a;  3L7U A;  1OJ4 A;  4IG0 B;  4LF8 J;  2JA6 A;  3I4N K;  3RW6 A;  1VC5 A;  1XTZ A;  3OTB A;  3F41 A;  2R7T A;  2GO9 A;  2DXD A;  4ELU A;  2GGP B;  3K8W A;  3IRW P;  3CQZ K;  3H0P A;  3NGT A;  4JB8 B;  3UDL A;  4HL9 A;  4HI1 A;  1F7V A;  1BMQ B;  1UPM B;  4GC7 A;  1FDN A;  3D9B A;  2W4P A;  4DV7 J;  3D2W A;  2MQO A;  3T1Y J;  1VOM A;  3UE2 A;  1P6T A;  2Z57 B;  1UZD A;  4JP8 A;  4OYM A;  1C0T B;  2XLI A;  4I68 A;  2Y1J A;  3C14 A;  4OLO A;  3BBC A;  4QIV A;  1EZZ B;  4IQX A;  3DRR B;  3LAM A;  2VDH A;  5IOQ A;  2KXH A;  4ES3 A;  1TKD A;  4PR6 A;  4DL3 A;  5A0Y A;  3A3P B;  1WDT A;  2LLZ A;  3PIO Q;  4FVM A;  3R7B B;  4FKX A;  3MEK A;  2ROG A;  4A8F A;  2PMZ L;  2IVM A;  4WPA A;  2DNZ A;  2B5J A;  1T3O A;  2R7O A;  2N7Y A;  3WC0 A;  2IJF A;  4EI2 A;  3J81 Y;  5LXY A;  2JLF A;  1BE4 A;  4ERD A;  2J6T A;  4LRB A;  5IM0 B;  3H2V E;  3A8I A;  4LF7 F;  2OI2 A;  4NRT A;  3QMQ A;  1MRO B;  1PSD A;  5IT9 Y;  1SC6 A;  1FRM A;  2ZHO A;  2X1B A;  2YBV A;  3RBD A;  2JA6 K;  4A3D K;  3WDO A;  2OKQ A;  5EGY A;  2LFV A;  4CDI A;  2RDD A;  2YWE A;  5A8W A;  3TAM B;  3QNW B;  4MKY A;  4MT1 A;  2K1R A;  4NWB A;  1FWP A;  5B09 A;  5F0U A;  3D28 A;  1M0S A;  4Q5V A;  4UOC A;  1NPP A;  4ZVS B;  4A3F C;  2GHW A;  3KLF A;  3S1M C;  1R7I A;  3LH2 S;  2R3V A;  4YY3 J;  2Z2Z A;  2M2B A;  4ZIV A;  4P2S A;  3SXL A;  2Y8W A;  4USM A;  1HNV A;  3PYG A;  5L8R C;  1WQH A;  3ZZZ A;  5L38 A;  2OTJ S;  4CCH A;  1S79 A;  2Y0S L;  1FK9 B;  2VPZ B;  1VQ9 S;  1NPK A;  4ED0 A;  1WC4 A;  3UO0 A;  1TKX B;  3TA1 A;  4X4P A;  4ECV A;  3C6T B;  3I87 A;  5IQ6 A;  3OJS A;  2RRB A;  3PHT A;  4LF2 A;  5IV4 A;  1OS5 A;  2FPH X;  4FF1 A;  4FS1 A;  3ZZ0 A;  4XSZ A;  2R7S A;  4RUH A;  1HBO A;  1VBK A;  5JVO A;  2F8M A;  4RU9 A;  1Y5I B;  1HW9 A;  4YB5 A;  1Q5V A;  1OSD A;  3D1Q A;  3BGO P;  2GAG C;  1TQL A;  1SFO A;  3C6T A;  3EIC A;  4FXD A;  3W2W A;  2BE2 B;  2HKE A;  3LW5 C;  3M8P B;  2BKO A;  2UV8 G;  1KQG B;  3BDE A;  3CDU A;  3Q8Q B;  4XLN A;  4RL1 A;  3MM8 A;  4ZIW A;  1QUV A;  4PUO B;  2HVH A;  1BS2 A;  2DGV A;  4UUW A;  2Z58 B;  2R4F A;  2DO4 A;  1WWH A;  1UVM A;  3ULH A;  1EQM A;  3IGV A;  4JV2 A;  5CXT A;  4ETZ A;  3CT9 A;  4AUK A;  4YR2 A;  3D54 A;  2M8H A;  1OPZ A;  3PKM A;  4A3D C;  4U8V A;  4WZM A;  5IYD C;  5F9N A;  4KPC A;  4J9S A;  2GSU A;  5AJ3 F;  1CBK A;  3PW7 A;  1U45 A;  2YWK A;  3CUL A;  1GE9 A;  1HNW J;  3G71 S;  4HVZ A;  2DGU A;  3D6T B;  6FD1 A;  2YWF A;  4KH1 B;  2M52 A;  5FDL A;  5CAA A;  1EAR A;  3T02 A;  1UAW A;  2C42 A;  2K1R B;  3KLI A;  2ZC4 A;  3AH5 A;  1RAE B;  2DVI A;  2O5I A;  2ZBI A;  1RBL A;  3FQL A;  2CQG A;  2NPI A;  2JHE A;  2QV6 A;  5HRO A;  3MAA A;  4GTL A;  2WON B;  2OUG A;  2V50 A;  4ZCM A;  3ZXW A;  1EI6 A;  2A6H A;  3SCK E;  3IBC B;  5J1N A;  4Y6I A;  1YX2 A;  3UD3 P;  4DR6 J;  2RH6 A;  3CJR A;  2FQQ B;  3SIP B;  1ZBS A;  1RB0 A;  4U95 A;  1E6Y A;  4DV1 F;  3MMB A;  3Q89 A;  3GTO C;  4WP9 A;  1HFE L;  3P5T L;  3NY0 A;  2V2V A;  4PPZ A;  1V5V A;  1DD5 A;  1YKW A;  3I5A A;  4I4B A;  2CVE A;  1LOU A;  1HNZ F;  4LMZ A;  2XZW A;  5KG5 A;  3MCM A;  2B4V A;  3CCW A;  1RA7 A;  2IAJ A;  4XO0 A;  1S1V A;  3IC1 A;  5D4P A;  1HBO B;  1UFW A;  1IBK F;  2JEF A;  1F5B A;  4DDF A;  2CJA A;  4HKQ A;  3H4D A;  4PWD B;  3LPX A;  4KT0 C;  5B0D A;  2BYC A;  4BY1 K;  3GEE A;  4HT7 A;  2GVZ A;  4OV6 A;  4CLP A;  1HLW A;  1DHM A;  2F8E X;  3IAS 9;  3LAK A;  4USJ C;  1SC4 B;  4BWJ A;  5EHH A;  1CC8 A;  1JLE B;  1RIS A;  4QR1 A;  2E5H A;  4Q5S A;  3CJ3 A;  5IV3 A;  2F40 A;  2IIH A;  2I8E A;  2HK3 A;  2HLU A;  2VUM K;  2FHO B;  2ZH7 A;  2ZDP A;  4YME A;  5IOL A;  1PCA A;  4IR1 A;  2R7Q A;  3N6N A;  1X4B A;  3E8O A;  3M2U A;  4WK3 A;  3AB2 B;  1EQ0 A;  7AT1 B;  2HZC A;  3DYA A;  4KGK A;  1S9F A;  1V3R A;  4J37 A;  1RT1 B;  3N0V A;  2CJX B;  4TU7 A;  4O3Q A;  2RD5 C;  2YNI B;  3JSM B;  1CS4 A;  4O3P A;  3Q8P B;  3VA7 A;  4LRE A;  1IKX A;  4A3F K;  1B99 A;  2OPQ A;  5KFN A;  3OFG A;  3S1R C;  5AXM A;  1CSJ A;  1F5C A;  5GAE U;  1CS4 B;  2IPO B;  2O5J A;  1N33 J;  1S0N A;  7FD1 A;  3H8Y A;  4RNN A;  2JFD A;  1VHI A;  3N0C A;  2OPQ B;  2HZA A;  1WTB A;  2D9P A;  4M63 A;  4ZKA A;  4I2Q A;  3Q23 A;  1WQG A;  4QQB A;  4HT5 A;  1DCP A;  1L3S A;  2RB7 A;  3C46 A;  2JH3 A;  4BC9 A;  1E6V A;  1I3O B;  1YLX A;  1IR2 A;  2HGN A;  1S99 A;  4ZP6 A;  1U2C A;  4B3M J;  1B64 A;  2C22 A;  2YX1 A;  4A3J C;  2BJD A;  3DGV A;  2YU9 A;  2WVD A;  5F0W A;  3DI6 B;  3CJ0 A;  5M2P A;  3IPJ A;  2DPJ A;  2HNZ B;  3KK1 A;  1YJW S;  2CNO B;  5K14 B;  2AD9 A;  4EZ9 A;  2ZJR Q;  4ECR A;  4JV1 A;  3FSI A;  1U25 A;  3GCX P;  1O2B A;  4WU2 A;  4A4J A;  2W9C A;  1ISE A;  3HKW A;  3K57 A;  3U02 A;  2MJU A;  4JI5 J;  3KK3 A;  3R97 A;  4L76 A;  3KOA A;  2DR9 A;  3I4M C;  1FD8 A;  2BVZ A;  3P5B P;  2VFU A;  5LT5 A;  3DLB A;  2ZBP A;  4I56 A;  4PPD A;  5F8N A;  4TY8 B;  4JUZ A;  4I6W A;  3ZTP A;  2MKS A;  4GO5 X;  4DUY F;  4FYD A;  1HBU B;  4N47 A;  4C8Y A;  4JOU A;  5FLX U;  3V81 A;  5EWG A;  4H4M B;  4DQQ A;  1R9T K;  2FQT A;  4K4W A;  1QAJ A;  4CLK A;  3SV3 A;  3HJV A;  3EGN A;  5K8N A;  3FSY A;  1EFW A;  3IAM 9;  2GVZ B;  2AKW B;  1FJC A;  3HMJ G;  1RT2 B;  5L1J A;  1NH7 A;  1K1S A;  3W66 A;  2PA3 A;  4O23 A;  1KS2 A;  3IWL A;  2EBB A;  1X0F A;  2C2Z B;  1HI9 A;  3EDR B;  3DRS B;  2K7K A;  2YKM B;  3IS9 A;  1ITP A;  3HZE A;  2A2D A;  2IC3 A;  3HOU C;  5KFQ A;  4DQP A;  4U7U K;  1N33 F;  3GTL C;  5KFI A;  3I5B A;  1ZTT A;  3GR0 A;  3QYY A;  2VQE J;  2ZH3 A;  1LW2 B;  4I69 A;  1IBL F;  4JYA J;  3BJY A;  1ZTW A;  3S14 C;  1NSA A;  4F4Y A;  4ZLL A;  3HVW A;  1L5U A;  3CTR A;  3J81 U;  2ZJP Q;  1HWK A;  3RBE A;  4DSI A;  2FVR A;  4ELT A;  4LF5 J;  3ZTS A;  2XZD B;  1DRZ A;  3SEO A;  2D7S A;  2G1H A;  3F56 A;  4LF9 J;  1JLA B;  1IJE B;  1TWG K;  2MY7 A;  3RBZ A;  1RYS A;  4KPY A;  3TJA A;  1KD1 T;  3UPF A;  3V6K A;  4GO7 X;  2ZHA A;  3GR1 A;  1RXO B;  3FEX B;  4OHV A;  2ROP A;  5ITH A;  1I3Q C;  3UFC X;  2VG6 B;  4OZN A;  1I94 J;  5C3E C;  2VL1 A;  2JA7 C;  3O5T B;  2XMT A;  4MEY A;  2MSS A;  2R92 K;  2L41 A;  1YJR A;  4U9R A;  4EYH B;  4CO3 A;  2AYG A;  2X1A A;  4NCG A;  1RTH A;  2ASL A;  3HHK A;  3TFI A;  3BZQ A;  1LXN A;  3IWX A;  2XNQ A;  1RTJ B;  4OHX A;  1VYA A;  2KXN B;  1AB8 A;  3EGV A;  4JI8 J;  3CAG A;  1KFD A;  1K47 A;  1XC9 A;  3CO0 P;  2KL8 A;  2FLO A;  2LP4 A;  1BQN B;  5KFU A;  2IRY A;  2FTR A;  4F2S A;  4KB2 A;  3Q86 A;  4OLP A;  4RO0 A;  4M5H A;  4P75 A;  3QO9 B;  2PA8 D;  3V4M A;  4E0D A;  3ZTO A;  3AT1 B;  1Y7P A;  3GTM A;  2V6T A;  4DCP B;  3IN5 A;  2JNJ A;  4F0K A;  1XZQ A;  1FRX A;  2UUW A;  2ZWO A;  1C2P A;  1WHY A;  1XNQ J;  2W8L A;  2BE2 A;  5KFY A;  2EK6 A;  1MU2 B;  3M8Z A;  4CQ1 A;  1NK6 A;  1ZPV A;  1VRU B;  2VBY A;  1W2B R;  1F7U A;  4OV1 A;  2A6E A;  1M5P C;  2WZ1 A;  3J80 Y;  2HVI A;  4XLP A;  3GTP K;  3K5L A;  4EYI B;  3DN9 A;  3K17 A;  1IL2 A;  4UOF A;  4TYA A;  1PBA A;  7FDR A;  5ETM A;  1T9V A;  1WG5 A;  2NXC A;  2P2C B;  2KJV A;  3GPA A;  3MED B;  2W9B B;  3OT9 A;  1YBT A;  1HYS A;  4J9V A;  4NX9 A;  2UUT A;  1NDK A;  4PG8 A;  2B63 A;  3QBC A;  1RTI B;  3HHL B;  3AOC A;  2Q79 A;  1RBA A;  1AYE A;  4FF4 A;  4KGV B;  2A6O A;  4NEY A;  2J8S A;  5CYM A;  3GFY A;  1EIY B;  3MM7 B;  3R6G B;  2HRU A;  2RS8 A;  3LF0 A;  1XN9 A;  2QIF A;  2HYI B;  4CIO A;  1S1T B;  5AXL A;  3TFJ A;  3KJV B;  4IRC A;  5EWF A;  1WAC A;  4AL7 A;  2YNG A;  1T03 B;  4A93 K;  3CDW A;  2MKI A;  2VA2 A;  4OI3 A;  1LW0 A;  2P9C A;  2CQ3 A;  3OR2 A;  1SQF A;  4NLT A;  2GAH C;  1R8B A;  3BM7 A;  1IUJ A;  2GFF A;  3LA0 A;  1RTJ A;  1D8Y A;  1TMM A;  2P5M A;  2MKJ A;  2NVQ K;  4BDP A;  3MDF A;  5KFL A;  5GAD U;  1Z4U A;  4KAT A;  4ZVO B;  5HAN A;  3LUY A;  1YSJ A;  4MIB A;  4W90 B;  5H9F J;  4CZC A;  2NLW A;  2ZH8 A;  2NYH A;  3GCW P;  3FKB A;  4ZHR B;  4RUA A;  4WJB A;  4F50 A;  3OXL A;  4GTF A;  3MPY A;  3GU0 A;  1TK5 A;  3J80 U;  3AOD A;  5KFC A;  1TEL A;  2QFI A;  1EX8 A;  2W2N P;  1TV6 A;  5CD4 H;  4RMF A;  1Q5Y A;  3GYG A;  5EX3 A;  2H51 B;  1HI8 A;  2FHJ A;  2WSE C;  2Z56 B;  2JLE A;  4F4K A;  1F60 B;  4KMA A;  3GE9 A;  4RX6 A;  1IE0 A;  4ZPD A;  4YB7 A;  1X9S A;  4O0I A;  3QLH B;  2CIM A;  3MM7 A;  1KFS A;  2L9N A;  1FDB A;  1S1W A;  3MR5 A;  2F7V A;  2DHA A;  2N4D A;  1EKR A;  4NA2 A;  2EFV A;  3QAT A;  4M5L A;  2DHX A;  1RKJ A;  1QSY A;  5FJ8 K;  5IYB K;  2RU9 A;  3QT5 A;  4WTO B;  3AY0 A;  4M5M A;  5KAK A;  3OXG A;  1W26 A;  1YG0 A;  4DR1 F;  1U0H B;  6AT1 B;  3G6Y A;  2X3D A;  2I38 A;  2APO A;  3CPW R;  1RTD A;  2CDR B;  2MMY A;  2C2K B;  1B7F A;  3OJU A;  1HR0 J;  4QIW L;  4KAS A;  1LWC A;  3CCV S;  2ZOG A;  2M70 A;  4WU3 A;  1URR A;  2RDJ A;  5HL8 A;  3MEE A;  2ZD1 B;  8ATC B;  2Y1L B;  2MKK A;  3M9O B;  5HK4 A;  3W5Z A;  1O8B A;  1VLY A;  1FJ7 A;  1VLO A;  1C1B A;  3CD5 A;  2BV3 A;  2CZ4 A;  2JA5 A;  1NKC A;  2GMH A;  3CCZ A;  1VQ5 S;  3NCP A;  1EP4 A;  3LGH A;  2AX0 A;  2GIQ A;  5F3T A;  4WF9 Q;  3W1Y C;  2XCA A;  3B6B A;  4OIR A;  3GB0 A;  4KAI A;  3GDZ A;  2J9E A;  3SZ2 A;  3G87 A;  1QAI A;  1RWK B;  3KMS A;  1KOH A;  2YX7 A;  4KHP F;  4A3I C;  2MJN A;  4ZHR A;  1V5I B;  4QWA A;  3SFU A;  3W3S A;  1Q8L A;  1YRT A;  1XMO J;  2GIF A;  5C42 B;  1R0B G;  4GMK A;  4F02 A;  3AH6 A;  2LQJ A;  4EWT A;  3PXG a;  4PWD A;  4IH5 A;  3DLJ A;  2AJ1 A;  2IVF B;  5LSO A;  1VQN S;  4I6Y A;  5EUH A;  1X60 A;  5BJR A;  4OZ3 A;  2EBE A;  5E0O A;  4AQY J;  3LP2 B;  4IG3 B;  3B8H A;  3QPI A;  2YWG A;  4YUD A;  4ZN3 A;  1C0T A;  4ZA1 A;  4DFJ A;  4DR5 F;  3C14 B;  5FLX Y;  1U4B A;  5GMD A;  3RB6 A;  1RHK B;  5ETT A;  3ET6 B;  4FP9 A;  2G2Y A;  5D0R A;  3JAM U;  2JSX A;  3U27 A;  1TWH K;  2OFH X;  2GMJ A;  1OY9 A;  1IKW B;  3ISN D;  4GVL A;  3EXY A;  2RRA A;  1PC4 A;  4PG5 A;  4OX9 F;  4FKY A;  5C5J A;  1RWV B;  1VQ7 S;  3FK4 A;  4A3B C;  4B9N A;  1FRJ A;  1DUR A;  2BW2 A;  3J7Y I;  4O44 B;  1I50 K;  3I4H X;  1N54 B;  1R8H A;  1TWH C;  2C2N A;  4A8M P;  2M5Y A;  3AJ1 A;  3EDQ B;  3GV5 B;  3FGV A;  5A0Y B;  3QLH A;  3E2E A;  1UW9 A;  4A3M C;  2OEK A;  5BYQ A;  2BJ7 A;  4C3H K;  2DJW A;  2WB1 L;  2W4C A;  3VF0 B;  3J7A N;  2MEW A;  3TRG A;  3PW2 A;  1OY8 A;  5EWE A;  3UN3 A;  5T7L A;  4KB4 A;  1FJE B;  5FII A;  1GX5 A;  2KYX A;  3C19 A;  5D0E A;  2NZC A;  1YWX A;  5AE2 A;  3HKZ D;  4X64 F;  2CKW A;  1EQR A;  3KHL A;  1WOS A;  3PO2 K;  2YKO A;  4ENO A;  2Y9H A;  2UP1 A;  5DG9 A;  3MM9 A;  1UA0 A;  4N56 A;  2RH3 A;  3OR1 B;  2ZDO A;  1XNR J;  3IG1 B;  5LMU F;  3HVA A;  2VBX A;  1UJ6 A;  1V3S A;  4C0B A;  3JTP A;  4WZQ A;  2BDP A;  2CPD A;  3GTJ C;  3RR7 A;  1SI9 A;  1REG X;  1LK5 A;  3VTI A;  1TL1 A;  1P9Q C;  3SSS A;  2JLG A;  2LQB A;  1PJ7 A;  1WEZ A;  3MAA B;  1Y11 A;  2DNP A;  2LYV A;  3QJL A;  3HVT A;  1N5T A;  5E3P A;  3O3L A;  3OW2 R;  2F9J A;  4KQZ A;  2CPY A;  4LRC A;  3BKF A;  1SBR A;  3HF5 A;  3DOM A;  5I3Q A;  4LR8 A;  2LU1 A;  1JQG A;  3EMT A;  4J9O A;  4LQ9 A;  5E33 A;  1CPZ A;  2BRK A;  3VGT A;  3H5Y A;  4ED7 A;  4AYB D;  1TUV A;  5J2Q B;  1N5S A;  3QAU A;  3TUJ C;  1TWC C;  1NK4 A;  3T6J A;  1R3N A;  1Q81 T;  2IM3 A;  1ZVU A;  5J2N A;  3ZO7 A;  2KT5 A;  1RCX B;  4C0O C;  1N48 A;  5CYQ A;  2NUH A;  2Y0B B;  2CVI A;  5E3A A;  4ED1 A;  1IKY B;  5D15 A;  4YQW A;  2BXJ A;  4CH7 A;  3HFV A;  3MPU B;  2FB0 A;  3CME S;  3IRX B;  4A8Q A;  3FEY B;  1G1X A;  2DB1 A;  4DL6 A;  1A0O B;  1CLF A;  3BUE A;  3I32 A;  4X4V A;  4AL5 A;  2KI2 A;  3DLE A;  4R5P B;  4BBR C;  2C3O A;  5IFM A;  2BAN B;  1U24 A;  1WC1 A;  2V4R A;  2JA5 C;  2FLN A;  1GTH A;  3K5P A;  1IQ0 A;  4I67 A;  1X9M A;  1QUP A;  4PCQ A;  1S9G B;  3MR7 A;  1RT7 B;  1HW8 A;  1AFJ A;  1EP4 B;  2FDN A;  1HNX F;  1WEY A;  1N32 F;  3ET6 A;  4LIW A;  1NXI A;  1OY6 A;  3NOG A;  2FHM A;  4B17 A;  3OHB A;  4M95 A;  3RW7 A;  1KOO A;  3OTO F;  3OV7 A;  3AOA A;  3BDP A;  3U1M A;  1HWU A;  3W9H A;  4F3Q A;  3I96 A;  1KSP A;  3A1Y G;  3FZB A;  2IFX A;  2GCF A;  4RNM A;  2WON A;  4B9U A;  4URQ U;  4I2P A;  5IYC C;  5DQG A;  4DI6 A;  5JXS A;  3MHY A;  2ZFH A;  4RBT A;  2QLX A;  3BP3 A;  1HHQ A;  4DSJ A;  1EET B;  1YGY A;  1Y1V K;  1HNX J;  4KH0 B;  4FYW B;  2RUS A;  4MFB A;  2EW9 A;  2BEF A;  1XZQ B;  4K4X A;  2R2U A;  3FCV A;  2GQQ A;  2I0X A;  2M3D A;  1U6B A;  3VGS A;  2RDI A;  4ZCL A;  4MK9 A;  4UUX A;  2CJ9 A;  1JLF B;  1I1G A;  2FVP A;  1N8R T;  2IDL A;  2CQP A;  3SZZ A;  1M5V C;  5M5Y K;  2HBR B;  1HQU B;  3LP0 A;  2Z4P A;  9ATC B;  1T03 A;  1JLA A;  4R0J A;  4KMD A;  5AT1 B;  4IH7 A;  4LSN B;  3W63 A;  2CFA B;  1CEZ A;  4X66 J;  4U8Y A;  4USH A;  3G96 A;  2BBE A;  3UCZ P;  2YU9 C;  1KN6 A;  3KUE A;  1TKT A;  1RYR A;  4M1K A;  3PEH A;  4ETX A;  3K89 A;  4GKK J;  1N56 A;  1H73 A;  4P2M A;  1RCO B;  2NSB A;  2EKY A;  4WFZ A;  2UVW A;  2ACM A;  2N7C A;  4KKO B;  4OFZ A;  5D4L A;  3M2V B;  2E2J K;  1SJF A;  2MQL A;  5FLM K;  4GVB B;  3NGR A;  4F2R A;  1RT7 A;  1O2A A;  1TWA C;  3TUP A;  4LF4 J;  3TAR A;  2FLP A;  1O29 A;  1WCM A;  2L3M A;  2DHH A;  2YKA A;  3BSN A;  2MB0 B;  3LAN A;  3JB9 k;  1WC3 A;  1S9G A;  3MWB A;  3EJM A;  2ERR A;  3S2D C;  4FYY B;  1KHW A;  3ENA A;  1FVS A;  2D69 A;  2WOM A;  4F0M A;  3FOE A;  2HIY A;  4OZ5 A;  2HAF A;  4PQA A;  4YFU A;  2ZH9 A;  1T7P A;  3A3N B;  1LNQ A;  5IT4 A;  4CNY A;  1U7L A;  3AOB A;  2AQ4 A;  1JIH A;  4AYB L;  4CLZ A;  2LQ9 A;  1GT8 A;  4NMX A;  4UQT A;  2X1F A;  3S2D K;  2ZH2 A;  1XNR F;  5HMZ A;  3D6H B;  5F9L A;  1DQ9 A;  1N34 J;  3H0G C;  1TVR A;  2AZ3 A;  3EVM A;  2LA4 A;  1S0O A;  5KTQ A;  1RHU B;  2RQC A;  2QGF B;  4PXC A;  4A48 A;  2VU5 A;  1O24 A;  1VQY A;  4JV5 J;  4TYB A;  2JC1 A;  3KTQ A;  1XIQ A;  3CJK A;  4PXD A;  4M94 A;  2WRM A;  3EUN A;  2HNY B;  1UJ5 A;  2DD8 S;  2AEJ A;  2V9K A;  3MR3 A;  1VC0 A;  5A2Q Y;  1WTF A;  2DNQ A;  1TWC A;  1J5O B;  2CPJ A;  4MK7 A;  3W9J A;  3CSK A;  4DV6 J;  2QL5 B;  3QFW A;  1I3Q K;  2ALZ A;  3DKD A;  4DR7 J;  1RLD A;  2R92 A;  2OPP A;  3I0S B;  1LWF A;  4JI8 F;  4Y28 C;  5GAH U;  3QAE A;  2PMH A;  2ATL A;  1NM2 A;  5HAT A;  5B0F A;  2QL7 B;  4LFC F;  2WB1 D;  2NRE A;  2PII A;  2FLL A;  3K5M A;  4ECX A;  3BS9 A;  5DGB A;  2HPU A;  3PAC A;  4UY8 T;  3PX6 A;  3D1H A;  3HKZ L;  1S4E A;  4DUZ F;  1XBW A;  1SFO C;  3FZ2 A;  4TQS A;  3T5J A;  1CJU A;  3CDE A;  1DLO B;  3BGU A;  1EHW A;  4CYU A;  1N36 F;  2XGQ A;  4QYZ K;  4LF9 F;  1LFP A;  3N28 A;  4QIE A;  3NGK A;  3GTG C;  4KFB B;  3BN7 A;  3WX8 A;  2X7I A;  2H1Y A;  1ZBT A;  2DPI A;  3IS9 B;  2RT3 A;  3NLC A;  2RRN A;  4UT4 A;  2VPY B;  5KFF A;  2UXC F;  1ZOT A;  3CJ8 A;  3K7R A;  5D8H B;  4DPU A;  4ATN A;  4W98 A;  2UXD J;  1X4H A;  1T9W A;  3CCL S;  5E3C A;  1V9O A;  2CG8 A;  4FXW A;  3TUI C;  2F8H A;  2GNK A;  2W7V A;  4ZVP B;  1KLN A;  4DV5 F;  2AJ4 A;  4X4S A;  5E3R A;  4NML A;  5E68 A;  2DHS A;  5HMX A;  1L0W A;  3TOQ A;  4WFN Q;  2O5D A;  4U7C A;  1J5E J;  4LBP A;  1FJG J;  4P52 A;  5M5X K;  4KTQ A;  4NYP A;  2Q3P A;  2M9K A;  1NSQ A;  5ADZ A;  4MKV A;  3MAH A;  1HAR A;  2NUU G;  4DPY A;  1QTM A;  3CE8 A;  4ECY A;  2OEM A;  3JYT A;  2DIU A;  2DIT A;  2V5H G;  4XDC A;  2HFV A;  1JKH B;  1URN A;  1Y1W A;  3M7V A;  4JI6 J;  3G82 B;  4QPX A;  4KO0 B;  4IDK A;  1VJE A;  4ILL A;  1MML A;  1KKH A;  5AXK A;  3TP2 A;  2QSW A;  1L3U A;  3SZY A;  4DMZ A;  1X8D A;  4ES2 A;  3U1L A;  4ZVU B;  4OI2 A;  3TA2 A;  4KN7 A;  1W2I A;  4JI1 J;  1N6Q B;  1B4A A;  3PY8 A;  4FXV A;  1NZ8 A;  2U1A A;  5F8H A;  4LK1 A;  3K2Y A;  4JI0 J;  2D3O R;  4ED8 A;  3R3T A;  3FBB A;  1RI7 A;  1S1U B;  1TL4 A;  4J9N A;  4CI0 B;  3FCH A;  3H3V L;  2BA9 A;  5EGE A;  4U67 Q;  1S0V A;  2VPW B;  1WC5 A;  1RDR A;  1S9E A;  3PRD A;  4IG3 A;  2FD2 A;  4MKA A;  5ETP A;  3RZA A;  3I82 A;  1AXQ A;  3IWN C;  2JOQ A;  2C2D A;  1CC7 A;  1MNE A;  2MZ1 A;  3WZ0 A;  4P2F A;  2RAQ A;  1TK8 A;  5MLC V;  1S0M A;  3VHQ A;  4LRA A;  5FDL B;  3MM9 B;  4L73 A;  2HGM A;  3KWM A;  1HBM A;  2GVD A;  1PC5 A;  4B9M A;  3IG1 A;  3HVR A;  2I9S A;  4HAC A;  1SJR A;  3POT B;  4HDG A;  4KMU A;  4DG1 A;  1VJW A;  1VRT A;  4DXL A;  1JOE A;  1N52 B;  4OQJ A;  1S1V B;  3M8Q B;  4F4X A;  2DIV A;  4NEZ A;  2HRY A;  1ZA1 B;  4KJI A;  3P8B B;  1AB4 A;  2DRA A;  4DOZ A;  2JRS A;  5DS7 A;  1Y1W K;  3BQ0 A;  2L9D A;  4KV8 B;  1OWX A;  1L3T A;  2H48 B;  2WVE A;  1WNE A;  2B4U A;  4UZC A;  1REV B;  3NBP A;  4C2M A;  3D0H E;  4X2B A;  5FLM C;  4K4T A;  3LP1 B;  4GKJ F;  2DR8 A;  3NNC A;  2CQ1 A;  2ZD1 A;  3TO8 A;  4UZB A;  2GHP A;  5G0R B;  4PG7 A;  3A4T A;  4U6P A;  5M5W K;  2YWH A;  3NEK A;  3GTO A;  1D9A A;  2GX8 A;  2D6F C;  1F3F A;  1KC8 T;  3IRX A;  4PEO A;  1VI7 A;  4BS2 A;  3FMB A;  3BSA A;  1CJV B;  5CHC B;  4X4O A;  3LPE A;  4K2J A;  3PG9 A;  2FJE B;  3C6U B;  3L4B C;  5IWA J;  2V8H A;  4IFV B;  4V19 J;  3WBZ A;  4NOH A;  1GMW A;  1O27 A;  4YN3 B;  3KLE A;  4NLX A;  1S6P B;  1W7W A;  1A6L A;  1VK3 A;  1HNZ J;  2YKP A;  1FEH A;  1FFW B;  4G1Q B;  2MQM A;  2XI2 A;  3F0N A;  3B54 A;  2SXL A;  1YDL A;  5F8M A;  4UW2 A;  1C1C A;  5A8R B;  1R8A A;  2JL9 A;  2RKI B;  4UQG A;  4PXE A;  3UNG C;  3NWG A;  1YJV A;  3BRE A;  4M5K A;  2MPU A;  3U7J A;  1U0S A;  4EUV A;  1NU4 A;  2KFN A;  1O2F B;  4IFY B;  3T1H J;  1XEZ A;  5HL7 Q;  1BY9 A;  4IOB A;  1U8W A;  1RT6 A;  1Y1V A;  2HFO A;  2UVU A;  2J7U A;  1XNQ F;  3GFX A;  4GTE A;  3OVA A;  4DJB A;  3GYX B;  3FMW A;  4ZH4 A;  2HS3 A;  4RUC A;  2A2C A;  2W2Q P;  1D1U A;  3R2D J;  4MYU A;  3CJQ A;  1KQS R;  4A3L K;  4KHR A;  2RJZ A;  4DX6 A;  2M4M A;  5B0A A;  2DNL A;  4J9R A;  1NJY A;  1ARO P;  2R2S A;  3D67 A;  3GEI A;  3L9Z A;  2PI4 A;  4FBT A;  2KG0 A;  5HQL A;  1ZS6 A;  3OUY B;  1K73 T;  5HJY A;  1RTI A;  3HHL A;  4DF8 A;  3MUV P;  2NXU A;  3VZI A;  4BY7 K;  2VAS A;  2AX1 A;  4XIU A;  1FXL A;  1MWY A;  3V4I B;  3S14 K;  4ZP7 A;  5M3M K;  4P6Q A;  1X7V A;  3Q8R B;  1HPZ A;  1YJU A;  3CED A;  4HH0 A;  4QWC A;  4F3M A;  1KTV A;  4KM8 A;  4Z7Y A;  5B0B A;  3L4J A;  1UMJ A;  1WKK A;  4DS4 A;  2IBO A;  5KFS A;  2YVS A;  2KRR A;  3G8S A;  2D1C A;  5L39 A;  1KVK A;  1ZXO A;  3P45 B;  4CM0 A;  1JXV A;  4MIA A;  3T5L A;  3O44 A;  1K0T A;  1Y00 A;  3CDA A;  1EH1 A;  4DV0 F;  1I6H C;  1X4G A;  3G6E S;  4N8N A;  3Q8V A;  4Y00 A;  3QFH A;  2J7W A;  4FNI A;  4I2P B;  1LQ9 A;  1TMJ A;  1S6Q A;  5CAB A;  1JB0 C;  4NLV A;  2QMW A;  1FE0 A;  2YKN A;  2V8D A;  1M1K T;  3PX4 A;  1HIY A;  3N5F A;  1RJJ A;  1FWK A;  4MFB B;  4YP3 A;  3OSP A;  1YRU A;  3RGI A;  3GJR B;  2W7A A;  2VQF J;  2WCX A;  3BB5 A;  3M8S A;  2YQ3 A;  4XPC A;  1CJT A;  2XSF A;  2B56 A;  4AE5 A;  1UKU A;  1VRQ C;  1FRI A;  1DAR A;  1NRK A;  3AFG A;  3GQC A;  4QJV A;  4OJ1 A;  5A76 A;  2Q6C A;  3DRX A;  2ZBR A;  3M9M B;  3LAP A;  3R7S B;  2HHQ A;  2NVQ C;  1YIJ S;  1IQT A;  4HR2 A;  4DUT A;  2GGP A;  3PR5 B;  3HOW C;  4NRU A;  1HD0 A;  2IYI A;  3Q2S C;  2C2M B;  3D66 A;  3RTV A;  3HSG A;  3QT6 A;  2H3E B;  4ZDN A;  2R7W A;  1VR6 A;  3PDN A;  1WG1 A;  4I0W A;  1CUL B;  3W5X A;  3FFI B;  2OTL S;  3PO5 A;  4FF2 A;  1KTQ A;  2ADC A;  4OHW A;  1MW7 A;  3MPD A;  4ID5 A;  2RUG A;  4F3O A;  4WIQ A;  2JJ4 D;  2R7Z K;  2PA8 L;  1RTH B;  4ECZ A;  3EXC X;  5CA5 A;  1BD6 A;  2FC8 A;  4ZVF A;  4A8W A;  3DGP B;  2H4Y B;  4LLG A;  2HFZ A;  2W24 A;  3KLG B;  3CB4 A;  1RWX B;  3PYF A;  3KUH A;  1E6Y B;  2DH9 A;  1UTA A;  1Y1V C;  3CCM S;  4CM2 A;  1XR7 A;  2UU9 J;  1SH0 A;  2VD3 A;  3O8W A;  4XCH A;  3W64 A;  2QLF B;  4KKO A;  2NSC A;  2KM8 C;  2DCL A;  2UU9 F;  4JV5 F;  1OIA A;  4A8O A;  2B6A B;  2XMJ A;  4WXO A;  4H4M A;  3CJ4 A;  5SZT A;  2MDA A;  3T5K A;  4JI2 F;  3MEC A;  1KQF B;  1HD1 A;  1QAY A;  3OEP A;  4RUB A;  1VQM S;  1UVK A;  2KHD A;  1JVI A;  3FC9 A;  3JSY A;  2NZ4 A;  2MLY A;  1TWG A;  3DLK B;  3HOU K;  2GSN A;  2HQ3 A;  3D0G E;  1KHV A;  4LOW A;  4RW7 A;  5DET A;  4QIG A;  3GLJ A;  4PQU A;  2HND A;  2AF6 A;  4H4O B;  1H2V Z;  4OYA A;  1RGV A;  2MQ8 A;  2OO4 A;  1OYE A;  2QRR A;  1I6V A;  5LSL A;  2R93 K;  3ENW A;  1VH2 A;  4IKA A;  2IA6 A;  5L1L A;  1M5O C;  3MEG B;  4AFF A;  1JLB B;  4A3K K;  3MM6 A;  2GS8 A;  2V8P A;  1AUD A;  3C6U A;  3MMC B;  2VFR A;  3TQE A;  2QO3 A;  1FKO A;  5IOS A;  1FF2 A;  4KO0 A;  1P1L A;  4PG6 A;  1HWJ A;  1MMN A;  1BWE A;  3BEG B;  1JKH A;  5C25 A;  1SJ4 P;  4G0W A;  3ERE D;  5H9E J;  2XLK A;  3RZO C;  3B4D A;  3E01 B;  4XAK A;  4K2X A;  4GKJ J;  3FBF A;  4M5I A;  2K2P A;  1Z2Z A;  4IRD A;  2IVY A;  1OPI A;  2O67 A;  4HI2 A;  3MFI A;  4YFN A;  2YPY A;  2CYY A;  4TVA B;  3CD6 S;  3BO3 A;  2WOM B;  2UVV A;  4PWU A;  2G0J A;  4DV1 J;  4GT9 A;  4M5D A;  3V6J A;  2PGC A;  2HLT A;  1PYS B;  4X66 F;  5M2R A;  4G65 A;  5F8L A;  1RQ0 A;  2IJR A;  3VAF A;  2CJY B;  4BBY A;  3ENQ A;  2ZUE A;  3FVY A;  3GJT B;  2PD1 A;  2HHH F;  5I42 B;  4K50 A;  3GG0 A;  2QZ8 A;  1N0V C;  3HOZ C;  2CQC A;  3ISN C;  4XPE A;  1F9F A;  2O3D A;  5C42 A;  2R93 C;  2UUC F;  3R2C J;  3CD7 A;  4Y65 A;  1QSS A;  2MTL A;  5BR8 J;  5H1S V;  2OPR B;  3OHA A;  4AL6 A;  1S77 D;  4C2M C;  4DL4 A;  2XSJ A;  1T8E A;  4C4W A;  3KK3 B;  2MKH A;  3GFH A;  2OJ3 A;  4CNZ A;  3TZZ A;  4J5O A;  5IOR A;  1G7C B;  1SCJ B;  3NGD A;  1LWE B;  4RU2 A;  4DFP A;  1J27 A;  2C2O B;  3H20 A;  5C2G A;  1IBM F;  2JC0 A;  2W7O A;  1NEE A;  1T05 B;  1BGX T;  5FD1 A;  1D3W A;  2WSC C;  1YCL A;  5CZX A;  3MCO A;  3PM9 A;  4KAW X;  1JJC B;  1X9W A;  2MZS A;  2D74 B;  4TQR A;  3PKY A;  4NCB A;  4ZP8 A;  4WKR A;  2LA6 A;  1E6V B;  3RRK A;  3TTG A;  4FPI A;  4ER8 A;  1KVI A;  4AT1 B;  2DNN A;  3M32 B;  2VG5 B;  2HHT A;  3NAI A;  4OL8 A;  2Q43 A;  1UWB A;  3M3Y C;  2UV8 A;  3HX9 A;  4YS2 A;  4CLL A;  2HS4 A;  3R5J B;  3TVZ A;  3HOV K;  4C3I K;  2BQ3 A;  4M5G A;  3RBX A;  2HK2 A;  4ZVH A;  3BP8 C;  1YHQ S;  4MYT A;  5KFA A;  2IMO A;  4OJG A;  1N5Y A;  4A8X A;  3TUZ C;  2J0Q D;  1X31 C;  3KG4 A;  4IH6 A;  5HQM A;  4QWB A;  2EG2 A;  4B9T A;  2LXF A;  2UUC J;  2L08 A;  2W2M P;  2P9E A;  3C8Y A;  1M1H A;  3PJ9 A;  4NLU A;  4K4S A;  1G4C A;  1DCH A;  3E3X A;  5J2Q A;  2O01 C;  3ZZY A;  4EBC A;  5KOX A;  2B7C B;  1FT8 A;  1XXB A;  3T1Y F;  2KO1 A;  2DNH A;  3Q8U A;  1U6F A;  1VQS A;  5T7L B;  2J0S D;  4JK1 A;  2UXC J;  2CPI A;  3M8R A;  4DU8 A;  3PW5 A;  2HQC A;  1MN9 A;  5F8J A;  4TY9 A;  2G2O A;  4DQS A;  2RE1 A;  1SJ1 A;  5DQI A;  4C3H C;  1UVN A;  2HVZ A;  2Z30 B;  3B4M A;  1K83 C;  4C7Q A;  3US5 A;  2YQ1 A;  1LKZ A;  3V6H A;  2HHP A;  2ZNY A;  1FD2 A;  3MMJ A;  4DR3 F;  4Y3C A;  1NME B;  2ILY A;  4Q8F A;  1IKV B;  4C11 B;  2VUM C;  1HBN B;  2MHN A;  5KT4 A;  2MGZ A;  3M30 B;  4DPX A;  1Q4R A;  1U8S A;  2XS2 A;  1IR1 A;  3W65 A;  2DYA A;  4YG2 A;  4ECW A;  1UL3 A;  4LFC J;  5M3F K;  4Y2I A;  3GTJ K;  3ZZT A;  2ZWP A;  3LGM A;  3RZD C;  1TUW A;  4GKK F;  1UEV A;  4J7C A;  1OYD A;  5C4J K;  3HOW K;  2BQR A;  4KYZ A;  4DV4 J;  3ETM A;  4WFX A;  2IAJ B;  3NCR A;  3MMA B;  3W2V B;  4F04 B;  3CVK A;  3V4G A;  4FZB A;  2COL A;  2XMM A;  2ZFZ A;  2E5L F;  3MEC B;  1I5O B;  2ZZT A;  3BR9 A;  5CD4 A;  3D7S B;  1PAE X;  3KJV A;  2JA5 K;  4QBU A;  3VAH A;  2HBY B;  4TLR A;  5IOT A;  5HAO A;  2DGO A;  2V6S A;  2E1C A;  1GNK A;  2BQU A;  2Y0S D;  3JQK A;  2OH2 A;  1QVG R;  3G6V A;  3ZTQ A;  3NOC A;  4XDD A;  1SVD A;  1MRO A;  2B8Q A;  3NG8 A;  2POK A;  1ELO A;  4ZPA A;  5RUB A;  1HQU A;  1VQO S;  4YB1 P;  3M8Q A;  2XMA A;  1J98 A;  4C8L A;  2RS2 A;  4B3S F;  4TN2 A;  5KFT A;  2ILZ A;  1DTQ B;  2EI5 A;  3T3F A;  4DSE A;  2E2H C;  4BLA A;  3KG1 A;  1SUQ A;  3D4J A;  3CJS A;  4CLU A;  2B7B B;  3BO4 A;  4JI5 F;  1R0C B;  3VVT A;  2HFU A;  4RBV A;  1LK7 A;  1UFL A;  5K20 B;  1NDC A;  3EQL A;  1H74 A;  4OZ0 A;  1NND A;  3HD1 A;  3H5S A;  1IR0 A;  3R9L A;  5KT6 A;  4FDF A;  4WBF A;  2QYC A;  1O51 A;  1HBN A;  4HTJ A;  2PEB A;  4DQR A;  4UOH A;  3VQT A;  3RZO K;  2QEX S;  1CQM A;  1HNI B;  4J90 A;  1JLF A;  4TU8 A;  2DNR A;  1AZS A;  4LF5 F;  1XMO F;  1V6H A;  2EPI A;  3VAI A;  4I7F B;  5F8G A;  4F4Z A;  3C66 A;  3FKI C;  3NAH A;  3G4A A;  3MCN A;  1CVJ A;  2FJV A;  3TW0 A;  1O28 A;  2VQE F;  1LWF B;  2BJE A;  2X51 A;  2HND B;  3KJF B;  1U49 A;  4B3O A;  3G6X A;  4C2M K;  5CCL A;  3PO3 K;  3BGR B;  1RHQ B;  4E2F B;  3MUM P;  4TY8 A;  1I50 A;  3M2R A;  2Y3P A;  1NJZ A;  4Z7C A;  2ZC3 A;  2P9G A;  1XQI A;  2MXY A;  3SQG A;  1XJW B;  4HTI A;  1NHU A;  4WJ4 A;  2B9W A;  3VCD A;  4X65 J;  1KRP A;  4USV A;  1B0T A;  2AEM A;  3G2X A;  3L7P A;  2CJK A;  4EBD A;  1RHJ B;  2QSF A;  5DJB A;  2XS7 A;  1IM6 A;  3TWZ A;  3KFW X;  4DUZ J;  1Q53 A;  1I6J A;  2ZH4 A;  1DLO A;  3QWP A;  3DXJ A;  2IHR 1;  4RW7 B;  2RF2 B;  2N3O A;  4I1T A;  1GFW B;  2UUA J;  5DO2 A;  2UUA F;  4FNH A;  4ZPC A;  2XMW A;  4L72 B;  2D3O 1;  3I0S A;  2E1R A;  3VAM A;  2B63 C;  1VQ8 S;  2VB6 A;  1UWB B;  1XMB A;  3BKT A;  3J81 j;  3PR4 A;  2PHC B;  2YNF A;  1ZM9 A;  3BYP A;  1INN A;  2V8G A;  3GJS B;  3JQJ A;  1PJ6 A;  2DNY A;  4NLG A;  3CC2 S;  2J6S A;  4NYO A;  2LXU A;  2V0N A;  4G1I A;  2VFS A;  2G9O A;  4ILM A;  5C4X K;  1RAJ A;  5B0G A;  1ACM B;  4DV5 J;  4RWW A;  3THV A;  2NVY K;  3K5O A;  4N7T A;  3ZZP A;  5IP7 K;  2B0G A;  1F93 A;  2ZKU A;  5JVG Q;  5DZ6 A;  4X62 J;  1TWF A;  5KG2 A;  5LM7 E;  3OR2 B;  2EWH A;  1W25 A;  3VVU A;  1ZAW A;  4RJV A;  1P27 B;  3RB0 A;  2CPH A;  4NCG B;  2HQG A;  3KDO A;  1X5P A;  3FOF A;  4UTG A;  1FA0 A;  3HO1 A;  5C3E K;  3ILL A;  4C3L A;  5IYC K;  1XXC A;  2AJQ A;  3GTP C;  3HCX A;  3RYL A;  4RW9 B;  2F9D A;  3KJN B;  3BH6 B;  4IDK B;  1Z1Z A;  3G82 A;  4WE1 A;  2E7W A;  1NAQ A;  1MWZ A;  2WAQ D;  4B3O B;  1P8G A;  1AT1 B;  2Z2Y B;  4WP8 A;  1N5Q A;  2DNK A;  3MFH A;  5I3U B;  2DR5 A;  1P9Y A;  1KLM B;  4UY8 5;  1BHN A;  4BWM A;  2DKO B;  2B9E A;  1NCL A;  2C3U A;  4J9M A;  2XEX A;  1RU0 A;  4MJK A;  1RAB B;  1PIE A;  3EZU A;  1R9T A;  4ZJO A;  2F3J A;  1I6H K;  2W2O P;  2VKZ G;  4AH6 A;  4CO5 A;  4LF1 A;  2XCR B;  5FJ4 A;  5B0E A;  2QE5 A;  4N77 A;  1DTT B;  3OL9 A;  5D4O A;  4OI4 A;  3MM5 A;  1A9N B;  3DMJ B;  5BXI A;  2H5E A;  3AB4 B;  4RW8 A;  1FXD A;  2HMI A;  3MMC A;  3OTD A;  4KSE B;  3KNG A;  4JBC A;  1ZPW X;  2R8H A;  1GXU A;  2OEJ A;  3GYN A;  3IR5 B;  1IWG A;  1IVZ A;  2QT7 A;  1TWF K;  4FYX B;  2ZE2 B;  1Q0N A;  4DFM A;  1FJG F;  3QRP A;  3ILO A;  1PBU A;  2YU9 K;  1QSL A;  4PQU B;  1XR5 A;  1CJK A;  1VQK S;  3V6D B;  4C3J K;  4QIF A;  3QT7 A;  2ZBC A;  3CJ2 A;  1UEK A;  4LF6 F;  4HH1 A;  2LEC A;  3I4M K;  2ASD A;  3P49 B;  2DGX A;  3PIP Q;  3MAQ A;  2QTW A;  2YTC A;  1FKP A;  1UVL A;  1R0A B;  1WUU A;  2EXU A;  3HOX C;  3A12 A;  1O25 A;  3GJQ B;  4LVO P;  2CQD A;  2EVZ A;  3CCE S;  4Y0F A;  2J9D A;  5KT2 A;  3QQC D;  4Q44 A;  4M8L A;  2QG9 B;  2X1G A;  1NZA A;  2HRT A;  1KQK A;  3JTN A;  1NPR A;  3N3Y A;  4NXM J;  4RW4 A;  1WCM K;  5B08 A;  1FKP B;  5DLF A;  2HEK A;  1R31 A;  1N36 J;  4GTD A;  3I9Z A;  3QWU A;  1H2U X;  1S1U A;  1VMB A;  2CXE A;  3DDI A;  2MZR A;  2DNG A;  1K0V A;  3Q8S B;  5M2U A;  3IGN A;  4Z37 A;  1Q78 A;  1S6U A;  2PE8 A;  4XSX A;  5KFW A;  2GHV C;  4GC6 A;  3T00 A;  1QAX A;  2BRL A;  3FDS A;  3CDB A;  2VG7 A;  5KFZ A;  4CP5 A;  3UVJ B;  4NXM F;  1ZM2 A;  1FFS B;  2B9X A;  5LSR A;  2A0F B;  2V2Z A;  5THW A;  1U1N A;  3BGL A;  3CO9 A;  1G2E A;  1WG4 A;  1R0A A;  4Y7N C;  3JAM Y;  3H2U B;  2VFV A;  1IBL J;  3DM2 A;  1ZA2 B;  4EU0 A;  4ICL A;  1S59 A;  4CLW A;  2MQN A;  2KFZ A;  4WJ3 M;  4WFA Q;  5I3P A;  3H59 A;  2FIU A;  4G1P A;  3UDV A;  2HHH J;  5KFX A;  1RU1 A;  4RW6 A;  2VBW A;  4P71 A;  2FC9 A;  4IO9 Q;  4WCE Q;  3JTO A;  5DRK A;  3CCS S;  3OUY A;  4C3M A;  3FBC A;  2XO7 A;  3CWJ A;  4B3T F;  2LDY A;  3QT8 A;  1N34 F;  1T3N A;  3M8Y A;  1BQM A;  1BUX A;  3OVS A;  3DLG B;  4RW9 A;  4OI1 A;  1TR0 A;  1KNZ A;  5JJB A;  3W5Y A;  3HD2 A;  1AUS L;  4O2D A;  4FZV A;  1HHS A;  3GV7 B;  3QGH A;  3EYZ A;  1WSV A;  2OPS A;  3IBW A;  2EFN A;  2YKQ A;  4K5R A;  4C3I C;  1Y3K A;  4OIQ A;  5JFE A;  2KN4 A;  4CO0 A;  3DYA B;  2V4J B;  2FJX A;  2M88 A;  2GZO A;  1WF0 A;  3UI3 A;  4DSF A;  5HI7 A;  4P72 A;  1NLK L;  3QO9 A;  1PYO B;  4KC5 A;  1RT2 A;  1JNZ B;  5K5M A;  1CG2 A;  4AXJ A;  3KLF B;  1FXR A;  1R27 B;  2ZH6 A;  3S2H C;  2HW3 A;  4NXN J;  4WWS A;  2VV5 A;  4X65 F;  3F44 A;  3K58 A;  2PI5 A;  1KWM A;  4W4M A;  3I4P A;  5A8R A;  3UD4 P;  1X4E A;  2HSE B;  3SMZ A;  3M6U A;  2FYX A;  4LRF A;  2KT2 A;  3I56 S;  4BY1 C;  3CUN A;  2R2T A;  1S72 S;  4DQI A;  3Q24 A;  1JLC B;  1PJ5 A;  4IOA Q;  2AT1 B;  1NSP A;  4F8R A;  2M7S A;  2HNY A;  4Q0B A;  2LMI A;  3FQK A;  5L9X A;  4LFA F;  2PFF B;  1S1X A;  3S7R A;  2ABY A;  4CT8 A;  5KFR A;  2RIL A;  4G0V A;  3WIU A;  2CPX A;  5DLG A;  1YJT A;  4I7F A;  3UCU P;  2YNI A;  4A3L C;  2W9B A;  1XER A;  1XPP A;  3FHZ A;  2FZG B;  4K7Q A;  2HVE A;  2CQH A;  1NK7 A;  1U0H A;  2E44 A;  1NSK L;  4M1X A;  2W9A A;  1NK8 A;  2KWA A;  3N0B A;  2GW8 A;  1RBO B;  2DR7 A;  3T01 A;  2CRL A;  4DL5 A;  5E7O B;  1WEL A;  3RJM B;  3RRG A;  3V81 B;  4U7U D;  4OMF G;  2WVF A;  1TWA K;  2ZUG A;  1RKI A;  1WF2 A;  1O0P A;  3M4O K;  3HDS A;  2X3G A;  3BH7 B;  3BGR A;  4CO2 A;  4WXW A;  2NVT C;  1WKJ A;  3T6B A;  1ZZF A;  4X4R A;  2FHJ D;  3DOK B;  2GQ2 A;  1IBK J;  1S1T A;  4ED3 A;  3QRQ A;  2W9C B;  2KXF A;  3PYE A;  3OFH A;  4L75 A;  2KM8 B;  2G13 A;  4RLE A;  4LF4 F;  4RNO A;  3GTK A;  1NDL A;  1VIX A;  4LQY A;  5U47 A;  4IYQ A;  2C28 A;  3R5C A;  1UA1 A;  3NCQ A;  3CW2 C;  4OIO A;  1Q82 T;  1NHK L;  3BQ1 A;  4LR2 A;  5J2M B;  4C97 A;  1MN7 A;  4N5S A;  1R43 A;  3G8Q A;  1R89 A;  3A3O B;  3HPO A;  3MXH P;  3UNY A;  2G0C A;  2GA7 A;  4IG0 A;  2VIC A;  1M5H A;  1OO0 B;  4ILD A;  3VAG A;  4H54 A;  3MTJ A;  1NDP A;  5A6P A;  4KIA A;  3HHE A;  1YNN A;  1C0A A;  1JLC A;  2HQF A;  2AWZ A;  4BHQ A;  1OSC A;  1GXL A;  2GML A;  3QJP A;  2H54 B;  5CH7 B;  4WIL A;  2VG7 B;  3IXQ A;  2RGR A;  3DMJ A;  3UW1 A;  3LPY A;  1M5K C;  1KDN A;  3QSY B;  4A46 A;  4JI3 F;  3C3L A;  4EO8 A;  5D77 A;  5T14 A;  3WC2 A;  4NLD A;  2DR6 A;  2FJB B;  1N5V A;  3SCJ E;  4OJ3 A;  4I64 A;  4J9U E;  2YH1 A;  2OAU A;  3MED A;  3GTL A;  1Q79 A;  1ICE B;  2BE9 B;  2BKP A;  3TEH B;  3GZ7 A;  5TJ3 A;  4A3G C;  3THP A;  2B4P A;  3ISZ A;  4B3R J;  3E01 A;  2CZV C;  2BW7 A;  5JUM A;  2U2F A;  5H9E K;  3IO1 A;  2OPP B;  2YH0 A;  4Q4Z A;  5IZH A;  1Q8K A;  1GTE A;  4XK8 C;  2KYZ A;  2ZKT A;  1YZ7 A;  2Y1I A;  4PUO A;  4J9Q A;  2BZ2 A;  2VBZ A;  3QID A;  3S8S A;  1TTH B;  3ITH B;  3J7Y U;  2IC3 B;  4OX6 A;  4CRJ A;  4L3K A;  4TLQ A;  4YFX A;  3RR8 A;  2YKN B;  3Q2T C;  4MAK A;  1N32 J;  5E41 A;  4ZCI A;  1ULR A;  1PAU B;  2MZQ A;  1T02 A;  3TAM A;  3H5X A;  2OD4 A;  4QW9 A;  2E66 A;  3H98 A;  1JMT A;  2K06 A;  3JST A;  1TKX A;  3MEG A;  1UCN A;  3IA0 A;  4MEX A;  4QW8 A;  1TV6 B;  1IBC B;  2Z2M A;  3UDE A;  3SCL E;  3NS5 A;  2DH7 A;  5I3U A;  2C1E B;  3I4N C;  3IMQ J;  5KG4 A;  2LQ5 A;  3DLK A;  4GRS A;  3ELH A;  4X6A K;  4WP3 A;  4W92 B;  2DRD A;  4K5S A;  3RB4 A;  1MMD A;  1UVI A;  1F9E B;  1IW7 A;  2JDJ A;  3HSZ A;  1KVJ A;  3G86 A;  3E51 A;  3NS6 A;  5DDR C;  2DGQ A;  3ZZO A;  2Z8Q A;  3KLI B;  3M1V A;  2GC8 A;  1SQG A;  2A6M A;  1F1B B;  2HNZ A;  2FJD B;  1HPZ B;  1F9N A;  1C1B B;  1PO6 A;  2GJF A;  1WI6 A;  1WKL A;  2F4V F;  1TL7 A;  1FO1 A;  1S5Z A;  5KFB A;  4NXN F;  3DRS A;  1YVF A;  4AND A;  3GSI A;  3VR1 A;  1WJ9 A;  2QMU B;  3IM9 A;  3WIV A;  5HLF A;  3BR8 A;  4EMD A;  4EZ6 A;  5C24 A;  5IYB C;  3PRB A;  3TNV A;  1J5O A;  9RUB A;  3I0R A;  4FPR A;  3NNA A;  4KDD A;  4CTA B;  4V1A k;  4KE5 A;  5CYJ A;  3CQZ A;  1GX6 A;  1M1G A;  3S17 K;  2WSF C;  1RUS A;  3KLE B;  3A8K A;  1WI8 A;  1B3T A;  4ECU A;  3RAX A;  3O1L A;  3CQZ C;  3A13 A;  1BC6 A;  1N5Y B;  4OIX A;  3WX4 A;  5LOQ A;  2BR0 A;  3KMQ A;  4PYD A;  2ZHB A;  1UET A;  5HSP A;  2LU2 A;  5EN1 A;  4DR7 F;  2QA2 A;  1F9H A;  5IC4 B;  3KNA A;  2XGP A;  4QYZ J;  3GII A;  3GIR A;  4ZN1 A;  5DQH A;  3D6F B;  4KV8 A;  3AJD A;  3LAL A;  2QLJ B;  1TWG C;  2VG5 A;  2XY5 A;  2E2H A;  3OL7 A;  3D5M A;  4A3B K;  4NLO A;  4GFQ A;  1YRX A;  4V19 X;  3H25 A;  3C2P A;  3AJ2 A;  2JA8 C;  2J8A A;  3BPS P;  4WK1 A;  1HMV B;  5D78 A;  4LQ3 A;  5ETN A;  4B9L A;  1MG7 A;  1YJN S;  3UQS A;  4Q8E A;  1L3V A;  3SFG A;  1UPP A;  2AV5 A;  2A69 A;  4QR0 A;  2MST A;  4OZ2 A;  4Y52 C;  4USW A;  3B82 A;  3T19 A;  3T1A A;  2E1P A;  3LP2 A;  3S15 K;  1HQM A;  3DM2 B;  1IWA A;  3OTE A;  2IMW P;  2MKC A;  4QU7 A;  2Z2L A;  4MMO A;  1FNM A;  4WTY A;  3BSO A;  1U1Q A;  5HRO B;  2R8J A;  1BWV A;  5GAE I;  2ZM6 F;  3EZ5 A;  3IP0 A;  5SUH A;  3G4S S;  3PO2 C;  2ZUF A;  1RT3 A;  5E2Q A;  1Q86 T;  3A8E A;  2N3L A;  3RG6 A;  3GTG K;  4P73 A;  2J0X A;  5L9N A;  3TJ8 A;  3GTQ C;  1I94 F;  3CMQ A;  4DR5 J;  4DZ6 A;  3DHW C;  2LEB A;  3IBF B;  5AE3 A;  4DR2 F;  2Y8Y A;  1WIH A;  2KVQ E;  4ZJL A;  2XNR A;  5KFJ A;  1FHT A;  2Q1L A;  4OZL A;  1JWW A;  4TNO A;  1KLM A;  1TAU A;  3FCW A;  1BQN A;  3C15 A;  4Q2L A;  2W25 A;  2WW8 A;  3GTM C;  3DHX A;  2KH9 A;  4PKD B;  3CC7 S;  2KRB A;  5KOW A;  4B08 A;  2ASY A;  2J5A A;  1IBM J;  4NA1 A;  1H6K X;  3OFE A;  2CQB A;  4HAC B;  1TUG B;  2R7Z C;  1T94 A;  3OTC A;  3LP0 B;  4ITS A;  4WE1 B;  4OZJ A;  2CG4 A;  4DL2 A;  4C8N A;  1Y10 A;  4LFB J;  4NCA A;  4HHJ A;  5IXU A;  3H7H B;  2P8T A;  1CQN A;  3W62 A;  4A3E C;  1ZZN A;  2LEA A;  5LJ5 Y;  3M3Y K;  3DLG A;  1U47 A;  4GZY A;  3RAQ A;  5D0H A;  4NYZ A;  4LSZ B;  4A3C C;  1NB7 A;  2W1B A;  4YHH F;  4R5P A;  2ADB A;  2ZH1 A;  3MI7 X;  3JXO A;  1RAG B;  2KJW A;  2ACY A;  3CD0 A;  2R8K A;  2NVX A;  2I5J B;  3O2I A;  3ZZR A;  1YBU A;  4NLY A;  2XLJ A;  4H4K A;  4M5J A;  2A10 A;  3TVY A;  4CH0 S;  4LR7 A;  3MPW A;  5CYQ B;  5JMN A;  1DTQ A;  1RA6 A;  2OPR A;  3ILI A;  3PTW A;  3M6X A;  1HBU A;  2ZNZ A;  2KHC A;  2R42 A;  3MUR P;  5HJX A;  3R6L B;  1O5J A;  4J9P A;  1FES A;  2XYH B;  4CH1 A;  1T05 A;  1YTY A;  4O4R A;  2OP5 A;  5HLF B;  4A3I K;  2WW4 A;  2H4W B;  1NJX A;  4G3I A;  5HQ8 A;  3IFE A;  3FRY A;  3NWR A;  3R5A A;  4KBI A;  3CJK B;  4QU6 A;  1HWI A;  1RT3 B;  2CNK B;  4CO4 A;  5L1K A;  2ZVS A;  5J2P A;  2QLW A;  3TJ9 A;  1K44 A;  5K14 A;  3JS9 A;  2V2K A;  1S1W B;  4QJV B;  3GTQ K;  3GTG A;  5F8I A;  3OBI A;  4ZVG A;  3K59 A;  3DGP A;  4NLP A;  1IKY A;  5DZ7 A;  3TQ1 A;  1G6B A;  3DOK A;  4CT9 A;  3TVK A;  1GMW D;  4OYW A;  2FZK B;  2CJB A;  1HA1 A;  1NO8 A;  3MMA A;  4IO1 A;  4N76 A;  4DFK A;  4DV6 F;  3QIP A;  4K4U A;  4ED4 A;  4IRK A;  1YQH A;  3OL6 A;  2EFG A;  2DTJ A;  2B5J B;  4Z2X A;  1S9E B;  3TI0 A;  4ZOS A;  1U1R A;  1RHM B;  1U1M A;  1DQ8 A;  5KT5 A;  3HOY K;  4R0E A;  2FUG 9;  1VGY A;  1FDD A;  2AHO B;  3CJ5 A;  3UCG A;  1VBY A;  3M6V A;  2B8P A;  2J6U A;  3G9C A;  2E1M C;  2G2Z A;  3GG1 A;  4DV3 J;  2XY6 A;  5HVG A;  3I6P A;  1EKS A;  2I1R A;  3FKI A;  4QWD A;  4C8M A;  3SBM A;  4FN5 A;  4ED6 A;  4A47 A;  4P7T A;  3QX3 A;  2O1P A;  2AMC B;  4DSL A;  3S1T A;  1TL5 A;  4JV0 A;  2VIH A;  4ZPT R;  2QLB B;  3C15 B;  4RNH A;  2QL9 B;  2DT9 A;  5GAG U;  4OYB A;  3GSD A;  2VH7 A;  1AA1 B;  2QX0 A;  4LVN P;  2RIJ A;  4DSK A;  1PKU A;  2VJV A;  2LEP A;  2VOD A;  3CMA S;  5HO4 A;  4ECS A;  2YXL A;  1Y5N B;  4BLG A;  3OLB A;  3HFZ B;  3KK2 A;  2DCU B;  3FSX A;  3VAK A;  2PMW A;  3TEG A;  5HP1 A;  1K1Q A;  3MML B;  2MZT A;  3PZP A;  4EFA C;  4X4N A;  2VOP A;  3J7Z 5;  1BLU A;  4PRF A;  4A3K C;  2R7V A;  1HI1 A;  4OYI A;  4KHM A;  4DV2 J;  1SH2 A;  1Y0H A;  2CWX A;  2IM0 A;  4JI3 J;  1VJQ A;  4X64 J;  2JVR A;  1SL0 A;  2WHO A;  1BDF A;  4KM9 A;  3EE3 A;  4A93 C;  3UDC A;  3QJJ A;  2XBP A;  4NE9 C;  1GXT A;  1XZP A;  3P4U B;  4F26 A;  5AE1 A;  2HG4 A;  5KG1 A;  1C0U B;  2JEG A;  1DY3 A;  2IRX A;  1Y4Z B;  3PVX A;  1Q1K A;  5A8K B;  1SJQ A;  4P74 A;  5DDO C;  1FEE A;  2KTQ A;  1QLN A;  2E2I C;  2CFA A;  3V4I A;  4K0K J;  3ONQ A;  2D3Z A;  2R2R A;  1S6O A;  4DCO B;  4O3R A;  3I55 S;  4DU7 A;  3QGP A;  3HOZ K;  1KP6 A;  2ZVI A;  3KHR A;  3NP5 A;  2FY8 A;  5KT7 A;  1YJ9 S;  1VBX A;  1C1C B;  4KC6 A;  5AJ3 J;  3SQG B;  3CNQ P;  2XS5 A;  1Y1W C;  2NPF A;  4DX8 H;  2FZC B;  3MPV A;  1HNV B;  2KB2 A;  4WFY A;  3M2R B;  4URS A;  2P6T A;  1H3D A;  4ZIT A;  4JI0 F;  2MLZ A;  1R8C A;  3RB3 A;  4P7V A;  3HXM A;  1IM4 A;  1G51 A;  3GIL A;  2AYM A;  3S1M K;  2OSR A;  1NK9 A;  2NVX C;  2AJ2 A;  2EC2 A;  3S1Q K;  4DR4 F;  1FCA A;  2ZH5 A;  4RW8 B;  4J9K A;  2RNE A;  2ZOM A;  2B9Y A;  4Q0B B;  5DM6 Q;  2N82 B;  1U2R A;  1B70 B;  3TA0 A;  4CTA A;  1RHR B;  3TX0 A;  4DCJ B;  2PFD A;  5LMU J;  3EGZ A;  3DXS X;  3M8P A;  3NRB A;  1ZYR A;  1SKS A;  1UW4 A;  3HZG A;  2HHV A;  3D6M B;  1RT1 A;  3OQ2 A;  5D3G B;  4DN9 A;  3KG0 A;  2E7X A;  1IXK A;  4ZVT B;  2LQ8 A;  1NHV A;  1HI0 P;  4RNF A;  3BQ2 A;  3UWT A;  1R8P A;  3N4W A;  1BXN A;  5HMW A;  2ATC B;  2IBK A;  2DGW A;  4F7V A;  1IS1 A;  3PEJ A;  2HBZ B;  2BAN A;  1VRT B;  4GTC A;  4M5D B;  4ILR A;  4NZ7 A;  2B43 A;  3ZNU A;  3TAQ A;  3QSI A;  3ITH A;  1TL7 B;  3N6M A;  1Q7L B;  1PYT A;  2IDE A;  2XTJ P;  1FDA A;  3CXC R;  3BYR A;  1N4L A;  4A3J K;  1WDD A;  2V4J A;  1TU0 B;  4L3N A;  4X62 F;  2B51 A;  3JYT B;  1IJF B;  5ETL A;  5KFE A;  4NZ0 A;  2DH8 A;  4Y52 K;  3DRP B;  3MM8 B;  2V2Q A;  2NS1 B;  2CWK A;  3MOJ B;  2V63 A;  1F6T A;  4BY7 C;  1D8Z A;  3W2W B;  2BX6 A;  1JLB A;  3RAM A;  5IYD K;  2B6A A;  2BOA A;  1RAD B;  1FFG B;  3PJW A;  4F4A A;  4DV2 F;  1TKZ B;  5LXR A;  4HHU A;  2V8V A;  3UD5 A;  1NK0 A;  4P10 A;  1HQE B;  3L09 A;  5HMY A;  4IQM A;  5T41 A;  5D3G A;  1FRK A;  4KB7 A;  4DUY J;  4DDQ A;  1VQ4 S;  4WKY A;  2XB2 D;  2R7U A;  2JZ5 A;  1U09 A;  3I31 A;  4KGZ B;  1SV5 A;  3GWC A;  4DR3 J;  5ETV A;  2OML A;  5IT9 U;  3H2L A;  1JXL A;  1JLQ A;  1S1X B;  3TZW A;  5F41 A;  4AQY F;  2XM3 A;  3R8Y A;  2XG8 A;  1XZP B;  2P5V A;  3FUY A;  2VZ9 A;  2V6A A;  4RW4 B;  3EPI A;  1T9U A;  4LK0 A;  8AT1 B;  1LWX A;  3HT0 A;  2P8I A;  2F4F A;  3V5R A;  4C8O A;  4LSL A;  3Q8Y A;  3GFZ A;  3TR5 A;  4ICL B;  3GIM A;  1HQ2 A;  1CJK B;  1QE1 A;  3KLH A;  2R92 C;  4EK2 A;  3TFH A;  4I2Q B;  3GTP A;  4H4K C;  2OD6 A;  1UZH A;  4BCA A;  1TWC K;  2DXF A;  1JQW A;  4OYO A;  1XXA A;  3GTJ A;  2XCO A;  3AD9 C;  3FJ2 A;  5KFG A;  3VWS A;  2VF3 A;  2F63 A;  3BGF A;  5C24 B;  4L74 A;  3WQP A;  2EK1 A;  1VIO A;  1M5S A;  2CZ9 A;  4N41 A;  2HHX A;  3GEH A;  2XYG B;  3NMA A;  4HYK A;  4YDX A;  2CW0 A;  5GAH I;  2UUB J;  4O44 A;  1UEU A;  3JSM A;  2IM2 A;  4K8R A;  1NH8 A;  5DDQ C;  2J0W A;  2ZOF A;  4HDH A;  2HHW A;  5KG7 A;  4QWE A;  1SKW A;  4USK A;  1QJH A;  2Y1R I;  2L48 A;  1SC3 B;  3OL8 A;  1HQE A;  1S7H A;  4LT6 A;  4AD6 A;  1SIW B;  4MK8 A;  2NXE A;  2AGP A;  1NKB A;  1U48 A;  2RKI A;  5C4X C;  2D3U A;  2K3I A;  3DLE B;  3B78 A;  2RQK A;  1SB6 A;  3EPG A;  4ECT A;  4ZK7 M;  4X84 A;  1H7W A;  1T9Y A;  2N4C A;  3HM9 A;  2ZM6 J;  2WBR A;  3R1H A;  3GMG A;  1ZM4 A;  3HJF A;  3HVT B;  1XMQ J;  4JI7 J;  5KFM A;  3G8T A;  2BAC A;  1D09 B;  2HS0 A;  4WYW A;  3KUG A;  1I50 C;  3VV2 B;  4NLW A;  1EB0 A;  5LMN F;  3D68 A;  4I6A A;  3MM5 B;  1GK8 A;  1QVF R;  1R6Y A;  5BR8 F;  1J5E F;  2V67 A;  3MR6 A;  1USM A;  5J2P B;  2VC1 A;  2JA6 C;  4NLS A;  3TZY A;  3SSR A;  2V34 A;  2LCW A;  1HHT P;  5J1E A;  3DRR A;  2JEJ A;  3HHD A;  4PXB A;  3N01 A;  3Q83 A;  3CF5 Q;  4LJM A;  1H2T Z;  1RAC B;  1J2V A;  1U1O A;  2I2Y A;  1JJ2 R;  2RSQ A;  3HHL C;  3DDN A;  2EKN A;  4EO6 A;  2UXD F;  4KGM A;  1RP5 A;  1T0T V;  1UFK A;  4NI2 A;  5BYR A;  3J7Z T;  5HVF A;  3DOL A;  1S10 A;  4C6A A;  3X1L B;  1DJ0 A;  4NPO A;  3PO4 A;  2MYF A;  5KG6 A;  3Q22 A;  1M90 T;  4Y7N K;  1LFW A;  5KT3 A;  1HBM B;  2GVD B;  4P2X A;  1S7I A;  4NI2 B;  1X5O A;  1FRH A;  4K4Y A;  1QTN B;  3IM8 A;  1SMY A;  2J7K A;  1LV5 A;  8RUC A;  4DX5 A;  3G4C A;  4WII A;  1PIL A;  4Y2C A;  1AZS B;  1MU2 A;  5HVH A;  4JI1 F;  2WVC A;  4P5A A;  3C16 B;  3FKI K;  4CO1 A;  1ZET A;  2JVO A;  5K9F A;  5EGH A;  3NGS A;  4KGX B;  4DWI A;  2XHC A;  3HLU A;  1YNJ A;  1H38 A;  2WB4 A;  1U2F A;  1TL1 B;  2K3K A;  4MKB A;  2L9W A;  1FX4 A;  3I9V 9;  2VDI A;  3EM1 A;  3HSD A;  1VQL S;  3IR7 B;  4CLS A;  4QR2 A;  1RWW B;  3AHP A;  2DEI A;  3CCU S;  5ETQ A;  2VQF F;  3DU6 A;  4LUB A;  4BBS C;  3KKF A;  2C3P A;  3MD1 A;  5J1P A;  2PC6 A;  4M5N A;  1TZ0 A;  5CYM B;  1DTT A;  2CDQ A;  3MUT P;  1FK9 A;  4OIP A;  5ETR A;  1T9T A;  4G1Q A;  3DDK A;  4DPW A;  3KHG A;  2GJI A;  1NBE B;  2V68 A;  4G6V B;  3SDE A;  4G7O A;  4J9L A;  1DCO A;  4TKT A;  3PJX A;  3GP9 A;  4L6V 3;  3R5G A;  3EWG A;  1B4B A;  2NR0 A;  4LSL B;  2FVS A;  2HQD A;  1VCT A;  1O6X A;  3LTO A;  3R5B A;  4KAR A;  3M4X A;  3W9I A;  2YX4 A;  3GON A;  1C0U A;  5C7P A;  1XK8 A;  1I51 B;  2F1F A;  4DEZ A;  2CQ4 A;  3KLV A;  3KK2 B;  2VFT A;  4EGL A;  1WQF A;  2KU7 A;  2V94 A;  3ORE A;  3GTK K;  1RT6 B;  2C3Y A;  2HWH A;  3EVW A;  5TMC A;  3MGJ A;  4ED2 A;  3UVJ A;  2AIR B;  4YR3 A;  3FFI A;  1Z2L A;  5A8W B;  1REV A;  3NBP B;  2ZZM A;  4QIW D;  3BF4 A;  3GTK C;  4DHV A;  4DR2 J;  4OX7 A;  2VUM A;  4QCL A;  2BE7 D;  3N9U C;  1FNO A;  2ZEJ A;  3OFF A;  3OSN A;  4USI A;  4K59 A;  5C44 K;  2LXI A;  1RAO A;  4OYZ A;  1K9M T;  1UP1 A;  3M4O C;  2BJ1 A;  1RWN B;  2VPX B;  2CAD A;  4B3M F;  2QA4 S;  1KQ4 A;  5KG3 A;  2AGO A;  2XZT B;  1LWE A;  4F25 A;  2F4V J;  1RTZ A;  3SYZ A;  2K7J A;  5H9F K;  3DRP A;  2NVX K;  3GIK A;  2R8I A;  4ZPB A;  2RQ4 A;  2DY9 A;  3DRY A;  2QA1 A;  1TFW A;  3CJT A;  1Q7Y T;  1CJU B;  2CUY A;  1VRU A;  4PG4 A;  4IFY A;  4BKW A;  4B9V A;  3VZH A;  2QYG A;  4ZP9 A;  1B0V A;  1U02 A;  1OQ3 A;  3SCI E;  1Y5L B;  1FWL A;  2ZIT A;  3KDN A;  5IT0 A;  2PN6 A;  5B0C A;  3K7A K;  3VAL A;  2J9D E;  2E5I A;  3ZFV A;  4Y2M A;  2EBG A;  4KRW A;  4F36 A;  2OLW A;  2HAI A;  1Y3J A;  4OYP A;  1Y9O A;  1VDH A;  5C2C A;  4H4O A;  2HQI A;  5ETO A;  5L1I A;  1NK5 A;  2RHS B;  4LFB F;  2BJ9 A;  1VIS A;  4DLE A;  1VGX A;  1S6P A;  4Y34 A;  2AGQ A;  4TXS A;  4LBI A;  2IA0 A;  4B02 A;  4JI7 F;  1VQP S;  2OHD A;  2KG1 A;  4OI6 A;  3H3V D;  3QZ7 A;  1WCM C;  2A68 A;  5CZV A;  2P6S A;  2W01 A;  1WHV A;  3T9N A;  3S6E A;  3EVO A;  3GTQ A;  1RT5 B;  1L3K A;  1GAO A;  2XCP A;  2PDA A;  1N0U A;  2R8G A;  2KVI A;  1LW0 B;  3CIM A;  4NL5 A;  3I5C A;  3MMB B;  3K8V A;  5LL6 d;  4LR9 A;  5DGA A;  2YKM A;  2YNG B;  1FE4 A;  2HIQ A;  3S0X A;  3KLH B;  1OMS A;  2K8G A;  1SFO K;  4ALZ A;  1U26 A;  1GEH A;  3PRV A;  4J91 A;  1J6W A;  2PMZ D;  6FDR A;  3BBF A;  3TAP A;  2G0I A;  2C2E A;  3QGG A;  3H4B A;  4DLG A;  5IS2 A;  2YQ0 A;  3S01 A;  4P5B A;  3ZZU A;  3P96 A;  4DS5 A;  1F3V A;  1SXL A;  5KFV A;  5A2Q U;  2OFG X;  4C3K A;  4Q7A A;  4K0K F;  2CQ2 A;  1YIT S;  4C8Z A;  4PZV A;  3POT A;  1S6Q B;  2NVT K;  3K5N A;  2RQM A;  2XMU A;  4E98 A;  2XMK A;  2VHG A;  1T9X A;  1S97 A;  1X5T A;  3Q3Q A;  3HOX K;  2IRU A;  3P3D A;  4KR0 B;  2DY1 A;  3F73 A;  3WHI A;  3ZTR A;  1V3Z A;  3FRZ A;  3MF5 A;  2V4Q A;  1B0P A;  3M05 A;  3UR3 C;  4D3H A;  2GIR A;  5F3Z A;  3ENV A;  1HNW F;  3DI6 A;  3S15 C;  3UN5 A;  2DEJ A;  2W2P P;  2BOP A;  4FF3 A;  4A3E K;  1WC6 A;  5TMF A;  5EX0 A;  4BXX C;  2B63 K;  1ZQ1 C;  2E7V A;  3DNC A;  4DR1 J;  2NCK L;  1S4F A;  4R8U B;  2HVD A;  1CJT B;  4MTP A;  3BKU A;  1SIZ A;  3M6W A;  3X3U A;  5KFH A;  2H65 B;  1LWC B;  5K8P A;  3V2U C;  3PNI A;  3R1L A;  3MEE B;  1UJ4 A;  1U1K A;  2JWN A;  3AXK A;  4IUF A;  4LIR A;  3W61 A;  3PX0 A;  3LGN A;  3OTO J;  2A18 A;  2ALY B;  2NVY A;  4FVC A;  3W60 A;  2WTF A;  1D0E A;  2BUN A;  4ANE A;  2E2H K;  1BQX A;  3LP1 A;  2WAQ L;  3FBE A;  1DZ5 A;  1FVQ A;  5CJ9 A;  3R27 A;  1WOR A;  4ZVQ B;  2AJ0 A;  1SV5 B;  3HFK A;  2XWX A;  1ZM3 A;  4O4G B;  1FTR A;  3GIJ A;  4ZCK A;  2XWY A;  2MKY A;  1H7X A;  1SKR A;  2MLX A;  2WVB A;  1S48 A;  4Y2K A;  3M32 A;  1HWL A;  4ZS6 A;  1X4D A;  4R25 A;  4OZ1 A;  4CLY A;  5IC6 B;  1FX2 A;  1HL6 A;  4OIN A;  3UN2 A;  2ZBQ A;  4BBR K;  1YJ7 A;  3CIZ A;  2BM0 A;  3N6L A;  4USU A;  1MWQ A;  2FJW A;  1WHX A;  1UVJ A;  3TX8 A;  3MR2 A;  2Q6B A;  3OPK A;  4JI4 F;  4UST A;  4N8O A;  1WSR A;  1IKX B;  3M8W A;  2D41 A;  2EC0 A;  2CJQ A;  3IR6 B;  3T1H F;  3KYL A;  2QA4 G;  3FEZ A;  4RR5 A;  1DBD A;  1Q8I A;  3HXA A;  4OX8 A;  3PCO B;  4AXI A;  4OX9 J;  4RW6 B;  1LXJ A;  4ELV A;  4ZVR B;  1MLA A;  3S1N K;  2BJ8 A;  1HR0 F;  1HNI A;  2ZZN A;  2VG6 A;  3N5B A;  1JLG B;  1BQM B;  1G3O A;  3PFO A;  5GAG I;  1IQZ A;  1KEK A;  2FGC A;  2JA7 K;  5B7W A;  3DLH A;  1IN0 A;  3UR0 A;  2JEI A;  1IKV A;  4C11 A;  2XO6 A;  1WF1 A;  5IP9 C;  5HP1 B;  1DAX A;  1RWM B;  4MIW A;  5G4D A;  1DQA A;  2FVQ A;  3JSB A;  3QRR A;  1JLG A;  3TAN A;  1D9D A;  5CHP A;  3H0G K;  1T11 A;  4LRD A;  3S1N C;  2AZ1 A;  3PW4 A;  1TL3 A;  4RWX A;  3HK2 A;  2J9C A;  5KFD A;  4DR4 J;  2YNH A;  2OPS B;  4WFB Q;  1TKT B;  1HKA A;  4YR0 A;  5HBM A;  3DLL Q;  4G7H A;  4KN4 A;  1FI4 A;  2XUL A;  2DNM A;  1TL3 B;  2RML A;  2M0G B;  1TFY A;  3W8G A;  4Q45 A;  4B3T J;  2Z0G A;  5C25 B;  2CA9 A;  4RBU A;  2XI3 A;  1C4C A;  3DOL B;  2KDO A;  2A1B A;  2GO8 A;  3ICL A;  4GVB A;  5KFO A;  2MZJ A;  1F2G A;  3HSJ A;  3PFE A;  1F2H A;  5AXN A;  3M30 A;  4A3G K;  1SC1 B;  3RU0 A;  3VGU A;  1RAI B;  1VHF A;  4YHH J;  4XTT A;  3NXZ A;  4A8S A;  3GV8 B;  3HT3 A;  1YI2 S;  1X5S A;  4CWB A;  1J6V A;  3MTK A;  3NS7 B;  4F0H A;  4YY3 F;  4DV7 F;  2DXE A;  1JLQ B;  2GSO A;  2FY1 A;  4A3M K;  3HI9 A;  2UVR A;  1FRL A;  2IM1 A;  4UF4 A;  4A8K A;  1QD1 A;  1ZAX A;  2BAB A;  2G1D A;  1SUQ B;  2C3M A;  4NOI A;  1R6V A;  1JNR B;  1WOO A;  2CPZ A;  4ZPW R;  4GTB A;  1U6Z A;  3NL0 A;  2YPZ A;  1FKA F;  4Q43 A;  4LF8 F;  1ZAV A;  3QZ8 A;  1RTD B;  4LBH A;  2MQQ A;  3H0G A;  2AJF E;  2BE5 A;  3ETO A;  4DZD A;  2I6W A;  2BM1 A;  3CCQ S;  3VGV A;  5MAO A;  2C2R A;  4BLB A;  2ZJQ Q;  3KK1 B;  5GVQ A;  3U1N A;  4ZMM A;  2XYP B;  2HFS A;  3LAJ A;  3ZNJ 1;  4URG A;  3S16 K;  3OPF A;  2H5I B;  1RZM A;  1TWF C;  2JA7 A;  2QJ3 A;  3KLG A;  1RLC L;  1RAH B;  1Q16 B;  4F67 A;  3JSR A;  1TWA A;  5E3Q A;  1C4A A;  2XC9 A;  2WK4 A;  1CJV A;  3VQS A;  3PO3 C;  1IKW A;  3K0J A;  3W7B A;  4ID8 A;  4LSN A;  4K4Z A;  2F65 A;  2NYI A;  5A8K A;  1FTC A;  3DCA A;  2EEY A;  3BSC A;  5HBM B;  3S16 C;  1X4F A;  2CPE A;  4JI2 J;  2UZA A;  3QIP B;  4KHP J;  3OR1 A;  3HP6 A;  4C8K A;  2AYB A;  1CUL A;  4D3G A;  1T95 A;  3HHL D;  4QZV B;  2CPF A;  4G0U A;  4YB6 A;  4DL7 A;  3DXB A;  2FGO A;  3TZX A;  4HHH A;  2W8K A;  2HHS A;  4G7Z A;  4LFA J;  2JA8 K;  3M1V B;  2AEF A;  2DNO A;  2NXJ A;  1O26 A;  1AW0 A;  2E9T A;  2H9Z A;  5LMN J;  1U1L A;  2KZZ A;  4ZVE A;  3GTM K;  4EEY A;  3H42 A;  2HMI B;  2OEL A;  3LO3 A;  1TP7 A;  1X0P A;  1GQE A; 
#chains in the Genus database with same CATH homology
 3GSI A;  4PAA A;  1WOS A;  1VLO A;  3GEE A;  3TFI A;  2GAH C;  1XZP A;  1XZP B;  3GEI A;  1PJ5 A;  1XZQ A;  4P9S A;  3GIR A;  1X31 C;  3TFJ A;  1WOP A;  1WSV A;  3AD8 C;  1YX2 A;  3AD7 C;  1V5V A;  3A8K A;  1WOO A;  3A8J A;  3TFH A;  3A8I A;  3ADA C;  3GEH A;  1PJ7 A;  4PAB A;  5L46 A;  1WOR A;  1XZQ B;  1VRQ C;  2GAG C;  3TTG A;  1PJ6 A;  1WSR A;  3AD9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...