3AD7C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with methylthio acetate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Subunit alpha of sarcosine oxidase
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad7C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad7C01
4PAAA 1XZPB 3TTGA 1XZQA 1WOPA 3GEEA 1PJ5A 3AD7C 1VRQC 1YX2A 2GAGC 3AD9C 1X31C 1WSRA 1PJ7A 3GEIA 4PABA 5L46A 1XZPA 3A8IA 3A8JA 3GSIA 3GEHA 4P9SA 3A8KA 3TFHA 1WOOA 1VLOA 1WORA 1XZQB 3AD8C 1WSVA 3GIRA 1PJ6A 1WOSA 2GAHC 1V5VA 3TFIA 3TFJA 3ADAC
chains in the Genus database with same CATH superfamily
1DLOA 2EFOA 3KJNB 2LECA 2F3JA 5EX0A 2OUGA 1RU2A 1SQFA 1MMLA 1REVA 5I3PA 2FC9A 5KG3A 3EGZA 1P1LA 1KNZA 2A0FB 1T9UA 2BEFA 1F7UA 3TQ1A 2HSEB 4LRFA 3G6YA 3RBDA 2XGPA 4YFUA 1C2PA 5A8RA 3OJSA 2I0XA 3BP8C 4ZIVA 5C3EC 4FS2A 1UVLA 3TZWA 3KLEA 3W5ZA 1YBAA 3UD3P 1NKEA 1P9YA 1A0OB 2AU0A 2A10A 1EJ7L 3I0SA 2E1PA 5HBMB 4D3HA 4O3RA 2FJBB 2XG8A 2ZKTA 1N34J 2JEGA 2FHJA 3AA8A 3TNVA 3J7YI 2OP5A 5HP1B 1H2TZ 1R6YA 2IMWP 3ENWA 3V6DA 3DLLQ 5IP7K 3CCJS 4RW9A 2HRYA 1T05B 1S9GB 2KG0A 2C2KB 3GZ7A 2F4VJ 4O3OA 2MLXA 1HWKA 2HWIA 3OR1A 3GJRB 2QG9B 5F8MA 4ANEA 5IT9U 1HA1A 2HK2A 5C4XK 2AZ3A 3VWSA 1VQLS 1R8CA 1HI8A 2MLZA 3TUIC 3HZEA 2WVBA 3DGPB 4RW8B 3MM8A 1GTEA 3RRHA 1F5AA 5HJYA 5IV4A 2I5JB 1WSRA 4WP8A 3OHAA 4CI0B 5F8JA 3ULHA 3AD8C 5A76A 4RNNA 1H2UX 4OX6A 1Y5NB 1HI0P 4DPOA 4IYQA 2IA6A 4PXEA 1GMWD 2DNLA 2XWYA 4CZCA 4Y7NK 2VG5B 4KM9A 2CPEA 1NDLA 1JWWA 2BDPA 1O6XA 1UEKA 4J9LA 4QYZJ 2CJYB 4DMZA 4WBFA 4BS2A 3BKUA 3MM7B 3G8TA 2XMWA 2X3GA 3HPOA 3RZOC 1IKXA 1EQRA 5CZXA 1FXDA 3I9ZA 2QA4G 1FWKA 4LSLA 3NS5A 4RUCA 4IUFA 3IGNA 1S57A 2V5HG 3LP0B 3X1LB 1S0VA 3W9HA 3NG8A 1PYTA 2DNZA 1JLBB 5FD1A 1T7PA 3S7RA 5IZHA 4YB7A 2B9EA 2HQCA 1K0VA 3P4UB 2QFJA 1IWAA 5C2GA 4WK3A 3IRXB 2XYPB 2VASA 2VD3A 3RZDC 4K50A 2JA5A 2PMZL 2PMZD 3D1QA 3GP9A 2JLGA 5M5YK 1AUDA 1SXLA 2DHXA 4GVLA 1SJRA 2YH0A 4UTGA 1VQSA 3EICA 4EI2A 3PIPQ 3G71S 3HJVA 2NCKL 2KZZA 3HXMA 2WVFA 4OZ3A 1WC3A 1WTBA 3CCUS 4FF4A 1CULA 2PO4A 4MT1A 1U1PA 2JA6K 2RSQA 3DRPA 2LQ5A 4FBTA 2F1FA 3FZ2A 4GTAA 1M0SA 1DTTB 5M5WK 2B7BB 1H3DA 3N6NA 5E68A 3HOWK 4UZCA 4M1XA 3GFYA 4FM9A 1OY8A 5C3EK 3RBEA 3OL8A 2AYMA 3ZZUA 4L73A 4OHZA 6AT1B 4N5SA 1DLOB 5KFCA 4PUOA 1S6PB 2KFZA 2MQPA 3G2XA 2ZM6J 1QE1A 1PYOB 4E2FB 1TK5A 3ZTRA 2BZ2A 4ZVGA 2XTJP 1I6JA 1SV5A 5HATA 1V6HA 4Q5SA 4KSEB 2IYIA 1J5EJ 3K7AC 2DD8S 3KLEB 1Y9OA 3I5AA 3FSXA 3AY0A 4JI6J 3DXBA 2G0IA 3IFEA 4A8OA 2FHJD 1OY6A 2AKWB 3MR5A 3I0SB 4DV2J 2ADCA 1O8BA 4NYOA 5HK4A 3DU5A 4KV8B 2D7SA 1JXEA 2W2QP 2JSXA 3UDLA 2HURA 1DAXA 2JRSA 3ZTQA 4KFBA 4UW2A 3HFZB 3PVXA 2RUSA 4Y3CA 4HVZA 3ENQA 1CC8A 1Y1WC 1M5OC 4RW9B 1C1BA 2GMHA 3KMQA 1TV6A 3GEIA 2UVUA 1RWVB 1TUGB 1ICEB 3NWGA 2NZ4A 4XPEA 1VH2A 1USMA 1EI6A 4Y2KA 2BVZA 1NLKL 2LEAA 1S9EA 1RAEB 1TELA 1XZPB 3RB0A 2EWHA 3TEGA 1RK8A 1N52B 3GJSB 1Q8KA 9ATCB 2B4VA 4C3IK 1N36F 2WOMB 1Y3KA 4E0DA 1XMOJ 3FJ2A 2I6WA 2R7ZC 4CLWA 2CQPA 3KG1A 2P6SA 3PYFA 2PIIA 2RHSB 3AODA 3HOZC 5M2PA 3IAM9 4TYBA 5B08A 4XCHA 2IAJB 1YLXA 1IKYA 3IS9A 2HGNA 3LGNA 3J81U 3TZYA 3CJ8A 4JV5F 2VZ9A 3CCVS 4PYAA 1K83C 1RAIB 2E5LJ 4KAWX 3CIMA 3VQSA 3MURP 1UA0A 4A3JK 3QFHA 1X4EA 1TP7A 4WU3A 2VJVA 1UEUA 3D4JA 1VJQA 1G51A 4WFYA 2FZGB 3A3OB 4P7TA 2K06A 5BR8F 5IYDC 4K0KF 5SZTA 4NE9C 3PHTA 1WG1A 1Z2LA 1U6FA 4P2MA 1A6LA 1XNRF 3HJFA 1QY7A 5ETMA 4AL6A 2DK2A 4ZP9A 1ROFA 1GXTA 5D0RA 2OAUA 2CQBA 2XZWA 2RRAA 3M2VB 4DLGA 2XB2D 1PJ6A 2FC8A 4Z37A 4DQIA 3VA7A 4OIQA 2QLWA 1RA6A 2MTLA 3TA0A 5KFHA 5THWA 4IH5A 2F8HA 5EWGA 1YNJA 3HSZA 3HVRA 2AGPA 4DCJB 1JVIA 4QPXA 4WWSA 4OX9F 2IFXA 4DUZJ 5DZ6A 2D3ZA 2Z2MA 2DB1A 1IBLJ 4DX5A 1I6HK 2J6TA 1JJCB 4RPFA 2EKYA 3BREA 3PXGa 4HH1A 2RNEA 3POTB 2ZUFA 5IWAJ 1JK9B 2Y3PA 3MEEA 2HFSA 3CJKB 3UW1A 2DR5A 1HKAA 3CJRA 2BM0A 4QW8A 4ZVUB 2YXLA 2C2OB 1B0PA 3TUZC 2KM8C 2K1RB 7FDRA 5E3QA 3G4AA 3H5SA 1QE1B 4AFFA 4HLBA 3T9ZA 2ZOFA 4C45A 2BJ7A 3TP2A 1R8PA 1HARA 3LAJA 3Q8UA 2JJ4D 1JLQA 1U1QA 4X66F 4DFMA 4BWJA 4J91A 1HW8A 1BGWA 3G82B 4ZJLA 1XIQA 2AF6A 4ZDNA 3Q23A 2D1CA 2BUNA 2DT9A 3B54A 1NSQA 3U1LA 1RAAB 4ILMA 1DZ5A 1TKZA 1X4AA 1N5VA 2ZBRA 1FJCA 1YGYA 4EBCA 1NHUA 1TFWA 4OV1A 1TVRB 3BDPA 1I3QC 2LA6A 4KFBB 4EU0A 3H40A 4ZVEA 3L9ZA 3KLVA 4XDDA 2XZDB 1HIYA 2DR8A 4B9UA 3LAKA 4LR7A 3NLCA 3H0GA 1C1BB 3V4IB 1VS3A 1X4CA 1WF0A 3CSKA 4X65F 1TV6B 2VB6A 2VUMC 1KOOA 1M5SA 4PG7A 2ZHOA 3W5XA 1FO1A 2XMMA 2BJ9A 2UUWA 3BGUA 4I6WA 1Z4UA 3CD0A 4JI4J 4PXBA 2LDIA 4JP8A 4EZ6A 1FNXH 3EVMA 1S9EB 2R3VA 3VQTA 5BYRA 2CJBA 1SFOA 1F3FA 3CO0P 2LU2A 4BKWA 2B5JA 1YSJA 1VQ5S 4DL0C 2GGPB 2RT3A 1E6VA 4NX9A 3D68A 3N79A 1HQMA 4EYIB 4IRCA 5KG7A 4JYAJ 4Y6IA 2MKHA 4ELTA 3D1HA 4BWMA 1FRMA 3Q86A 2V68A 2EG1A 2GVZA 1UW4A 1IKYB 5T41A 4Y2AA 4ID5B 4ZCMA 4PPZA 3UDEA 2J5AA 2XSFA 4J90A 2MEWA 2DHHA 4QWCA 1ZPVA 3S1QK 1LW0B 1PCAA 1XK8A 4LT6A 5D77A 1KN6A 4M5JA 3N28A 4RW6B 4DR6F 1LWFB 3DRYA 3KK1B 4FNIA 2HIQA 3UCZP 4Y0FA 4TXSA 1CVJA 4DL6A 2N3OA 2VPXB 3QGPA 4J9QA 1IVZA 5F8IA 5EWFA 4DPTA 1YRTA 2DXFA 5HVFA 3T5LA 1L0WA 1RTZA 4PKDB 3CCSS 2G1HA 4QJVB 2XS7A 3W9JA 3GTOC 3CUNA 4DR3J 3BYRA 3EGWB 3LPYA 1QVGR 1KQFB 2HQDA 3DLKA 1U2FA 2EKNA 3CTRA 2UXCJ 2E7XA 4CTAB 1U24A 3OPKA 2B3TB 2NSBA 4UY85 5T14A 1S1VA 1KVJA 3DMJA 3W66A 3HHLA 2QJ3A 4DV5F 2ZH4A 3M8RA 2MKSA 4O3NA 4A47A 2XWXA 2UUCF 3NOCA 5D4NA 4ED2A 4NLWA 4CCHA 4B9LA 4FYYB 5J1EA 1IXKA 5M2RA 1EX8A 2AJFE 3T6JA 4BY7C 2YQ0A 4BC7A 5GMDA 5IORA 1NPRA 4O0NA 3OTCA 2XZTB 1REGX 1GMUA 2HFOA 1Y1VA 2VG6B 2VUGA 1HNXJ 4ZVSB 1WQHA 1T9WA 4JI2F 5CA5A 1I94F 4KPYA 1MLAA 2XS5A 4OYMA 1RA7A 4ZVTB 1VQNS 3GTPA 4DPXA 1SH3A 4A8FA 2HVIA 2C2ZB 2MHEA 1KFDA 2J7WA 3EDQB 1X5TA 1BJTA 2DPIA 2RIJA 4C8LA 3MCOA 4YN3B 3BDEA 3FMWA 2NUHA 1AB4A 2X1BA 3KLGA 3SCJE 1P8GA 1RAFB 2VHGA 5C24A 3P49B 2VF3A 4A3GK 1F93A 3FRZA 4ZN1A 1VIXA 3KJVA 1UEVA 1U09A 2E9RX 4QIGA 4KN7A 2GHWA 1H72C 1TWAC 5HVHA 3R5JB 1L3VA 4YEAA 4DSLA 2ZOMA 3IR6B 5GVQA 3MAHA 3GTJK 3DHXA 1X5OA 1RU0A 4DR5J 2OHDA 5U47A 1UPMB 2F5GA 3PJXA 4MYTA 3FKIA 2Q43A 3PO5A 1R9TC 2NQPA 1F9EB 2F65A 1TTHB 3EXCX 3AA9A 4F7VA 1B70B 1U1MA 3VZHA 1E6VB 1TK8A 4RR5A 4I2QB 4RBUA 2KH9A 1WTFA 3S1NK 2YPYA 3SI8A 2ZZMA 4A93C 1KLNA 1T0TV 1RBLA 2JEJA 1IR0A 2R93C 5DS7A 2GVZB 3FFIA 2D9OA 3PW5A 4QBUA 5IOTA 2DNGA 4C2MA 1MWQA 1VBZA 4NEYA 2OTLS 3I5BA 4WKRA 3HZGA 1E6YA 1B7YB 3BBFA 4YB6A 1OJ4A 1R31A 1ZH5A 2ZDOA 2C22A 1O29A 4C98A 4EMDA 1FDAA 3QAEA 2DRBA 1YCLA 2MQ8A 4BBRK 1TWFC 5C7PA 4N8NA 3VAGA 2CFAA 4YB5A 4B9MA 1VLOA 2C2EA 4PZVA 1LW2A 3PDNA 4DG1A 4KR0B 3HXAA 1SMYA 3PO3C 3T02A 3MAQA 2CVEA 4ZOSA 2QMUB 4B3TF 2DH9A 1ZQ1C 2J9DA 1YZ6A 4X62J 3C19A 1N88A 3LUYA 3OL9A 1RT3A 4NLUA 4OYIA 1HNIA 3G4SS 3DLKB 2XCPA 2N4CA 2NVQC 3C16B 2Q79A 2KWAA 2V0NA 3M9OB 5GAGU 1ACMB 2RKIB 5G0RA 2YNIA 2R92C 2XI2A 5AE1A 3OREA 2FJAB 2VPWB 2IMOA 3HOUC 4DN0A 1Q7LB 3T01A 2Y8YA 3M6WA 1R6VA 4ANCA 2FY1A 5KFNA 5BYQA 3HHLB 1CJTA 3IG1B 2C3OA 1I1GA 4RWWA 5DM6Q 2KKHA 4OYZA 3S2HC 5DLGA 2EVZA 1RBOB 4FPIA 2MKIA 2JVRA 1RT1A 1MROB 3ZTPA 3AT1B 1BS2A 4Q44A 3CMQA 3R5GA 1NHVA 5J1EB 4LF5J 1S6UA 2AHOB 4P9SA 2YWKA 4H4KA 2AX1A 4DX8H 4A8WA 3Q8SB 4F50A 4P2FA 2DO4A 4ECTA 4KB2A 3RRGA 2V8HA 2NREA 1QAXA 4N47A 5LXRA 2E9ZA 3CJSA 1TMJA 2IM0A 2DYAA 2SXLA 1CS4A 4LF8F 1BGXT 1WD6A 2ZJRQ 4Y2MA 3WQPA 2OPSA 2HVZA 3E01A 4OJ3A 4ECZA 2JA7K 4JOUA 3LWMA 3JXOA 2HNYA 2W7VA 5B0AA 4B3OB 3DOLA 4EEYA 5H9EJ 3IGVA 4J9UE 4JBCA 4USWA 4NLPA 4DS4A 3KLGB 4AYBD 2CJAA 3O1LA 1VR6A 5C24B 3KXDA 1BQNA 4EO8A 3GTQC 2HNZB 3UVJA 1OS5A 2EEYA 3QGIA 1UFLA 2GVDA 2VBYA 1NK7A 3WZ0A 1PBUA 4DL5A 4IG0B 3NUHA 1BY9A 1LWEA 5DQIA 4LFAJ 4YQWA 4ITSA 1XQIA 3C6UA 1RT7B 2W9CA 1N32J 1FK9A 5AJ3F 3CQZA 2CNNB 2DR7A 4WIQA 3GJQB 5DDQC 3HLUA 1MU2A 2KXNB 1HQEA 2DGQA 1WHYA 3N6MA 1NK9A 3CJQA 4MAKA 2PD1A 5JVGQ 3TAMA 2QV6A 1RT6A 2QYGA 4USMA 4JI5J 1Q79A 4DV1J 5AXNA 5GAGI 1VRQC 1WCMC 1PG5B 4OZLA 3FFIB 2R2RA 2BOPA 4UOHA 3MM6A 2E44A 1SC4B 1U6ZA 5HLFA 2XCAA 2LEBA 2VQFJ 1XPPA 4NYZA 2RB7A 2XO6A 2D6FC 2NVXC 3M3YC 2GCFA 3C6TB 4M95A 3RAXA 1FXLA 3I4PA 2NVQK 3SXLA 4NLRA 1FRKA 5KT5A 2AX0A 1XC9A 1VBKA 1SL0A 2CPYA 1S1WA 5ETVA 1EP4A 3AJ2A 2J9DE 2O66A 2WONA 5DDOC 3MAAB 4M94A 2CQGA 1HLWA 1YWXA 1HMVA 1VC6A 1I50K 4CO5A 2CQ4A 4XLNA 5KFGA 3QSIA 3KMSA 5G0RB 2YNIB 1RHJB 4WE1B 4YR2A 1NJZA 3L7UA 2ZM6F 1G1XA 4DZ6A 1B4BA 1CJTB 4GTBA 1SUQA 3AXKA 2JNJA 3FMBA 2MPUA 4V1Ak 1GQEA 4F0KA 5J2MA 1ZM9A 4LBPA 3CJ2A 3CVKA 2RUGA 2PEHA 1CC7A 1EHWA 2F40A 4G7OA 3R5AA 2ZVSA 4EBEA 4B17A 4ZHRA 3KK2B 1WKLA 2OIHA 4F36A 2HVDA 4DR1J 4R0JA 3LANA 2D3OR 2O01C 2E1MC 1UTAA 5C25A 1CS4B 3LP1A 5GMEA 2R7XA 3AH5A 2GQ2A 3TUPA 2OPSB 3FSIA 1SJFA 2JLEA 1LWCA 3R6GB 2VBXA 1UP1A 3QT7A 3DOLB 4F26A 2XLKA 4PAAA 2KT3A 5M5XK 3FDSA 1LK7A 3T6BA 5HQ8A 1S12A 2M4MA 3HHKA 1RI7A 4F3MA 3MF5A 2Y9HA 4MFBA 4CNZA 4GKKJ 3I55S 1X4DA 4EYHB 1F3VA 1S76D 3PW7A 4A3KC 3UVJB 2UU9F 4DQRA 2R2TA 2QEXS 2KTQA 5E33A 2W2NP 1XMOF 4BLAA 2Z4PA 3S2DC 2QL7B 2MKYA 4C97A 4LMZA 3FCVA 4K4YA 1OO0B 1XMQF 4ECXA 4V19J 2FVSA 1XERA 2RQ4A 3H90A 3HKWA 4AT1B 3FQLA 3GTGA 4NZ7A 5F3ZA 4A3MC 3PNIA 1RB0A 2VODA 4WP3A 3VAHA 5ETSA 2E5LF 2YU9C 3IM8A 1FX2A 2HFNA 2MYFA 2QLBB 3G96A 2IM2A 1V3SA 1RT6B 3EYZA 4P2XA 1JKHA 3H25A 2NVXK 4UF4A 2MZJA 1DY3A 1TWGA 2CQ2A 3M3YK 1RWPB 4HTIA 1YK9A 4RW4B 2NXEA 3JQJA 2C3PA 1U8WA 3ZC4A 4RW7A 4ZPTR 4Q2MA 1NRKA 1NUEA 2GSOA 1H98A 2HBRB 2MZQA 3PKMA 4YG2A 2ZC4A 3H0PA 2LXUA 2L3MA 2CPDA 2QL9B 4MQ9A 5LMUJ 2AMCB 2W7OA 1VRTA 1JMTA 3QAUA 1QSYA 4KE5A 4OYPA 4A8QA 1FNOA 2FJXA 1UFWA 4DPYA 4RUBA 3V2UC 1S79A 1UVIA 2RHQB 3MTJA 4ES1A 3NGDA 4K4ZA 1ZTWA 2H4YB 2XHWA 4M8LA 3H2UB 1RGVA 3W62A 4TYAA 2JH3A 3TVKA 3MFHA 1H2VZ 2EFVA 5EGHA 2ZZTA 1EP4B 3GTKK 5HO4A 4DUZF 1UJ5A 2BYCA 3FK4A 1X5PA 1JXLA 1HBUB 2K3KA 2IRYA 1IBLF 1J5OB 4LR8A 4ZK7M 4TY8B 2MGZA 4LOWA 3MR3A 3K17A 2LCWA 5IWAF 3PCOB 3DRRB 3VAKA 1R0BG 1HNWJ 3VGSA 2XS2A 4XTTA 2O3DA 4WTOB 2JX2A 2ZH3A 1SUQB 1WI6A 4RX6A 3L95X 3QWUA 1MWZA 2P9EA 1HI1A 5J2MB 1HBNA 4PQUA 3DHWC 2L41A 1YJUA 4F4XA 1YJ7A 2FQQB 2M2BA 3J7ZT 1X5SA 3PACA 4ECRA 4K5SA 5HSPA 2GO9A 1LXJA 4J9MA 3HVWA 4NOIA 4C6AA 3EMTA 1VFJA 1KS2A 1KTQA 5KFFA 3CXCR 3L4JA 3P45B 1J2VA 2E2HA 1QTMA 3LP1B 4A3KK 2YNGB 2FZCB 2L48A 2YQ1A 3MD3A 1LWCB 2B4UA 4DPWA 2CXEA 1FFGB 1G6BA 1N33J 5IT4A 4YR0A 1B4AA 1T11A 2Y0SL 2HHTA 1SKUB 2YKNA 3PTWA 2MJNA 3LGMA 3TOQA 4H4MB 3MR7A 1YG0A 4MFBB 2KYZA 4N56A 1EQMA 1WDTA 2VFVA 3HM9A 3H98A 2PGCA 2D69A 5E3PA 4O3QA 3WIVA 2DIUA 5SUHA 3HT0A 1G2EA 1YJRA 3H5YA 2X1AA 2RU9A 1CJUA 3QBCA 2RGRA 4JYAF 1TWCC 2CA9A 5AE2A 3EDRB 1AA1B 4FVMA 1JQWA 4AQYJ 2RQKA 1S59A 3LH2S 3H3VD 2B63A 2KN4A 4ZLLA 2BR0A 2VC0A 4C9DA 1IBAA 2Q3PA 3CT9A 4DSIA 3SIPB 4GTEA 4U95A 4A3EC 3IN5A 2QO3A 3A8KA 2RE1A 1RYSA 1NDCA 3QATA 1F0XA 3A4TA 4XLPA 1RE1B 1JKHB 2PA3A 1F6TA 4F67A 3QRPA 1TMMA 2E7VA 1S1TA 3AAWB 3BGRA 1RAOA 1VC5A 3IWXA 3OXGA 2H65B 3OSNA 3WX4A 1RWMB 4X4VA 4AL5A 1V5VA 4GZYA 4USVA 1FHTA 5C4JK 2WAQD 3AQOA 2RQMA 1VRTB 2DNKA 2F9JA 2G1DA 5FDLB 5K5MA 4KM8A 4QR1A 4DR3F 1JLFA 3FBCA 2MZSA 2ZWPA 5HMXA 4J9RA 2IBOA 2V94A 2AJ4A 4QIEA 4LRBA 2XULA 2YKAA 2V2VA 2HQ3A 2B0GA 1TK0A 4OLPA 5KFSA 3TX0A 3B6BA 2CJKA 2BV3A 5FJ8K 4PYDA 1WDDA 1NNDA 2ZE2A 4PG5A 1N6QB 1VHIA 2W4DA 1TR0A 4IFYA 5G4DA 3CDAA 4KHRA 3VAFA 3HCXA 3T1YJ 3M8YA 3AFGA 4OIOA 2MGZB 4K5RA 2VG7B 2X3DA 2BOAA 1N54B 2COLA 4C8YA 2W8KA 5FLMK 1IS1A 3L7OA 1N36J 5BJRA 3UE2A 2QA1A 5EWEA 3ISND 3AXMA 3KLHA 5KG1A 1MN9A 4A3LK 2J0XA 1VQKS 1J98A 2G9OA 2J6UA 4YDXA 3SDEA 1B3TA 3OFFA 1IN0A 2UUBJ 4PQUB 1RAHB 5KFWA 3IO1A 3IR5B 3I4NC 1N48A 2GMLA 4BDPA 4BXXC 1IKWA 5I3UA 5M2UA 3P96A 4IH6A 3HOYC 4EFAC 2IPOB 1NSAA 4NOHA 4JK1A 4KYZA 3DLEB 3QZ8A 3PEHA 3GFZA 5KFJA 1M5VC 3LAPA 3ETMA 1W2IA 1DJ0A 2HG4A 2P8IA 1TL5A 2UVVA 2FJEB 4OYXA 3PEJA 1OWXA 4K0KJ 4ZCIA 1Q16B 5KFBA 2DNPA 5J1PA 4KMUA 4DF4A 3BUEA 2ZKUA 4I2PA 2EBGA 4OYAA 1XNRJ 2OH2A 2ZH9A 4K2JA 2YKNB 4Z2XA 1L5UA 1RACB 2DR6A 3AD9C 5DG9A 4OHXA 4LJZA 5D3GA 3MHYA 1RWNB 3J81Y 4X4UA 1V5IB 4USHA 3C46A 5ETKA 1U8SA 4AD6A 3RAQA 2JFKA 1IR2A 4ZITA 2LA4A 2ZDPA 3F73A 2ZBPA 3MEGB 4KH1B 1CJUB 4KQZA 2XI3A 1ITPA 3CCRS 4OX9J 3QT8A 4ECWA 2HAFA 4C8NA 4WFAQ 1EETA 2MSTA 3K0JA 3CB4A 4CDIA 3NNCA 3GYXB 1UETA 4O4RA 2H5IB 4HEA9 3WC0A 1U1OA 1PAEX 3FOFA 1SL1A 5DZ7A 1U48A 2A6HA 1DTQB 4AUKA 1O24A 2YWGA 4OZNA 2AJ1A 3IC1A 3NS7B 2CFXA 3BO4A 4OYBA 5KT2A 2V9WA 5KFMA 4B08A 3PR5B 1S1TB 4IKAA 1QUPA 4MKVA 5HANA 2DY9A 3DOMB 1XZQA 4WZQA 4A3DC 3D6FB 3UQSA 1MNEA 5CHCB 1FNMA 2PMHA 1VQ6S 2I38A 2CRLA 2ZBIA 1F9FA 5A0YB 4TNOA 3HHNB 4CWBA 5IM0A 4B9TA 3GV8B 3B4DA 4O44A 3VR1A 4X62F 1X0PA 4O0IA 4DUYF 3TX8A 2ZH5A 3L3CA 2HPUA 4XK8C 4OX8A 3TYTA 1SJ4P 1K0TA 4GTCA 1JLGA 1ELOA 1UAWA 2L9DA 2VFRA 1Q8BA 2MZTA 2V8PA 3SYZA 3EXYA 2FDNA 1HI9A 3KDOA 3DFEA 4F3OA 2IDLA 1KBRA 5HL8A 2PT0A 1FE4A 2A6MA 4LRAA 4X65J 3HSJA 2ZE2B 2W25A 5D78A 2BW7A 5ETOA 4IFYB 1AROP 3R6LB 4ILRA 2IDEA 3PFEA 1MN7A 3WC2A 3ICLA 1HWLA 4CQ1A 3TVYA 3CDWA 4CP5A 4EUVA 4LF5F 2PA8D 2OPPA 2V50A 3HOYK 2AJ0A 4LRDA 2E2IC 1TKXB 4DV7F 2ZD1A 3N0CA 4KN4A 1M1KT 3VGUA 1S1UB 3V4GA 5JJBA 3JYTB 2OEMA 1HNVA 3LO3A 3H8YA 2FJWA 2DTJA 4OX7A 1NM2A 2FB0A 5RUBA 2VDIA 1YIJS 3C15A 4DQPA 2HWTA 4IG3B 4J9VA 4XO0A 1IKWB 1HHSA 2UZAA 3P3DA 2QMWA 5I3UB 3ZZPA 5DG8A 5B0FA 4Z7YA 2KDOA 5HVGA 2BE2B 1NZ8A 4CLKA 4UZBA 5CZVA 3KK3B 4O3PA 2M8DB 4DF8A 2W2MP 5CYMA 3DI6B 2DNOA 1V3ZA 2NVYC 5ETQA 2XSJA 5A6PA 4Y00A 3W2VA 2GQCA 2GA7A 2HMIA 5IP9K 4DXLA 2A6OA 1ISEA 4XSXA 2DNRA 1F2GA 3NXZA 4LFAF 5F9LA 5I42B 1FF2A 1N32F 4AE5A 5IYCK 1JXVA 1JJHA 1USOA 1OMSA 3R9LA 1ZZFA 3OR2A 3IM9A 2ACYA 4BY1C 2XYGB 2C3MA 2XMKA 2V34A 4BHQA 5I3QA 3W65A 1RT4A 3SMZA 4DX6A 3EPIA 1WHVA 2XHCA 1RABB 3SFUA 5BYSA 3FSYA 3K5MA 2GFFA 2OD4A 3OQ2A 2HRUA 5E3AA 4DV1F 1F5CA 4TU7A 4DV5J 2PFDA 4OINA 1SC6A 3CCLS 3KJQB 1EETB 1U47A 1C4CA 1DURA 4A3DK 4QU7A 3ENVA 2R7OA 4XDCA 4KAIA 4OYOA 2DXDA 3GTYX 4CRJA 3JTNA 1K47A 2XEXA 2VQFF 3Q24A 3BN7A 3M7VA 5HBMA 1BQMB 3TJAA 1T03A 1D8ZA 2UV8G 3QIDA 3GG0A 3GTLC 1PJ5A 2D74B 1UJ6A 2IA0A 4MEXA 4JI2J 3NGUA 1OQ3A 5D15A 3RAMA 1DQ8A 4C0BA 1T05A 4DSJA 1S9GA 4ED8A 3ZTOA 3BQ1A 4GFQA 1Y1WA 1URNA 4ED1A 4OI6A 1RZMA 4RUAA 3A12A 2RH6A 1D8YA 2XLJA 5KTQA 4Y34A 4O44B 2JEFA 1WG5A 3CNQP 3NNAA 4QOTA 4IR1A 1CJVB 5HMYA 1VQ4S 2YX7A 4LF9F 1JLGB 1HL6A 4K2XA 3DGPA 3JSRA 1NJXA 3MOZA 5IP7C 3BYPA 3D0IE 5L9NA 4PEOA 4WCEQ 1T9YA 4F25A 3O5TB 4ZVQB 4QWEA 3H0GK 2KRRA 4KGMA 4KRWA 2R7ZA 2YNFA 5C4XC 5CD4A 1RCXB 4M63A 3BR9A 2YNHA 3M1VB 1ZA1B 2VG5A 4UQTA 2WBRA 4ZVRB 4NLVA 3R5DA 1HQUB 1SFOK 1JLCB 1R8BA 2HRTA 3R97A 1K83A 5C2CA 1WUUA 4DR1F 1KWMA 2ZD1B 4JI3F 1WC6A 2J0WA 1HNVB 2IRXA 5IOLA 4KPCA 1S9FA 1JNRB 2IJFA 4JI8J 4Y7NC 3LP0A 5KFZA 1Y00A 2JFDA 2BKNA 1J6XA 3OBIA 1Q86T 4BLBA 3TRGA 1NH7A 3JSMB 1SI9A 1GXUA 2RD5C 3IRXA 1LNQA 4Y52K 1C1CB 3PG9A 5ETRA 2CPHA 1FVSA 1CBKA 2AYEA 1U4BA 3AOCA 4B3SF 1B7FA 1S97A 4GKKF 2C2DA 2VFTA 3W2VB 2ZNYA 4DFPA 4G7ZA 1Z1ZA 1VGYA 4IRDA 4BBYA 4B9SA 2CNLB 4LR9A 3I4MC 1FD8A 1HYSB 3ZXWA 3I87A 3FCHA 3BPDA 4PWWA 4CNYA 1N4LA 3CPWR 3H4DA 3OL6A 1NJYA 3D0HE 3T5HA 1N5SA 3MPWA 2IVFB 2QRRA 3T5KA 4N76A 3A3PB 1S4FA 1AB8A 1RT4B 3PX4A 1SJ3P 2EG2A 1S6PA 4YFNA 1RXOB 4GRSA 5HAOA 4K4WA 2FLNA 2FTRA 4ICLA 3NCPA 1NEEA 2WZ1A 2K7JA 2HZVA 2JA6C 3S1RK 4CLPA 2HW3A 3GTLK 4A8XA 4ZPCA 2Z2ZA 2V63A 2GIRA 3HHDA 4E98A 5C42B 2HLTA 4NMXA 3N5BA 2LLZA 2NXUA 5JVHQ 3HOWC 4DDQA 2BJDA 4CYUA 1OYDA 3F44A 4PRFA 3VALA 1CEZA 2AGQA 2HHUA 2CPJA 2H51B 5LMUF 3A1YG 4H4OA 2GO8A 1FJGJ 1UA1A 3CJ0A 5T7LA 1T03B 3ITHB 2OSQA 2MQOA 4Q43A 4C8KA 4KV8A 4J5OA 1Q8LA 3K5OA 3GIKA 3LP2B 2Y8WA 1J27A 2XNRA 1ZZNA 4LF8J 2EFQA 3K7RA 1Y1VK 2OLWA 5EGYA 3M6UA 2CYYA 1YBTA 1I3QA 4ECQA 2PHCB 3GEHA 3PYEA 2RU3A 2MLYA 3BO3A 4HHHA 4NWBA 3TJ8A 4LF7J 3GTPK 3IWLA 2VUMA 4FZBA 2FJVA 2HBQB 1XZPA 4DFJA 5J2PA 1HD0A 1MWYA 4ZLPA 1UVNA 1AFIA 4OLOA 4PR6A 4YMEA 2WBMA 4FBUA 2KZMA 4F02A 1RWOB 2RVJA 2WOMA 1KVKA 2KHCA 1QVFR 1HNWF 1NSKL 1HPZA 4J9NA 3UDVA 3CMAS 1I3OB 2LXFA 3OFHA 4C3LA 4GKJJ 1AW0A 2B56A 2D3UA 2HHSA 4LFCF 1IL2A 2YNFB 5AJ3J 4OZ1A 3OTOJ 2GZOA 3V6KA 3HOXK 4QPTA 2IAJA 1RWWB 1GFWB 4MKAA 2YNHB 1OPIA 2F63A 3R5BA 4GC7A 2JDJA 1N5YA 3TW0A 1LKZA 5K20B 3DYAB 4C3IC 3FKIK 5F8NA 2RDJA 4I6YA 3MPYA 3UDCA 4KHMA 4JI0F 3E51A 2QLFB 3SQOP 3QSYB 3CC7S 4CO2A 5CABA 1CJKB 1QUVA 2F7VA 4A8MP 2B4PA 3VCDA 4C4WA 2EFNA 3RZAA 2VFSA 1F9NA 3KNGA 4B3RF 4FN5A 2M3DA 4ZMMA 1GEHA 2YWEA 1RISA 3S15K 4NZ6A 2JC1A 3D6MB 3U27A 1YQHA 3I4MK 4PCQA 2KT5A 1N33F 4C2MK 4ZPDA 3R27A 1ZS6A 3H2LA 2M5YA 4LF6J 4A3JC 2BANB 4J7CA 3M2VA 1R43A 2E66A 4USTA 5FLXU 1S0NA 3GTOA 4YP3A 1VHFA 4M5KA 1GXLA 3O6QA 1TL4A 4RU9A 1TAQA 1Z2ZA 3Q2SC 2KXFA 2MKJA 3D28A 4OQJA 1U6BA 3KHGA 2G2ZA 4N77A 1URRA 4ZLNA 2OFHX 4P5BA 2GIQA 2J6SA 2IC3A 1VBYA 2ZH7A 2DJWA 4A3IK 3I6PA 3HOVK 3MCSA 4F2RA 4AQYF 1VOMA 2HFVA 3JSBA 4QYZK 3D5MA 3ADAC 4RL1A 1WOPA 2UUTA 1SC3B 1Q95G 2NPIA 3US5A 3POTA 1RLDA 4QR0A 2HNDB 4ELVA 3N0BA 2P9CA 3FGVA 4OZJA 1VK8A 3CJKA 4R5PB 3CJTA 4LIRA 2E5JA 5EX3A 4ICLB 2HBYB 3RRKA 2K1RA 2E5GA 3LA0A 4ED3A 3TQEA 4WZMA 2KM8B 2MHNA 1H0HB 2V8VA 9RUBA 1RQ0A 3BPSP 3DLBA 2E7WA 1I6HC 1ZBSA 1NKBA 2BM1A 1R89A 4EWTA 4OI1A 1I6VA 4CYUB 4QYRA 2CADA 4LQ9A 3ELHA 3HVTB 2AJQA 3G82A 3ZZYA 1RT2B 4H4OB 2MDAA 1SVDA 2B9YA 4I7FA 3QRQA 1FRIA 1WHWA 4YOEA 5T7LB 3DRSB 5HJXA 2C3UA 2HQGA 1BUXA 1XTZA 4WXWA 3LGHA 5IT0A 2VKZG 4LF2A 1TVRA 2AD9A 4RNFA 1O2BA 2CKWA 1VDHA 2AEJA 2NVTK 2DHAA 3V4IA 3KHRA 4NA1A 1U0HA 2IJNA 1WKJA 3AOAA 1Y4ZB 4G1PA 1MW7A 1SJ1A 2CQ3A 1TWAA 2DPJA 1WQGA 4C3HC 2O5IA 5TMCA 3T1YF 4KATA 3GTMC 1FERA 3GIIA 2IJRA 1F5BA 4QIFA 5KFOA 4CH1A 5B0CA 5J2PB 5DDRC 1U45A 3KWMA 4YHHJ 1X8DA 4G1QB 4DL3A 3TZZA 4J9OA 4GTLA 3CULA 1QM9A 2UU9J 5HQLA 2M9KA 1R9TA 3B78A 2GGPA 4CO0A 4Q45A 3GR1A 1HPZB 3BGFA 1OSDA 1TL3B 1XMQJ 3MPVA 3MM5B 4X4OA 2A2CA 4X4QA 2UUBF 5IYBK 4QZVB 2QMXA 4ID5A 3CQZK 1IWGA 4K4XA 1RTDA 4QIWL 3KFWX 2R93A 4QIWD 4WYLA 2H48B 3IR7B 1N5YB 1T9VA 5LT5A 4QCLA 2VOPA 3CDUA 3G8SA 5IOSA 2QSFA 1MMDA 2DGTA 1AT1B 1DBDA 1LW0A 2MZRA 5CYQA 2XY6A 1FTRA 2B51A 5K8MA 4RW6A 3M6XA 4P73A 2EC0A 3WODA 4DSEA 2DR9A 3LAMA 1LWFA 1Y5IB 2KXHA 3KK1A 1HQ2A 2B8QA 2QGFB 3SBMA 3MM9A 5CXTA 3EQLA 3G8QA 4L3KA 4TQRA 4WJBA 1TWFA 2W9BB 1B0VA 1YJ9S 4IOAQ 4L76A 3N01A 1QAIA 2IM3A 3WX8A 5C5JA 5F8HA 3GLJA 3CJ4A 3S1QC 1EKSA 4QJVA 4I67A 4DL4A 2W01A 3RU0A 2OI2A 4ENOA 1WOSA 1QLNA 4KGXB 3MCMA 4DL7A 4CTAA 1IKVB 3MUVP 3OVBA 1DQAA 2XCRB 5C44K 4GO5X 3BSOA 4LUBA 5AE3A 1Q0NA 2IC3B 1NXIA 1Q7YT 2ERRA 2R92A 2MZ1A 3PM9A 5E3RA 3VVTA 4LF4J 1X31C 1X7VA 5H1SV 1LFPA 3HT3A 4NXNF 2R7VA 1O0PA 3HVAA 3L7PA 2OMLA 4BBSK 3SSSA 2QE5A 3QLHA 4YDDB 4URQU 1IM6A 2CQ1A 2AIRB 2CVIA 1ZM3A 2ATCB 4LJMA 1LV5A 4DV6J 4CO1A 3D67A 7AT1B 3T1HF 3NAIA 1XN9A 4R8UA 2Y0BB 4A3CK 2VG6A 3DDKA 4URGA 3M8QA 2W4CA 4CT8A 3DCAA 2F4FA 2M7SA 3KUHA 2YQ3A 3M9MB 3EVWA 3DNCA 2HGLA 1JB0C 2DH8A 1TZ0A 2BE7D 2DRAA 4C3HK 4I7FB 1FRJA 2V8DA 2UV8A 4P5AA 3IA0A 1F2HA 3GTMK 3NWRA 5IQQA 1KRPA 2W2PP 4IFVA 4DU8A 3QX3A 1LFWA 3OXLA 2WVDA 3W61A 1BDFA 3UD5A 4O3SA 4R0EA 5D4DA 4PWDA 3MECA 2XMUA 3GTQA 1U0HB 3D0GE 3M05A 3D54A 3Q83A 5H9FJ 3V81A 1HD1A 2Y1IA 4IH7A 3D7SB 2MQNA 3TZXA 3C2PA 4A3FK 2W1BA 5DO2A 3TFHA 2RJZA 2R8IA 4A3GC 2LMIA 2FGOA 2NSCA 2BQ3A 3R1HA 4NLGA 3BBBA 4NLSA 1HNZF 4J9KA 1SL2A 2V2QA 3TARA 4KASA 4P74A 1BLUA 2BABA 4I2QA 3W8PA 1K8AT 3GTJC 3G6ES 1BXNA 2AGOA 1M5KC 1NK4A 2Z2LA 3K5LA 1FEEA 3GIMA 3H20A 3V4MA 4FF3A 1Y5LB 5TJ3A 2RH3A 1NJWA 1WCMA 2VKRA 3BR8A 5HROB 1RTDB 4L75A 1G4CA 5L39A 2YBVA 1ZA2B 1KSPA 2ZHAA 1H74A 3BBCA 2MXYA 3GTGK 5LL6d 2BE9B 5CYQB 4TVAB 2RDDA 4AXIA 2HQIA 3V6JA 3R3TA 3S1NC 2AP6A 3KHHA 2A2DA 1U2RA 2NVXA 2GW8A 3SSQA 4DV3J 4NYPA 3HD2A 3MM9B 1TWGK 3JTPA 2DNHA 4M5GA 1WF2A 1VJEA 4LVNP 2KFNA 2JA8C 2XBPA 4WPAA 1TWHC 3F41A 4K59A 1S77D 3HK2A 1Y7PA 1LOUA 1XJWB 3MPDA 1C0TA 2W7PA 4JI7J 4OJHA 4UOFA 5GADU 2GJ2A 2KJVA 1NK5A 3PRBA 2L9WA 5LM7E 2RAQA 3GV5B 3M2RB 2DEJA 4BBRC 2KI2A 1VRUA 3C16A 3TVZA 4QWDA 5KOXA 3TUJC 3ILLA 2RKIA 2CUYA 3GCWP 3IRWP 4ERDA 3MOJB 1AYEA 4WYWA 2Z56B 4HDGA 3WDOA 3R1LA 4N41A 2VICA 3IG1A 3I82A 4KY3A 3R2DJ 4C7QA 2KRBA 3MEDB 1BMQB 1YX2A 3HP6A 2YX4A 3DN9A 2HFZA 1MROA 1S0MA 4F04B 4OZ5A 2XM3A 3QLHB 3GPAA 1U1RA 2VBZA 4KB7A 4IOBA 2V6SA 1FKPB 5CYJA 4R8UB 4Q2LA 2F9DA 4ECYA 2DXEA 3RR8A 3HMJG 3M8QB 4L74A 3FQKA 1IM4A 2L9NA 2BQRA 5KFRA 3O44A 2Z30B 1D9AA 1Y10A 3JS9A 4B3OA 4OIPA 5E2QA 1U0SA 4CLYA 1PC4A 2GSNA 4UY8T 3ISZA 3EGNA 1OY9A 4F4WA 1U02A 4I69A 4IFVB 1KEKA 3H7HB 2U1AA 3KLIA 3FHZA 2BJ8A 1CG2A 4DCPB 1EK8A 3MMAB 3M9NB 3PO2C 4PWDB 1B4SA 2C42A 3MECB 2HNZA 4ILDA 4C8ZA 2E2HK 2V6AA 4P6QA 4DZDA 3S6EA 2NXNA 3GYGA 5TMFA 4IG0A 1TKTA 4PG6A 2JA7C 5DETA 4DCOB 3V81B 1UV7A 1MMNA 3OTBA 1RT7A 2LU1A 2OSRA 1S48A 1KFSA 4U96A 2ZJPQ 1XMBA 4LBIA 3ZTSA 1N5QA 1UCNA 1KQKA 1W25A 1WC5A 5D8HB 5K8NA 5B7WA 4KT0C 1RUSA 3CGIA 5GADI 4KGVB 4HACA 2FLPA 4ZJOA 2U2FA 2JOQA 4G3IA 2YU9A 3W2WA 3AHPA 3CCES 4CIOA 4LSNB 1S1XA 2ROGA 4PABA 3CJ3A 5D0HA 1X60A 3D9BA 3UPFA 3CE8A 1TL7B 4N7TA 2DGXA 3UD4P 1NPPA 2HLUA 4I6AA 5CCMA 2YKMB 4JI8F 1Q81T 4KKOB 3JSTA 2JA8K 4IOCQ 4I4BA 3S1MK 2B63K 1TWHK 3FRYA 4WKYA 5ETLA 2EPIA 4A8KA 4YFKA 3PHEA 4NI2B 4C3JK 3CCWA 1VQYA 1WSVA 3NP5A 2R8KA 2J8AA 4LFBF 4ZJQA 2A3JA 4WJ4A 3C6TA 4FYWB 3GJTB 1B64A 1FX4A 1B0TA 1YVFA 1XXBA 5CQGA 1XBWA 4M5DA 1R0AA 2QIFA 2ACMA 1RLCL 2B9XA 2BJEA 3S16K 3M30B 3DC2A 4I68A 2QZ8A 3CW2C 1H7XA 2KFYA 4OJGA 1C0TB 3D6TB 3MAAA 2RDIA 2NPFA 1CQNA 4DUYJ 3QMQA 3OW2R 1RHUB 1UJ4A 1VRUB 4FKXA 4RBVA 1DCPA 3GCXP 2MQQA 4CLZA 3GQCA 2IM1A 4ZKAA 2ROEA 4YY3J 4K4SA 3HHLD 3MCNA 1RHKB 4WE1A 4AXJA 2AEMA 4I64A 3MMBB 4WFXA 5LOQA 2UVRA 3CEDA 3RG6A 3UCGA 4GT9A 3AJ1A 4PQAA 1CQMA 1JLEA 2HAIA 2CG8A 2W2OP 4OI0A 4LIWA 2P5MA 3MMCB 4PG8A 3R7NB 4DX7A 4IRKA 4X4SA 1LXNA 5KAKA 2AQ4A 1RKJA 4MIWA 1I50C 3I0RB 3D3BJ 4DR7F 1FJGF 2A6EA 1XNQJ 3TEHB 4UQGA 2Y1JA 4DV7J 2OO4A 3KK2A 2CPXA 3EZ5A 3M2UB 1ZM2A 2W4PA 2R2UA 1O2AA 3HFKA 4RO0A 3DXJA 2WK4A 2LQBA 4ALZA 5L46A 2RQCA 3PO2K 2CPZA 4OIXA 3S1TA 4LQYA 3ZFVA 4WFZA 3ZZTA 5DQHA 5L1LA 3GDZA 1JX4A 2BRLA 4NXMJ 2CG4A 4J3NA 2GX8A 4LF7F 4F0HA 2HS4A 3SZ2A 5DDPC 2YKOA 1QTNB 1FWPA 2FZKB 4ED0A 3KLIB 1J6VA 2R4FA 3AB2B 4TLQA 4IDKB 4OJ1A 1OSCA 4M5HA 3GONA 5J2QA 1PKUA 1TKTB 3W3SA 4KO0B 4GKJF 1KOHA 2XO7A 4I56A 3O8WA 4TU8A 1RJJA 3W8GA 3VGVA 1TWCA 3OTOF 3B8HA 1HWIA 3GILA 3FEXB 3QIPA 2JWNA 4KC6A 4O23A 3UO0A 3L09A 1IUJA 2BBEA 2LEPA 4PWUA 5HI7A 3W7BA 2VDHA 5GAEU 1WNEA 2Z58B 4HACB 1L3SA 2B8PA 1VQ9S 4ZP7A 3W2WB 2EK1A 2PDAA 3BQ0A 1YITS 1S1XB 3PW4A 2H5EA 3C14B 4L3NA 5H9EK 4RW4A 1WWHA 3S0XA 2BW2A 3IPJA 2X7IA 1I51B 2R8HA 4OHYA 1QD1A 1SKRA 2YKQA 2XMTA 2CZ4A 5KFXA 3BP3A 1I5OB 4DV0J 4QW9A 4ED4A 2HZAA 1IE0A 4DOZA 3MTKA 3BH6B 3FZBA 5LJ5Y 2PFFB 2HIYA 2WRMA 3CWJA 2YPZA 1EIYB 2L08A 4LF6F 1RWKB 4GVBB 1RP5A 2QL5B 4DJBA 1G7CB 2VJUA 4UOCA 3CC4S 1S10A 2J9CA 3HSGA 2A69A 4TKTA 5L1IA 1YZ7A 2POKA 3P8BB 4M5DB 3EVOA 1R0AB 1REVB 3ZZZA 3N4WA 3A8IA 3BSNA 5DGBA 1TL1A 3R5CA 3J80Y 2DITA 1UWBA 4UUXA 2M0GB 5A8RB 2BACA 4CLFA 3OEPA 4FYDA 5L8RC 1S6QA 1HBUA 3QT5A 1KONA 1J5OA 2FJDB 1BWEA 4TY8A 1B99A 4X4TA 4G0WA 4LF9J 5EN1A 3RB3A 4YR3A 2MQLA 3N5FA 2AYBA 3UI3A 3DRRA 1ZAWA 3K89A 1AZSA 2YX1A 2LFVA 2P9GA 5DGAA 3GTKC 2QA2A 2CWKA 4CO4A 1Y0HA 4FDFA 1JLEB 3V6DB 3LPXA 3NGSA 4ZH4A 4K8RA 1GNKA 3VTIA 1T3NA 3HFVA 2BA9A 3ILJA 3VGTA 4X4PA 2XCOA 3IAS9 4Y2CA 4A8YA 2LDYA 3OR1B 1ZYRA 4USUA 4OZ2A 3ERED 2Z57B 5ETPA 1RAGB 3GB0A 3KHLA 1WC4A 1G3OA 2G4BA 2IIHA 3Q0AA 5IC6B 5E5NA 3MM8B 3K58A 1F60B 2DO0A 3W5YA 2ASDA 4JI3J 2C3YA 4ZLJA 5GAEI 4U7UD 4LBHA 3IP0A 5B0DA 3F56A 2EXUA 3MFIA 2H1YA 4C8MA 6FDRA 2NXJA 2YNGA 4GO7X 3TA1A 1ZPWX 3G4CA 3RZOK 1QJHA 1H38A 2OKQA 3C8YA 3BH7B 1FRHA 1YRXA 3A8EA 3KUGA 4ELUA 2HHWA 4H4MA 2AZ1A 4X6AC 1UWAA 3OXFA 4B3SJ 1AUSL 2PSZA 4YHHF 4WILA 4M5IA 2KJWA 3NY0A 4ES3A 1SKWA 3BSAA 4RLEA 3RZDK 1DCOA 2VQEJ 2ZZNA 5J2QB 4P7VA 4ZS6A 1HR0F 4DQQA 2X1GA 1NJIT 1IKXB 2FPHX 2R7RA 4LSLB 5JFEA 4HI2A 4ZVFA 3QIPB 3CCZA 4NCAA 1K9MT 4RWXA 5IV3A 4UT4A 5LMNF 1U2CA 2IVMA 4JV1A 4RKUC 3K59A 3DM2A 1O51A 4X4RA 4USJC 5HQMA 4B9VA 2AWZA 4NRUA 3NCRA 1VMBA 2E1CA 1DRZA 2R7SA 2R7QA 2C28A 4QWAA 2Q6BA 1U25A 3ET6A 1CULB 2GJIA 3QPIA 3DXSX 4TY9A 3DRPB 1JJ2R 5LSRA 4ILLA 1AFJA 4C0OC 1SIWB 2DRDA 3N0VA 3OVAA 2DGOA 4ES2A 3OFGA 2ZH2A 2OELA 5FDLA 5AXLA 3MR2A 1KKHA 4HH0A 4KH0B 3K7AK 1K1SA 3Q8QB 2UUAJ 4PUOB 3K5PA 5ITHA 2OGUA 2CQDA 1YJVA 4M5NA 2FUG9 2E5HA 1L3KA 3AQPA 3KDNA 2XC9A 4MMOA 1TL1B 1T94A 1UWBB 1N6QA 5C4JC 4KTQA 4BC9A 1SV5B 3CCTA 4LF4F 3QO9A 3BGOP 5IQ6A 2KHDA 1GH8A 1S6QB 4C11A 2RF2A 4ZPBA 1Y1WK 1WI8A 4OMFG 5LSLA 4LRCA 2VG7A 4P72A 1UMJA 2NS1B 3MWBA 4TQSA 2JZ5A 2FD2A 1LWXA 2UXDF 4USIA 1W2BR 3THPA 5L38A 1Q8IA 2BRKA 1FFSB 4WFNQ 1AZSB 3A13A 4X2BA 4Q8EA 4DV6F 1N0VC 2FVCA 1N8RT 3E3XA 3DLHA 2ZH8A 3BQ2A 2K3IA 3MGJA 2E2IA 2MY7A 3B82A 4LFCJ 1K44A 4P75A 4DR2J 2K2PA 3PKYA 4IO1A 2R7ZK 1T3OA 2C2RA 4ED7A 3LPEA 1UVJA 1GMVA 5FLMC 2JLFA 3HOZK 4WF9Q 4JI0J 4K4TA 3G87A 3MPUB 1O28A 4B3MF 3DLEA 4WFBQ 2C2MB 5IT9Y 4RMFA 2MB0B 3JTOA 5KFYA 5KG2A 4A3LC 3PRVA 4A46A 4X6AK 1K83K 3PV8A 3BF4A 4B3RJ 3LW5C 2CNKB 2NVYA 2QTWA 3E2EA 4HT5A 3NOGA 8RUCA 3FCWA 1YDLA 4F4AA 4JV2A 3VAMA 2HHPA 2XMAA 2R9LA 4CM2A 4Q4ZA 4JI1J 1TFYA 4DV4J 4DLEA 5IYDK 2FGCA 2LP4A 3GR0A 1KQSR 2Y0SD 3IS9B 3FKBA 2WSEC 1UVKA 3I5CA 3S17C 1VGXA 2P2CB 3GFHA 3DOKA 1S72S 5AXMA 2E2JC 2GQQA 2N4DA 4NLOA 3QZ7A 1VIOA 4HKQA 3K2YA 2GSUA 3MEGA 2HQFA 3W1YC 2FVRA 3KG0A 5B09A 5CD4H 1A7GE 4LQ3A 4KMAA 2UXBJ 1DARA 2D9PA 3ZZ0A 1Q78A 3SEOA 3D1OA 3ZNJ1 2A1BA 3H5UA 2JA5C 1V3RA 2WSFC 3PRDA 1U1KA 3VAIA 3KNAA 5F8LA 1RADB 3V6HA 3DM2B 3BSCA 2G0CA 1ZVUA 1DTQA 3W9IA 1YJWS 4KHPJ 1FTCA 5A2QU 4AH6A 4ZP8A 2C2NA 2GV1A 4X84A 1EARA 3Q2TC 2CNOB 5L9XA 4DV3F 5FLXY 3K8WA 3GTLA 3ET6B 3DOMA 3S14C 3JQKA 5FIIA 2IRUA 3RR7A 1WHXA 2F8EX 4W4MA 1K73T 1W26A 2Y1RI 2N82B 5A0YA 2H3EB 4FXDA 3GFXA 4ZIWA 2ZBCA 4JI7F 4DR4J 1JJ4A 1D9DA 5F41A 3QNWB 2BJ1A 3WBZA 4Y28C 3UFCX 1R27B 3MEEB 1GX6A 4KIAA 2VL1A 2CJ9A 4FP9A 4O2DA 2XLIA 3S8SA 4KGKA 1FKAF 3JAMU 1RHRB 3EUNA 3IBWA 4DN9A 4LK0A 3OD2A 3PZPA 3CO9A 2E1AA 3RGIA 2A68A 2CZVC 5LJ3Y 1I3QK 1JLQB 5E3CA 5EHHA 3QO9B 1T9XA 2FQTA 4C11B 2RF2B 1H7WA 1UPPA 2OTJS 3CCMS 4ATNA 3M8ZA 5EGEA 2VUMK 2CJQA 1VC0A 1DFDA 2BXJA 4OHWA 5IS2A 5A6WA 4KBIA 2RS2A 4PXDA 3NGRA 3D3CJ 1TKZB 1HBOA 3CMES 2DVIA 2BE5A 4OYWA 1TKXA 5DJBA 4ANDA 5KFPA 1GX5A 4MYUA 5AXKA 3UN2A 4FPRA 4PPDA 3GWCA 1S1UA 3JYTA 4ER8A 3AD7C 2XY5A 3L4KA 1FVQA 4ZP6A 1NK0A 4IG3A 4IQXA 3UCUP 2ZWOA 1KC8T 4USKA 1EFWA 1PGZA 2BE2A 4OFZA 1PSDA 1YBUA 1TUWA 1R3NA 2I9SA 2HZCA 3KK3A 2NYIA 2E5IA 2I2YA 4HT7A 3S17K 3DI6A 4GMKA 3BO2A 2B5JB 4FXVA 1SBRA 1S0OA 1Y3JA 3I56S 5KFKA 2E2JK 3UR3C 4I1TA 1P9QC 2JL9A 3CDBA 2AT1B 3CJ5A 4W90B 4MIAA 3QJLA 2D41A 2WVEA 3TO8A 1KVIA 3N6LA 1IBMJ 5I42A 4LR2A 4F8RA 5L1JA 2ADBA 2OMOA 1WOOA 3DOKB 2JA5K 1PAUB 2ILZA 2HHQA 3CDEA 3P6YC 2O5DA 3GTOK 1IBKJ 3OTEA 4QWBA 5IP9C 2DNYA 1WG4A 3BV8A 3QGGA 2HHXA 3KG4A 1T9TA 3OV7A 1IJFB 3THTA 3PJ9A 3OFEA 3G6XA 4NA2A 1SIZA 5IYCC 2JA6A 1S7IA 1RYRA 2NLWA 2IVYA 2DNMA 3Q8PB 4NXNJ 1N5TA 1FT8A 3NGKA 3NL0A 3S14K 4LREA 1U1LA 3EE3A 1WQFA 3CD5A 2VA3A 5DRKA 1SQEA 4C0HA 5GAHU 3VZIA 3HSDA 1OPZA 4ECVA 1NK8A 4U8VA 4NLQA 2O1PA 5IC4B 3ONQA 1BQMA 3I32A 5E41A 4FVCA 2JC0A 3T1HJ 3U1NA 2HGMA 1IR1A 3MUTP 3EPGA 4J9PA 1PC5A 4BY7K 3KKFA 4C8OA 5ETTA 4LVOP 1S1VB 2NYHA 2CAJA 4HHUA 1Y11A 3DMJB 1FJEB 1NAQA 2H5JB 5BXIA 3A8JA 2AJ2A 2IBKA 1XR6A 3EZOA 3AB4B 2HK3A 3SV4A 2MQMA 3OTDA 1R0CB 1TKDA 3F0NA 4ZVOB 4CT9A 1VK3A 2J8SA 3D2WA 3THVA 1CJVA 8ATCB 2HEKA 3LOUA 5KFIA 4YY3F 1K1QA 4DEZA 1N34F 2XMJA 4CLSA 2CDQA 3LTOA 1WC1A 3WHIA 3GSIA 2V2KA 1RWXB 4RNOA 1O26A 2N7YA 1F9HA 1IQZA 3K8VA 1M5PC 3TFIA 3TJ9A 2FVQA 2YY3A 1TWAK 5B0EA 3JB9k 2F4VF 1A9NB 2KG1A 3M1VA 2XCQA 1D09B 1FXRA 3DDNA 2QN6B 1YTYA 3MDFA 2DBBA 1HNZJ 3OJUA 2M70A 5CAAA 2LYVA 4AYBL 1HQUA 2KVIA 1XNQF 1HBOB 3W64A 4ETXA 3M4XA 1HBMA 1JLCA 4FYXB 5K9FA 3L4BC 2HWHA 3BZQA 2R2SA 1YNNA 3KJVB 2ASJA 3H0GC 3TANA 1R9TK 4CH7A 2ZFHA 2QLJB 1NDKA 3TA2A 1ZYQA 4IO9Q 3QFWA 3FBFA 4D3GA 4MKBA 2O67A 4NXMF 1EQ0A 2VH7A 4A93K 2Y1LB 1SFOC 4QIVA 4MKYA 3JSMA 2R93K 4KJIA 5KFLA 2HYIB 1U7LA 4F0MA 1C1CA 4X64J 2A18A 2DGVA 3KJFB 1YI2S 5GAHI 3BGLA 3EZUA 5MLCV 2XGQA 5KG4A 4NL5A 3ILIA 4UUWA 3TFJA 1RTHA 2AV5A 4ZVHA 3M4OC 1HYSA 5ADZA 1TWFK 3QQCD 1NZAA 1FD2A 4Y52C 3ZZRA 2W9AA 3TI0A 2XYHB 3SCIE 1E6YB 1JNZB 3PO3K 2E29A 1ZTTA 3GYNA 2LQ9A 3FBEA 2V6TA 4MK8A 4U67Q 1NB2A 3FNNA 3PFOA 2V2ZA 4E8UA 3DDIA 4CM0A 2WW4A 1Q5VA 3T00A 1RT5A 4O4GA 2Z2YB 1U1NA 2MKCA 1X9MA 2V4RA 4TU9A 1LK5A 2EI5A 2CFAB 2QLXA 3OLBA 1NKCA 3G86A 1LW2B 3NBPA 2W7AA 2DIVA 2OEKA 4DG1B 2R92K 4F2SA 3K57A 4NLTA 5C42A 2ZVIA 2J0QD 3HOUK 2DH7A 2M8HA 1H73A 1WKKA 4XSZA 4FS1A 3KYLA 4DV0F 3ZNUA 4NMLA 5KFQA 4A8SA 3HX9A 5CJ9A 3S2HK 1HFEL 2PPBA 2FHKA 1YKWA 2MSSA 1RT3B 1HNIB 3S1RC 3ITHA 3M8SA 1YJNS 2Q66A 1JQGA 3LP2A 4K4UA 4ED5A 4JV0A 2Z0GA 3HHLC 2DNNA 2HKEA 3DU6A 2CPIA 2X1FA 2VV5A 4OV6A 4YUDA 3CAGA 1WEZA 2VOOA 1RT1B 1J5EF 1UZHA 2HHHJ 4CH0S 3DRXA 4Z7CA 1NPKA 2K7KA 4JI6F 1ZOTA 1RDRA 1KQGB 1JIHA 4XIUA 3GTMA 5KT6A 2VPZB 3OL7A 1F1BB 5KOWA 2NXCA 4DV2F 4S0MA 1Y1VC 5CCLA 2FIUA 2HVEA 2FLOA 3EWGA 2V4JA 4WK1A 2E1RA 3HD1A 3VVUA 4XPCA 4GTDA 3Q3QA 3TTGA 3GTQK 3GTPC 1DD5A 4Q7AA 1UW9A 4IR9A 2LXIA 3E01B 4KMHA 1VCTA 5KT3A 2HNYB 2V9KA 3JSYA 3NNHA 3QYYA 4CO3A 3DYAA 1XEZA 4OHVA 2JEIA 4AL7A 2N3LA 5E0OA 7FD1A 4HL9A 1HBMB 8AT1B 2DNQA 1HHQA 1BQNB 1YJTA 3QWPA 3HULA 1CJKA 2P6TA 1GK8A 4WIIA 3BJYA 2Q6CA 5K14A 2PI4A 2GVDB 2C1EB 3PIOQ 2XNQA 3HOXC 3NCQA 2JVOA 2WVCA 4C3MA 1SH2A 2QC3A 4L6V3 1LWEB 5DQGA 2VA2A 1INNA 4ECSA 3CD7A 1L3TA 3RW6A 3FBBA 3C6UB 1FA0A 2NUUG 2W9CB 3PW2A 1WEYA 3M4OK 3LWLA 1HHTP 4G65A 1FK9B 3PX0A 4EZ9A 4MK7A 3FKIC 1HWJA 1WCMK 3PR4A 3HDSA 1MU2B 2V67A 4LFBJ 1HQEB 2BANA 3GV7B 4G1IA 4R25A 2WB4A 1WEXA 2EBEA 1SH0A 4CLUA 3NMRA 1OYEA 2GHPA 2OPRA 1EKRA 3TAMB 4DUTA 3S15C 4WP9A 2APOA 3IBCB 1MSWD 2VQEF 3EGVA 1RTHB 1R8AA 4OI3A 3UN5A 2P5VA 4C2MC 2BMBA 2NR0A 1ZBTA 3GSDA 4MK9A 1S7HA 2WHOA 5KG6A 3MM6B 3UNGC 1NB7A 1YRUA 5HLFB 1S6OA 3NEKA 3IXQA 3TAQA 4WTYA 3ZO7A 1TQLA 2GS8A 5E7OB 2HNDA 2V4QA 4LK1A 4WXOA 4R5PA 2UP1A 2BQUA 1NDPA 3D6HB 5F9NA 3J7Z5 1IW7A 1RT5B 1NMEB 4O4GB 4A3IC 2JHEA 1UFKA 4NLYA 3SZZA 3HOVC 4TN2A 3MR6A 4X4NA 3T3FA 2B6AA 2YKPA 3NBPB 1DHMA 4OIRA 3C3LA 2ZITA 1S1WB 2RS8A 4U6PA 4FF1A 3BEGB 2FYXA 1SPBP 2DEIA 3PYGA 1N0UA 3HVTA 2YVSA 2ZUGA 2WONB 4RNHA 3M8WA 1RT2A 3LF0A 1IQ0A 5LSOA 4DR7J 4B02A 5F3TA 2GAGC 3I4HX 3CIZA 1HMVB 3DRSA 2UUAF 4WJ3M 4QU6A 2XMVA 1OIAA 4OL8A 5CHPA 1BWVA 2DHGA 1V9OA 4YB1P 2F8MA 2ASLA 3GMGA 1YHQS 1SQGA 2EFGA 4DWIA 3IBFB 1S4EA 3DKDA 3T9NA 3T5JA 2VBWA 1IQTA 2WSCC 2OJ3A 3H59A 3AOBA 1GTHA 4H4KC 2V69A 2PE8A 2ZBQA 5IFMA 4MJKA 2CDRB 5KT4A 4G1QA 4ZHRB 3FOEA 2NVTC 1RTJA 1WJ9A 1WF1A 2CQ0A 2WW8A 1OQ6A 3R7BB 2V4JB 3LQVA 2G2OA 1NK6A 2ZEJA 5C25B 2CIMA 5IXUA 3H5XA 5D0EA 4FNHA 3MMJA 1TL3A 2KL8A 4DR2F 1VLYA 2ROPA 3MM5A 3GTJA 2RRNA 1VBXA 3S2DK 3NS6A 2O5JA 5A8KA 2EBBA 3KTQA 5KFEA 1LQ9A 4JI4F 1XWLA 5M3FK 3PY8A 2ZUEA 5A8WA 4ED6A 5ETNA 2EFPA 4F4YA 2E9TA 2NZCA 4A3MK 2K8GA 4UOGA 3M32A 3MXHP 2CJXB 3KLFA 3RYLA 3X3UA 2GNKA 2YU9K 5K14B 1X9SA 2B7CB 1S49A 4PXCA 4HDHA 2ZH6A 5IYBC 2G13A 1GAOA 2W9BA 3CQZC 1XR5A 4CLTA 1FKOA 1FWLA 3WIUA 1VYAA 3H3VL 3SCKE 4JI1F 4DV4F 1TWHA 5D6GA 1SB6A 2V8GA 2GHVC 1VJWA 2GAHC 2QA4S 3UWTA 3M6VA 1KP6A 4N8OA 5HMWA 3BKFA 2ZOGA 4M5MA 2VIHA 4DU7A 1C0UA 4K7QA 1IKVA 4EO6A 2BJ3A 1O2FB 2OPRB 1VQ7S 5J1NA 3FUYA 1CLFA 1QAJA 3G9CA 5JXSA 3G6VA 4RW7B 3S01A 4P2SA 4DBQA 4RJVA 2XY7A 2R42A 2UXBF 5F0UA 2WTFA 2FLLA 2WAQL 5B0BA 4HTJA 2HHVA 3KOAA 1X4GA 4DSFA 3K5NA 3P5TL 3N3YA 3HF5A 3CCQS 3OT9A 3DLGA 3U7JA 2BX6A 5C44C 1DQ9A 1T8EA 4KHPF 1S5ZA 3SSRA 4NASA 2UXCF 2LQJA 4FF2A 3LALA 2ALZA 1C4AA 4ZA1A 3VV2B 2B6AB 3T1AA 4U7CA 3H2VE 4A3BC 3FC9A 1XXAA 1RAJA 2QT7A 1F7VA 1FDNA 5J2NA 2CQIA 4BBSC 5F8GA 2YH1A 2GJFA 1VQPS 1Q4RA 1FJ7A 3MZIA 3VF0B 4DR4F 3P5BP 2M88A 1KQ4A 1KLMA 3GIRA 2QFIA 4ZPAA 4M1KA 4A3CC 4Y65A 2VU5A 1QSSA 5HMZA 1D9FA 2B9WA 2VFUA 4KDDA 2EK6A 3CC2S 3BB5A 1HNXF 5KFVA 1JLAA 1KD1T 2DCLA 3PYDA 2DCUB 2W24A 1HBNB 2ALYB 3NGTA 2JA7A 4KC5A 2YTCA 4U7UK 3HO1A 4FZVA 4ZPWR 4NZ0A 4QQBA 3KUEA 1D0EA 4JV5J 4RNMA 2HFUA 3A3NB 3Q89A 2FHOB 2KO1A 1X9WA 2CQHA 2G2YA 3Q8RB 2HBZB 1RTJB 1O27A 2IYGA 2YWWA 2PI5A 1T95A 1KDNA 3AJDA 3SZYA 1HR0J 3PX6A 3SCLE 2EW9A 1XR7A 1RCOB 4G7HA 3C66A 1VQ8S 5BR8J 3BKTA 1RKIA 3JQMA 4NLDA 4KARA 3IWNC 5KFAA 4A3FC 2BKPA 1FESA 4Y2IA 3Q8YA 1RBAA 3GIJA 3O2IA 4MTPA 4RU2A 4H54A 1WELA 1TWCK 2WCXA 4NEZA 5A8KB 1NBEB 5CH7B 2H54B 5HROA 4NA3A 5LMNJ 1S99A 4P52A 1X4BA 3UNYA 3RUBL 5I4MA 4JB8B 1Q5YA 3R2CJ 1FEHA 3RBXA 4DR5F 3OPFA 1UZDA 5A8WB 3DGVA 5KG0A 1KHWA 3SQGA 1NSPA 4HI1A 5KFTA 1APSA 4I0WA 3M32B 1UVMA 3KLFB 5KFDA 1ZETA 5HL7Q 4A3EK 2J0SD 5JMNA 3SFGA 1BD6A 2OPQA 1IBCB 1FKOB 1FI4A 3EM1A 1ULRA 4HHJA 2ZH1A 1FCAA 3GTGC 1IBMF 5M3MK 4KB4A 1BC6A 2GC8A 1N56A 4DHVA 4ZN3A 1R7IA 4RBTA 2RILA 2DKOB 3RB4A 3W60A 2OD6A 2FVPA 3M2RA 4U9RA 4KGZB 1P6TA 1C0UB 2H9ZA 1TWGC 4LSZB 1IBKF 3EX7B 2OEJA 1PJ7A 2FHMA 3B4MA 1SJQA 3U1MA 3QJJA 5JUMA 3NAHA 3BGRB 3GG1A 2CWXA 3N9UC 3PJWA 4ZCLA 3V5RA 2VPYB 4X66J 3NRBA 1RWUA 4A3BK 3TR5A 3VHQA 3MUMP 3MEDA 4HYKA 3OLAA 1EB0A 3QT6A 2V6UA 4A48A 1PBAA 2KB2A 4GTFA 1TAUA 2UXDJ 4FKYA 2J76E 3DLGB 3J7AN 4U8YA 3GU0A 5LXYA 1I50A 1TUVA 4PG4A 1JLFB 1HWUA 3RJMB 4DSKA 4BCAA 4NCBA 2R7WA 1FKPA 1EH1A 4KMDA 2CW0A 2KU7A 1L3UA 1NU4A 4Q5VA 1W7WA 1PIEA 3J7A1 2Y3YA 2HS0A 3HKZL 3HKZD 2OFGX 1DCHA 1KR4A 1C0AA 1P1TA 1Q1KA 1WIHA 3FVYA 5J2NB 3UR0A 1ZXOA 3OSPA 4EK2A 2QYCA 1SKSA 3FEZA 4OI2A 1LEOA 1RU1A 2AYGA 4DI6A 1SC1B 2DGWA 1KLMB 2FY8A 3I4NK 5EDWA 3R7SB 2Z8QA 2QX0A 4B3MJ 4BXXK 2WB1L 2WB1D 2PA8L 4G0UA 1KHVA 1P27B 1CSJA 1QDUB 3MMAA 3QJPA 2BKOA 3KLHB 3ILOA 1QAYA 3ISNC 1JLAB 1BHNA 3SDEB 5F0WA 3EJMA 2EC2A 4ID8A 2R7UA 1BQXA 1FRXA 1ZAVA 1X4FA 3TAPA 3OUYA 3CF5Q 1TU0B 4LLGA 2FQOA 4HR2A 2D3O1 2E2HC 2IY5B 4DR6J 2ZNZA 2RMLA 2VONA 2MKKA 3RB6A 1RHQB 4F4KA 4FYVB 4MEYA 4DS5A 3ENAA 4MIBA 3ETOA 4LSNA 5K8OA 3T19A 4Q0BA 1M1HA 3H42A 2ZJQQ 5MAOA 4XAKA 1TL7A 2ABYA 4ECUA 1U26A 2PEBA 2DY1A 1X0FA 4DQSA 4I2PB 4F3QA 2YKMA 4KKOA 1NH8A 1X4HA 5GMKa 4NCGA 4F4ZA 2ZUAA 4RZRA 2IHR1 3UN3A 1RTIA 4NI2A 4JUZA 2DISA 4NRTA 3BN4A 2RRBA 1NO8A 2I8EA 4X64F 3SQGB 3I31A 5D3GB 3VAJA 1GT8A 4FXWA 3GE9A 1VQOS 5H9FK 3R8YA 3M8PA 2R7TA 3CD6S 5L1KA 3J80U 5B0GA 2J7KA 5DLFA 1GE9A 1ZAXA 4LF1A 1FE0A 3H4BA 1NHKL 4JI5F 3S1MC 2OPQB 3O3LA 2B63C 3M30A 3PW0A 2UVWA 2J9EA 4IQMA 4J9SA 2UUCJ 4C3JC 3BS9A 2PN6A 4A4JA 1VI7A 1FRLA 3RBZA 2AEFA 3MEKA 1VISA 2H4WB 3HI9A 1Q82T 5JVOA 2Q1LA 3MD1A 3E8OA 2HS3A 5EUHA 4NPOA 2W8LA 4GC6A 4OI4A 1RHMB 2ATLA 3S16C 3Q8VA 1J6WA 4CLLA 3MMBA 2GIFA 1EZZB 2HVHA 1I94J 1H6KX 4C3KA 5HP1A 5A2QY 4ZCKA 3IMQJ 1O5JA 1UL3A 1XZQB 3MMCA 3GTKA 5D4PA 3I9V9 3OHBA 3ZZOA 1T02A 4ZVPB 1R8HA 3SV3A 5D4OA 4YS2A 1ZM4A 1VQMS 3NKYA 3OVSA 5AT1B 5KFUA 5D0GA 5KT7A 4Q8FA 3AH6A 4G6VB 2KT2A 4RUHA 4B9NA 5D4LA 4DPUA 5IM0B 3I0RA 1KTVA 1M5HA 1Q53A 1BE4A 4K4VA 2VC1A 1WACA 5KG5A 2YWHA 5HN0A 4DL2A 3W63A 2KVQE 2ZHBA 1QSLA 4URSA 2MY8A 3M2UA 4RW8A 4WU2A 3QGHA 1JOEA 1D1UA 2R8GA 2ASYA 2I5JA 1U49A 3MI7X 3FEYB 1M90T 2E2IK 2N7CA 4L72B 2DGUA 3JAMY 4W92B 5IOQA 3Q22A 3MMLB 2DGSA 3HHEA 4BLGA 4M5LA 1MG7A 4G0VA 2ILYA 2ZC3A 2HHHF 4W98A 2CQCA 1AXQA 4DDFA 3J7YU 1SCJB 3QRRA 1GMWA 2GMJA 3TWZA 2OPPB 2P8TA 1IJEB 1EAYC 2CZ9A 4IDKA 1PYSB 2B43A 2MMYA 2KYXA 2AW0A 3MM7A 4EBDA 2X51A 3RW7A 4DFKA 2NVYK 2CPFA 3U02A 1UKUA 4KO0A 1O25A 4YFXA 4TLRA 4C48A 1FDDA 1FFWB 1NCLA 2QSWA 2B4OA 3C15B 5K8PA 2J7UA 4NLXA 3BM7A 1JLBA 3J81j 2R8JA 1M1GA 4V19X 3NMAA 4ZPVR 3GEEA 2LKZA 5DM7Q 1CPZA 3OUYB 3D66A 1XXCA 1D3WA 5CYMB 4ETZA 4P71A 1WC0A 2LQ8A 2MJUA 4BY1K 5FJ4A 2XSJB 6FD1A 3C14A 4EGLA 4Q0BB 2YWFA 4OZ0A 1PO6A 2HMIB 5DG7A 3RTVA 3I96A 1HW9A 2M52A 2ZFZA 4B3TJ 2G0JA 2DHSA 3DLJA 4QR2A 1PILA 3T41A 4J37A 4NCGB 4P10A 2LVWA 1DTTA 1FDBA 2I1RA 4MH8A 2XQCA 3OR2B 2PC6A 1RTIB 3PO4A 1WORA 2PMWA 1RSCA 4GVBA 3M8PB
chains in the Genus database with same CATH topology
4PAAA 1XZPB 3TTGA 1XZQA 1WOPA 3GEEA 1PJ5A 3AD7C 1VRQC 1YX2A 2GAGC 3AD9C 1X31C 1WSRA 1PJ7A 3GEIA 4PABA 5L46A 1XZPA 3A8IA 3A8JA 3GSIA 3GEHA 4P9SA 3A8KA 3TFHA 1WOOA 1VLOA 1WORA 1XZQB 3AD8C 1WSVA 3GIRA 1PJ6A 1WOSA 2GAHC 1V5VA 3TFIA 3TFJA 3ADAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAA A;  1XZP B;  3TTG A;  1XZQ A;  1WOP A;  3GEE A;  1PJ5 A;  3AD7 C;  1VRQ C;  1YX2 A;  2GAG C;  3AD9 C;  1X31 C;  1WSR A;  1PJ7 A;  3GEI A;  4PAB A;  5L46 A;  1XZP A;  3A8I A;  3A8J A;  3GSI A;  3GEH A;  4P9S A;  3A8K A;  3TFH A;  1WOO A;  1VLO A;  1WOR A;  1XZQ B;  3AD8 C;  1WSV A;  3GIR A;  1PJ6 A;  1WOS A;  2GAH C;  1V5V A;  3TFI A;  3TFJ A;  3ADA C; 
#chains in the Genus database with same CATH topology
 1DLO A;  2EFO A;  3KJN B;  2LEC A;  2F3J A;  5EX0 A;  2OUG A;  1RU2 A;  1SQF A;  1MML A;  1REV A;  5I3P A;  2FC9 A;  5KG3 A;  3EGZ A;  1P1L A;  1KNZ A;  2A0F B;  1T9U A;  2BEF A;  1F7U A;  3TQ1 A;  2HSE B;  4LRF A;  3G6Y A;  3RBD A;  2XGP A;  4YFU A;  1C2P A;  5A8R A;  3OJS A;  2I0X A;  3BP8 C;  4ZIV A;  5C3E C;  4FS2 A;  1UVL A;  3TZW A;  3KLE A;  3W5Z A;  1YBA A;  3UD3 P;  1NKE A;  1P9Y A;  1A0O B;  2AU0 A;  2A10 A;  1EJ7 L;  3I0S A;  2E1P A;  5HBM B;  4D3H A;  4O3R A;  2FJB B;  2XG8 A;  2ZKT A;  1N34 J;  2JEG A;  2FHJ A;  3AA8 A;  3TNV A;  3J7Y I;  2OP5 A;  5HP1 B;  1H2T Z;  1R6Y A;  2IMW P;  3ENW A;  3V6D A;  3DLL Q;  5IP7 K;  3CCJ S;  4RW9 A;  2HRY A;  1T05 B;  1S9G B;  2KG0 A;  2C2K B;  3GZ7 A;  2F4V J;  4O3O A;  2MLX A;  1HWK A;  2HWI A;  3OR1 A;  3GJR B;  2QG9 B;  5F8M A;  4ANE A;  5IT9 U;  1HA1 A;  2HK2 A;  5C4X K;  2AZ3 A;  3VWS A;  1VQL S;  1R8C A;  1HI8 A;  2MLZ A;  3TUI C;  3HZE A;  2WVB A;  3DGP B;  4RW8 B;  3MM8 A;  1GTE A;  3RRH A;  1F5A A;  5HJY A;  5IV4 A;  2I5J B;  1WSR A;  4WP8 A;  3OHA A;  4CI0 B;  5F8J A;  3ULH A;  3AD8 C;  5A76 A;  4RNN A;  1H2U X;  4OX6 A;  1Y5N B;  1HI0 P;  4DPO A;  4IYQ A;  2IA6 A;  4PXE A;  1GMW D;  2DNL A;  2XWY A;  4CZC A;  4Y7N K;  2VG5 B;  4KM9 A;  2CPE A;  1NDL A;  1JWW A;  2BDP A;  1O6X A;  1UEK A;  4J9L A;  4QYZ J;  2CJY B;  4DMZ A;  4WBF A;  4BS2 A;  3BKU A;  3MM7 B;  3G8T A;  2XMW A;  2X3G A;  3HPO A;  3RZO C;  1IKX A;  1EQR A;  5CZX A;  1FXD A;  3I9Z A;  2QA4 G;  1FWK A;  4LSL A;  3NS5 A;  4RUC A;  4IUF A;  3IGN A;  1S57 A;  2V5H G;  3LP0 B;  3X1L B;  1S0V A;  3W9H A;  3NG8 A;  1PYT A;  2DNZ A;  1JLB B;  5FD1 A;  1T7P A;  3S7R A;  5IZH A;  4YB7 A;  2B9E A;  2HQC A;  1K0V A;  3P4U B;  2QFJ A;  1IWA A;  5C2G A;  4WK3 A;  3IRX B;  2XYP B;  2VAS A;  2VD3 A;  3RZD C;  4K50 A;  2JA5 A;  2PMZ L;  2PMZ D;  3D1Q A;  3GP9 A;  2JLG A;  5M5Y K;  1AUD A;  1SXL A;  2DHX A;  4GVL A;  1SJR A;  2YH0 A;  4UTG A;  1VQS A;  3EIC A;  4EI2 A;  3PIP Q;  3G71 S;  3HJV A;  2NCK L;  2KZZ A;  3HXM A;  2WVF A;  4OZ3 A;  1WC3 A;  1WTB A;  3CCU S;  4FF4 A;  1CUL A;  2PO4 A;  4MT1 A;  1U1P A;  2JA6 K;  2RSQ A;  3DRP A;  2LQ5 A;  4FBT A;  2F1F A;  3FZ2 A;  4GTA A;  1M0S A;  1DTT B;  5M5W K;  2B7B B;  1H3D A;  3N6N A;  5E68 A;  3HOW K;  4UZC A;  4M1X A;  3GFY A;  4FM9 A;  1OY8 A;  5C3E K;  3RBE A;  3OL8 A;  2AYM A;  3ZZU A;  4L73 A;  4OHZ A;  6AT1 B;  4N5S A;  1DLO B;  5KFC A;  4PUO A;  1S6P B;  2KFZ A;  2MQP A;  3G2X A;  2ZM6 J;  1QE1 A;  1PYO B;  4E2F B;  1TK5 A;  3ZTR A;  2BZ2 A;  4ZVG A;  2XTJ P;  1I6J A;  1SV5 A;  5HAT A;  1V6H A;  4Q5S A;  4KSE B;  2IYI A;  1J5E J;  3K7A C;  2DD8 S;  3KLE B;  1Y9O A;  3I5A A;  3FSX A;  3AY0 A;  4JI6 J;  3DXB A;  2G0I A;  3IFE A;  4A8O A;  2FHJ D;  1OY6 A;  2AKW B;  3MR5 A;  3I0S B;  4DV2 J;  2ADC A;  1O8B A;  4NYO A;  5HK4 A;  3DU5 A;  4KV8 B;  2D7S A;  1JXE A;  2W2Q P;  2JSX A;  3UDL A;  2HUR A;  1DAX A;  2JRS A;  3ZTQ A;  4KFB A;  4UW2 A;  3HFZ B;  3PVX A;  2RUS A;  4Y3C A;  4HVZ A;  3ENQ A;  1CC8 A;  1Y1W C;  1M5O C;  4RW9 B;  1C1B A;  2GMH A;  3KMQ A;  1TV6 A;  3GEI A;  2UVU A;  1RWV B;  1TUG B;  1ICE B;  3NWG A;  2NZ4 A;  4XPE A;  1VH2 A;  1USM A;  1EI6 A;  4Y2K A;  2BVZ A;  1NLK L;  2LEA A;  1S9E A;  1RAE B;  1TEL A;  1XZP B;  3RB0 A;  2EWH A;  3TEG A;  1RK8 A;  1N52 B;  3GJS B;  1Q8K A;  9ATC B;  2B4V A;  4C3I K;  1N36 F;  2WOM B;  1Y3K A;  4E0D A;  1XMO J;  3FJ2 A;  2I6W A;  2R7Z C;  4CLW A;  2CQP A;  3KG1 A;  2P6S A;  3PYF A;  2PII A;  2RHS B;  3AOD A;  3HOZ C;  5M2P A;  3IAM 9;  4TYB A;  5B08 A;  4XCH A;  2IAJ B;  1YLX A;  1IKY A;  3IS9 A;  2HGN A;  3LGN A;  3J81 U;  3TZY A;  3CJ8 A;  4JV5 F;  2VZ9 A;  3CCV S;  4PYA A;  1K83 C;  1RAI B;  2E5L J;  4KAW X;  3CIM A;  3VQS A;  3MUR P;  1UA0 A;  4A3J K;  3QFH A;  1X4E A;  1TP7 A;  4WU3 A;  2VJV A;  1UEU A;  3D4J A;  1VJQ A;  1G51 A;  4WFY A;  2FZG B;  3A3O B;  4P7T A;  2K06 A;  5BR8 F;  5IYD C;  4K0K F;  5SZT A;  4NE9 C;  3PHT A;  1WG1 A;  1Z2L A;  1U6F A;  4P2M A;  1A6L A;  1XNR F;  3HJF A;  1QY7 A;  5ETM A;  4AL6 A;  2DK2 A;  4ZP9 A;  1ROF A;  1GXT A;  5D0R A;  2OAU A;  2CQB A;  2XZW A;  2RRA A;  3M2V B;  4DLG A;  2XB2 D;  1PJ6 A;  2FC8 A;  4Z37 A;  4DQI A;  3VA7 A;  4OIQ A;  2QLW A;  1RA6 A;  2MTL A;  3TA0 A;  5KFH A;  5THW A;  4IH5 A;  2F8H A;  5EWG A;  1YNJ A;  3HSZ A;  3HVR A;  2AGP A;  4DCJ B;  1JVI A;  4QPX A;  4WWS A;  4OX9 F;  2IFX A;  4DUZ J;  5DZ6 A;  2D3Z A;  2Z2M A;  2DB1 A;  1IBL J;  4DX5 A;  1I6H K;  2J6T A;  1JJC B;  4RPF A;  2EKY A;  3BRE A;  3PXG a;  4HH1 A;  2RNE A;  3POT B;  2ZUF A;  5IWA J;  1JK9 B;  2Y3P A;  3MEE A;  2HFS A;  3CJK B;  3UW1 A;  2DR5 A;  1HKA A;  3CJR A;  2BM0 A;  4QW8 A;  4ZVU B;  2YXL A;  2C2O B;  1B0P A;  3TUZ C;  2KM8 C;  2K1R B;  7FDR A;  5E3Q A;  3G4A A;  3H5S A;  1QE1 B;  4AFF A;  4HLB A;  3T9Z A;  2ZOF A;  4C45 A;  2BJ7 A;  3TP2 A;  1R8P A;  1HAR A;  3LAJ A;  3Q8U A;  2JJ4 D;  1JLQ A;  1U1Q A;  4X66 F;  4DFM A;  4BWJ A;  4J91 A;  1HW8 A;  1BGW A;  3G82 B;  4ZJL A;  1XIQ A;  2AF6 A;  4ZDN A;  3Q23 A;  2D1C A;  2BUN A;  2DT9 A;  3B54 A;  1NSQ A;  3U1L A;  1RAA B;  4ILM A;  1DZ5 A;  1TKZ A;  1X4A A;  1N5V A;  2ZBR A;  1FJC A;  1YGY A;  4EBC A;  1NHU A;  1TFW A;  4OV1 A;  1TVR B;  3BDP A;  1I3Q C;  2LA6 A;  4KFB B;  4EU0 A;  3H40 A;  4ZVE A;  3L9Z A;  3KLV A;  4XDD A;  2XZD B;  1HIY A;  2DR8 A;  4B9U A;  3LAK A;  4LR7 A;  3NLC A;  3H0G A;  1C1B B;  3V4I B;  1VS3 A;  1X4C A;  1WF0 A;  3CSK A;  4X65 F;  1TV6 B;  2VB6 A;  2VUM C;  1KOO A;  1M5S A;  4PG7 A;  2ZHO A;  3W5X A;  1FO1 A;  2XMM A;  2BJ9 A;  2UUW A;  3BGU A;  4I6W A;  1Z4U A;  3CD0 A;  4JI4 J;  4PXB A;  2LDI A;  4JP8 A;  4EZ6 A;  1FNX H;  3EVM A;  1S9E B;  2R3V A;  3VQT A;  5BYR A;  2CJB A;  1SFO A;  1F3F A;  3CO0 P;  2LU2 A;  4BKW A;  2B5J A;  1YSJ A;  1VQ5 S;  4DL0 C;  2GGP B;  2RT3 A;  1E6V A;  4NX9 A;  3D68 A;  3N79 A;  1HQM A;  4EYI B;  4IRC A;  5KG7 A;  4JYA J;  4Y6I A;  2MKH A;  4ELT A;  3D1H A;  4BWM A;  1FRM A;  3Q86 A;  2V68 A;  2EG1 A;  2GVZ A;  1UW4 A;  1IKY B;  5T41 A;  4Y2A A;  4ID5 B;  4ZCM A;  4PPZ A;  3UDE A;  2J5A A;  2XSF A;  4J90 A;  2MEW A;  2DHH A;  4QWC A;  1ZPV A;  3S1Q K;  1LW0 B;  1PCA A;  1XK8 A;  4LT6 A;  5D77 A;  1KN6 A;  4M5J A;  3N28 A;  4RW6 B;  4DR6 F;  1LWF B;  3DRY A;  3KK1 B;  4FNI A;  2HIQ A;  3UCZ P;  4Y0F A;  4TXS A;  1CVJ A;  4DL6 A;  2N3O A;  2VPX B;  3QGP A;  4J9Q A;  1IVZ A;  5F8I A;  5EWF A;  4DPT A;  1YRT A;  2DXF A;  5HVF A;  3T5L A;  1L0W A;  1RTZ A;  4PKD B;  3CCS S;  2G1H A;  4QJV B;  2XS7 A;  3W9J A;  3GTO C;  3CUN A;  4DR3 J;  3BYR A;  3EGW B;  3LPY A;  1QVG R;  1KQF B;  2HQD A;  3DLK A;  1U2F A;  2EKN A;  3CTR A;  2UXC J;  2E7X A;  4CTA B;  1U24 A;  3OPK A;  2B3T B;  2NSB A;  4UY8 5;  5T14 A;  1S1V A;  1KVJ A;  3DMJ A;  3W66 A;  3HHL A;  2QJ3 A;  4DV5 F;  2ZH4 A;  3M8R A;  2MKS A;  4O3N A;  4A47 A;  2XWX A;  2UUC F;  3NOC A;  5D4N A;  4ED2 A;  4NLW A;  4CCH A;  4B9L A;  4FYY B;  5J1E A;  1IXK A;  5M2R A;  1EX8 A;  2AJF E;  3T6J A;  4BY7 C;  2YQ0 A;  4BC7 A;  5GMD A;  5IOR A;  1NPR A;  4O0N A;  3OTC A;  2XZT B;  1REG X;  1GMU A;  2HFO A;  1Y1V A;  2VG6 B;  2VUG A;  1HNX J;  4ZVS B;  1WQH A;  1T9W A;  4JI2 F;  5CA5 A;  1I94 F;  4KPY A;  1MLA A;  2XS5 A;  4OYM A;  1RA7 A;  4ZVT B;  1VQN S;  3GTP A;  4DPX A;  1SH3 A;  4A8F A;  2HVI A;  2C2Z B;  2MHE A;  1KFD A;  2J7W A;  3EDQ B;  1X5T A;  1BJT A;  2DPI A;  2RIJ A;  4C8L A;  3MCO A;  4YN3 B;  3BDE A;  3FMW A;  2NUH A;  1AB4 A;  2X1B A;  3KLG A;  3SCJ E;  1P8G A;  1RAF B;  2VHG A;  5C24 A;  3P49 B;  2VF3 A;  4A3G K;  1F93 A;  3FRZ A;  4ZN1 A;  1VIX A;  3KJV A;  1UEV A;  1U09 A;  2E9R X;  4QIG A;  4KN7 A;  2GHW A;  1H72 C;  1TWA C;  5HVH A;  3R5J B;  1L3V A;  4YEA A;  4DSL A;  2ZOM A;  3IR6 B;  5GVQ A;  3MAH A;  3GTJ K;  3DHX A;  1X5O A;  1RU0 A;  4DR5 J;  2OHD A;  5U47 A;  1UPM B;  2F5G A;  3PJX A;  4MYT A;  3FKI A;  2Q43 A;  3PO5 A;  1R9T C;  2NQP A;  1F9E B;  2F65 A;  1TTH B;  3EXC X;  3AA9 A;  4F7V A;  1B70 B;  1U1M A;  3VZH A;  1E6V B;  1TK8 A;  4RR5 A;  4I2Q B;  4RBU A;  2KH9 A;  1WTF A;  3S1N K;  2YPY A;  3SI8 A;  2ZZM A;  4A93 C;  1KLN A;  1T0T V;  1RBL A;  2JEJ A;  1IR0 A;  2R93 C;  5DS7 A;  2GVZ B;  3FFI A;  2D9O A;  3PW5 A;  4QBU A;  5IOT A;  2DNG A;  4C2M A;  1MWQ A;  1VBZ A;  4NEY A;  2OTL S;  3I5B A;  4WKR A;  3HZG A;  1E6Y A;  1B7Y B;  3BBF A;  4YB6 A;  1OJ4 A;  1R31 A;  1ZH5 A;  2ZDO A;  2C22 A;  1O29 A;  4C98 A;  4EMD A;  1FDA A;  3QAE A;  2DRB A;  1YCL A;  2MQ8 A;  4BBR K;  1TWF C;  5C7P A;  4N8N A;  3VAG A;  2CFA A;  4YB5 A;  4B9M A;  1VLO A;  2C2E A;  4PZV A;  1LW2 A;  3PDN A;  4DG1 A;  4KR0 B;  3HXA A;  1SMY A;  3PO3 C;  3T02 A;  3MAQ A;  2CVE A;  4ZOS A;  2QMU B;  4B3T F;  2DH9 A;  1ZQ1 C;  2J9D A;  1YZ6 A;  4X62 J;  3C19 A;  1N88 A;  3LUY A;  3OL9 A;  1RT3 A;  4NLU A;  4OYI A;  1HNI A;  3G4S S;  3DLK B;  2XCP A;  2N4C A;  2NVQ C;  3C16 B;  2Q79 A;  2KWA A;  2V0N A;  3M9O B;  5GAG U;  1ACM B;  2RKI B;  5G0R A;  2YNI A;  2R92 C;  2XI2 A;  5AE1 A;  3ORE A;  2FJA B;  2VPW B;  2IMO A;  3HOU C;  4DN0 A;  1Q7L B;  3T01 A;  2Y8Y A;  3M6W A;  1R6V A;  4ANC A;  2FY1 A;  5KFN A;  5BYQ A;  3HHL B;  1CJT A;  3IG1 B;  2C3O A;  1I1G A;  4RWW A;  5DM6 Q;  2KKH A;  4OYZ A;  3S2H C;  5DLG A;  2EVZ A;  1RBO B;  4FPI A;  2MKI A;  2JVR A;  1RT1 A;  1MRO B;  3ZTP A;  3AT1 B;  1BS2 A;  4Q44 A;  3CMQ A;  3R5G A;  1NHV A;  5J1E B;  4LF5 J;  1S6U A;  2AHO B;  4P9S A;  2YWK A;  4H4K A;  2AX1 A;  4DX8 H;  4A8W A;  3Q8S B;  4F50 A;  4P2F A;  2DO4 A;  4ECT A;  4KB2 A;  3RRG A;  2V8H A;  2NRE A;  1QAX A;  4N47 A;  5LXR A;  2E9Z A;  3CJS A;  1TMJ A;  2IM0 A;  2DYA A;  2SXL A;  1CS4 A;  4LF8 F;  1BGX T;  1WD6 A;  2ZJR Q;  4Y2M A;  3WQP A;  2OPS A;  2HVZ A;  3E01 A;  4OJ3 A;  4ECZ A;  2JA7 K;  4JOU A;  3LWM A;  3JXO A;  2HNY A;  2W7V A;  5B0A A;  4B3O B;  3DOL A;  4EEY A;  5H9E J;  3IGV A;  4J9U E;  4JBC A;  4USW A;  4NLP A;  4DS4 A;  3KLG B;  4AYB D;  2CJA A;  3O1L A;  1VR6 A;  5C24 B;  3KXD A;  1BQN A;  4EO8 A;  3GTQ C;  2HNZ B;  3UVJ A;  1OS5 A;  2EEY A;  3QGI A;  1UFL A;  2GVD A;  2VBY A;  1NK7 A;  3WZ0 A;  1PBU A;  4DL5 A;  4IG0 B;  3NUH A;  1BY9 A;  1LWE A;  5DQI A;  4LFA J;  4YQW A;  4ITS A;  1XQI A;  3C6U A;  1RT7 B;  2W9C A;  1N32 J;  1FK9 A;  5AJ3 F;  3CQZ A;  2CNN B;  2DR7 A;  4WIQ A;  3GJQ B;  5DDQ C;  3HLU A;  1MU2 A;  2KXN B;  1HQE A;  2DGQ A;  1WHY A;  3N6M A;  1NK9 A;  3CJQ A;  4MAK A;  2PD1 A;  5JVG Q;  3TAM A;  2QV6 A;  1RT6 A;  2QYG A;  4USM A;  4JI5 J;  1Q79 A;  4DV1 J;  5AXN A;  5GAG I;  1VRQ C;  1WCM C;  1PG5 B;  4OZL A;  3FFI B;  2R2R A;  2BOP A;  4UOH A;  3MM6 A;  2E44 A;  1SC4 B;  1U6Z A;  5HLF A;  2XCA A;  2LEB A;  2VQF J;  1XPP A;  4NYZ A;  2RB7 A;  2XO6 A;  2D6F C;  2NVX C;  3M3Y C;  2GCF A;  3C6T B;  4M95 A;  3RAX A;  1FXL A;  3I4P A;  2NVQ K;  3SXL A;  4NLR A;  1FRK A;  5KT5 A;  2AX0 A;  1XC9 A;  1VBK A;  1SL0 A;  2CPY A;  1S1W A;  5ETV A;  1EP4 A;  3AJ2 A;  2J9D E;  2O66 A;  2WON A;  5DDO C;  3MAA B;  4M94 A;  2CQG A;  1HLW A;  1YWX A;  1HMV A;  1VC6 A;  1I50 K;  4CO5 A;  2CQ4 A;  4XLN A;  5KFG A;  3QSI A;  3KMS A;  5G0R B;  2YNI B;  1RHJ B;  4WE1 B;  4YR2 A;  1NJZ A;  3L7U A;  2ZM6 F;  1G1X A;  4DZ6 A;  1B4B A;  1CJT B;  4GTB A;  1SUQ A;  3AXK A;  2JNJ A;  3FMB A;  2MPU A;  4V1A k;  1GQE A;  4F0K A;  5J2M A;  1ZM9 A;  4LBP A;  3CJ2 A;  3CVK A;  2RUG A;  2PEH A;  1CC7 A;  1EHW A;  2F40 A;  4G7O A;  3R5A A;  2ZVS A;  4EBE A;  4B17 A;  4ZHR A;  3KK2 B;  1WKL A;  2OIH A;  4F36 A;  2HVD A;  4DR1 J;  4R0J A;  3LAN A;  2D3O R;  2O01 C;  2E1M C;  1UTA A;  5C25 A;  1CS4 B;  3LP1 A;  5GME A;  2R7X A;  3AH5 A;  2GQ2 A;  3TUP A;  2OPS B;  3FSI A;  1SJF A;  2JLE A;  1LWC A;  3R6G B;  2VBX A;  1UP1 A;  3QT7 A;  3DOL B;  4F26 A;  2XLK A;  4PAA A;  2KT3 A;  5M5X K;  3FDS A;  1LK7 A;  3T6B A;  5HQ8 A;  1S12 A;  2M4M A;  3HHK A;  1RI7 A;  4F3M A;  3MF5 A;  2Y9H A;  4MFB A;  4CNZ A;  4GKK J;  3I55 S;  1X4D A;  4EYH B;  1F3V A;  1S76 D;  3PW7 A;  4A3K C;  3UVJ B;  2UU9 F;  4DQR A;  2R2T A;  2QEX S;  2KTQ A;  5E33 A;  2W2N P;  1XMO F;  4BLA A;  2Z4P A;  3S2D C;  2QL7 B;  2MKY A;  4C97 A;  4LMZ A;  3FCV A;  4K4Y A;  1OO0 B;  1XMQ F;  4ECX A;  4V19 J;  2FVS A;  1XER A;  2RQ4 A;  3H90 A;  3HKW A;  4AT1 B;  3FQL A;  3GTG A;  4NZ7 A;  5F3Z A;  4A3M C;  3PNI A;  1RB0 A;  2VOD A;  4WP3 A;  3VAH A;  5ETS A;  2E5L F;  2YU9 C;  3IM8 A;  1FX2 A;  2HFN A;  2MYF A;  2QLB B;  3G96 A;  2IM2 A;  1V3S A;  1RT6 B;  3EYZ A;  4P2X A;  1JKH A;  3H25 A;  2NVX K;  4UF4 A;  2MZJ A;  1DY3 A;  1TWG A;  2CQ2 A;  3M3Y K;  1RWP B;  4HTI A;  1YK9 A;  4RW4 B;  2NXE A;  3JQJ A;  2C3P A;  1U8W A;  3ZC4 A;  4RW7 A;  4ZPT R;  4Q2M A;  1NRK A;  1NUE A;  2GSO A;  1H98 A;  2HBR B;  2MZQ A;  3PKM A;  4YG2 A;  2ZC4 A;  3H0P A;  2LXU A;  2L3M A;  2CPD A;  2QL9 B;  4MQ9 A;  5LMU J;  2AMC B;  2W7O A;  1VRT A;  1JMT A;  3QAU A;  1QSY A;  4KE5 A;  4OYP A;  4A8Q A;  1FNO A;  2FJX A;  1UFW A;  4DPY A;  4RUB A;  3V2U C;  1S79 A;  1UVI A;  2RHQ B;  3MTJ A;  4ES1 A;  3NGD A;  4K4Z A;  1ZTW A;  2H4Y B;  2XHW A;  4M8L A;  3H2U B;  1RGV A;  3W62 A;  4TYA A;  2JH3 A;  3TVK A;  3MFH A;  1H2V Z;  2EFV A;  5EGH A;  2ZZT A;  1EP4 B;  3GTK K;  5HO4 A;  4DUZ F;  1UJ5 A;  2BYC A;  3FK4 A;  1X5P A;  1JXL A;  1HBU B;  2K3K A;  2IRY A;  1IBL F;  1J5O B;  4LR8 A;  4ZK7 M;  4TY8 B;  2MGZ A;  4LOW A;  3MR3 A;  3K17 A;  2LCW A;  5IWA F;  3PCO B;  3DRR B;  3VAK A;  1R0B G;  1HNW J;  3VGS A;  2XS2 A;  4XTT A;  2O3D A;  4WTO B;  2JX2 A;  2ZH3 A;  1SUQ B;  1WI6 A;  4RX6 A;  3L95 X;  3QWU A;  1MWZ A;  2P9E A;  1HI1 A;  5J2M B;  1HBN A;  4PQU A;  3DHW C;  2L41 A;  1YJU A;  4F4X A;  1YJ7 A;  2FQQ B;  2M2B A;  3J7Z T;  1X5S A;  3PAC A;  4ECR A;  4K5S A;  5HSP A;  2GO9 A;  1LXJ A;  4J9M A;  3HVW A;  4NOI A;  4C6A A;  3EMT A;  1VFJ A;  1KS2 A;  1KTQ A;  5KFF A;  3CXC R;  3L4J A;  3P45 B;  1J2V A;  2E2H A;  1QTM A;  3LP1 B;  4A3K K;  2YNG B;  2FZC B;  2L48 A;  2YQ1 A;  3MD3 A;  1LWC B;  2B4U A;  4DPW A;  2CXE A;  1FFG B;  1G6B A;  1N33 J;  5IT4 A;  4YR0 A;  1B4A A;  1T11 A;  2Y0S L;  2HHT A;  1SKU B;  2YKN A;  3PTW A;  2MJN A;  3LGM A;  3TOQ A;  4H4M B;  3MR7 A;  1YG0 A;  4MFB B;  2KYZ A;  4N56 A;  1EQM A;  1WDT A;  2VFV A;  3HM9 A;  3H98 A;  2PGC A;  2D69 A;  5E3P A;  4O3Q A;  3WIV A;  2DIU A;  5SUH A;  3HT0 A;  1G2E A;  1YJR A;  3H5Y A;  2X1A A;  2RU9 A;  1CJU A;  3QBC A;  2RGR A;  4JYA F;  1TWC C;  2CA9 A;  5AE2 A;  3EDR B;  1AA1 B;  4FVM A;  1JQW A;  4AQY J;  2RQK A;  1S59 A;  3LH2 S;  3H3V D;  2B63 A;  2KN4 A;  4ZLL A;  2BR0 A;  2VC0 A;  4C9D A;  1IBA A;  2Q3P A;  3CT9 A;  4DSI A;  3SIP B;  4GTE A;  4U95 A;  4A3E C;  3IN5 A;  2QO3 A;  3A8K A;  2RE1 A;  1RYS A;  1NDC A;  3QAT A;  1F0X A;  3A4T A;  4XLP A;  1RE1 B;  1JKH B;  2PA3 A;  1F6T A;  4F67 A;  3QRP A;  1TMM A;  2E7V A;  1S1T A;  3AAW B;  3BGR A;  1RAO A;  1VC5 A;  3IWX A;  3OXG A;  2H65 B;  3OSN A;  3WX4 A;  1RWM B;  4X4V A;  4AL5 A;  1V5V A;  4GZY A;  4USV A;  1FHT A;  5C4J K;  2WAQ D;  3AQO A;  2RQM A;  1VRT B;  2DNK A;  2F9J A;  2G1D A;  5FDL B;  5K5M A;  4KM8 A;  4QR1 A;  4DR3 F;  1JLF A;  3FBC A;  2MZS A;  2ZWP A;  5HMX A;  4J9R A;  2IBO A;  2V94 A;  2AJ4 A;  4QIE A;  4LRB A;  2XUL A;  2YKA A;  2V2V A;  2HQ3 A;  2B0G A;  1TK0 A;  4OLP A;  5KFS A;  3TX0 A;  3B6B A;  2CJK A;  2BV3 A;  5FJ8 K;  4PYD A;  1WDD A;  1NND A;  2ZE2 A;  4PG5 A;  1N6Q B;  1VHI A;  2W4D A;  1TR0 A;  4IFY A;  5G4D A;  3CDA A;  4KHR A;  3VAF A;  3HCX A;  3T1Y J;  3M8Y A;  3AFG A;  4OIO A;  2MGZ B;  4K5R A;  2VG7 B;  2X3D A;  2BOA A;  1N54 B;  2COL A;  4C8Y A;  2W8K A;  5FLM K;  1IS1 A;  3L7O A;  1N36 J;  5BJR A;  3UE2 A;  2QA1 A;  5EWE A;  3ISN D;  3AXM A;  3KLH A;  5KG1 A;  1MN9 A;  4A3L K;  2J0X A;  1VQK S;  1J98 A;  2G9O A;  2J6U A;  4YDX A;  3SDE A;  1B3T A;  3OFF A;  1IN0 A;  2UUB J;  4PQU B;  1RAH B;  5KFW A;  3IO1 A;  3IR5 B;  3I4N C;  1N48 A;  2GML A;  4BDP A;  4BXX C;  1IKW A;  5I3U A;  5M2U A;  3P96 A;  4IH6 A;  3HOY C;  4EFA C;  2IPO B;  1NSA A;  4NOH A;  4JK1 A;  4KYZ A;  3DLE B;  3QZ8 A;  3PEH A;  3GFZ A;  5KFJ A;  1M5V C;  3LAP A;  3ETM A;  1W2I A;  1DJ0 A;  2HG4 A;  2P8I A;  1TL5 A;  2UVV A;  2FJE B;  4OYX A;  3PEJ A;  1OWX A;  4K0K J;  4ZCI A;  1Q16 B;  5KFB A;  2DNP A;  5J1P A;  4KMU A;  4DF4 A;  3BUE A;  2ZKU A;  4I2P A;  2EBG A;  4OYA A;  1XNR J;  2OH2 A;  2ZH9 A;  4K2J A;  2YKN B;  4Z2X A;  1L5U A;  1RAC B;  2DR6 A;  3AD9 C;  5DG9 A;  4OHX A;  4LJZ A;  5D3G A;  3MHY A;  1RWN B;  3J81 Y;  4X4U A;  1V5I B;  4USH A;  3C46 A;  5ETK A;  1U8S A;  4AD6 A;  3RAQ A;  2JFK A;  1IR2 A;  4ZIT A;  2LA4 A;  2ZDP A;  3F73 A;  2ZBP A;  3MEG B;  4KH1 B;  1CJU B;  4KQZ A;  2XI3 A;  1ITP A;  3CCR S;  4OX9 J;  3QT8 A;  4ECW A;  2HAF A;  4C8N A;  4WFA Q;  1EET A;  2MST A;  3K0J A;  3CB4 A;  4CDI A;  3NNC A;  3GYX B;  1UET A;  4O4R A;  2H5I B;  4HEA 9;  3WC0 A;  1U1O A;  1PAE X;  3FOF A;  1SL1 A;  5DZ7 A;  1U48 A;  2A6H A;  1DTQ B;  4AUK A;  1O24 A;  2YWG A;  4OZN A;  2AJ1 A;  3IC1 A;  3NS7 B;  2CFX A;  3BO4 A;  4OYB A;  5KT2 A;  2V9W A;  5KFM A;  4B08 A;  3PR5 B;  1S1T B;  4IKA A;  1QUP A;  4MKV A;  5HAN A;  2DY9 A;  3DOM B;  1XZQ A;  4WZQ A;  4A3D C;  3D6F B;  3UQS A;  1MNE A;  5CHC B;  1FNM A;  2PMH A;  1VQ6 S;  2I38 A;  2CRL A;  2ZBI A;  1F9F A;  5A0Y B;  4TNO A;  3HHN B;  4CWB A;  5IM0 A;  4B9T A;  3GV8 B;  3B4D A;  4O44 A;  3VR1 A;  4X62 F;  1X0P A;  4O0I A;  4DUY F;  3TX8 A;  2ZH5 A;  3L3C A;  2HPU A;  4XK8 C;  4OX8 A;  3TYT A;  1SJ4 P;  1K0T A;  4GTC A;  1JLG A;  1ELO A;  1UAW A;  2L9D A;  2VFR A;  1Q8B A;  2MZT A;  2V8P A;  3SYZ A;  3EXY A;  2FDN A;  1HI9 A;  3KDO A;  3DFE A;  4F3O A;  2IDL A;  1KBR A;  5HL8 A;  2PT0 A;  1FE4 A;  2A6M A;  4LRA A;  4X65 J;  3HSJ A;  2ZE2 B;  2W25 A;  5D78 A;  2BW7 A;  5ETO A;  4IFY B;  1ARO P;  3R6L B;  4ILR A;  2IDE A;  3PFE A;  1MN7 A;  3WC2 A;  3ICL A;  1HWL A;  4CQ1 A;  3TVY A;  3CDW A;  4CP5 A;  4EUV A;  4LF5 F;  2PA8 D;  2OPP A;  2V50 A;  3HOY K;  2AJ0 A;  4LRD A;  2E2I C;  1TKX B;  4DV7 F;  2ZD1 A;  3N0C A;  4KN4 A;  1M1K T;  3VGU A;  1S1U B;  3V4G A;  5JJB A;  3JYT B;  2OEM A;  1HNV A;  3LO3 A;  3H8Y A;  2FJW A;  2DTJ A;  4OX7 A;  1NM2 A;  2FB0 A;  5RUB A;  2VDI A;  1YIJ S;  3C15 A;  4DQP A;  2HWT A;  4IG3 B;  4J9V A;  4XO0 A;  1IKW B;  1HHS A;  2UZA A;  3P3D A;  2QMW A;  5I3U B;  3ZZP A;  5DG8 A;  5B0F A;  4Z7Y A;  2KDO A;  5HVG A;  2BE2 B;  1NZ8 A;  4CLK A;  4UZB A;  5CZV A;  3KK3 B;  4O3P A;  2M8D B;  4DF8 A;  2W2M P;  5CYM A;  3DI6 B;  2DNO A;  1V3Z A;  2NVY C;  5ETQ A;  2XSJ A;  5A6P A;  4Y00 A;  3W2V A;  2GQC A;  2GA7 A;  2HMI A;  5IP9 K;  4DXL A;  2A6O A;  1ISE A;  4XSX A;  2DNR A;  1F2G A;  3NXZ A;  4LFA F;  5F9L A;  5I42 B;  1FF2 A;  1N32 F;  4AE5 A;  5IYC K;  1JXV A;  1JJH A;  1USO A;  1OMS A;  3R9L A;  1ZZF A;  3OR2 A;  3IM9 A;  2ACY A;  4BY1 C;  2XYG B;  2C3M A;  2XMK A;  2V34 A;  4BHQ A;  5I3Q A;  3W65 A;  1RT4 A;  3SMZ A;  4DX6 A;  3EPI A;  1WHV A;  2XHC A;  1RAB B;  3SFU A;  5BYS A;  3FSY A;  3K5M A;  2GFF A;  2OD4 A;  3OQ2 A;  2HRU A;  5E3A A;  4DV1 F;  1F5C A;  4TU7 A;  4DV5 J;  2PFD A;  4OIN A;  1SC6 A;  3CCL S;  3KJQ B;  1EET B;  1U47 A;  1C4C A;  1DUR A;  4A3D K;  4QU7 A;  3ENV A;  2R7O A;  4XDC A;  4KAI A;  4OYO A;  2DXD A;  3GTY X;  4CRJ A;  3JTN A;  1K47 A;  2XEX A;  2VQF F;  3Q24 A;  3BN7 A;  3M7V A;  5HBM A;  1BQM B;  3TJA A;  1T03 A;  1D8Z A;  2UV8 G;  3QID A;  3GG0 A;  3GTL C;  1PJ5 A;  2D74 B;  1UJ6 A;  2IA0 A;  4MEX A;  4JI2 J;  3NGU A;  1OQ3 A;  5D15 A;  3RAM A;  1DQ8 A;  4C0B A;  1T05 A;  4DSJ A;  1S9G A;  4ED8 A;  3ZTO A;  3BQ1 A;  4GFQ A;  1Y1W A;  1URN A;  4ED1 A;  4OI6 A;  1RZM A;  4RUA A;  3A12 A;  2RH6 A;  1D8Y A;  2XLJ A;  5KTQ A;  4Y34 A;  4O44 B;  2JEF A;  1WG5 A;  3CNQ P;  3NNA A;  4QOT A;  4IR1 A;  1CJV B;  5HMY A;  1VQ4 S;  2YX7 A;  4LF9 F;  1JLG B;  1HL6 A;  4K2X A;  3DGP A;  3JSR A;  1NJX A;  3MOZ A;  5IP7 C;  3BYP A;  3D0I E;  5L9N A;  4PEO A;  4WCE Q;  1T9Y A;  4F25 A;  3O5T B;  4ZVQ B;  4QWE A;  3H0G K;  2KRR A;  4KGM A;  4KRW A;  2R7Z A;  2YNF A;  5C4X C;  5CD4 A;  1RCX B;  4M63 A;  3BR9 A;  2YNH A;  3M1V B;  1ZA1 B;  2VG5 A;  4UQT A;  2WBR A;  4ZVR B;  4NLV A;  3R5D A;  1HQU B;  1SFO K;  1JLC B;  1R8B A;  2HRT A;  3R97 A;  1K83 A;  5C2C A;  1WUU A;  4DR1 F;  1KWM A;  2ZD1 B;  4JI3 F;  1WC6 A;  2J0W A;  1HNV B;  2IRX A;  5IOL A;  4KPC A;  1S9F A;  1JNR B;  2IJF A;  4JI8 J;  4Y7N C;  3LP0 A;  5KFZ A;  1Y00 A;  2JFD A;  2BKN A;  1J6X A;  3OBI A;  1Q86 T;  4BLB A;  3TRG A;  1NH7 A;  3JSM B;  1SI9 A;  1GXU A;  2RD5 C;  3IRX A;  1LNQ A;  4Y52 K;  1C1C B;  3PG9 A;  5ETR A;  2CPH A;  1FVS A;  1CBK A;  2AYE A;  1U4B A;  3AOC A;  4B3S F;  1B7F A;  1S97 A;  4GKK F;  2C2D A;  2VFT A;  3W2V B;  2ZNY A;  4DFP A;  4G7Z A;  1Z1Z A;  1VGY A;  4IRD A;  4BBY A;  4B9S A;  2CNL B;  4LR9 A;  3I4M C;  1FD8 A;  1HYS B;  3ZXW A;  3I87 A;  3FCH A;  3BPD A;  4PWW A;  4CNY A;  1N4L A;  3CPW R;  3H4D A;  3OL6 A;  1NJY A;  3D0H E;  3T5H A;  1N5S A;  3MPW A;  2IVF B;  2QRR A;  3T5K A;  4N76 A;  3A3P B;  1S4F A;  1AB8 A;  1RT4 B;  3PX4 A;  1SJ3 P;  2EG2 A;  1S6P A;  4YFN A;  1RXO B;  4GRS A;  5HAO A;  4K4W A;  2FLN A;  2FTR A;  4ICL A;  3NCP A;  1NEE A;  2WZ1 A;  2K7J A;  2HZV A;  2JA6 C;  3S1R K;  4CLP A;  2HW3 A;  3GTL K;  4A8X A;  4ZPC A;  2Z2Z A;  2V63 A;  2GIR A;  3HHD A;  4E98 A;  5C42 B;  2HLT A;  4NMX A;  3N5B A;  2LLZ A;  2NXU A;  5JVH Q;  3HOW C;  4DDQ A;  2BJD A;  4CYU A;  1OYD A;  3F44 A;  4PRF A;  3VAL A;  1CEZ A;  2AGQ A;  2HHU A;  2CPJ A;  2H51 B;  5LMU F;  3A1Y G;  4H4O A;  2GO8 A;  1FJG J;  1UA1 A;  3CJ0 A;  5T7L A;  1T03 B;  3ITH B;  2OSQ A;  2MQO A;  4Q43 A;  4C8K A;  4KV8 A;  4J5O A;  1Q8L A;  3K5O A;  3GIK A;  3LP2 B;  2Y8W A;  1J27 A;  2XNR A;  1ZZN A;  4LF8 J;  2EFQ A;  3K7R A;  1Y1V K;  2OLW A;  5EGY A;  3M6U A;  2CYY A;  1YBT A;  1I3Q A;  4ECQ A;  2PHC B;  3GEH A;  3PYE A;  2RU3 A;  2MLY A;  3BO3 A;  4HHH A;  4NWB A;  3TJ8 A;  4LF7 J;  3GTP K;  3IWL A;  2VUM A;  4FZB A;  2FJV A;  2HBQ B;  1XZP A;  4DFJ A;  5J2P A;  1HD0 A;  1MWY A;  4ZLP A;  1UVN A;  1AFI A;  4OLO A;  4PR6 A;  4YME A;  2WBM A;  4FBU A;  2KZM A;  4F02 A;  1RWO B;  2RVJ A;  2WOM A;  1KVK A;  2KHC A;  1QVF R;  1HNW F;  1NSK L;  1HPZ A;  4J9N A;  3UDV A;  3CMA S;  1I3O B;  2LXF A;  3OFH A;  4C3L A;  4GKJ J;  1AW0 A;  2B56 A;  2D3U A;  2HHS A;  4LFC F;  1IL2 A;  2YNF B;  5AJ3 J;  4OZ1 A;  3OTO J;  2GZO A;  3V6K A;  3HOX K;  4QPT A;  2IAJ A;  1RWW B;  1GFW B;  4MKA A;  2YNH B;  1OPI A;  2F63 A;  3R5B A;  4GC7 A;  2JDJ A;  1N5Y A;  3TW0 A;  1LKZ A;  5K20 B;  3DYA B;  4C3I C;  3FKI K;  5F8N A;  2RDJ A;  4I6Y A;  3MPY A;  3UDC A;  4KHM A;  4JI0 F;  3E51 A;  2QLF B;  3SQO P;  3QSY B;  3CC7 S;  4CO2 A;  5CAB A;  1CJK B;  1QUV A;  2F7V A;  4A8M P;  2B4P A;  3VCD A;  4C4W A;  2EFN A;  3RZA A;  2VFS A;  1F9N A;  3KNG A;  4B3R F;  4FN5 A;  2M3D A;  4ZMM A;  1GEH A;  2YWE A;  1RIS A;  3S15 K;  4NZ6 A;  2JC1 A;  3D6M B;  3U27 A;  1YQH A;  3I4M K;  4PCQ A;  2KT5 A;  1N33 F;  4C2M K;  4ZPD A;  3R27 A;  1ZS6 A;  3H2L A;  2M5Y A;  4LF6 J;  4A3J C;  2BAN B;  4J7C A;  3M2V A;  1R43 A;  2E66 A;  4UST A;  5FLX U;  1S0N A;  3GTO A;  4YP3 A;  1VHF A;  4M5K A;  1GXL A;  3O6Q A;  1TL4 A;  4RU9 A;  1TAQ A;  1Z2Z A;  3Q2S C;  2KXF A;  2MKJ A;  3D28 A;  4OQJ A;  1U6B A;  3KHG A;  2G2Z A;  4N77 A;  1URR A;  4ZLN A;  2OFH X;  4P5B A;  2GIQ A;  2J6S A;  2IC3 A;  1VBY A;  2ZH7 A;  2DJW A;  4A3I K;  3I6P A;  3HOV K;  3MCS A;  4F2R A;  4AQY F;  1VOM A;  2HFV A;  3JSB A;  4QYZ K;  3D5M A;  3ADA C;  4RL1 A;  1WOP A;  2UUT A;  1SC3 B;  1Q95 G;  2NPI A;  3US5 A;  3POT A;  1RLD A;  4QR0 A;  2HND B;  4ELV A;  3N0B A;  2P9C A;  3FGV A;  4OZJ A;  1VK8 A;  3CJK A;  4R5P B;  3CJT A;  4LIR A;  2E5J A;  5EX3 A;  4ICL B;  2HBY B;  3RRK A;  2K1R A;  2E5G A;  3LA0 A;  4ED3 A;  3TQE A;  4WZM A;  2KM8 B;  2MHN A;  1H0H B;  2V8V A;  9RUB A;  1RQ0 A;  3BPS P;  3DLB A;  2E7W A;  1I6H C;  1ZBS A;  1NKB A;  2BM1 A;  1R89 A;  4EWT A;  4OI1 A;  1I6V A;  4CYU B;  4QYR A;  2CAD A;  4LQ9 A;  3ELH A;  3HVT B;  2AJQ A;  3G82 A;  3ZZY A;  1RT2 B;  4H4O B;  2MDA A;  1SVD A;  2B9Y A;  4I7F A;  3QRQ A;  1FRI A;  1WHW A;  4YOE A;  5T7L B;  3DRS B;  5HJX A;  2C3U A;  2HQG A;  1BUX A;  1XTZ A;  4WXW A;  3LGH A;  5IT0 A;  2VKZ G;  4LF2 A;  1TVR A;  2AD9 A;  4RNF A;  1O2B A;  2CKW A;  1VDH A;  2AEJ A;  2NVT K;  2DHA A;  3V4I A;  3KHR A;  4NA1 A;  1U0H A;  2IJN A;  1WKJ A;  3AOA A;  1Y4Z B;  4G1P A;  1MW7 A;  1SJ1 A;  2CQ3 A;  1TWA A;  2DPJ A;  1WQG A;  4C3H C;  2O5I A;  5TMC A;  3T1Y F;  4KAT A;  3GTM C;  1FER A;  3GII A;  2IJR A;  1F5B A;  4QIF A;  5KFO A;  4CH1 A;  5B0C A;  5J2P B;  5DDR C;  1U45 A;  3KWM A;  4YHH J;  1X8D A;  4G1Q B;  4DL3 A;  3TZZ A;  4J9O A;  4GTL A;  3CUL A;  1QM9 A;  2UU9 J;  5HQL A;  2M9K A;  1R9T A;  3B78 A;  2GGP A;  4CO0 A;  4Q45 A;  3GR1 A;  1HPZ B;  3BGF A;  1OSD A;  1TL3 B;  1XMQ J;  3MPV A;  3MM5 B;  4X4O A;  2A2C A;  4X4Q A;  2UUB F;  5IYB K;  4QZV B;  2QMX A;  4ID5 A;  3CQZ K;  1IWG A;  4K4X A;  1RTD A;  4QIW L;  3KFW X;  2R93 A;  4QIW D;  4WYL A;  2H48 B;  3IR7 B;  1N5Y B;  1T9V A;  5LT5 A;  4QCL A;  2VOP A;  3CDU A;  3G8S A;  5IOS A;  2QSF A;  1MMD A;  2DGT A;  1AT1 B;  1DBD A;  1LW0 A;  2MZR A;  5CYQ A;  2XY6 A;  1FTR A;  2B51 A;  5K8M A;  4RW6 A;  3M6X A;  4P73 A;  2EC0 A;  3WOD A;  4DSE A;  2DR9 A;  3LAM A;  1LWF A;  1Y5I B;  2KXH A;  3KK1 A;  1HQ2 A;  2B8Q A;  2QGF B;  3SBM A;  3MM9 A;  5CXT A;  3EQL A;  3G8Q A;  4L3K A;  4TQR A;  4WJB A;  1TWF A;  2W9B B;  1B0V A;  1YJ9 S;  4IOA Q;  4L76 A;  3N01 A;  1QAI A;  2IM3 A;  3WX8 A;  5C5J A;  5F8H A;  3GLJ A;  3CJ4 A;  3S1Q C;  1EKS A;  4QJV A;  4I67 A;  4DL4 A;  2W01 A;  3RU0 A;  2OI2 A;  4ENO A;  1WOS A;  1QLN A;  4KGX B;  3MCM A;  4DL7 A;  4CTA A;  1IKV B;  3MUV P;  3OVB A;  1DQA A;  2XCR B;  5C44 K;  4GO5 X;  3BSO A;  4LUB A;  5AE3 A;  1Q0N A;  2IC3 B;  1NXI A;  1Q7Y T;  2ERR A;  2R92 A;  2MZ1 A;  3PM9 A;  5E3R A;  3VVT A;  4LF4 J;  1X31 C;  1X7V A;  5H1S V;  1LFP A;  3HT3 A;  4NXN F;  2R7V A;  1O0P A;  3HVA A;  3L7P A;  2OML A;  4BBS K;  3SSS A;  2QE5 A;  3QLH A;  4YDD B;  4URQ U;  1IM6 A;  2CQ1 A;  2AIR B;  2CVI A;  1ZM3 A;  2ATC B;  4LJM A;  1LV5 A;  4DV6 J;  4CO1 A;  3D67 A;  7AT1 B;  3T1H F;  3NAI A;  1XN9 A;  4R8U A;  2Y0B B;  4A3C K;  2VG6 A;  3DDK A;  4URG A;  3M8Q A;  2W4C A;  4CT8 A;  3DCA A;  2F4F A;  2M7S A;  3KUH A;  2YQ3 A;  3M9M B;  3EVW A;  3DNC A;  2HGL A;  1JB0 C;  2DH8 A;  1TZ0 A;  2BE7 D;  2DRA A;  4C3H K;  4I7F B;  1FRJ A;  2V8D A;  2UV8 A;  4P5A A;  3IA0 A;  1F2H A;  3GTM K;  3NWR A;  5IQQ A;  1KRP A;  2W2P P;  4IFV A;  4DU8 A;  3QX3 A;  1LFW A;  3OXL A;  2WVD A;  3W61 A;  1BDF A;  3UD5 A;  4O3S A;  4R0E A;  5D4D A;  4PWD A;  3MEC A;  2XMU A;  3GTQ A;  1U0H B;  3D0G E;  3M05 A;  3D54 A;  3Q83 A;  5H9F J;  3V81 A;  1HD1 A;  2Y1I A;  4IH7 A;  3D7S B;  2MQN A;  3TZX A;  3C2P A;  4A3F K;  2W1B A;  5DO2 A;  3TFH A;  2RJZ A;  2R8I A;  4A3G C;  2LMI A;  2FGO A;  2NSC A;  2BQ3 A;  3R1H A;  4NLG A;  3BBB A;  4NLS A;  1HNZ F;  4J9K A;  1SL2 A;  2V2Q A;  3TAR A;  4KAS A;  4P74 A;  1BLU A;  2BAB A;  4I2Q A;  3W8P A;  1K8A T;  3GTJ C;  3G6E S;  1BXN A;  2AGO A;  1M5K C;  1NK4 A;  2Z2L A;  3K5L A;  1FEE A;  3GIM A;  3H20 A;  3V4M A;  4FF3 A;  1Y5L B;  5TJ3 A;  2RH3 A;  1NJW A;  1WCM A;  2VKR A;  3BR8 A;  5HRO B;  1RTD B;  4L75 A;  1G4C A;  5L39 A;  2YBV A;  1ZA2 B;  1KSP A;  2ZHA A;  1H74 A;  3BBC A;  2MXY A;  3GTG K;  5LL6 d;  2BE9 B;  5CYQ B;  4TVA B;  2RDD A;  4AXI A;  2HQI A;  3V6J A;  3R3T A;  3S1N C;  2AP6 A;  3KHH A;  2A2D A;  1U2R A;  2NVX A;  2GW8 A;  3SSQ A;  4DV3 J;  4NYP A;  3HD2 A;  3MM9 B;  1TWG K;  3JTP A;  2DNH A;  4M5G A;  1WF2 A;  1VJE A;  4LVN P;  2KFN A;  2JA8 C;  2XBP A;  4WPA A;  1TWH C;  3F41 A;  4K59 A;  1S77 D;  3HK2 A;  1Y7P A;  1LOU A;  1XJW B;  3MPD A;  1C0T A;  2W7P A;  4JI7 J;  4OJH A;  4UOF A;  5GAD U;  2GJ2 A;  2KJV A;  1NK5 A;  3PRB A;  2L9W A;  5LM7 E;  2RAQ A;  3GV5 B;  3M2R B;  2DEJ A;  4BBR C;  2KI2 A;  1VRU A;  3C16 A;  3TVZ A;  4QWD A;  5KOX A;  3TUJ C;  3ILL A;  2RKI A;  2CUY A;  3GCW P;  3IRW P;  4ERD A;  3MOJ B;  1AYE A;  4WYW A;  2Z56 B;  4HDG A;  3WDO A;  3R1L A;  4N41 A;  2VIC A;  3IG1 A;  3I82 A;  4KY3 A;  3R2D J;  4C7Q A;  2KRB A;  3MED B;  1BMQ B;  1YX2 A;  3HP6 A;  2YX4 A;  3DN9 A;  2HFZ A;  1MRO A;  1S0M A;  4F04 B;  4OZ5 A;  2XM3 A;  3QLH B;  3GPA A;  1U1R A;  2VBZ A;  4KB7 A;  4IOB A;  2V6S A;  1FKP B;  5CYJ A;  4R8U B;  4Q2L A;  2F9D A;  4ECY A;  2DXE A;  3RR8 A;  3HMJ G;  3M8Q B;  4L74 A;  3FQK A;  1IM4 A;  2L9N A;  2BQR A;  5KFR A;  3O44 A;  2Z30 B;  1D9A A;  1Y10 A;  3JS9 A;  4B3O A;  4OIP A;  5E2Q A;  1U0S A;  4CLY A;  1PC4 A;  2GSN A;  4UY8 T;  3ISZ A;  3EGN A;  1OY9 A;  4F4W A;  1U02 A;  4I69 A;  4IFV B;  1KEK A;  3H7H B;  2U1A A;  3KLI A;  3FHZ A;  2BJ8 A;  1CG2 A;  4DCP B;  1EK8 A;  3MMA B;  3M9N B;  3PO2 C;  4PWD B;  1B4S A;  2C42 A;  3MEC B;  2HNZ A;  4ILD A;  4C8Z A;  2E2H K;  2V6A A;  4P6Q A;  4DZD A;  3S6E A;  2NXN A;  3GYG A;  5TMF A;  4IG0 A;  1TKT A;  4PG6 A;  2JA7 C;  5DET A;  4DCO B;  3V81 B;  1UV7 A;  1MMN A;  3OTB A;  1RT7 A;  2LU1 A;  2OSR A;  1S48 A;  1KFS A;  4U96 A;  2ZJP Q;  1XMB A;  4LBI A;  3ZTS A;  1N5Q A;  1UCN A;  1KQK A;  1W25 A;  1WC5 A;  5D8H B;  5K8N A;  5B7W A;  4KT0 C;  1RUS A;  3CGI A;  5GAD I;  4KGV B;  4HAC A;  2FLP A;  4ZJO A;  2U2F A;  2JOQ A;  4G3I A;  2YU9 A;  3W2W A;  3AHP A;  3CCE S;  4CIO A;  4LSN B;  1S1X A;  2ROG A;  4PAB A;  3CJ3 A;  5D0H A;  1X60 A;  3D9B A;  3UPF A;  3CE8 A;  1TL7 B;  4N7T A;  2DGX A;  3UD4 P;  1NPP A;  2HLU A;  4I6A A;  5CCM A;  2YKM B;  4JI8 F;  1Q81 T;  4KKO B;  3JST A;  2JA8 K;  4IOC Q;  4I4B A;  3S1M K;  2B63 K;  1TWH K;  3FRY A;  4WKY A;  5ETL A;  2EPI A;  4A8K A;  4YFK A;  3PHE A;  4NI2 B;  4C3J K;  3CCW A;  1VQY A;  1WSV A;  3NP5 A;  2R8K A;  2J8A A;  4LFB F;  4ZJQ A;  2A3J A;  4WJ4 A;  3C6T A;  4FYW B;  3GJT B;  1B64 A;  1FX4 A;  1B0T A;  1YVF A;  1XXB A;  5CQG A;  1XBW A;  4M5D A;  1R0A A;  2QIF A;  2ACM A;  1RLC L;  2B9X A;  2BJE A;  3S16 K;  3M30 B;  3DC2 A;  4I68 A;  2QZ8 A;  3CW2 C;  1H7X A;  2KFY A;  4OJG A;  1C0T B;  3D6T B;  3MAA A;  2RDI A;  2NPF A;  1CQN A;  4DUY J;  3QMQ A;  3OW2 R;  1RHU B;  1UJ4 A;  1VRU B;  4FKX A;  4RBV A;  1DCP A;  3GCX P;  2MQQ A;  4CLZ A;  3GQC A;  2IM1 A;  4ZKA A;  2ROE A;  4YY3 J;  4K4S A;  3HHL D;  3MCN A;  1RHK B;  4WE1 A;  4AXJ A;  2AEM A;  4I64 A;  3MMB B;  4WFX A;  5LOQ A;  2UVR A;  3CED A;  3RG6 A;  3UCG A;  4GT9 A;  3AJ1 A;  4PQA A;  1CQM A;  1JLE A;  2HAI A;  2CG8 A;  2W2O P;  4OI0 A;  4LIW A;  2P5M A;  3MMC B;  4PG8 A;  3R7N B;  4DX7 A;  4IRK A;  4X4S A;  1LXN A;  5KAK A;  2AQ4 A;  1RKJ A;  4MIW A;  1I50 C;  3I0R B;  3D3B J;  4DR7 F;  1FJG F;  2A6E A;  1XNQ J;  3TEH B;  4UQG A;  2Y1J A;  4DV7 J;  2OO4 A;  3KK2 A;  2CPX A;  3EZ5 A;  3M2U B;  1ZM2 A;  2W4P A;  2R2U A;  1O2A A;  3HFK A;  4RO0 A;  3DXJ A;  2WK4 A;  2LQB A;  4ALZ A;  5L46 A;  2RQC A;  3PO2 K;  2CPZ A;  4OIX A;  3S1T A;  4LQY A;  3ZFV A;  4WFZ A;  3ZZT A;  5DQH A;  5L1L A;  3GDZ A;  1JX4 A;  2BRL A;  4NXM J;  2CG4 A;  4J3N A;  2GX8 A;  4LF7 F;  4F0H A;  2HS4 A;  3SZ2 A;  5DDP C;  2YKO A;  1QTN B;  1FWP A;  2FZK B;  4ED0 A;  3KLI B;  1J6V A;  2R4F A;  3AB2 B;  4TLQ A;  4IDK B;  4OJ1 A;  1OSC A;  4M5H A;  3GON A;  5J2Q A;  1PKU A;  1TKT B;  3W3S A;  4KO0 B;  4GKJ F;  1KOH A;  2XO7 A;  4I56 A;  3O8W A;  4TU8 A;  1RJJ A;  3W8G A;  3VGV A;  1TWC A;  3OTO F;  3B8H A;  1HWI A;  3GIL A;  3FEX B;  3QIP A;  2JWN A;  4KC6 A;  4O23 A;  3UO0 A;  3L09 A;  1IUJ A;  2BBE A;  2LEP A;  4PWU A;  5HI7 A;  3W7B A;  2VDH A;  5GAE U;  1WNE A;  2Z58 B;  4HAC B;  1L3S A;  2B8P A;  1VQ9 S;  4ZP7 A;  3W2W B;  2EK1 A;  2PDA A;  3BQ0 A;  1YIT S;  1S1X B;  3PW4 A;  2H5E A;  3C14 B;  4L3N A;  5H9E K;  4RW4 A;  1WWH A;  3S0X A;  2BW2 A;  3IPJ A;  2X7I A;  1I51 B;  2R8H A;  4OHY A;  1QD1 A;  1SKR A;  2YKQ A;  2XMT A;  2CZ4 A;  5KFX A;  3BP3 A;  1I5O B;  4DV0 J;  4QW9 A;  4ED4 A;  2HZA A;  1IE0 A;  4DOZ A;  3MTK A;  3BH6 B;  3FZB A;  5LJ5 Y;  2PFF B;  2HIY A;  2WRM A;  3CWJ A;  2YPZ A;  1EIY B;  2L08 A;  4LF6 F;  1RWK B;  4GVB B;  1RP5 A;  2QL5 B;  4DJB A;  1G7C B;  2VJU A;  4UOC A;  3CC4 S;  1S10 A;  2J9C A;  3HSG A;  2A69 A;  4TKT A;  5L1I A;  1YZ7 A;  2POK A;  3P8B B;  4M5D B;  3EVO A;  1R0A B;  1REV B;  3ZZZ A;  3N4W A;  3A8I A;  3BSN A;  5DGB A;  1TL1 A;  3R5C A;  3J80 Y;  2DIT A;  1UWB A;  4UUX A;  2M0G B;  5A8R B;  2BAC A;  4CLF A;  3OEP A;  4FYD A;  5L8R C;  1S6Q A;  1HBU A;  3QT5 A;  1KON A;  1J5O A;  2FJD B;  1BWE A;  4TY8 A;  1B99 A;  4X4T A;  4G0W A;  4LF9 J;  5EN1 A;  3RB3 A;  4YR3 A;  2MQL A;  3N5F A;  2AYB A;  3UI3 A;  3DRR A;  1ZAW A;  3K89 A;  1AZS A;  2YX1 A;  2LFV A;  2P9G A;  5DGA A;  3GTK C;  2QA2 A;  2CWK A;  4CO4 A;  1Y0H A;  4FDF A;  1JLE B;  3V6D B;  3LPX A;  3NGS A;  4ZH4 A;  4K8R A;  1GNK A;  3VTI A;  1T3N A;  3HFV A;  2BA9 A;  3ILJ A;  3VGT A;  4X4P A;  2XCO A;  3IAS 9;  4Y2C A;  4A8Y A;  2LDY A;  3OR1 B;  1ZYR A;  4USU A;  4OZ2 A;  3ERE D;  2Z57 B;  5ETP A;  1RAG B;  3GB0 A;  3KHL A;  1WC4 A;  1G3O A;  2G4B A;  2IIH A;  3Q0A A;  5IC6 B;  5E5N A;  3MM8 B;  3K58 A;  1F60 B;  2DO0 A;  3W5Y A;  2ASD A;  4JI3 J;  2C3Y A;  4ZLJ A;  5GAE I;  4U7U D;  4LBH A;  3IP0 A;  5B0D A;  3F56 A;  2EXU A;  3MFI A;  2H1Y A;  4C8M A;  6FDR A;  2NXJ A;  2YNG A;  4GO7 X;  3TA1 A;  1ZPW X;  3G4C A;  3RZO K;  1QJH A;  1H38 A;  2OKQ A;  3C8Y A;  3BH7 B;  1FRH A;  1YRX A;  3A8E A;  3KUG A;  4ELU A;  2HHW A;  4H4M A;  2AZ1 A;  4X6A C;  1UWA A;  3OXF A;  4B3S J;  1AUS L;  2PSZ A;  4YHH F;  4WIL A;  4M5I A;  2KJW A;  3NY0 A;  4ES3 A;  1SKW A;  3BSA A;  4RLE A;  3RZD K;  1DCO A;  2VQE J;  2ZZN A;  5J2Q B;  4P7V A;  4ZS6 A;  1HR0 F;  4DQQ A;  2X1G A;  1NJI T;  1IKX B;  2FPH X;  2R7R A;  4LSL B;  5JFE A;  4HI2 A;  4ZVF A;  3QIP B;  3CCZ A;  4NCA A;  1K9M T;  4RWX A;  5IV3 A;  4UT4 A;  5LMN F;  1U2C A;  2IVM A;  4JV1 A;  4RKU C;  3K59 A;  3DM2 A;  1O51 A;  4X4R A;  4USJ C;  5HQM A;  4B9V A;  2AWZ A;  4NRU A;  3NCR A;  1VMB A;  2E1C A;  1DRZ A;  2R7S A;  2R7Q A;  2C28 A;  4QWA A;  2Q6B A;  1U25 A;  3ET6 A;  1CUL B;  2GJI A;  3QPI A;  3DXS X;  4TY9 A;  3DRP B;  1JJ2 R;  5LSR A;  4ILL A;  1AFJ A;  4C0O C;  1SIW B;  2DRD A;  3N0V A;  3OVA A;  2DGO A;  4ES2 A;  3OFG A;  2ZH2 A;  2OEL A;  5FDL A;  5AXL A;  3MR2 A;  1KKH A;  4HH0 A;  4KH0 B;  3K7A K;  1K1S A;  3Q8Q B;  2UUA J;  4PUO B;  3K5P A;  5ITH A;  2OGU A;  2CQD A;  1YJV A;  4M5N A;  2FUG 9;  2E5H A;  1L3K A;  3AQP A;  3KDN A;  2XC9 A;  4MMO A;  1TL1 B;  1T94 A;  1UWB B;  1N6Q A;  5C4J C;  4KTQ A;  4BC9 A;  1SV5 B;  3CCT A;  4LF4 F;  3QO9 A;  3BGO P;  5IQ6 A;  2KHD A;  1GH8 A;  1S6Q B;  4C11 A;  2RF2 A;  4ZPB A;  1Y1W K;  1WI8 A;  4OMF G;  5LSL A;  4LRC A;  2VG7 A;  4P72 A;  1UMJ A;  2NS1 B;  3MWB A;  4TQS A;  2JZ5 A;  2FD2 A;  1LWX A;  2UXD F;  4USI A;  1W2B R;  3THP A;  5L38 A;  1Q8I A;  2BRK A;  1FFS B;  4WFN Q;  1AZS B;  3A13 A;  4X2B A;  4Q8E A;  4DV6 F;  1N0V C;  2FVC A;  1N8R T;  3E3X A;  3DLH A;  2ZH8 A;  3BQ2 A;  2K3I A;  3MGJ A;  2E2I A;  2MY7 A;  3B82 A;  4LFC J;  1K44 A;  4P75 A;  4DR2 J;  2K2P A;  3PKY A;  4IO1 A;  2R7Z K;  1T3O A;  2C2R A;  4ED7 A;  3LPE A;  1UVJ A;  1GMV A;  5FLM C;  2JLF A;  3HOZ K;  4WF9 Q;  4JI0 J;  4K4T A;  3G87 A;  3MPU B;  1O28 A;  4B3M F;  3DLE A;  4WFB Q;  2C2M B;  5IT9 Y;  4RMF A;  2MB0 B;  3JTO A;  5KFY A;  5KG2 A;  4A3L C;  3PRV A;  4A46 A;  4X6A K;  1K83 K;  3PV8 A;  3BF4 A;  4B3R J;  3LW5 C;  2CNK B;  2NVY A;  2QTW A;  3E2E A;  4HT5 A;  3NOG A;  8RUC A;  3FCW A;  1YDL A;  4F4A A;  4JV2 A;  3VAM A;  2HHP A;  2XMA A;  2R9L A;  4CM2 A;  4Q4Z A;  4JI1 J;  1TFY A;  4DV4 J;  4DLE A;  5IYD K;  2FGC A;  2LP4 A;  3GR0 A;  1KQS R;  2Y0S D;  3IS9 B;  3FKB A;  2WSE C;  1UVK A;  3I5C A;  3S17 C;  1VGX A;  2P2C B;  3GFH A;  3DOK A;  1S72 S;  5AXM A;  2E2J C;  2GQQ A;  2N4D A;  4NLO A;  3QZ7 A;  1VIO A;  4HKQ A;  3K2Y A;  2GSU A;  3MEG A;  2HQF A;  3W1Y C;  2FVR A;  3KG0 A;  5B09 A;  5CD4 H;  1A7G E;  4LQ3 A;  4KMA A;  2UXB J;  1DAR A;  2D9P A;  3ZZ0 A;  1Q78 A;  3SEO A;  3D1O A;  3ZNJ 1;  2A1B A;  3H5U A;  2JA5 C;  1V3R A;  2WSF C;  3PRD A;  1U1K A;  3VAI A;  3KNA A;  5F8L A;  1RAD B;  3V6H A;  3DM2 B;  3BSC A;  2G0C A;  1ZVU A;  1DTQ A;  3W9I A;  1YJW S;  4KHP J;  1FTC A;  5A2Q U;  4AH6 A;  4ZP8 A;  2C2N A;  2GV1 A;  4X84 A;  1EAR A;  3Q2T C;  2CNO B;  5L9X A;  4DV3 F;  5FLX Y;  3K8W A;  3GTL A;  3ET6 B;  3DOM A;  3S14 C;  3JQK A;  5FII A;  2IRU A;  3RR7 A;  1WHX A;  2F8E X;  4W4M A;  1K73 T;  1W26 A;  2Y1R I;  2N82 B;  5A0Y A;  2H3E B;  4FXD A;  3GFX A;  4ZIW A;  2ZBC A;  4JI7 F;  4DR4 J;  1JJ4 A;  1D9D A;  5F41 A;  3QNW B;  2BJ1 A;  3WBZ A;  4Y28 C;  3UFC X;  1R27 B;  3MEE B;  1GX6 A;  4KIA A;  2VL1 A;  2CJ9 A;  4FP9 A;  4O2D A;  2XLI A;  3S8S A;  4KGK A;  1FKA F;  3JAM U;  1RHR B;  3EUN A;  3IBW A;  4DN9 A;  4LK0 A;  3OD2 A;  3PZP A;  3CO9 A;  2E1A A;  3RGI A;  2A68 A;  2CZV C;  5LJ3 Y;  1I3Q K;  1JLQ B;  5E3C A;  5EHH A;  3QO9 B;  1T9X A;  2FQT A;  4C11 B;  2RF2 B;  1H7W A;  1UPP A;  2OTJ S;  3CCM S;  4ATN A;  3M8Z A;  5EGE A;  2VUM K;  2CJQ A;  1VC0 A;  1DFD A;  2BXJ A;  4OHW A;  5IS2 A;  5A6W A;  4KBI A;  2RS2 A;  4PXD A;  3NGR A;  3D3C J;  1TKZ B;  1HBO A;  3CME S;  2DVI A;  2BE5 A;  4OYW A;  1TKX A;  5DJB A;  4AND A;  5KFP A;  1GX5 A;  4MYU A;  5AXK A;  3UN2 A;  4FPR A;  4PPD A;  3GWC A;  1S1U A;  3JYT A;  4ER8 A;  3AD7 C;  2XY5 A;  3L4K A;  1FVQ A;  4ZP6 A;  1NK0 A;  4IG3 A;  4IQX A;  3UCU P;  2ZWO A;  1KC8 T;  4USK A;  1EFW A;  1PGZ A;  2BE2 A;  4OFZ A;  1PSD A;  1YBU A;  1TUW A;  1R3N A;  2I9S A;  2HZC A;  3KK3 A;  2NYI A;  2E5I A;  2I2Y A;  4HT7 A;  3S17 K;  3DI6 A;  4GMK A;  3BO2 A;  2B5J B;  4FXV A;  1SBR A;  1S0O A;  1Y3J A;  3I56 S;  5KFK A;  2E2J K;  3UR3 C;  4I1T A;  1P9Q C;  2JL9 A;  3CDB A;  2AT1 B;  3CJ5 A;  4W90 B;  4MIA A;  3QJL A;  2D41 A;  2WVE A;  3TO8 A;  1KVI A;  3N6L A;  1IBM J;  5I42 A;  4LR2 A;  4F8R A;  5L1J A;  2ADB A;  2OMO A;  1WOO A;  3DOK B;  2JA5 K;  1PAU B;  2ILZ A;  2HHQ A;  3CDE A;  3P6Y C;  2O5D A;  3GTO K;  1IBK J;  3OTE A;  4QWB A;  5IP9 C;  2DNY A;  1WG4 A;  3BV8 A;  3QGG A;  2HHX A;  3KG4 A;  1T9T A;  3OV7 A;  1IJF B;  3THT A;  3PJ9 A;  3OFE A;  3G6X A;  4NA2 A;  1SIZ A;  5IYC C;  2JA6 A;  1S7I A;  1RYR A;  2NLW A;  2IVY A;  2DNM A;  3Q8P B;  4NXN J;  1N5T A;  1FT8 A;  3NGK A;  3NL0 A;  3S14 K;  4LRE A;  1U1L A;  3EE3 A;  1WQF A;  3CD5 A;  2VA3 A;  5DRK A;  1SQE A;  4C0H A;  5GAH U;  3VZI A;  3HSD A;  1OPZ A;  4ECV A;  1NK8 A;  4U8V A;  4NLQ A;  2O1P A;  5IC4 B;  3ONQ A;  1BQM A;  3I32 A;  5E41 A;  4FVC A;  2JC0 A;  3T1H J;  3U1N A;  2HGM A;  1IR1 A;  3MUT P;  3EPG A;  4J9P A;  1PC5 A;  4BY7 K;  3KKF A;  4C8O A;  5ETT A;  4LVO P;  1S1V B;  2NYH A;  2CAJ A;  4HHU A;  1Y11 A;  3DMJ B;  1FJE B;  1NAQ A;  2H5J B;  5BXI A;  3A8J A;  2AJ2 A;  2IBK A;  1XR6 A;  3EZO A;  3AB4 B;  2HK3 A;  3SV4 A;  2MQM A;  3OTD A;  1R0C B;  1TKD A;  3F0N A;  4ZVO B;  4CT9 A;  1VK3 A;  2J8S A;  3D2W A;  3THV A;  1CJV A;  8ATC B;  2HEK A;  3LOU A;  5KFI A;  4YY3 F;  1K1Q A;  4DEZ A;  1N34 F;  2XMJ A;  4CLS A;  2CDQ A;  3LTO A;  1WC1 A;  3WHI A;  3GSI A;  2V2K A;  1RWX B;  4RNO A;  1O26 A;  2N7Y A;  1F9H A;  1IQZ A;  3K8V A;  1M5P C;  3TFI A;  3TJ9 A;  2FVQ A;  2YY3 A;  1TWA K;  5B0E A;  3JB9 k;  2F4V F;  1A9N B;  2KG1 A;  3M1V A;  2XCQ A;  1D09 B;  1FXR A;  3DDN A;  2QN6 B;  1YTY A;  3MDF A;  2DBB A;  1HNZ J;  3OJU A;  2M70 A;  5CAA A;  2LYV A;  4AYB L;  1HQU A;  2KVI A;  1XNQ F;  1HBO B;  3W64 A;  4ETX A;  3M4X A;  1HBM A;  1JLC A;  4FYX B;  5K9F A;  3L4B C;  2HWH A;  3BZQ A;  2R2S A;  1YNN A;  3KJV B;  2ASJ A;  3H0G C;  3TAN A;  1R9T K;  4CH7 A;  2ZFH A;  2QLJ B;  1NDK A;  3TA2 A;  1ZYQ A;  4IO9 Q;  3QFW A;  3FBF A;  4D3G A;  4MKB A;  2O67 A;  4NXM F;  1EQ0 A;  2VH7 A;  4A93 K;  2Y1L B;  1SFO C;  4QIV A;  4MKY A;  3JSM A;  2R93 K;  4KJI A;  5KFL A;  2HYI B;  1U7L A;  4F0M A;  1C1C A;  4X64 J;  2A18 A;  2DGV A;  3KJF B;  1YI2 S;  5GAH I;  3BGL A;  3EZU A;  5MLC V;  2XGQ A;  5KG4 A;  4NL5 A;  3ILI A;  4UUW A;  3TFJ A;  1RTH A;  2AV5 A;  4ZVH A;  3M4O C;  1HYS A;  5ADZ A;  1TWF K;  3QQC D;  1NZA A;  1FD2 A;  4Y52 C;  3ZZR A;  2W9A A;  3TI0 A;  2XYH B;  3SCI E;  1E6Y B;  1JNZ B;  3PO3 K;  2E29 A;  1ZTT A;  3GYN A;  2LQ9 A;  3FBE A;  2V6T A;  4MK8 A;  4U67 Q;  1NB2 A;  3FNN A;  3PFO A;  2V2Z A;  4E8U A;  3DDI A;  4CM0 A;  2WW4 A;  1Q5V A;  3T00 A;  1RT5 A;  4O4G A;  2Z2Y B;  1U1N A;  2MKC A;  1X9M A;  2V4R A;  4TU9 A;  1LK5 A;  2EI5 A;  2CFA B;  2QLX A;  3OLB A;  1NKC A;  3G86 A;  1LW2 B;  3NBP A;  2W7A A;  2DIV A;  2OEK A;  4DG1 B;  2R92 K;  4F2S A;  3K57 A;  4NLT A;  5C42 A;  2ZVI A;  2J0Q D;  3HOU K;  2DH7 A;  2M8H A;  1H73 A;  1WKK A;  4XSZ A;  4FS1 A;  3KYL A;  4DV0 F;  3ZNU A;  4NML A;  5KFQ A;  4A8S A;  3HX9 A;  5CJ9 A;  3S2H K;  1HFE L;  2PPB A;  2FHK A;  1YKW A;  2MSS A;  1RT3 B;  1HNI B;  3S1R C;  3ITH A;  3M8S A;  1YJN S;  2Q66 A;  1JQG A;  3LP2 A;  4K4U A;  4ED5 A;  4JV0 A;  2Z0G A;  3HHL C;  2DNN A;  2HKE A;  3DU6 A;  2CPI A;  2X1F A;  2VV5 A;  4OV6 A;  4YUD A;  3CAG A;  1WEZ A;  2VOO A;  1RT1 B;  1J5E F;  1UZH A;  2HHH J;  4CH0 S;  3DRX A;  4Z7C A;  1NPK A;  2K7K A;  4JI6 F;  1ZOT A;  1RDR A;  1KQG B;  1JIH A;  4XIU A;  3GTM A;  5KT6 A;  2VPZ B;  3OL7 A;  1F1B B;  5KOW A;  2NXC A;  4DV2 F;  4S0M A;  1Y1V C;  5CCL A;  2FIU A;  2HVE A;  2FLO A;  3EWG A;  2V4J A;  4WK1 A;  2E1R A;  3HD1 A;  3VVU A;  4XPC A;  4GTD A;  3Q3Q A;  3TTG A;  3GTQ K;  3GTP C;  1DD5 A;  4Q7A A;  1UW9 A;  4IR9 A;  2LXI A;  3E01 B;  4KMH A;  1VCT A;  5KT3 A;  2HNY B;  2V9K A;  3JSY A;  3NNH A;  3QYY A;  4CO3 A;  3DYA A;  1XEZ A;  4OHV A;  2JEI A;  4AL7 A;  2N3L A;  5E0O A;  7FD1 A;  4HL9 A;  1HBM B;  8AT1 B;  2DNQ A;  1HHQ A;  1BQN B;  1YJT A;  3QWP A;  3HUL A;  1CJK A;  2P6T A;  1GK8 A;  4WII A;  3BJY A;  2Q6C A;  5K14 A;  2PI4 A;  2GVD B;  2C1E B;  3PIO Q;  2XNQ A;  3HOX C;  3NCQ A;  2JVO A;  2WVC A;  4C3M A;  1SH2 A;  2QC3 A;  4L6V 3;  1LWE B;  5DQG A;  2VA2 A;  1INN A;  4ECS A;  3CD7 A;  1L3T A;  3RW6 A;  3FBB A;  3C6U B;  1FA0 A;  2NUU G;  2W9C B;  3PW2 A;  1WEY A;  3M4O K;  3LWL A;  1HHT P;  4G65 A;  1FK9 B;  3PX0 A;  4EZ9 A;  4MK7 A;  3FKI C;  1HWJ A;  1WCM K;  3PR4 A;  3HDS A;  1MU2 B;  2V67 A;  4LFB J;  1HQE B;  2BAN A;  3GV7 B;  4G1I A;  4R25 A;  2WB4 A;  1WEX A;  2EBE A;  1SH0 A;  4CLU A;  3NMR A;  1OYE A;  2GHP A;  2OPR A;  1EKR A;  3TAM B;  4DUT A;  3S15 C;  4WP9 A;  2APO A;  3IBC B;  1MSW D;  2VQE F;  3EGV A;  1RTH B;  1R8A A;  4OI3 A;  3UN5 A;  2P5V A;  4C2M C;  2BMB A;  2NR0 A;  1ZBT A;  3GSD A;  4MK9 A;  1S7H A;  2WHO A;  5KG6 A;  3MM6 B;  3UNG C;  1NB7 A;  1YRU A;  5HLF B;  1S6O A;  3NEK A;  3IXQ A;  3TAQ A;  4WTY A;  3ZO7 A;  1TQL A;  2GS8 A;  5E7O B;  2HND A;  2V4Q A;  4LK1 A;  4WXO A;  4R5P A;  2UP1 A;  2BQU A;  1NDP A;  3D6H B;  5F9N A;  3J7Z 5;  1IW7 A;  1RT5 B;  1NME B;  4O4G B;  4A3I C;  2JHE A;  1UFK A;  4NLY A;  3SZZ A;  3HOV C;  4TN2 A;  3MR6 A;  4X4N A;  3T3F A;  2B6A A;  2YKP A;  3NBP B;  1DHM A;  4OIR A;  3C3L A;  2ZIT A;  1S1W B;  2RS8 A;  4U6P A;  4FF1 A;  3BEG B;  2FYX A;  1SPB P;  2DEI A;  3PYG A;  1N0U A;  3HVT A;  2YVS A;  2ZUG A;  2WON B;  4RNH A;  3M8W A;  1RT2 A;  3LF0 A;  1IQ0 A;  5LSO A;  4DR7 J;  4B02 A;  5F3T A;  2GAG C;  3I4H X;  3CIZ A;  1HMV B;  3DRS A;  2UUA F;  4WJ3 M;  4QU6 A;  2XMV A;  1OIA A;  4OL8 A;  5CHP A;  1BWV A;  2DHG A;  1V9O A;  4YB1 P;  2F8M A;  2ASL A;  3GMG A;  1YHQ S;  1SQG A;  2EFG A;  4DWI A;  3IBF B;  1S4E A;  3DKD A;  3T9N A;  3T5J A;  2VBW A;  1IQT A;  2WSC C;  2OJ3 A;  3H59 A;  3AOB A;  1GTH A;  4H4K C;  2V69 A;  2PE8 A;  2ZBQ A;  5IFM A;  4MJK A;  2CDR B;  5KT4 A;  4G1Q A;  4ZHR B;  3FOE A;  2NVT C;  1RTJ A;  1WJ9 A;  1WF1 A;  2CQ0 A;  2WW8 A;  1OQ6 A;  3R7B B;  2V4J B;  3LQV A;  2G2O A;  1NK6 A;  2ZEJ A;  5C25 B;  2CIM A;  5IXU A;  3H5X A;  5D0E A;  4FNH A;  3MMJ A;  1TL3 A;  2KL8 A;  4DR2 F;  1VLY A;  2ROP A;  3MM5 A;  3GTJ A;  2RRN A;  1VBX A;  3S2D K;  3NS6 A;  2O5J A;  5A8K A;  2EBB A;  3KTQ A;  5KFE A;  1LQ9 A;  4JI4 F;  1XWL A;  5M3F K;  3PY8 A;  2ZUE A;  5A8W A;  4ED6 A;  5ETN A;  2EFP A;  4F4Y A;  2E9T A;  2NZC A;  4A3M K;  2K8G A;  4UOG A;  3M32 A;  3MXH P;  2CJX B;  3KLF A;  3RYL A;  3X3U A;  2GNK A;  2YU9 K;  5K14 B;  1X9S A;  2B7C B;  1S49 A;  4PXC A;  4HDH A;  2ZH6 A;  5IYB C;  2G13 A;  1GAO A;  2W9B A;  3CQZ C;  1XR5 A;  4CLT A;  1FKO A;  1FWL A;  3WIU A;  1VYA A;  3H3V L;  3SCK E;  4JI1 F;  4DV4 F;  1TWH A;  5D6G A;  1SB6 A;  2V8G A;  2GHV C;  1VJW A;  2GAH C;  2QA4 S;  3UWT A;  3M6V A;  1KP6 A;  4N8O A;  5HMW A;  3BKF A;  2ZOG A;  4M5M A;  2VIH A;  4DU7 A;  1C0U A;  4K7Q A;  1IKV A;  4EO6 A;  2BJ3 A;  1O2F B;  2OPR B;  1VQ7 S;  5J1N A;  3FUY A;  1CLF A;  1QAJ A;  3G9C A;  5JXS A;  3G6V A;  4RW7 B;  3S01 A;  4P2S A;  4DBQ A;  4RJV A;  2XY7 A;  2R42 A;  2UXB F;  5F0U A;  2WTF A;  2FLL A;  2WAQ L;  5B0B A;  4HTJ A;  2HHV A;  3KOA A;  1X4G A;  4DSF A;  3K5N A;  3P5T L;  3N3Y A;  3HF5 A;  3CCQ S;  3OT9 A;  3DLG A;  3U7J A;  2BX6 A;  5C44 C;  1DQ9 A;  1T8E A;  4KHP F;  1S5Z A;  3SSR A;  4NAS A;  2UXC F;  2LQJ A;  4FF2 A;  3LAL A;  2ALZ A;  1C4A A;  4ZA1 A;  3VV2 B;  2B6A B;  3T1A A;  4U7C A;  3H2V E;  4A3B C;  3FC9 A;  1XXA A;  1RAJ A;  2QT7 A;  1F7V A;  1FDN A;  5J2N A;  2CQI A;  4BBS C;  5F8G A;  2YH1 A;  2GJF A;  1VQP S;  1Q4R A;  1FJ7 A;  3MZI A;  3VF0 B;  4DR4 F;  3P5B P;  2M88 A;  1KQ4 A;  1KLM A;  3GIR A;  2QFI A;  4ZPA A;  4M1K A;  4A3C C;  4Y65 A;  2VU5 A;  1QSS A;  5HMZ A;  1D9F A;  2B9W A;  2VFU A;  4KDD A;  2EK6 A;  3CC2 S;  3BB5 A;  1HNX F;  5KFV A;  1JLA A;  1KD1 T;  2DCL A;  3PYD A;  2DCU B;  2W24 A;  1HBN B;  2ALY B;  3NGT A;  2JA7 A;  4KC5 A;  2YTC A;  4U7U K;  3HO1 A;  4FZV A;  4ZPW R;  4NZ0 A;  4QQB A;  3KUE A;  1D0E A;  4JV5 J;  4RNM A;  2HFU A;  3A3N B;  3Q89 A;  2FHO B;  2KO1 A;  1X9W A;  2CQH A;  2G2Y A;  3Q8R B;  2HBZ B;  1RTJ B;  1O27 A;  2IYG A;  2YWW A;  2PI5 A;  1T95 A;  1KDN A;  3AJD A;  3SZY A;  1HR0 J;  3PX6 A;  3SCL E;  2EW9 A;  1XR7 A;  1RCO B;  4G7H A;  3C66 A;  1VQ8 S;  5BR8 J;  3BKT A;  1RKI A;  3JQM A;  4NLD A;  4KAR A;  3IWN C;  5KFA A;  4A3F C;  2BKP A;  1FES A;  4Y2I A;  3Q8Y A;  1RBA A;  3GIJ A;  3O2I A;  4MTP A;  4RU2 A;  4H54 A;  1WEL A;  1TWC K;  2WCX A;  4NEZ A;  5A8K B;  1NBE B;  5CH7 B;  2H54 B;  5HRO A;  4NA3 A;  5LMN J;  1S99 A;  4P52 A;  1X4B A;  3UNY A;  3RUB L;  5I4M A;  4JB8 B;  1Q5Y A;  3R2C J;  1FEH A;  3RBX A;  4DR5 F;  3OPF A;  1UZD A;  5A8W B;  3DGV A;  5KG0 A;  1KHW A;  3SQG A;  1NSP A;  4HI1 A;  5KFT A;  1APS A;  4I0W A;  3M32 B;  1UVM A;  3KLF B;  5KFD A;  1ZET A;  5HL7 Q;  4A3E K;  2J0S D;  5JMN A;  3SFG A;  1BD6 A;  2OPQ A;  1IBC B;  1FKO B;  1FI4 A;  3EM1 A;  1ULR A;  4HHJ A;  2ZH1 A;  1FCA A;  3GTG C;  1IBM F;  5M3M K;  4KB4 A;  1BC6 A;  2GC8 A;  1N56 A;  4DHV A;  4ZN3 A;  1R7I A;  4RBT A;  2RIL A;  2DKO B;  3RB4 A;  3W60 A;  2OD6 A;  2FVP A;  3M2R A;  4U9R A;  4KGZ B;  1P6T A;  1C0U B;  2H9Z A;  1TWG C;  4LSZ B;  1IBK F;  3EX7 B;  2OEJ A;  1PJ7 A;  2FHM A;  3B4M A;  1SJQ A;  3U1M A;  3QJJ A;  5JUM A;  3NAH A;  3BGR B;  3GG1 A;  2CWX A;  3N9U C;  3PJW A;  4ZCL A;  3V5R A;  2VPY B;  4X66 J;  3NRB A;  1RWU A;  4A3B K;  3TR5 A;  3VHQ A;  3MUM P;  3MED A;  4HYK A;  3OLA A;  1EB0 A;  3QT6 A;  2V6U A;  4A48 A;  1PBA A;  2KB2 A;  4GTF A;  1TAU A;  2UXD J;  4FKY A;  2J76 E;  3DLG B;  3J7A N;  4U8Y A;  3GU0 A;  5LXY A;  1I50 A;  1TUV A;  4PG4 A;  1JLF B;  1HWU A;  3RJM B;  4DSK A;  4BCA A;  4NCB A;  2R7W A;  1FKP A;  1EH1 A;  4KMD A;  2CW0 A;  2KU7 A;  1L3U A;  1NU4 A;  4Q5V A;  1W7W A;  1PIE A;  3J7A 1;  2Y3Y A;  2HS0 A;  3HKZ L;  3HKZ D;  2OFG X;  1DCH A;  1KR4 A;  1C0A A;  1P1T A;  1Q1K A;  1WIH A;  3FVY A;  5J2N B;  3UR0 A;  1ZXO A;  3OSP A;  4EK2 A;  2QYC A;  1SKS A;  3FEZ A;  4OI2 A;  1LEO A;  1RU1 A;  2AYG A;  4DI6 A;  1SC1 B;  2DGW A;  1KLM B;  2FY8 A;  3I4N K;  5EDW A;  3R7S B;  2Z8Q A;  2QX0 A;  4B3M J;  4BXX K;  2WB1 L;  2WB1 D;  2PA8 L;  4G0U A;  1KHV A;  1P27 B;  1CSJ A;  1QDU B;  3MMA A;  3QJP A;  2BKO A;  3KLH B;  3ILO A;  1QAY A;  3ISN C;  1JLA B;  1BHN A;  3SDE B;  5F0W A;  3EJM A;  2EC2 A;  4ID8 A;  2R7U A;  1BQX A;  1FRX A;  1ZAV A;  1X4F A;  3TAP A;  3OUY A;  3CF5 Q;  1TU0 B;  4LLG A;  2FQO A;  4HR2 A;  2D3O 1;  2E2H C;  2IY5 B;  4DR6 J;  2ZNZ A;  2RML A;  2VON A;  2MKK A;  3RB6 A;  1RHQ B;  4F4K A;  4FYV B;  4MEY A;  4DS5 A;  3ENA A;  4MIB A;  3ETO A;  4LSN A;  5K8O A;  3T19 A;  4Q0B A;  1M1H A;  3H42 A;  2ZJQ Q;  5MAO A;  4XAK A;  1TL7 A;  2ABY A;  4ECU A;  1U26 A;  2PEB A;  2DY1 A;  1X0F A;  4DQS A;  4I2P B;  4F3Q A;  2YKM A;  4KKO A;  1NH8 A;  1X4H A;  5GMK a;  4NCG A;  4F4Z A;  2ZUA A;  4RZR A;  2IHR 1;  3UN3 A;  1RTI A;  4NI2 A;  4JUZ A;  2DIS A;  4NRT A;  3BN4 A;  2RRB A;  1NO8 A;  2I8E A;  4X64 F;  3SQG B;  3I31 A;  5D3G B;  3VAJ A;  1GT8 A;  4FXW A;  3GE9 A;  1VQO S;  5H9F K;  3R8Y A;  3M8P A;  2R7T A;  3CD6 S;  5L1K A;  3J80 U;  5B0G A;  2J7K A;  5DLF A;  1GE9 A;  1ZAX A;  4LF1 A;  1FE0 A;  3H4B A;  1NHK L;  4JI5 F;  3S1M C;  2OPQ B;  3O3L A;  2B63 C;  3M30 A;  3PW0 A;  2UVW A;  2J9E A;  4IQM A;  4J9S A;  2UUC J;  4C3J C;  3BS9 A;  2PN6 A;  4A4J A;  1VI7 A;  1FRL A;  3RBZ A;  2AEF A;  3MEK A;  1VIS A;  2H4W B;  3HI9 A;  1Q82 T;  5JVO A;  2Q1L A;  3MD1 A;  3E8O A;  2HS3 A;  5EUH A;  4NPO A;  2W8L A;  4GC6 A;  4OI4 A;  1RHM B;  2ATL A;  3S16 C;  3Q8V A;  1J6W A;  4CLL A;  3MMB A;  2GIF A;  1EZZ B;  2HVH A;  1I94 J;  1H6K X;  4C3K A;  5HP1 A;  5A2Q Y;  4ZCK A;  3IMQ J;  1O5J A;  1UL3 A;  1XZQ B;  3MMC A;  3GTK A;  5D4P A;  3I9V 9;  3OHB A;  3ZZO A;  1T02 A;  4ZVP B;  1R8H A;  3SV3 A;  5D4O A;  4YS2 A;  1ZM4 A;  1VQM S;  3NKY A;  3OVS A;  5AT1 B;  5KFU A;  5D0G A;  5KT7 A;  4Q8F A;  3AH6 A;  4G6V B;  2KT2 A;  4RUH A;  4B9N A;  5D4L A;  4DPU A;  5IM0 B;  3I0R A;  1KTV A;  1M5H A;  1Q53 A;  1BE4 A;  4K4V A;  2VC1 A;  1WAC A;  5KG5 A;  2YWH A;  5HN0 A;  4DL2 A;  3W63 A;  2KVQ E;  2ZHB A;  1QSL A;  4URS A;  2MY8 A;  3M2U A;  4RW8 A;  4WU2 A;  3QGH A;  1JOE A;  1D1U A;  2R8G A;  2ASY A;  2I5J A;  1U49 A;  3MI7 X;  3FEY B;  1M90 T;  2E2I K;  2N7C A;  4L72 B;  2DGU A;  3JAM Y;  4W92 B;  5IOQ A;  3Q22 A;  3MML B;  2DGS A;  3HHE A;  4BLG A;  4M5L A;  1MG7 A;  4G0V A;  2ILY A;  2ZC3 A;  2HHH F;  4W98 A;  2CQC A;  1AXQ A;  4DDF A;  3J7Y U;  1SCJ B;  3QRR A;  1GMW A;  2GMJ A;  3TWZ A;  2OPP B;  2P8T A;  1IJE B;  1EAY C;  2CZ9 A;  4IDK A;  1PYS B;  2B43 A;  2MMY A;  2KYX A;  2AW0 A;  3MM7 A;  4EBD A;  2X51 A;  3RW7 A;  4DFK A;  2NVY K;  2CPF A;  3U02 A;  1UKU A;  4KO0 A;  1O25 A;  4YFX A;  4TLR A;  4C48 A;  1FDD A;  1FFW B;  1NCL A;  2QSW A;  2B4O A;  3C15 B;  5K8P A;  2J7U A;  4NLX A;  3BM7 A;  1JLB A;  3J81 j;  2R8J A;  1M1G A;  4V19 X;  3NMA A;  4ZPV R;  3GEE A;  2LKZ A;  5DM7 Q;  1CPZ A;  3OUY B;  3D66 A;  1XXC A;  1D3W A;  5CYM B;  4ETZ A;  4P71 A;  1WC0 A;  2LQ8 A;  2MJU A;  4BY1 K;  5FJ4 A;  2XSJ B;  6FD1 A;  3C14 A;  4EGL A;  4Q0B B;  2YWF A;  4OZ0 A;  1PO6 A;  2HMI B;  5DG7 A;  3RTV A;  3I96 A;  1HW9 A;  2M52 A;  2ZFZ A;  4B3T J;  2G0J A;  2DHS A;  3DLJ A;  4QR2 A;  1PIL A;  3T41 A;  4J37 A;  4NCG B;  4P10 A;  2LVW A;  1DTT A;  1FDB A;  2I1R A;  4MH8 A;  2XQC A;  3OR2 B;  2PC6 A;  1RTI B;  3PO4 A;  1WOR A;  2PMW A;  1RSC A;  4GVB A;  3M8P B; 
#chains in the Genus database with same CATH homology
 4PAA A;  1XZP B;  3TTG A;  1XZQ A;  1WOP A;  3GEE A;  1PJ5 A;  3AD7 C;  1VRQ C;  1YX2 A;  2GAG C;  3AD9 C;  1X31 C;  1WSR A;  1PJ7 A;  3GEI A;  4PAB A;  5L46 A;  1XZP A;  3A8I A;  3A8J A;  3GSI A;  3GEH A;  4P9S A;  3A8K A;  3TFH A;  1WOO A;  1VLO A;  1WOR A;  1XZQ B;  3AD8 C;  1WSV A;  3GIR A;  1PJ6 A;  1WOS A;  2GAH C;  1V5V A;  3TFI A;  3TFJ A;  3ADA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...