3AD7C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with methylthio acetate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
molecule keywords Subunit alpha of sarcosine oxidase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad7C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad7C01
1XZQB 3A8IA 1XZQA 1PJ6A 1WORA 1WSRA 3GEIA 1PJ7A 3GIRA 2GAGC 1VLOA 3AD7C 1YX2A 3GEEA 3TFHA 1V5VA 4PABA 2GAHC 3TFJA 3ADAC 3GEHA 3TTGA 1VRQC 1PJ5A 1WOPA 1XZPB 4P9SA 3GSIA 3TFIA 3A8JA 3A8KA 3AD9C 1WSVA 1XZPA 1X31C 4PAAA 1WOOA 3AD8C 1WOSA 5L46A
chains in the Genus database with same CATH superfamily
4DV6F 2V6AA 2WVBA 3IPJA 3D1OA 1I3QC 1RAIB 4ED3A 4TU9A 5KG3A 3VVTA 3RR7A 4ZPDA 1TL7A 4KGZB 5DETA 1H2TZ 4CO4A 1M5OC 4RBTA 1JXVA 1VQ4S 1TELA 2R7OA 1EHWA 1XR5A 3FK4A 1N48A 1U6BA 4X4SA 3SYZA 1X0PA 2VH7A 1O26A 2XSJB 1LW2A 2Y8YA 1IW7A 4Q45A 2RRNA 2BUNA 3T5HA 2C2MB 4D3HA 2ZWPA 2MY8A 3DXBA 3KLVA 5C44C 1RLCL 3ENAA 2KM8B 5DO2A 3I4HX 1ZYQA 1PYOB 2HHWA 5LSRA 3NP5A 2Q43A 3ET6B 4PPZA 4I56A 3VF0B 1H98A 4ED4A 2NVYA 2PI5A 3GTMC 3CO9A 1JLAB 3V6DA 3M2UA 3ZZ0A 1B70B 3QIPA 3EVWA 1QUPA 2W4CA 2CPFA 4P9SA 2EFVA 4HHHA 2P8IA 4DQIA 4YFNA 1SJ1A 1IBKJ 2JVRA 2DY9A 4PWWA 3FRYA 1L0WA 1HKAA 1U6FA 4DN0A 4JI1F 4WJ4A 1HWJA 4LR9A 2RU9A 5JJBA 2DEJA 2I5JB 3N6NA 1E6YB 1NZ8A 4BBSC 2XB2D 1FRLA 4IG0A 4ZPTR 3H5XA 5HJYA 1IKVA 5KG6A 3TA0A 2YNHB 1D1UA 1NCLA 3FQKA 1BMQB 4TYAA 2UUCF 2RDJA 4DR4F 3I0SA 4C98A 2HNDB 2JNJA 2YQ3A 1KWMA 4CO2A 5GAHI 4DQRA 1RCXB 2OAUA 5E33A 5LMNF 4CO3A 4YMEA 1TMMA 4DJBA 3MEGA 1FFSB 1NH7A 1YQHA 3D0GE 2A10A 3AODA 4DR1J 1YJWS 2NLWA 3HZEA 3DLGB 4U8VA 4QWAA 5F8JA 2U1AA 5CA5A 3IRWP 2OSRA 2VPXB 2OPQB 5IP7C 2YWWA 2MQLA 2IRYA 3CIMA 3OFHA 2LECA 3IR5B 4DX6A 4P71A 2BM1A 2ROPA 2M2BA 1UV7A 3RB4A 4WU3A 3CO0P 4QR2A 4Z7YA 2M4MA 4KHMA 4ATNA 2ATLA 2KB2A 3PEJA 5KG5A 5HP1B 2W9BA 4LOWA 1FVSA 4QJVB 3B8HA 1UVMA 2HLTA 3DC2A 4DOZA 3KLHA 4KC6A 2YU9A 1M5SA 3KJFB 3AT1B 2VV5A 2Y0SL 2Y1JA 1T05A 1N32J 4MKVA 2HBRB 3FKBA 4H4MA 1T9YA 3VALA 2UUTA 2EW9A 3L7OA 5D4OA 4PG7A 2OD6A 5HMZA 3Q0AA 3G4CA 3IP0A 4TY8B 3FCVA 5CYJA 1HNZF 1WEXA 1F2GA 4OLPA 4N47A 1ZM4A 4WFZA 1YTYA 2AWZA 2UVUA 3O1LA 4PXBA 2V6SA 3Q8VA 2E2IA 1FRXA 5ETTA 3OR1B 1LWXA 3EDRB 3GR0A 1RADB 3NAHA 1HQ2A 5GADI 5F8MA 3KWMA 3C6UA 3PW5A 4A3DC 4BKWA 2M3DA 2CPJA 2HFZA 2DXDA 2YQ0A 1RT1B 1GE9A 4NEZA 3CWJA 1JXLA 3H2UB 4LVNP 5A8KB 3W2WA 4PR6A 3AD7C 4LRAA 3HSJA 3PR4A 2O5DA 4NCGB 1QJHA 1AXQA 1N52B 1LK7A 3LP2B 1WIHA 5ETNA 3HD1A 5CZXA 3MR7A 2CQCA 2D9OA 1JLBA 1XK8A 3B4DA 1FNOA 1RDRA 4USIA 1K1QA 3HJVA 3A4TA 2M70A 3NGTA 1AUSL 3FBEA 4ED5A 2PA3A 3I0RA 3LAKA 2D3ZA 1Z2ZA 3HSGA 1TAUA 1LOUA 1TWAA 2KVQE 2MZ1A 4YEAA 2CQBA 3Q8RB 3DYAA 4F26A 4QYZK 1S79A 1CJUA 4CO0A 3KOAA 1RWWB 2M9KA 4YFUA 3ILLA 3J7Z5 4L76A 4A8OA 1JIHA 4LF4J 4NYZA 2DNGA 4ITSA 3C6TA 4D3GA 1NSPA 1U0HA 5J1NA 1J6WA 2LXFA 3EGVA 2IA6A 1KHVA 4N77A 4TNOA 3T1AA 2KT5A 4CTAB 1CBKA 1D8ZA 4KGKA 3M8ZA 1ZTTA 3PY8A 4RNMA 3DLKB 4K4TA 4WWSA 1HQUB 3V81A 1ZYRA 2DPIA 3PACA 2BOAA 4F4XA 1MNEA 2CVIA 4L73A 1YDLA 4QJVA 5L9XA 1NO8A 3LP1B 1SPBP 4G1QA 1BQXA 3CCJS 3U02A 2QMXA 1IN0A 1EAYC 4KQZA 3DM2A 4YFKA 1JNZB 4L3NA 1AT1B 3TWZA 2HBQB 2UZAA 2ZNZA 3DLGA 1F3FA 1Y1WK 4TXSA 4AFFA 2AYGA 2PSZA 4OHVA 3R2CJ 6FD1A 2NSBA 4A3MK 2DBBA 1CC7A 3T9NA 2ZHAA 3EGZA 3GSIA 4DI6A 1IL2A 2E2HC 2G2YA 4OZ2A 3KG0A 1IQ0A 4P2SA 2XNRA 4OZLA 4JYAJ 7FD1A 1NSQA 2MKKA 1BD6A 4OX9J 1YRUA 2JEJA 4A93C 1MMDA 4IKAA 2DD8S 3OXGA 4F67A 3UVJB 2CXEA 1O5JA 2ZH3A 3CD6S 5A6PA 2ZFZA 1RAEB 3TFIA 4AL5A 3PG9A 2XTJP 4FPRA 2XYPB 5KOXA 2HHPA 1T9TA 1IQTA 2D69A 2VG7B 3D5MA 2KRRA 2KHDA 2DKOB 2I0XA 2LXUA 3EXCX 2PDAA 3SSRA 4JV5J 2KFNA 3I4PA 3GTQK 3TANA 4RNHA 5RUBA 1YJUA 1KFDA 2CJYB 1HWKA 4A3LC 2YKPA 3KK3A 2XHWA 4J9LA 3LA0A 1R43A 1HARA 3ZO7A 1WKJA 4USUA 2DGVA 2LU1A 2NVXC 1T3OA 5KFCA 3MCNA 2XLKA 1R7IA 4WJ3M 3HHLC 2GQCA 2E9ZA 1X4FA 2HQFA 4ZJLA 4USMA 2P5VA 3DRRA 5IWAJ 1QAJA 4K4SA 2GIFA 2QIFA 4F4YA 4MT1A 2ZOGA 4P7TA 1X60A 4CLTA 3DRYA 2HLUA 1FE4A 3KHGA 4OYWA 1WCMK 3V5RA 3T5KA 2HBZB 3MCOA 5CAAA 1FESA 2YNGB 1FCAA 1RT3B 3TYTA 2I2YA 4A8FA 2ZC4A 2QSFA 1NH8A 5IT0A 2R7XA 3J81Y 3UD4P 5KFYA 5K20B 5JVHQ 5KT2A 2GHPA 4YOEA 4WFXA 2DGXA 1XPPA 3H40A 4DF8A 1JJ2R 3M4OC 2RF2A 2ZH1A 1T7PA 3QFWA 2V68A 1T02A 1SKWA 2I8EA 3LF0A 3OFGA 4C11A 2HNZB 2JLGA 1S6QA 3U1LA 2QA1A 1DCHA 1RTDB 3CCES 1JLCB 3NCQA 1ZAWA 2BM0A 3S16K 3FEZA 4EBDA 4GZYA 2ROEA 2BJDA 1HR0F 4S0MA 1TV6A 2JA5A 3CJTA 3HVAA 1LWEB 3T3FA 3KK2B 2LVWA 2KDOA 1UZHA 1N54B 3MURP 5C42A 1KLMA 4OYIA 5D8HB 4M1XA 2C3UA 4JI3J 3DMJB 4DL5A 4K5SA 1XNRF 2ZFHA 1NJIT 5LJ5Y 3MAAA 5KFOA 3RAXA 1NDCA 2HG4A 1ZZNA 4HH1A 2ZITA 2E5GA 5D0EA 4BBRK 1RHUB 3M8SA 2EPIA 1XR6A 5KG1A 4F0KA 1HQMA 1TKTA 3LP0B 2IJRA 5LT5A 4HKQA 4RU9A 1JKHB 2EKYA 3A8IA 2CPXA 1FX4A 4KM9A 2FZGB 3DDKA 3VA7A 1NK9A 4KMUA 4AXIA 3CC2S 4ANEA 2K06A 1RYSA 3SSQA 2UXCJ 2YVSA 1XMOF 3HHNB 4L6V3 1RAJA 3CJSA 1IVZA 2V94A 2RKIA 1HIYA 2PMHA 2R7SA 3PRVA 5B0EA 1X4CA 4USHA 3M2VB 2E2JC 1NHKL 4OI6A 2UXCF 2VG6B 4MQ9A 3DDNA 1DZ5A 1RWMB 3GYGA 2HSEB 1HNIB 3AOBA 3UDCA 1HBOA 2ZUEA 1CEZA 4G7ZA 3IMQJ 4OYPA 2BE9B 1O6XA 4DCJB 2AYBA 5IS2A 4J9MA 4K0KF 2JH3A 4RR5A 5FLXU 1JLCA 3ZTSA 3MR2A 2RQCA 2GW8A 5E3RA 2B7BB 4DCPB 5I3UA 1T0TV 4DV6J 2N3OA 3OLBA 3O2IA 4Y65A 4Y2IA 4PKDB 2L9DA 1P1TA 3CQZA 3FSYA 2P8TA 5IOLA 2J8AA 3CT9A 1JOEA 5GMKa 2M52A 2ZE2A 4ZCIA 2WTFA 5DQHA 4LIWA 4LF6F 1VBKA 2OEMA 2RE1A 2IAJB 1F9NA 1Y1VC 2XMWA 2O66A 1ICEB 1PBUA 1RISA 4USWA 1XEZA 4GKKF 4O3SA 1FRJA 2HHQA 5B0GA 1UVNA 4OHXA 5DG9A 4DMZA 5HSPA 3R1HA 1FHTA 4I64A 4J5OA 1RACB 4M63A 3CDUA 4OHWA 4NMXA 2IJNA 3G96A 5B0DA 8ATCB 2LQBA 4CRJA 1LW0B 1F2HA 3HOYC 4OZ5A 2AD9A 4LFBF 4ILDA 4LQ9A 1YJNS 1XIQA 2CKWA 4C3JC 2FTRA 2ZUAA 3CQZC 1M1HA 1DARA 3VZIA 1NKCA 3NG8A 1O2AA 5ADZA 2B6AB 3NCPA 2NXNA 3V4GA 2DNKA 3V6HA 4P2MA 1UVIA 1X31C 4DS4A 2XI3A 2FGCA 2HWHA 3ADAC 3FMWA 4ECXA 4IG3B 2MY7A 4F0HA 3IBWA 1NB7A 3GTPK 4JK1A 1K0VA 3W2VA 1U09A 1DTQB 2J6UA 1S99A 1VQMS 2ZH7A 3TI0A 4DPXA 2EC2A 1C0TB 3HF5A 4WZMA 5M2RA 4F8RA 4F7VA 4G0VA 4KB4A 2VPZB 3HFZB 5DLFA 3S17K 3R5BA 3BQ0A 2DGWA 2GS8A 4CLYA 5B0AA 5E0OA 3U1MA 2N7CA 3UW1A 1RP5A 4DX8H 1Q82T 1LNQA 4OMFG 2PT0A 1UWBA 3O8WA 3MOZA 4K50A 2V6TA 2W7OA 1U1NA 1RT2A 2P6TA 1HFEL 3GEIA 3NMAA 2V8DA 1RHMB 4KHPJ 4I6YA 2M0GB 4C8OA 4NLUA 2WVFA 4O4GB 3QRRA 2LEPA 2JJ4D 3C15A 1XJWB 2UV8A 1Q86T 4MEXA 4A3DK 4C8NA 2CG8A 5C7PA 2QTWA 1FERA 2E2IC 1G6BA 1T9UA 2B4PA 4EFAC 4A3KK 3D6FB 1LXJA 5KFPA 2FHMA 1VQSA 1SJ3P 3G8QA 3IN5A 1WHWA 3JQMA 1XN9A 2RQ4A 3DM2B 2JSXA 3OL7A 4AXJA 5D0GA 3HVTB 4LJZA 2XGQA 2BE5A 3PW7A 3CTRA 3SQOP 4ZMMA 4DL4A 2CVEA 4KRWA 1RWVB 2UUCJ 3FGVA 4MFBA 3JTOA 4ZPVR 5KFSA 3KNGA 4PYDA 2Y3PA 1WACA 2OIHA 1RTDA 2DXFA 3LOUA 3KJNB 2F8MA 1RAHB 3Q8SB 2CPEA 1RU1A 2POKA 5KFFA 5KFUA 3DLKA 3UDVA 5KFTA 3NGUA 5K8MA 2KXHA 2B51A 3VAIA 3PVXA 1U26A 2CZ9A 4PABA 2RUGA 4X4PA 2KN4A 4K59A 2BYCA 1QAIA 1I5OB 1EKRA 3I5AA 1Q5YA 5JUMA 4O3OA 2AJQA 3AAWB 3AJDA 1R9TA 1D9FA 2XLIA 2K1RB 1EX8A 4UOHA 4OZ3A 2M88A 4C8LA 3A8KA 1FJGF 3ZTRA 2LQJA 2XZDB 4MAKA 1YWXA 1HI1A 4I69A 1VQ5S 4PXDA 4M5GA 1IWGA 4WYWA 4ZJOA 4GKJJ 3QSYB 4FF3A 1N6QB 3UFCX 2B43A 1IJEB 1N33F 1G51A 3D6HB 2KM8C 2R7ZA 2PI4A 4B9NA 4DWIA 3GFZA 1Y1VK 1NSAA 4OX6A 1YIJS 5HQMA 4PQUA 4DV2F 5KG2A 3CCLS 3LP2A 5JFEA 4ID8A 2A18A 3KK3B 2K7JA 5C3EC 4K4YA 3MMLB 1S6OA 4A8XA 2YKNB 3DOMB 1WHXA 5J2MA 1Q4RA 1I3QK 1N6QA 4JBCA 3TZZA 1YRXA 1ZH5A 3POTA 3PXGa 4GTDA 2DR7A 1USMA 4A3MC 5K14A 2Y1IA 3JS9A 2ASDA 1EKSA 4GT9A 4YR2A 4LFBJ 3KJVB 1S1WB 1GX6A 1WC3A 4DUZJ 1K1SA 3I32A 3IC1A 2H5JB 5J2NA 1S9FA 3D7SB 3BBFA 2VL1A 2HK2A 5ETLA 2V69A 2J0WA 4L72B 3PKMA 3UCZP 4NLWA 3TEGA 3GTKC 5L1KA 1UPMB 1S9GA 1HNWF 2E9RX 3HHEA 3R8YA 3ONQA 4J9NA 3BSAA 3P96A 1SH3A 4CO1A 3K5LA 5IZHA 4RL1A 2PFFB 4QYRA 1URRA 3FBCA 4KH0B 1QAXA 1IUJA 5L8RC 3GTQC 4NXMJ 2QA4S 1TWFA 3CNQP 3CCRS 3T6JA 2B5JA 4PUOB 1FJ7A 2D3UA 1UW4A 4A3FC 3NKYA 4JP8A 2VKZG 2O5IA 2KVIA 4J7CA 3S2DC 3GFHA 1BWVA 1B0TA 2PA8L 1RTHB 3W9JA 2CFAA 1LFPA 3M9NB 2GX8A 4ZLPA 4ETZA 4UY8T 1VGYA 3DHWC 4Y28C 2AMCB 2IM3A 5IM0B 3CJ2A 1GXLA 3PRDA 1UJ5A 4NX9A 3HJFA 3DRPB 4DUZF 4FBTA 5SZTA 1Q81T 3I0SB 3V81B 1VQ7S 4OHZA 1MWYA 2P9GA 2DNYA 4OV1A 1F9HA 5SUHA 4WBFA 1WELA 5GAEU 1TR0A 3K89A 1SKSA 2A2DA 2V2ZA 4EUVA 1Y5IB 2YNHA 4DU7A 2E5LJ 3SEOA 3ELHA 5HLFA 2MLYA 3P6YC 1SIWB 3BSCA 1G3OA 2HRUA 5GAGU 3BP8C 4O44A 4KT0C 5H1SV 4C48A 4NCBA 5L1IA 3FJ2A 2MQNA 2RIJA 3H5SA 4MH8A 2LLZA 5C2CA 1MMLA 5KT7A 3T1HF 5AJ3J 2WSCC 4ZVPB 4N8NA 3DYAB 1T9VA 3M2UB 1DTQA 3MD1A 3OXLA 4OV6A 4A8KA 4DR5F 4DQSA 2RDDA 3DRXA 3POTB 3HOVK 4FF4A 2KZZA 1NRKA 3MTKA 2QRRA 4P72A 2FHJA 1S12A 4USVA 2HFNA 3M4OK 2LEBA 4IH5A 2XBPA 3CJ5A 4J3NA 5IQ6A 1EFWA 1X5PA 4HH0A 1LK5A 4BY1C 4EEYA 4H4KC 2VUMA 2DCUB 3CCZA 4DR2J 1TVRA 3FOEA 4CLLA 1X9SA 5T7LB 2Y3YA 3W9HA 2AZ1A 2D1CA 4I6AA 4NRUA 4B9LA 4LR2A 4K4XA 5KG4A 4C8MA 2LU2A 2HRYA 3JTNA 3TNVA 1RT4B 2RU3A 2PD1A 1X9MA 5I42B 3Q2TC 4DR1F 4A3CK 4M5HA 3W8GA 3M2RB 3A12A 5KG0A 1KFSA 3UNYA 1FXLA 1TL7B 1HD1A 1I94J 3HKZD 3KUGA 3R5JB 3HVRA 3CCQS 2AU0A 1DD5A 1S1UB 3EVOA 2ZE2B 4OJHA 5T41A 2YQ1A 3GIIA 2YXLA 3T01A 5ETOA 3M05A 4ZLNA 3C16B 2Z2MA 4A3BK 3N0BA 2BZ2A 5E2QA 1Z1ZA 2HZAA 1U7LA 1OSCA 5AT1B 4C45A 1SH0A 1T05B 2JFKA 1FTCA 2A69A 2OEJA 1WHVA 3N9UC 2KXNB 5HO4A 4ZP8A 1N0UA 4WP9A 4WKRA 4C97A 1YJ9S 2ADBA 1Y3JA 3QGPA 3KLHB 3D3CJ 3H2VE 2OPRA 4X64F 1FJCA 4Q44A 1VJQA 3ZZOA 3MWBA 2CQIA 4DUTA 3H20A 2ZDPA 4GRSA 2M8DB 1A9NB 1WOPA 3QWUA 1SV5B 3RB6A 4ZVTB 5KT6A 1T9WA 1KQ4A 2W9CA 1H74A 1NUEA 2VBZA 1DRZA 3KUHA 3RBZA 4FYWB 2RQMA 5F8LA 3MR3A 4B3OB 1BJTA 1UL3A 5KFBA 3CF5Q 3TX8A 1YCLA 2XZWA 1TKZB 3N28A 5AXLA 2JDJA 4IFYA 4K8RA 4NLGA 4GKKJ 3GLJA 4JV2A 2D3O1 3UE2A 1GTEA 4LSNB 1CQNA 1FE0A 1EH1A 3H25A 4KIAA 3P5TL 2MKYA 4BWMA 4ELTA 2FGOA 3ISZA 4Y2AA 1RT2B 4KPYA 1PC5A 1F5AA 4HI1A 1WHYA 4LF2A 2ZUGA 5CYQB 4CLUA 4Q0BA 2BBEA 1TWHK 2FY1A 2MKCA 3HOYK 2WK4A 1RZMA 1VI7A 1Y5NB 2QLJB 1N56A 3H4DA 2MZJA 2CQ1A 3D0IE 1HHQA 1U1RA 1WDTA 1S59A 3A3OB 3GFYA 3JSBA 4UT4A 1GH8A 1EJ7L 2YKOA 4NLPA 3GTGK 2CJKA 3CDWA 4W90B 3KK2A 1D3WA 3CCTA 3V4MA 1VYAA 1EQRA 3QZ8A 5C4XK 1IWAA 4CYUA 2UXDJ 4TQRA 3V6DB 3W2VB 1W2IA 3TFHA 2EG2A 4WP3A 3NWGA 2IBKA 5D0HA 3H98A 3KHLA 2HMIB 1RAOA 4IG3A 4YUDA 3ET6A 2JRSA 1SI9A 3EGWB 4K5RA 2AX0A 3PEHA 1N8RT 5KT5A 1YGYA 2RF2B 3BZQA 2W2QP 1O2BA 2G13A 4XLPA 4WTYA 2XWXA 2CFXA 4I68A 4CLWA 2ERRA 3MCMA 2XY5A 2Z2YB 1WSRA 4DSKA 3CJ4A 1J5OA 3N0CA 2NVTK 2PO4A 1LW2B 3VCDA 3TZWA 1N5VA 1KD1T 2BKOA 2ROGA 1C0UA 4X4TA 1U2RA 1RT3A 2BE7D 1MU2A 3S17C 1HR0J 4WJBA 2A0FB 2DGQA 1PIEA 4DCOB 5KFAA 2HW3A 5LMUF 2X7IA 2LEAA 5KFVA 2GJIA 4PG8A 1SFOA 3H5YA 1DFDA 2BQUA 3GE9A 3DRRB 2IVYA 4U96A 4P10A 2Q79A 1JVIA 1XZPB 5CCLA 1REGX 5IT9Y 1U02A 1ZA1B 1CS4B 1J5OB 3S1RK 4NEYA 4X4VA 3ENVA 1F93A 4ED7A 3CW2C 3KKFA 4A8MP 1VHIA 1I6HC 4E8UA 4C4WA 4TU8A 5D4LA 1GMVA 3H0GC 2QN6B 4DV4F 3NS6A 5F0UA 3HDSA 1GMWA 1YKWA 4OIQA 2HGMA 2R7TA 1PYTA 3ZZRA 4LUBA 5HATA 4IDKB 2MMYA 2RB7A 4Z37A 1IBMJ 1H73A 4QW9A 2W2MP 4CYUB 4YHHF 4UW2A 2Z0GA 1GNKA 1SUQB 2CQPA 2QZ8A 4F2SA 1DHMA 3B82A 2CPDA 2OLWA 3NS7B 4Y34A 2W7PA 4O44B 1C4AA 2B3TB 4BLGA 2NCKL 3BO2A 1XXBA 1FVQA 2OFHX 3FOFA 4Y7NK 3KTQA 4Q0BB 4A3IK 4FZVA 1KTQA 5LOQA 3PO3K 4RPFA 4DFJA 4Y2MA 4B02A 1HNZJ 3HLUA 2Z4PA 2HIYA 1IM4A 5BR8J 1YK9A 2UVRA 2F7VA 5E68A 4Z2XA 1TKTB 4YQWA 2J0SD 3MM5B 3BF4A 2XHCA 4X4UA 5IM0A 2VU5A 4RKUC 1XZQB 4IFYB 1QY7A 4WPAA 1EZZB 4X66F 3MAAB 4JI3F 2CFAB 2E1MC 3L7UA 1RTIA 1RTHA 2RRAA 4NE9C 4FVMA 1K83K 3E2EA 1MLAA 4IOBA 3S6EA 4FM9A 2FQOA 3LGNA 1LWEA 4G1PA 3I87A 4BBRC 5M2UA 4BY7K 2HHHF 3H4BA 4LREA 5HVGA 1V9OA 3MAQA 4X4NA 7FDRA 2G0JA 2H1YA 4ZLLA 4EBEA 1FNMA 2HQ3A 4A3JK 2HQGA 5EUHA 3GG1A 2EI5A 2E1RA 4KAIA 2B4VA 2XCOA 4AL7A 2FJBB 4GTBA 4KBIA 1T8EA 1H3DA 2VASA 1VC6A 4J9VA 5K8PA 2CYYA 3D66A 3WX8A 2V2VA 3BO3A 1UJ6A 1RA7A 3MM8B 3C16A 4KHPF 2V6UA 1FWLA 1S1UA 4BCAA 3OW2R 4R8UA 4TLQA 5HMWA 5C2GA 2M7SA 5J2NB 4I7FA 1VQNS 3CIZA 3GTPA 2A1BA 1CJUB 4C3MA 2BA9A 3GIKA 3QFHA 3F41A 4DV0F 3CDEA 3S7RA 4DF4A 2VBWA 3GIRA 4BLAA 1X4DA 3ZFVA 3RG6A 2AZ3A 1PYSB 3THPA 5M2PA 2B9XA 3WIVA 4KATA 2QG9B 5T7LA 3GJSB 3IWNC 2HYIB 1TFWA 1JLBB 1HI0P 2EK6A 3SCLE 3PHTA 3H59A 3PYFA 2ACYA 5IYCK 1FRMA 3CCMS 1UVKA 3R5DA 1VBXA 4QQBA 3A8EA 3CD0A 4WCEQ 3Q24A 1XR7A 1JLQB 2XO6A 1U1KA 2MXYA 2GZOA 2I38A 4M5DA 4DLGA 3KHRA 3C6UB 2NR0A 5F8HA 1TK8A 3T41A 1O51A 5CZVA 4A8WA 2OD4A 4KGMA 4JOUA 2P9CA 4DLEA 5KFEA 2V67A 2E1AA 1Y7PA 3LALA 2KZMA 2B63A 1TWCA 2F4FA 5LSLA 2KL8A 4BLBA 2QMUB 2ZH2A 3RB0A 4KMAA 4U7CA 5KFGA 3FZBA 1TFYA 3BS9A 5KFJA 4AYBD 1AROP 3KLFB 3KHHA 5DDOC 4X2BA 4FYDA 3MPDA 2P9EA 2FDNA 3L3CA 5D4NA 1BWEA 4XLNA 3QPIA 4JI2F 1TL1B 5D15A 3HHDA 2AYEA 2R92K 5ETSA 1P9QC 1S1XA 2W2NP 2N3LA 4FYVB 2H5IB 3L4KA 3CMAS 3MEKA 5EGYA 5DDQC 2ZD1B 4K7QA 3M8PB 2XS2A 1B4SA 4X4RA 1UZDA 1NKEA 5HP1A 4ZVHA 3HCXA 2DHXA 2ZBPA 3DHXA 3TR5A 2JA7K 4MFBB 4RUCA 5CXTA 4CNYA 3T19A 3QJPA 3N5FA 2CJXB 2ASJA 1F9FA 3FKIA 3LUYA 2A3JA 4XDDA 3K0JA 5MAOA 3L4JA 3PX0A 1M5KC 3SCJE 1BC6A 1Q8KA 2R7VA 1XNRJ 2FJXA 2ASLA 5DG8A 3HP6A 1VQLS 1PO6A 2DNZA 4ZVFA 3EX7B 3V6JA 1LWCA 2CADA 4R0JA 1EK8A 2R93A 3C15B 1S1XB 2V50A 2VOPA 4NMLA 3DLLQ 4NA3A 1B7YB 4JI2J 4DPYA 3TO8A 2C42A 1KNZA 1AW0A 1VGXA 3S1MC 4OIOA 2MKIA 3TUZC 2Y1LB 1VQ6S 1SL2A 2N82B 1NHVA 3MMAA 1FFWB 4LSLA 3L95X 1U0HB 4ZVUB 2IA0A 4YB6A 1KVJA 4DL6A 2NS1B 1XNQF 4V19X 4JI1J 3UWTA 5C5JA 1AB4A 3VAHA 3GTLC 2W8KA 4DZDA 3QIPB 4EYIB 3R7BB 4M5LA 5M3FK 5DG7A 1V3RA 3HM9A 4E2FB 4YY3F 2MHEA 4C2MA 1MN9A 2XSFA 2JHEA 3C19A 5IC4B 4NLTA 2J9DE 2BV3A 3S2HC 2UV8G 1O0PA 2V4RA 1SVDA 2BKPA 3RBXA 2SXLA 4ZLJA 4DFPA 2HQDA 3SZYA 3DOMA 1UW9A 1RQ0A 4WIQA 1MW7A 3VVUA 3W1YC 4M5MA 3ZTQA 4RZRA 1XNQJ 5MLCV 3S01A 1UPPA 4NCGA 2LDYA 1R9TC 5J1EA 2E1CA 3QGHA 4KMHA 4DUYJ 4A3EK 2AT1B 5C44K 2IM1A 3HVWA 3BEGB 1RT1A 3IR6B 1LW0A 2WRMA 3D4JA 3RR8A 1R3NA 1KRPA 2XLJA 2QLWA 1LFWA 5EGHA 2AJ1A 1Q7LB 4ER8A 2G9OA 2GFFA 3MDFA 2FY8A 2OPSB 3IM8A 4DL3A 1YG0A 5GADU 2G1HA 2XMMA 1OO0B 5IOQA 4B3MF 1W2BR 3RRHA 3AXKA 1X4HA 5IXUA 4MK9A 3R27A 1TUVA 2GHWA 2IJFA 1Q8BA 1WQGA 2CWKA 4N41A 1TWHC 1HL6A 4C3HK 2Z2ZA 3RGIA 4A3LK 3G4AA 3VWSA 2VDIA 1JB0C 1NMEB 3RZOK 2VA3A 2YWEA 4ZIWA 4H4MB 1LWFB 1SJQA 5FIIA 4QZVB 1C1BA 2FHOB 3PRBA 2ZM6F 3VR1A 2AEJA 4U8YA 3CSKA 5C4XC 4DL0C 2OKQA 3NS5A 1EQMA 2QA4G 3PFOA 3T1YJ 3O44A 2AW0A 2N7YA 2JA6K 2IYIA 4J9OA 3CCUS 4ID5B 2GA7A 2GAGC 3V6KA 2J6TA 3IA0A 1YJRA 5FLXY 4OL8A 4JI4J 5KFDA 1HBUA 3PYGA 2XYGB 2QYGA 2ZHOA 1ZXOA 3QJLA 2F4VJ 3HT0A 5U47A 4KSEB 2UVVA 3HVTA 4U7UD 3T1HJ 2HZCA 4YFXA 2WB4A 1RCOB 4DR7F 2QJ3A 2HFOA 3GJRB 1VFJA 3M32A 3GTKK 4EK2A 2XMTA 1IBLF 2R4FA 4B9MA 2RKIB 4URGA 4IO9Q 3NOCA 2HVHA 1ROFA 2Y0SD 1XZQA 3MEEA 3C46A 2QLBB 4RNNA 3PX6A 2WVEA 5F3ZA 4B3SJ 4KN7A 1SL0A 2DR9A 1M5PC 1PSDA 2WAQL 3TFJA 2ZJPQ 1NZAA 4OJGA 2HNDA 4K0KJ 4O4GA 1FF2A 4N5SA 1CSJA 3RZDK 2B8PA 2V63A 4XSZA 1X5OA 4YY3J 2ZH5A 4WP8A 4L74A 3FFIA 1JKHA 1UWBB 2QT7A 1IKVB 2O67A 2RQKA 3LP0A 3NOGA 3TQ1A 2V8HA 2VICA 3EGNA 1NDPA 2L9NA 3D2WA 4F4ZA 3OTEA 1HHTP 1Q79A 4YB5A 1WSVA 1DCPA 3EJMA 5B08A 4A3FK 2K8GA 1ZAXA 3MMBB 2XY7A 2IFXA 3LTOA 2PGCA 2AJ0A 3R6LB 4R5PA 5FJ8K 3GTOA 5EX3A 3R2DJ 1KLMB 2VQFF 1WEZA 3DLEA 5GAGI 2WVCA 1C0TA 4OI1A 4HTJA 3H0GK 3I6PA 4OZJA 2HWIA 4C3LA 3S1MK 2QLFB 2FPHX 2W24A 5IFMA 1TV6B 1JJCB 4PG6A 3W7BA 4K2XA 1OMSA 3GJQB 2NXCA 4WILA 4U95A 1PGZA 3MMJA 4IDKA 4DV5F 1R8PA 3MR6A 2QL5B 1S6QB 3PYEA 4O23A 1YBUA 2YWFA 5T14A 4CH0S 3I31A 3GEHA 2B6AA 1E6VA 4DHVA 4NOIA 2IYGA 3KMQA 1CJVA 3PCOB 3ITHB 3PR5B 4DSIA 4LFCF 4QPXA 3W5XA 1UVJA 3LANA 5F8NA 1J5EJ 2P6SA 2XC9A 3C14B 2Z8QA 2IBOA 1YJVA 3P3DA 2O3DA 3HHLB 4G0UA 2WSEC 3SV3A 2OMOA 3T1YF 1SH2A 2QV6A 3N5BA 3RRKA 1KBRA 2DIVA 3IFEA 3NGSA 4KGVB 4G3IA 2MQMA 3GTJC 4YDXA 1O24A 3HOVC 4ECYA 4LF4F 2JEFA 2DH9A 2F8EX 3FZ2A 5C24A 2IAJA 5LXYA 1L3SA 4A3IC 1TMJA 1AFIA 1R0AA 4JI5J 2GSUA 3I56S 2VUMC 5IOTA 1SKUB 2HFSA 4Q43A 4IR9A 1RYRA 3T5JA 5IV4A 2MQ8A 3FMBA 1Q53A 2RH6A 1HW8A 2B9EA 3JTPA 4EZ6A 5CH7B 5DJBA 1KLNA 1WG1A 1XXAA 1J27A 1YNJA 2J9DA 2CA9A 1U2FA 3BN7A 4Q5VA 2NXEA 1FWKA 4DEZA 5A8WA 1R8CA 1U2CA 2KWAA 2ZM6J 4DV1F 4A3JC 4DPTA 1N34J 2OI2A 3UCUP 2F8HA 1KC8T 2RAQA 2A2CA 4N7TA 4LBIA 4DV3F 1I3QA 4BY7C 2KT2A 4OQJA 3SFUA 1X9WA 1YSJA 1J6XA 2V0NA 2RHSB 4XIUA 4PRFA 4C8KA 3GV5B 2WBMA 4M5IA 3DU5A 3HSZA 2CJ9A 2FIUA 4A3BC 3S1QC 2GIQA 1D9DA 4ED1A 1T95A 2F9DA 5ETMA 3F44A 1P9YA 1WUUA 1S49A 4I2PA 2K3KA 1Y1WC 3HKWA 4CM0A 5DDPC 4IO1A 1I6VA 4OIRA 1P8GA 3ISND 1N34F 1VJEA 3Q8YA 1RAAB 3TVKA 5A8RB 3PFEA 1JX4A 3BBBA 2DO0A 4LSNA 3KJQB 3PJ9A 4HDGA 4OLOA 1OYDA 5L1JA 3I4MK 1FWPA 1B0VA 1Y5LB 4DR6J 4IUFA 4ZPAA 4NOHA 3ZC4A 5C42B 4JI0J 2RS8A 2W9CB 2CNKB 2VONA 4RW9A 4JV5F 3BJYA 4KO0B 5GMDA 3WC2A 2DB1A 2J9EA 1WCMA 4XDCA 4GO5X 5AE3A 3UD3P 2HNYB 3QGIA 4ZVSB 2YPZA 2PMWA 5A0YB 1R0CB 1IKXA 2AJ4A 2Q3PA 2VG5B 3U1NA 2HNZA 4GVBB 1W25A 1LEOA 3BGRA 1HQUA 2XMAA 1RSCA 3BQ2A 2ALZA 2O1PA 3H0PA 1KR4A 4QPTA 2W25A 3H8YA 3EYZA 4M5NA 1S7HA 2DGUA 1FT8A 3OFEA 4KKOA 4DR4J 1ZBSA 5LMUJ 1TP7A 3M9OB 1OPIA 3O5TB 1GTHA 2B63C 1JLFB 2B9WA 4Y2KA 4NI2A 2JC0A 2YU9K 2VBYA 5I3PA 3HOXC 1R8HA 3VHQA 3TRGA 2EC0A 1N36F 2E29A 4CP5A 2PFDA 3ERED 1GXUA 2PA8D 3BREA 2LQ5A 3BP3A 2WBRA 5I42A 1RT4A 4DSFA 4TY9A 4LJMA 1M5VC 2Q66A 2VOOA 5I3QA 5TJ3A 1JXEA 4RLEA 1CPZA 1JLEB 3GFXA 3TTGA 2UXDF 4ZKAA 4UUXA 3HO1A 1J5EF 3Q22A 4RUAA 1K73T 2E5LF 3VAFA 1J98A 2XZTB 4OX9F 4ZHRA 4V1Ak 3W3SA 1REVB 6AT1B 5EGEA 4EO6A 2KFZA 2N4CA 3NCRA 4ZCKA 1TKXA 1QSYA 2YWGA 4F50A 4A48A 4MK8A 2KFYA 4DV7F 4GO7X 2GQQA 4DL2A 5A8KA 3GTGA 4JI7J 4KTQA 2JWNA 3AY0A 4W4MA 3FSIA 4RNOA 2VUMK 1WF1A 3CJRA 5TMCA 3N6MA 3CMES 4NYPA 2L3MA 1SQFA 3DOKA 2DO4A 2NVQC 3JSMA 1LXNA 3MUMP 3OTBA 1A0OB 4XO0A 3OHAA 1EP4B 2E2HA 3PW4A 2ZKUA 3AB4B 3UVJA 2OH2A 4TY8A 1X4EA 2WONA 2CZ4A 1RAGB 4PQAA 1YVFA 5D78A 3C8YA 3NMRA 2HGNA 3MTJA 4AL6A 2HEKA 4Q2MA 1S72S 1CULA 2G0CA 5H9FJ 5KG7A 5HJXA 1QVGR 2DTJA 4JI4F 3PZPA 3HULA 1NHUA 3CJ0A 2HHTA 2NYIA 3H2LA 3K8WA 4FDFA 2G1DA 2NVYC 3T9ZA 5L9NA 3DXSX 1O25A 1KVIA 3DRPA 3TEHB 2C2KB 1OYEA 2X3DA 2F63A 3QSIA 4P5BA 1KONA 2W9BB 1RU0A 1FD8A 3S2HK 1IBLJ 5LSOA 4C2MC 1ZBTA 3O3LA 4KV8A 2DR5A 3BH7B 4WE1A 4EGLA 1HQEB 5F8IA 1H6KX 1AA1B 2W8LA 5FJ4A 3G87A 1NPRA 2ZZTA 4WIIA 5KAKA 5HL8A 1L5UA 1KDNA 2NUHA 2CJAA 4PUOA 1VHFA 4G1QB 3P45B 1SIZA 1YJTA 1UA0A 2FHJD 4NPOA 4WK1A 3GU0A 3MEGB 2V9KA 8AT1B 2MKJA 1CLFA 2KHCA 3MI7X 4NZ0A 1Q8IA 4AH6A 2ZVSA 4RUBA 3EDQB 3HHKA 2PHCB 2MTLA 1NKBA 2WSFC 2JLFA 2HURA 2H4YB 4X6AC 3MECB 2DGOA 1NK5A 1VRUA 2D7SA 5HAOA 4CTAA 4ZOSA 3OVAA 2XNQA 4ECTA 2L41A 4K2JA 1VBYA 3MPVA 1WC1A 4IG0B 2C2NA 4MKYA 3C6TB 1E6YA 3W65A 4DR2F 3QATA 4N56A 1QUVA 3OVSA 4YP3A 3NNHA 3UI3A 3S2DK 3JSRA 2KG1A 1USOA 3THVA 3P49B 3W9IA 1SC4B 2BEFA 1YI2S 5J2QB 3K5PA 1LKZA 2VB6A 2NXJA 2A68A 3KJVA 3NBPA 1KP6A 1N4LA 2APOA 4Y0FA 4RBVA 3H3VL 2R8IA 4GVLA 4OZNA 2C3YA 4Q2LA 3OLAA 2J76E 2V8VA 1HYSB 2AEMA 4ZP9A 2MPUA 3LGMA 2DPJA 3HZGA 1VIOA 5EHHA 2QFJA 3DOLB 5J2MB 2GV1A 2NXUA 1TL3A 4P2FA 4ED0A 3HOXK 2YKNA 3TW0A 5K9FA 4C6AA 5AE2A 1F5BA 1GAOA 4ZS6A 1RWUA 1O27A 4PQUB 2EVZA 2HPUA 2FQQB 2ILZA 2CQ2A 5L46A 4CH1A 4RWWA 2CNNB 3VQTA 2KXFA 2KH9A 3GTPC 2FUG9 4LRFA 2XSJA 3HXMA 5C25B 7AT1B 4LR8A 2XO7A 3RYLA 1OWXA 2F40A 4PWDA 1P1LA 1FD2A 3CEDA 4RU2A 1QLNA 3L4BC 3EICA 1WORA 1KHWA 2VFSA 1FRHA 4QIVA 2B9YA 4BS2A 2CW0A 3C2PA 3T00A 3RZDC 4ECQA 2I9SA 1V6HA 3Q3QA 5HANA 1SQEA 4QIWL 3OL9A 2K1RA 2C3PA 3K8VA 5HBMA 2DJWA 2IPOB 2DRAA 4ZP6A 1H7XA 2YWHA 4ZN1A 1OY6A 3AJ2A 4U7UK 4B3RF 1HLWA 2JZ5A 3OTDA 3M3YC 3GCXP 3ZZUA 4B3RJ 5KFNA 5A76A 2R3VA 3WIUA 2E9TA 2BXJA 1T03B 2HK3A 2HVDA 3WBZA 4IH7A 4B9UA 3IS9B 1IKWB 2HAFA 4A3KC 4KMDA 3HXAA 3NGKA 2HS4A 3AD9C 3MPYA 3Q8PB 5CABA 4DPWA 1UVLA 3BGLA 4DDFA 2HRTA 2OELA 5L38A 1YITS 2R7WA 4DFMA 3A13A 1RTZA 3TARA 3EMTA 1TUGB 1ZQ1C 5ETVA 3A8JA 4EZ9A 2BRLA 1FKOA 3ISNC 5JMNA 1NK8A 3A3NB 3AHPA 5KFRA 4A46A 1IXKA 4ECVA 2XMJA 4WFAQ 1RWOB 3I9ZA 3BBCA 2AHOB 2WVDA 3OL6A 3D67A 2RDIA 5FD1A 1HNVA 4LFAF 3LQVA 2BANA 2DHHA 1S1TB 2L9WA 4HT7A 4WTOB 3HX9A 2BDPA 3S15C 4NZ6A 4FN5A 1VRTB 3G8SA 2MJUA 3UN3A 2R92C 4NL5A 3U27A 3QZ7A 4LBPA 4J9QA 4NYOA 3JSTA 3MMCA 4OIXA 3GONA 5CHCB 4ECWA 3D68A 5KFIA 1NBEB 3MEDA 4CI0B 1KEKA 2VJUA 3R5GA 4P5AA 4DV7J 2IRUA 3AFGA 1TWGA 2DNNA 4GTEA 4TQSA 1WDDA 1R8BA 5HMXA 2M5YA 1QM9A 2GO8A 2I5JA 4HYKA 1U1QA 2GO9A 5H9EK 2GHVC 2RNEA 3LGHA 1N5YB 1T03A 3MM9A 2FB0A 2CQ0A 4FXDA 3PM9A 4KAWX 4I1TA 2DHSA 3GP9A 2DEIA 2VC1A 2JA5K 1RWPB 3LAMA 3ENQA 3QYYA 2D9PA 3JYTB 1XERA 2EFOA 5G4DA 2ZH8A 4H4KA 1JLAA 3J80Y 4B3SF 3MM6A 4UQGA 2YNFA 4Y6IA 1P27B 2NPFA 4HHJA 4ES3A 5HBMB 2DNPA 2VQEJ 9ATCB 2JEGA 3TOQA 1WG4A 2C2OB 3HOWK 3IG1A 4LFCJ 1MWQA 2VFUA 3RBDA 4F3QA 2E1PA 4IOCQ 2I6WA 5L39A 1TWGC 2WHOA 4BDPA 1FRIA 3QGGA 1BY9A 2MQPA 3K59A 4C8ZA 5IYDK 3L7PA 2OTLS 1K9MT 2D74B 2CWXA 1HNWJ 1PILA 3OJSA 4QWCA 2J0XA 5CYMA 2RHQB 3OJUA 4NLRA 3UDEA 3EVMA 3OSPA 2LA4A 3K2YA 4LF8J 2HKEA 5J2PB 3CAGA 1CJTB 1B4AA 2HZVA 1FA0A 3M6XA 2MDAA 4J9RA 4ZVEA 3R6GB 2NQPA 3J81j 3S14C 5AE1A 2FLPA 3PO2K 1SC6A 4ZIVA 4CCHA 2MSSA 4C7QA 5GAEI 3CULA 4DBQA 1NPPA 2C2RA 4V19J 1HYSA 4OINA 2DCLA 1ZM3A 4Y00A 3NGDA 5E41A 4R0EA 4X84A 5K8OA 4F04B 2LDIA 3SDEA 2R2RA 4DX5A 3GV8B 3SCIE 4LRBA 3SBMA 3QWPA 1FTRA 5J2QA 3I4NC 3FBBA 4DN9A 2RVJA 5DQIA 3G6XA 5BXIA 2XCPA 5I3UB 4RW7B 2B4OA 3RB3A 4LF5J 2MGZB 2JEIA 1FDNA 4L75A 5K5MA 2Z56B 2BW2A 4C0OC 5CCMA 3W60A 1D09B 4KB2A 1DLOB 3WZ0A 3DGPA 3M30B 4LQ3A 4DU8A 3BYRA 3B4MA 4YN3B 4N8OA 1HMVB 3R5AA 2GGPA 1H72C 2QX0A 1T11A 3BKTA 1V5VA 5F0WA 2UXBJ 1YLXA 2VJVA 5D3GB 3K7AK 2U2FA 2BKNA 4X65J 1C1CB 4QBUA 1VC5A 5FLMC 4I6WA 1HNIA 1JMTA 1M5HA 1DQAA 1FFGB 2VG6A 3BSNA 3DI6A 1ELOA 3QT8A 3M2VA 1OQ6A 2W01A 3GWCA 1OY8A 2CPHA 3AQOA 1HW9A 5HROA 3MUVP 2AJ2A 3ZNUA 3LPXA 4FYXB 4C0HA 2XMUA 4XCHA 5ETRA 1FJEB 1WQFA 2RUSA 2HGLA 4P6QA 3VGUA 4IFVB 4KC5A 3WHIA 1S9EB 2ZH6A 4IH6A 1QE1B 2JA6C 3DRSA 4MTPA 1HPZA 2FLOA 4C3JK 3BN4A 1EETB 2ZH4A 3W5ZA 2Q6BA 4O0NA 4JV0A 3WODA 3QX3A 4ZCLA 1BQNA 1RT5B 3R5CA 4A47A 1IBCB 2RRBA 1ZM9A 4H4OA 1HWLA 1CC8A 1SBRA 1F7VA 4G7OA 2CZVC 1DCOA 4M1KA 5CD4H 3DMJA 2VPWB 1B7FA 3I5BA 4WYLA 2D41A 1GQEA 4MK7A 2BQ3A 2RJZA 3W62A 2ZJQQ 1RA6A 1PAEX 1GT8A 2QC3A 1VH2A 3E01A 4EMDA 2WONB 3R7NB 3CJ8A 2EBBA 5CQGA 3UN2A 1IE0A 2KG0A 2IVMA 2DGSA 1Q5VA 5DLGA 2XY6A 1VRQC 1W26A 4UTGA 4GFQA 3PO3C 3GZ7A 1K8AT 5AJ3F 3L09A 4CLPA 1FKPB 2EKNA 2X1GA 1VQKS 3K5OA 3A1YG 4DV5J 2YKMB 5C4JC 5B7WA 2EG1A 3JSMB 1WWHA 2O01C 5DGBA 1X4GA 1TKDA 1YZ6A 2IDLA 3AB2B 4ILRA 4ECRA 2EK1A 2F5GA 3CDBA 4OX8A 4QWBA 2W7AA 4A3GC 3PNIA 4X65F 3Q89A 4PXCA 1ZVUA 3G71S 4RW4A 1RLDA 5E7OB 1OIAA 2ZUFA 2R7ZC 3QBCA 1X4BA 2YNGA 2K3IA 5DZ6A 3DGVA 3DU6A 2MQQA 3M7VA 4USKA 1VK8A 4X62J 2MZSA 3OPKA 3HOUC 1TWGK 1TL5A 2AP6A 2ATCB 1N0VC 2KJVA 4ICLA 2AV5A 4CIOA 3KK1A 3HKZL 5IYDC 1BE4A 1O8BA 1R6YA 2LCWA 3VAMA 1WEYA 4BBYA 3I5CA 5D0RA 2GMLA 2O5JA 3RRGA 2VUGA 2OJ3A 2PMZD 4BWJA 4F25A 1VC0A 1S48A 3FCWA 1HWUA 2C3MA 4KB7A 5HL7Q 2YX1A 3QRQA 4FZBA 5D6GA 2UUBF 2LQ8A 4RWXA 3CMQA 3S14K 3OTCA 1BLUA 1RWKB 5G0RB 1SB6A 2ALYB 4I2QB 2E2HK 4DZ6A 4KE5A 4U9RA 2BX6A 4KKOB 1U47A 3US5A 4YHHJ 4LBHA 1VR6A 3BUEA 1HBMA 4L3KA 3HHLD 2V8PA 1UCNA 1DBDA 4J90A 3OT9A 1NK0A 2F65A 3G8TA 4AE5A 1JK9B 2ACMA 2VG7A 3K7RA 2YKMA 4B9TA 4NXNF 3K5NA 1S0MA 5KFLA 2VG5A 1FK9A 3AA9A 4X6AK 2UUBJ 4F4KA 3TAMA 2V4QA 3VTIA 1VDHA 3DLJA 3MGJA 1U49A 2IDEA 4X62F 4K4WA 4O3RA 4QU6A 2BE2A 1F60B 3DLHA 4YG2A 1I6JA 4KN4A 4HACB 1TZ0A 4JI6F 3N79A 1JQWA 3MAHA 2IC3B 1NNDA 1RHRB 2VD3A 4Y2CA 4ZH4A 2R7UA 3B78A 4UZCA 1RT6B 4JI5F 5ETQA 1XTZA 1QSLA 1RGVA 3D6TB 4MIBA 1DTTB 4MKBA 3QQCD 4DSEA 3EZ5A 1NB2A 3LAJA 1UA1A 1FDAA 4B17A 3AJ1A 4FS2A 3SCKE 3QNWB 4OYXA 2AGOA 1D8YA 3IBCB 2C2DA 1NU4A 4HVZA 3AA8A 2CPIA 4BBSK 3M6UA 3Q86A 1F1BB 4J9KA 5A8RA 4HT5A 5KT4A 4ZN3A 3R7SB 4E98A 2IC3A 4QWDA 1W7WA 3HI9A 3MM7A 3ETMA 3GTGC 3TUIC 1R27B 1WJ9A 4LRDA 1O2FB 1RTJA 3LP1A 3K17A 3CB4A 1B3TA 1WCMC 2BOPA 1DURA 3MPUB 1U1LA 4O3QA 1FK9B 1U0SA 5EWFA 4B08A 3B54A 1ZTWA 2VFTA 3IXQA 3TQEA 1M1KT 2OFGX 1I51B 5EX0A 2XS7A 5IP7K 3FBFA 1UWAA 2V5HG 4LF9J 4HHUA 2CQGA 1K0TA 1X5SA 4C0BA 2W4DA 2GGPB 5KFMA 3I4MC 2CAJA 4ANDA 1ULRA 2C1EB 2BJ3A 5M5XK 2YTCA 1RWXB 4OYZA 2A6OA 3IAS9 4FP9A 1HWIA 3HFKA 2YKQA 3GPAA 2MGZA 2MHNA 1WI8A 4FXVA 1UEKA 2CPZA 4PEOA 2EBEA 2DY1A 1NK6A 1JLGA 5H9EJ 5IOSA 1RXOB 1S6PB 4MYTA 3WQPA 4O2DA 3OQ2A 4TVAB 3OHBA 1S76D 3SDEB 4NLVA 1SXLA 2JC1A 1OSDA 3I0RB 3VGVA 3TZXA 2CG4A 2H4WB 3S1RC 5HI7A 5C24B 1SC3B 2ZHBA 1GMUA 2VODA 1HA1A 3CD7A 4IYQA 4PZVA 1UKUA 2HQCA 2R7ZK 4GC6A 4M5JA 3G82A 3QLHB 1WF2A 1R6VA 3PIOQ 2YWKA 4LT6A 3SQGB 1IKYB 1KVKA 4RW4B 5ITHA 1TWCC 3W2WB 2B63K 3PJWA 1OQ3A 2OGUA 2F4VF 4PG4A 4CDIA 3J7ZT 3D1HA 1PJ7A 2R7RA 3SV4A 3UCGA 1BGWA 1TUWA 2W2OP 3HOZC 2E5JA 2AX1A 2NUUG 3TA2A 3BPSP 4DV4J 4DSJA 5IV3A 4OI0A 2OSQA 3FRZA 5HMYA 2ZOMA 4X64J 3OR1A 1DY3A 3J80U 4LMZA 1XC9A 2WB1L 3DXJA 1VCTA 2VA2A 2LP4A 2R92A 4WU2A 2ZZNA 3N4WA 4H54A 4Y7NC 3O6QA 1Y11A 1KQKA 4CLKA 3MFHA 4KY3A 3RUBL 2DXEA 1NSKL 3JYTA 3PTWA 5J1PA 4O3PA 3DLEB 3CC7S 3I55S 4HI2A 4UZBA 5BJRA 2HFVA 3M1VB 3GB0A 1Z2LA 2YH1A 4A3EC 3M8WA 1KOOA 1I94F 2V34A 4FF1A 3KFWX 1SQGA 1L3UA 4USJC 4H4OB 4HLBA 1Y00A 2M8HA 3VAKA 2JA5C 1BGXT 4RX6A 3J7AN 3JQKA 3C3LA 3OD2A 4Q8EA 5DGAA 4HEA9 5DRKA 4U6PA 4J37A 3UD5A 3PW0A 1M0SA 2DR8A 5IQQA 1VRTA 4ED2A 4IQMA 5IC6B 1PKUA 3GSDA 3R3TA 2DRDA 2OPQA 3U7JA 3RU0A 3JAMU 4LF7J 2KT3A 4OJ3A 4C3KA 3G6YA 4ES2A 1K83C 4QIGA 1XMQF 1U1OA 3NAIA 5FDLA 3M32B 1OJ4A 5CD4A 3DI6B 1K44A 1QTNB 2KJWA 2MQOA 2W2PP 4M8LA 4F3OA 1X8DA 1RK8A 3IGVA 3GMGA 3CQZK 1S0VA 2V2KA 2YX4A 5IP9C 1HMVA 2ZJRQ 1Y3KA 2OTJS 2HVZA 4NA2A 3FCHA 4C2MK 2R2TA 3M30A 2P2CB 1H0HB 2L08A 2EXUA 1RKIA 4AT1B 4MIAA 2QSWA 3IS9A 2DNRA 4LIRA 4URSA 3PO2C 1C1BB 1MN7A 4YR3A 4MEYA 4Y52K 1IR1A 4GC7A 3HFVA 2EWHA 1KN6A 2MZTA 4KDDA 2FJEB 4MYUA 3TJ9A 3BGFA 1ZM2A 5KFHA 1H38A 1OS5A 1RT7B 4JI8F 2B4UA 3RAQA 3GQCA 3RBEA 1T3NA 4ZPCA 4MIWA 4DR3F 2CDRB 4G6VB 1WC0A 4WFNQ 4G65A 4CH7A 4CLZA 1F0XA 2Y8WA 3HK2A 1GEHA 4A4JA 2IM2A 4PCQA 1Y1WA 5IT9U 2JVOA 4EWTA 3LW5C 1KKHA 3ICLA 3W8PA 1URNA 2CPYA 4OYMA 1VK3A 2DH8A 4EYHB 2KRBA 5CJ9A 3Q83A 1GX5A 5IT4A 5F3TA 1QD1A 2AJFE 2YY3A 2X51A 4F4WA 3X3UA 2HQIA 5GVQA 1OY9A 1FDDA 4IR1A 5FLMK 4DQPA 3D6MB 3TX0A 5H9FK 2E44A 1KQFB 2FVSA 2XI2A 2AYMA 2WOMA 5D4PA 1Q0NA 1BHNA 3KG4A 1MSWD 2JA7A 1H2VZ 1INNA 3OTOF 1FJGJ 2R9LA 5GMEA 2E7VA 1VIXA 4DDQA 1U45A 2WW4A 1NJYA 2CJQA 4LRCA 4GKJF 3RZAA 2R2SA 8RUCA 1U25A 3MM6B 4E0DA 3IWXA 1IR2A 2AEFA 4GTCA 1U8WA 2VBXA 1I50C 2FZKB 2C2ZB 4UF4A 1Q1KA 2DH7A 4B9SA 3CJKA 3GCWP 1N88A 3DKDA 1H7WA 4OHYA 5E3QA 5KFQA 1S1VB 2H3EB 1Z4UA 1V3SA 1PG5B 4LSLB 3C66A 2QL9B 5JVOA 3MMAB 3MZIA 2ZKTA 1ZPVA 3OUYB 2HHSA 4TLRA 4ED6A 3ILIA 3GG0A 3IR7B 2E66A 2V4JB 4TN2A 3BR9A 1DQ9A 5DZ7A 3CUNA 3BM7A 3LPYA 3KLIA 1Y4ZB 4WXWA 2WB1D 2JA8K 2QEXS 3W66A 3E8OA 2MLZA 5BYSA 4KFBA 2VFRA 4Z7CA 4ZITA 1NK4A 4C9DA 4LFAJ 2UU9J 1U1MA 5L1LA 1PJ5A 1HNVB 2QFIA 5LL6d 5TMFA 2H65B 3PDNA 1TQLA 1RABB 1T9XA 5A6WA 2BJ8A 2ZBRA 3RTVA 4UY85 1BQMA 1U4BA 4OYAA 1YJ7A 4ZA1A 4TYBA 3KYLA 3R97A 1JJHA 2HAIA 3SZ2A 4LK0A 3HD2A 2ASYA 4USTA 2OPPA 2R42A 3BPDA 2GNKA 1AZSA 2CQDA 3IRXA 3GYXB 1VLOA 1RBAA 5LJ3Y 2FLLA 2W9AA 1VISA 4QW8A 4QIWD 3M8PA 2RGRA 2XMKA 3DNCA 4URQU 1IKWA 4EI2A 3HOUK 4FVCA 1Q8LA 4NLOA 4MJKA 3GTLK 3UPFA 3WC0A 3M1VA 1BDFA 2OMLA 1PCAA 2HS3A 3IO1A 1WG5A 4RMFA 4ENOA 3MOJB 2RMLA 3QO9A 2G2ZA 2J7WA 3OBIA 4FKYA 4OI2A 2J6SA 4K4ZA 1NXIA 2E7WA 2YNIB 1UTAA 1ZA2B 3G9CA 5GAHU 3M8QB 2Q6CA 2ABYA 3K58A 3UDLA 3DOKB 5KTQA 2XM3A 4KASA 3FKIC 4A8YA 2FD2A 1EB0A 5A2QU 1JLQA 1G2EA 2WCXA 1D0EA 5DQGA 4DG1B 4JI0F 1R31A 3MF5A 2A6HA 1U48A 3SQGA 2GVZB 1M90T 4KHRA 5G0RA 1RI7A 4DXLA 2BJEA 3AOAA 4AD6A 5LXRA 3BO4A 5LMNJ 1L3VA 4GTAA 3TA1A 3EUNA 2EFPA 3GTYX 3PIPQ 5KFKA 2HHVA 2KU7A 1S4EA 1FEEA 3ULHA 4ETXA 5BR8F 1F7UA 3OSNA 4C3HC 1AB8A 3G6ES 1I1GA 5M3MK 2GMJA 2EFGA 1MWZA 2NSCA 4G0WA 4ED8A 3D28A 5ETKA 3JB9k 1UFKA 2XS5A 1MROA 3BYPA 1UEUA 4K4VA 3RZOC 2GVZA 4NI2B 4QR0A 3GEEA 1N5SA 4BC7A 1VLYA 3KLGA 3N3YA 3J7YU 4DPUA 4XSXA 3MM8A 2DISA 2MKHA 3E3XA 4PYAA 4DG1A 1H2UX 5EWGA 3VV2B 2R7QA 3CC4S 2YU9C 5B0BA 3LH2S 3AQPA 2BR0A 4AQYF 5A2QY 1QAYA 3MECA 3T02A 1R0BG 5DM7Q 1CJKB 1S4FA 4OZ1A 3M8QA 3BGRB 1RB0A 3FDSA 1SC1B 4CNZA 2ZZMA 1FKPA 5THWA 4CLSA 2VIHA 1JJ4A 5A0YA 4FS1A 1GXTA 3BB5A 1RTJB 1XMBA 3MD3A 1VMBA 2C28A 4RW9B 1S97A 3LAPA 4ZK7M 3V4IA 4CLFA 4DV0J 2VQEF 2UP1A 4C8YA 1HQEA 3FEXB 3BSOA 4UUWA 4JI8J 4WE1B 1NDLA 1RTIB 3P8BB 1XXCA 2CQHA 4KR0B 4FF2A 3TAPA 3D1QA 2DHGA 5F9NA 2R8GA 4QWEA 4OJ1A 4RW6B 1YBAA 3ZZTA 9RUBA 2DIUA 2UUAF 2ILYA 1I3OB 2YX7A 3P4UB 2GSNA 1FEHA 1AZSB 1MG7A 2XYHB 3IRXB 4CWBA 2DR6A 1F3VA 1UMJA 3Q23A 2BVZA 1V3ZA 5IWAF 4AQYJ 1PBAA 3IBFB 3G4SS 3Q8QB 5F41A 1X4AA 4JI6J 1BQMB 4LLGA 4F36A 3F56A 3VGSA 1WTFA 4RW8A 3EWGA 3W5YA 2ZNYA 3ILJA 1NM2A 4CT9A 4B3MJ 2EEYA 3F0NA 3UR3C 4ERDA 1SUQA 2H9ZA 4PAAA 1XMOJ 1GK8A 4I0WA 2LYVA 1FXRA 2DNQA 1UJ4A 1TWFC 4F2RA 5IORA 2BJ7A 2GVDA 3ZZPA 2MSTA 5EWEA 3GDZA 2JFDA 3LWLA 2NVYK 3GTLA 1S10A 3OV7A 1CJKA 2OO4A 2OUGA 2KKHA 4QU7A 2IRXA 2V4JA 4IOAQ 5D3GA 4LF7F 4LK1A 3EM1A 3SIPB 3BGOP 2UXBF 1CG2A 4DV1J 1UFWA 4I4BA 2DNHA 2F1FA 1TAQA 1HBMB 3L9ZA 4PWUA 2W4PA 4X4QA 2VQFJ 4QIEA 2VHGA 4GTFA 2Y9HA 2MLXA 2JX2A 1A6LA 1ZPWX 4B3TJ 3DCAA 1S1VA 3QT7A 3KLGB 1TKXB 3W61A 4I67A 3GTJK 3M8RA 2LXIA 1FX2A 2ZBCA 4RUHA 4RW7A 4AYBL 3X1LB 1AFJA 4RBUA 5M5WK 1WTBA 2CRLA 1CS4A 3KDNA 4ZHRB 2D6FC 4C3IK 1QSSA 3KXDA 3PJXA 1SJ4P 3FKIK 1YRTA 1JLEA 2AIRB 2G0IA 3J7YI 2CJBA 1LQ9A 4M5KA 4ECSA 4DQQA 4ICLB 1X7VA 2E5IA 3JAMY 3SI8A 2X3GA 2DITA 3GTOC 1CJTA 4WK3A 1MU2B 1HNXJ 2C3OA 5DDRC 2CUYA 1C0UB 5I4MA 2FJVA 4BHQA 4ZVQB 2FJAB 1ZAVA 1N5TA 2GJ2A 3DDIA 2CNOB 4A8QA 5BYQA 1XQIA 2XCRB 4ILLA 4ES1A 4EO8A 3DLBA 1HI9A 1CJVB 4NLSA 3CD5A 2CIMA 3UO0A 2R8KA 4X66J 2PMZL 1C2PA 2MYFA 3MPWA 4Q8FA 2YNIA 3IG1B 2V8GA 1HD0A 1IKXB 2GAHC 4RO0A 4P73A 1HBNB 2GQ2A 3BDEA 1SMYA 2DVIA 3GTMA 2YNFB 2BABA 2IY5B 4NASA 2EBGA 1UEVA 1IBKF 3J81U 1QVFR 2QA2A 1SL1A 1Q16B 3E01B 1RE1B 1YNNA 3S1QK 2RH3A 2ZEJA 4IQXA 3EZOA 5HQLA 2OP5A 4MMOA 2MJNA 3H42A 1N5YA 3QAEA 3CCVS 4NWBA 1TTHB 3KMSA 1K47A 2IMOA 3KDOA 1JQGA 2B0GA 2FZCB 2GCFA 4GMKA 4Y3CA 3OTOJ 4Y52C 5CYQA 4NCAA 3PKYA 1WOSA 3FFIB 3OREA 4UQTA 5EDWA 1L3TA 4JYAF 2BJ9A 2NVTC 2XGPA 2OPPB 1QE1A 2HIQA 4QYZJ 4YS2A 3PYDA 4DS5A 2Z2LA 4QIFA 2HS0A 1U6ZA 2ZC3A 4TU7A 1J2VA 1ZS6A 2K7KA 3GILA 2E7XA 3M9MB 4LF9F 1GMWD 1TKZA 3SZZA 3M3YK 4Q7AA 4J9UE 2B7CB 3M8YA 4N76A 4YB7A 2Y1RI 3TP2A 4FKXA 1G7CB 2FYXA 1PJ6A 3EE3A 4ZJQA 3EZUA 1N33J 1XWLA 2CDQA 3TAQA 1BXNA 2FJDB 1QDUB 1SV5A 5B09A 5D4DA 3OUYA 3PO5A 1VQYA 1Y9OA 3OL8A 3KLEB 4FPIA 3BDPA 4W92B 3QJJA 1I6HK 2OPRB 2VPYB 3DGPB 4Q5SA 1NEEA 2ZBQA 3S1NK 1S5ZA 1WOOA 1MMNA 3OR2B 4LF8F 1LWFA 4BC9A 2HVIA 3B6BA 1IJFB 2DGTA 3D9BA 3GIJA 3T6BA 2KI2A 2KYZA 3MCSA 3GYNA 5F8GA 4J91A 3CVKA 5KFXA 1WC6A 5ETPA 3JXOA 4P2XA 4XK8C 3S15K 1YBTA 3GTKA 3R1LA 4ZDNA 4JI7F 2XULA 3G2XA 3M6VA 1UETA 3VZHA 3IM9A 1S57A 3M2RA 1EI6A 3GTJA 3KG1A 2MZQA 2WOMB 5HQ8A 1TK0A 4P7VA 4G7HA 2FJWA 3HHLA 1KSPA 1NLKL 5C25A 2E5HA 5AXKA 3NL0A 3CPWR 3C14A 5CYMB 3UNGC 2KTQA 4DPOA 3LWMA 2VC0A 1IKYA 2WZ1A 5J1EB 1C4CA 1TVRB 5CHPA 4JB8B 2Y0BB 1R89A 3NRBA 3PO4A 2JA8C 1E6VB 4J9SA 3AD8C 5BYRA 3PHEA 2D3OR 3QLHA 3CDAA 1TK5A 3OVBA 3GTOK 4BY1K 1NAQA 1S0NA 2J9CA 3FQLA 2VZ9A 4OZ0A 3Q8UA 2FC8A 3NUHA 4ZVGA 2UUWA 2DK2A 1TWAC 2HHHJ 1RT7A 2XWYA 1RKJA 2E2IK 1RAFB 3NBPB 1KQSR 1RHKB 2QLXA 2X1FA 2RSQA 1JLGB 3BGUA 4Q4ZA 4A3CC 1TWCK 1RBOB 1WQHA 3KNAA 4R5PB 3UR0A 3MM9B 3OR2A 3JSYA 3NNCA 3TZYA 1KS2A 5E3AA 3WDOA 3BV8A 4ZVOB 2N4DA 3HOZK 3AXMA 2CNLB 2MEWA 4P52A 1SFOC 1RJJA 3KLEA 5HLFB 4A8SA 2NPIA 5E3CA 1VRUB 3MMCB 1QTMA 2QL7B 3SSSA 3FHZA 2QE5A 3FC9A 4NLQA 4CT8A 1UFLA 4FXWA 2FVPA 4WF9Q 1WC5A 1LWCB 3ILOA 1S1TA 1F9EB 2BANB 1IR0A 3MEEB 1EIYB 5FDLB 1PAUB 1AUDA 1B99A 4A93K 2J8SA 2DHAA 3NEKA 2GMHA 4DR5J 1FKAF 2GC8A 1FO1A 4DUYF 3ZZYA 3GTMK 4KV8B 2B5JB 4YB1P 1HBUB 3DFEA 2XCAA 3KUEA 4HR2A 3FEYB 3RAMA 2AGQA 4M94A 1IBAA 3H5UA 4XPCA 1YX2A 2FVCA 1NJZA 1SCJB 4ID5A 4EU0A 5IYCC 2YH0A 2ZD1A 3QT6A 3K7AC 1HHSA 4OIPA 5B0FA 2YBVA 2G2OA 2B8QA 2R93K 4O4RA 2W7VA 4NZ7A 4DR3J 2ZH9A 1TL1A 1HI8A 3NY0A 4U67Q 2G4BA 2X1AA 4LF6J 1FXDA 1RU2A 4F0MA 2AQ4A 3OXFA 1JNRB 3HPOA 3FUYA 1S9GB 3GJTB 1SKRA 1WNEA 2ZOFA 4HACA 5C3EK 3KLFA 3EPGA 4ZVRB 2F3JA 3IWLA 2RD5C 2J7KA 3WX4A 3AOCA 4ZP7A 3OEPA 3QT5A 1EP4A 2IM0A 3GV7B 1HBNA 1X0FA 2UVWA 2JLEA 2XMVA 4IRDA 1JWWA 3ZXWA 3ZTPA 2OEKA 4CO5A 2OPSA 1S1WA 5K8NA 4BXXC 4FNIA 5IP9K 3R9LA 2AGPA 4OI4A 3IGNA 5K14B 4PWDB 4O3NA 2JOQA 2PN6A 5HVFA 1VOMA 1TL4A 4M5DB 4PPDA 2CQ3A 1Y0HA 3P5BP 2C2EA 2FLNA 1ITPA 4DV3J 4JUZA 3ETOA 1ACMB 1RUSA 4OFZA 3EPIA 1S6UA 4I2QA 2GIRA 3RJMB 1TWHA 3MR5A 4WXOA 3RW6A 2NVXA 4NLYA 1RHJB 3G82B 4LSZB 1TL3B 2JA7C 3M6WA 3S0XA 2DNMA 4M95A 3QAUA 3DOLA 4EBCA 4KJIA 1M1GA 4TKTA 1WKLA 1Q7YT 4K4UA 2FVRA 2VDHA 2LQ9A 4JV1A 1XBWA 3ZNJ1 2IIHA 2R8HA 2J5AA 4ZPWR 3NNAA 1RHQB 4XTTA 1F6TA 4NXMF 1NDKA 3S16C 4KGXB 1U8SA 2Z30B 1IQZA 1DAXA 1S6PA 4UOCA 3F73A 5IYBC 4OI3A 2IVFB 3VQSA 4I7FB 2XQCA 1D9AA 4WFYA 3VAJA 4WZQA 4RNFA 4R8UB 3SFGA 4FBUA 4NLDA 4W98A 2VKRA 4XPEA 3BH6B 3N0VA 2B56A 1FNXH 2DNOA 1U1PA 4AUKA 2JL9A 1TWAK 2I1RA 3W64A 5HVHA 3N01A 4RJVA 3G86A 2P5MA 1WD6A 1ISEA 3TVYA 3LPEA 4OYBA 4UOFA 3PW2A 1C0AA 2AF6A 3W63A 3NLCA 2DYAA 4ELVA 4ANCA 3HT3A 5KFWA 4R25A 2GVDB 1FRKA 4DV2J 4ALZA 2JA6A 4QR1A 2ZBIA 4HDHA 1FDBA 1S0OA 2YPYA 4GTLA 4LQYA 2HBYB 2VFVA 4P75A 4QOTA 1SFOK 1I50K 1PC4A 1TWFK 4KO0A 4RW8B 3IAM9 1G4CA 2DRBA 3MM7B 1SJFA 2XCQA 1VQ9S 3SXLA 2Q1LA 1WKKA 1WC4A 2NREA 3FSXA 4P74A 5E3PA 2E2JK 3S8SA 5KT3A 2LKZA 3TUJC 1ZOTA 2LMIA 4HTIA 2BQRA 1VQ8S 4HL9A 3MM5A 1N36J 3MXHP 6FDRA 2QMWA 1NK7A 1RT5A 3VAGA 4RW6A 1R9TK 1EETA 1U24A 3DN9A 3ZTOA 1O29A 1HPZB 1DTTA 3DRSB 4C3IC 4DR7J 4NLXA 3H7HB 2EFQA 1RT6A 5EN1A 2DNLA 2BRKA 1CULB 4I2PB 1BUXA 2RS2A 3FNNA 3V4IB 2NVQK 1WI6A 4DX7A 3FVYA 3CXCR 1HNXF 2BE2B 2X1BA 2L48A 3A3PB 2PE8A 4F02A 3TAMB 2R93C 3I96A 2C22A 1VQPS 1Q95G 3S1TA 1CQMA 3MFIA 3CGIA 3SMZA 2KYXA 2FVQA 1C1CA 2ADCA 2QO3A 1GFWB 3H0GA 1Y1VA 3HOWC 4OYOA 2V2QA 1N32F 1IBMF 2GSOA 4KARA 5AXNA 1AYEA 1B64A 1SJRA 5B0CA 1ZZFA 3OPFA 2DT9A 5DM6Q 3HSDA 1DLOA 2YKAA 3GR1A 4DR6F 3NGRA 1R8AA 1Y10A 2Z57B 1T94A 4ZCMA 2PIIA 3J7A1 3M4XA 1YZ7A 1MROB 1S7IA 2FQTA 2UU9F 2H54B 1DQ8A 5E5NA 4BXXK 2MKSA 3BKUA 1REVA 4X4OA 2PEBA 3TJ8A 2NZCA 2PPBA 2PC6A 3GTQA 4PG5A 1R0AB 3I82A 1A7GE 1F5CA 2ZDOA 1K83A 2F9JA 3HMJG 1Q78A 1FI4A 4O0IA 2K2PA 1UP1A 5HN0A 3KK1B 3TUPA 5DS7A 2LA6A 2NZ4A 4F4AA 5AXMA 1NPKA 3D54A 4FNHA 3UQSA 2QYCA 4ELUA 1KTVA 1S77D 2RT3A 5J2PA 3I4NK 2HWTA 2NYHA 2PEHA 2ZWOA 1JLFA 2AKWB 4NRTA 5JXSA 1V5IB 3CCWA 4ZPBA 1BS2A 4WFBQ 4LF1A 1VQOS 5KOWA 3I9V9 1RWNB 3AH5A 2FHKA 2Z58B 3T5LA 3QRPA 3QMQA 1EARA 3ITHA 3K57A 4CZCA 5D77A 3ZZZA 2XG8A 2H48B 1IS1A 4MKAA 3N6LA 4CM2A 5IYBK 3GIMA 2BACA 1NJXA 4GVBA 1IM6A 3CE8A 2FC9A 3EQLA 4B3TF 3D0HE 2J0QD 5JVGQ 4IRCA 3K5MA 1TU0B 3JQJA 1G1XA 4NXNJ 2HNYA 2NVXK 5LM7E 2HMIA 2A6MA 1J6VA 2KO1A 1KQGB 3TVZA 2WAQD 3QO9B 1HBOB 3PV8A 3Q2SC 2BW7A 2EFNA 4CQ1A 1RBLA 4ILMA 2HVEA 3MUTP 2UUAJ 3PX4A 2COLA 3TJAA 3THTA 3EXYA 4ECZA 3MMBA 1OPZA 2R2UA 1EQ0A 2J7UA 1X5TA 3BKFA 2IMWP 3S1NC 4YR0A 2BJ1A 3MEDB 1VJWA 4DFKA 1P6TA 3OFFA 1BQNB 3NWRA 1ZETA 2CQ4A 4F3MA 3D3BJ 2V9WA 1VS3A 3RW7A 3BQ1A 2XEXA 4KPCA 5M5YK 1S9EA 2MZRA 2HFUA 3CJQA 4IFVA 4KH1B 1L3KA 4XAKA 3LO3A 4UOGA 3NXZA 4LVOP 3CCSS 1APSA 1O28A 4DSLA 3G6VA 4KYZA 5HROB 3CJ3A 4NA1A 4B3OA 2GJFA 4KFBB 5C4JK 3QIDA 2R8JA 4QCLA 4KM8A 1B0PA 3H3VD 2A6EA 5F9LA 4DL7A 5KFZA 2HHUA 3KLIB 5HK4A 1I50A 1LV5A 2H5EA 1FKOB 3E51A 3AH6A 4OX7A 2BMBA 1WF0A 2ZVIA 2MB0B 2IHR1 3BR8A 2QGFB 5A8WB 1UAWA 4IRKA 3MHYA 4FYYB 3ENWA 4ECUA 2W1BA 1DJ0A 4B9VA 4C11B 4G1IA 1N5QA 4LF5F 2OHDA 1YHQS 3UN5A 4A3GK 3V2UC 1XMQJ 3VGTA 1B4BA 4LR7A 1CVJA 2LFVA 3CJKB 4PXEA 1VBZA 2RILA 1KOHA 3H90A 2WW8A 1NJWA 1XZPA 4J9PA 2VF3A 4WKYA 2HHXA 2H51B 4YDDB
chains in the Genus database with same CATH topology
1XZQB 3A8IA 1XZQA 1PJ6A 1WORA 1WSRA 3GEIA 1PJ7A 3GIRA 2GAGC 1VLOA 3AD7C 1YX2A 3GEEA 3TFHA 1V5VA 4PABA 2GAHC 3TFJA 3ADAC 3GEHA 3TTGA 1VRQC 1PJ5A 1WOPA 1XZPB 4P9SA 3GSIA 3TFIA 3A8JA 3A8KA 3AD9C 1WSVA 1XZPA 1X31C 4PAAA 1WOOA 3AD8C 1WOSA 5L46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XZQ B;  3A8I A;  1XZQ A;  1PJ6 A;  1WOR A;  1WSR A;  3GEI A;  1PJ7 A;  3GIR A;  2GAG C;  1VLO A;  3AD7 C;  1YX2 A;  3GEE A;  3TFH A;  1V5V A;  4PAB A;  2GAH C;  3TFJ A;  3ADA C;  3GEH A;  3TTG A;  1VRQ C;  1PJ5 A;  1WOP A;  1XZP B;  4P9S A;  3GSI A;  3TFI A;  3A8J A;  3A8K A;  3AD9 C;  1WSV A;  1XZP A;  1X31 C;  4PAA A;  1WOO A;  3AD8 C;  1WOS A;  5L46 A; 
#chains in the Genus database with same CATH topology
 4DV6 F;  2V6A A;  2WVB A;  3IPJ A;  3D1O A;  1I3Q C;  1RAI B;  4ED3 A;  4TU9 A;  5KG3 A;  3VVT A;  3RR7 A;  4ZPD A;  1TL7 A;  4KGZ B;  5DET A;  1H2T Z;  4CO4 A;  1M5O C;  4RBT A;  1JXV A;  1VQ4 S;  1TEL A;  2R7O A;  1EHW A;  1XR5 A;  3FK4 A;  1N48 A;  1U6B A;  4X4S A;  3SYZ A;  1X0P A;  2VH7 A;  1O26 A;  2XSJ B;  1LW2 A;  2Y8Y A;  1IW7 A;  4Q45 A;  2RRN A;  2BUN A;  3T5H A;  2C2M B;  4D3H A;  2ZWP A;  2MY8 A;  3DXB A;  3KLV A;  5C44 C;  1RLC L;  3ENA A;  2KM8 B;  5DO2 A;  3I4H X;  1ZYQ A;  1PYO B;  2HHW A;  5LSR A;  3NP5 A;  2Q43 A;  3ET6 B;  4PPZ A;  4I56 A;  3VF0 B;  1H98 A;  4ED4 A;  2NVY A;  2PI5 A;  3GTM C;  3CO9 A;  1JLA B;  3V6D A;  3M2U A;  3ZZ0 A;  1B70 B;  3QIP A;  3EVW A;  1QUP A;  2W4C A;  2CPF A;  4P9S A;  2EFV A;  4HHH A;  2P8I A;  4DQI A;  4YFN A;  1SJ1 A;  1IBK J;  2JVR A;  2DY9 A;  4PWW A;  3FRY A;  1L0W A;  1HKA A;  1U6F A;  4DN0 A;  4JI1 F;  4WJ4 A;  1HWJ A;  4LR9 A;  2RU9 A;  5JJB A;  2DEJ A;  2I5J B;  3N6N A;  1E6Y B;  1NZ8 A;  4BBS C;  2XB2 D;  1FRL A;  4IG0 A;  4ZPT R;  3H5X A;  5HJY A;  1IKV A;  5KG6 A;  3TA0 A;  2YNH B;  1D1U A;  1NCL A;  3FQK A;  1BMQ B;  4TYA A;  2UUC F;  2RDJ A;  4DR4 F;  3I0S A;  4C98 A;  2HND B;  2JNJ A;  2YQ3 A;  1KWM A;  4CO2 A;  5GAH I;  4DQR A;  1RCX B;  2OAU A;  5E33 A;  5LMN F;  4CO3 A;  4YME A;  1TMM A;  4DJB A;  3MEG A;  1FFS B;  1NH7 A;  1YQH A;  3D0G E;  2A10 A;  3AOD A;  4DR1 J;  1YJW S;  2NLW A;  3HZE A;  3DLG B;  4U8V A;  4QWA A;  5F8J A;  2U1A A;  5CA5 A;  3IRW P;  2OSR A;  2VPX B;  2OPQ B;  5IP7 C;  2YWW A;  2MQL A;  2IRY A;  3CIM A;  3OFH A;  2LEC A;  3IR5 B;  4DX6 A;  4P71 A;  2BM1 A;  2ROP A;  2M2B A;  1UV7 A;  3RB4 A;  4WU3 A;  3CO0 P;  4QR2 A;  4Z7Y A;  2M4M A;  4KHM A;  4ATN A;  2ATL A;  2KB2 A;  3PEJ A;  5KG5 A;  5HP1 B;  2W9B A;  4LOW A;  1FVS A;  4QJV B;  3B8H A;  1UVM A;  2HLT A;  3DC2 A;  4DOZ A;  3KLH A;  4KC6 A;  2YU9 A;  1M5S A;  3KJF B;  3AT1 B;  2VV5 A;  2Y0S L;  2Y1J A;  1T05 A;  1N32 J;  4MKV A;  2HBR B;  3FKB A;  4H4M A;  1T9Y A;  3VAL A;  2UUT A;  2EW9 A;  3L7O A;  5D4O A;  4PG7 A;  2OD6 A;  5HMZ A;  3Q0A A;  3G4C A;  3IP0 A;  4TY8 B;  3FCV A;  5CYJ A;  1HNZ F;  1WEX A;  1F2G A;  4OLP A;  4N47 A;  1ZM4 A;  4WFZ A;  1YTY A;  2AWZ A;  2UVU A;  3O1L A;  4PXB A;  2V6S A;  3Q8V A;  2E2I A;  1FRX A;  5ETT A;  3OR1 B;  1LWX A;  3EDR B;  3GR0 A;  1RAD B;  3NAH A;  1HQ2 A;  5GAD I;  5F8M A;  3KWM A;  3C6U A;  3PW5 A;  4A3D C;  4BKW A;  2M3D A;  2CPJ A;  2HFZ A;  2DXD A;  2YQ0 A;  1RT1 B;  1GE9 A;  4NEZ A;  3CWJ A;  1JXL A;  3H2U B;  4LVN P;  5A8K B;  3W2W A;  4PR6 A;  3AD7 C;  4LRA A;  3HSJ A;  3PR4 A;  2O5D A;  4NCG B;  1QJH A;  1AXQ A;  1N52 B;  1LK7 A;  3LP2 B;  1WIH A;  5ETN A;  3HD1 A;  5CZX A;  3MR7 A;  2CQC A;  2D9O A;  1JLB A;  1XK8 A;  3B4D A;  1FNO A;  1RDR A;  4USI A;  1K1Q A;  3HJV A;  3A4T A;  2M70 A;  3NGT A;  1AUS L;  3FBE A;  4ED5 A;  2PA3 A;  3I0R A;  3LAK A;  2D3Z A;  1Z2Z A;  3HSG A;  1TAU A;  1LOU A;  1TWA A;  2KVQ E;  2MZ1 A;  4YEA A;  2CQB A;  3Q8R B;  3DYA A;  4F26 A;  4QYZ K;  1S79 A;  1CJU A;  4CO0 A;  3KOA A;  1RWW B;  2M9K A;  4YFU A;  3ILL A;  3J7Z 5;  4L76 A;  4A8O A;  1JIH A;  4LF4 J;  4NYZ A;  2DNG A;  4ITS A;  3C6T A;  4D3G A;  1NSP A;  1U0H A;  5J1N A;  1J6W A;  2LXF A;  3EGV A;  2IA6 A;  1KHV A;  4N77 A;  4TNO A;  3T1A A;  2KT5 A;  4CTA B;  1CBK A;  1D8Z A;  4KGK A;  3M8Z A;  1ZTT A;  3PY8 A;  4RNM A;  3DLK B;  4K4T A;  4WWS A;  1HQU B;  3V81 A;  1ZYR A;  2DPI A;  3PAC A;  2BOA A;  4F4X A;  1MNE A;  2CVI A;  4L73 A;  1YDL A;  4QJV A;  5L9X A;  1NO8 A;  3LP1 B;  1SPB P;  4G1Q A;  1BQX A;  3CCJ S;  3U02 A;  2QMX A;  1IN0 A;  1EAY C;  4KQZ A;  3DM2 A;  4YFK A;  1JNZ B;  4L3N A;  1AT1 B;  3TWZ A;  2HBQ B;  2UZA A;  2ZNZ A;  3DLG A;  1F3F A;  1Y1W K;  4TXS A;  4AFF A;  2AYG A;  2PSZ A;  4OHV A;  3R2C J;  6FD1 A;  2NSB A;  4A3M K;  2DBB A;  1CC7 A;  3T9N A;  2ZHA A;  3EGZ A;  3GSI A;  4DI6 A;  1IL2 A;  2E2H C;  2G2Y A;  4OZ2 A;  3KG0 A;  1IQ0 A;  4P2S A;  2XNR A;  4OZL A;  4JYA J;  7FD1 A;  1NSQ A;  2MKK A;  1BD6 A;  4OX9 J;  1YRU A;  2JEJ A;  4A93 C;  1MMD A;  4IKA A;  2DD8 S;  3OXG A;  4F67 A;  3UVJ B;  2CXE A;  1O5J A;  2ZH3 A;  3CD6 S;  5A6P A;  2ZFZ A;  1RAE B;  3TFI A;  4AL5 A;  3PG9 A;  2XTJ P;  4FPR A;  2XYP B;  5KOX A;  2HHP A;  1T9T A;  1IQT A;  2D69 A;  2VG7 B;  3D5M A;  2KRR A;  2KHD A;  2DKO B;  2I0X A;  2LXU A;  3EXC X;  2PDA A;  3SSR A;  4JV5 J;  2KFN A;  3I4P A;  3GTQ K;  3TAN A;  4RNH A;  5RUB A;  1YJU A;  1KFD A;  2CJY B;  1HWK A;  4A3L C;  2YKP A;  3KK3 A;  2XHW A;  4J9L A;  3LA0 A;  1R43 A;  1HAR A;  3ZO7 A;  1WKJ A;  4USU A;  2DGV A;  2LU1 A;  2NVX C;  1T3O A;  5KFC A;  3MCN A;  2XLK A;  1R7I A;  4WJ3 M;  3HHL C;  2GQC A;  2E9Z A;  1X4F A;  2HQF A;  4ZJL A;  4USM A;  2P5V A;  3DRR A;  5IWA J;  1QAJ A;  4K4S A;  2GIF A;  2QIF A;  4F4Y A;  4MT1 A;  2ZOG A;  4P7T A;  1X60 A;  4CLT A;  3DRY A;  2HLU A;  1FE4 A;  3KHG A;  4OYW A;  1WCM K;  3V5R A;  3T5K A;  2HBZ B;  3MCO A;  5CAA A;  1FES A;  2YNG B;  1FCA A;  1RT3 B;  3TYT A;  2I2Y A;  4A8F A;  2ZC4 A;  2QSF A;  1NH8 A;  5IT0 A;  2R7X A;  3J81 Y;  3UD4 P;  5KFY A;  5K20 B;  5JVH Q;  5KT2 A;  2GHP A;  4YOE A;  4WFX A;  2DGX A;  1XPP A;  3H40 A;  4DF8 A;  1JJ2 R;  3M4O C;  2RF2 A;  2ZH1 A;  1T7P A;  3QFW A;  2V68 A;  1T02 A;  1SKW A;  2I8E A;  3LF0 A;  3OFG A;  4C11 A;  2HNZ B;  2JLG A;  1S6Q A;  3U1L A;  2QA1 A;  1DCH A;  1RTD B;  3CCE S;  1JLC B;  3NCQ A;  1ZAW A;  2BM0 A;  3S16 K;  3FEZ A;  4EBD A;  4GZY A;  2ROE A;  2BJD A;  1HR0 F;  4S0M A;  1TV6 A;  2JA5 A;  3CJT A;  3HVA A;  1LWE B;  3T3F A;  3KK2 B;  2LVW A;  2KDO A;  1UZH A;  1N54 B;  3MUR P;  5C42 A;  1KLM A;  4OYI A;  5D8H B;  4M1X A;  2C3U A;  4JI3 J;  3DMJ B;  4DL5 A;  4K5S A;  1XNR F;  2ZFH A;  1NJI T;  5LJ5 Y;  3MAA A;  5KFO A;  3RAX A;  1NDC A;  2HG4 A;  1ZZN A;  4HH1 A;  2ZIT A;  2E5G A;  5D0E A;  4BBR K;  1RHU B;  3M8S A;  2EPI A;  1XR6 A;  5KG1 A;  4F0K A;  1HQM A;  1TKT A;  3LP0 B;  2IJR A;  5LT5 A;  4HKQ A;  4RU9 A;  1JKH B;  2EKY A;  3A8I A;  2CPX A;  1FX4 A;  4KM9 A;  2FZG B;  3DDK A;  3VA7 A;  1NK9 A;  4KMU A;  4AXI A;  3CC2 S;  4ANE A;  2K06 A;  1RYS A;  3SSQ A;  2UXC J;  2YVS A;  1XMO F;  3HHN B;  4L6V 3;  1RAJ A;  3CJS A;  1IVZ A;  2V94 A;  2RKI A;  1HIY A;  2PMH A;  2R7S A;  3PRV A;  5B0E A;  1X4C A;  4USH A;  3M2V B;  2E2J C;  1NHK L;  4OI6 A;  2UXC F;  2VG6 B;  4MQ9 A;  3DDN A;  1DZ5 A;  1RWM B;  3GYG A;  2HSE B;  1HNI B;  3AOB A;  3UDC A;  1HBO A;  2ZUE A;  1CEZ A;  4G7Z A;  3IMQ J;  4OYP A;  2BE9 B;  1O6X A;  4DCJ B;  2AYB A;  5IS2 A;  4J9M A;  4K0K F;  2JH3 A;  4RR5 A;  5FLX U;  1JLC A;  3ZTS A;  3MR2 A;  2RQC A;  2GW8 A;  5E3R A;  2B7B B;  4DCP B;  5I3U A;  1T0T V;  4DV6 J;  2N3O A;  3OLB A;  3O2I A;  4Y65 A;  4Y2I A;  4PKD B;  2L9D A;  1P1T A;  3CQZ A;  3FSY A;  2P8T A;  5IOL A;  2J8A A;  3CT9 A;  1JOE A;  5GMK a;  2M52 A;  2ZE2 A;  4ZCI A;  2WTF A;  5DQH A;  4LIW A;  4LF6 F;  1VBK A;  2OEM A;  2RE1 A;  2IAJ B;  1F9N A;  1Y1V C;  2XMW A;  2O66 A;  1ICE B;  1PBU A;  1RIS A;  4USW A;  1XEZ A;  4GKK F;  4O3S A;  1FRJ A;  2HHQ A;  5B0G A;  1UVN A;  4OHX A;  5DG9 A;  4DMZ A;  5HSP A;  3R1H A;  1FHT A;  4I64 A;  4J5O A;  1RAC B;  4M63 A;  3CDU A;  4OHW A;  4NMX A;  2IJN A;  3G96 A;  5B0D A;  8ATC B;  2LQB A;  4CRJ A;  1LW0 B;  1F2H A;  3HOY C;  4OZ5 A;  2AD9 A;  4LFB F;  4ILD A;  4LQ9 A;  1YJN S;  1XIQ A;  2CKW A;  4C3J C;  2FTR A;  2ZUA A;  3CQZ C;  1M1H A;  1DAR A;  3VZI A;  1NKC A;  3NG8 A;  1O2A A;  5ADZ A;  2B6A B;  3NCP A;  2NXN A;  3V4G A;  2DNK A;  3V6H A;  4P2M A;  1UVI A;  1X31 C;  4DS4 A;  2XI3 A;  2FGC A;  2HWH A;  3ADA C;  3FMW A;  4ECX A;  4IG3 B;  2MY7 A;  4F0H A;  3IBW A;  1NB7 A;  3GTP K;  4JK1 A;  1K0V A;  3W2V A;  1U09 A;  1DTQ B;  2J6U A;  1S99 A;  1VQM S;  2ZH7 A;  3TI0 A;  4DPX A;  2EC2 A;  1C0T B;  3HF5 A;  4WZM A;  5M2R A;  4F8R A;  4F7V A;  4G0V A;  4KB4 A;  2VPZ B;  3HFZ B;  5DLF A;  3S17 K;  3R5B A;  3BQ0 A;  2DGW A;  2GS8 A;  4CLY A;  5B0A A;  5E0O A;  3U1M A;  2N7C A;  3UW1 A;  1RP5 A;  4DX8 H;  1Q82 T;  1LNQ A;  4OMF G;  2PT0 A;  1UWB A;  3O8W A;  3MOZ A;  4K50 A;  2V6T A;  2W7O A;  1U1N A;  1RT2 A;  2P6T A;  1HFE L;  3GEI A;  3NMA A;  2V8D A;  1RHM B;  4KHP J;  4I6Y A;  2M0G B;  4C8O A;  4NLU A;  2WVF A;  4O4G B;  3QRR A;  2LEP A;  2JJ4 D;  3C15 A;  1XJW B;  2UV8 A;  1Q86 T;  4MEX A;  4A3D K;  4C8N A;  2CG8 A;  5C7P A;  2QTW A;  1FER A;  2E2I C;  1G6B A;  1T9U A;  2B4P A;  4EFA C;  4A3K K;  3D6F B;  1LXJ A;  5KFP A;  2FHM A;  1VQS A;  1SJ3 P;  3G8Q A;  3IN5 A;  1WHW A;  3JQM A;  1XN9 A;  2RQ4 A;  3DM2 B;  2JSX A;  3OL7 A;  4AXJ A;  5D0G A;  3HVT B;  4LJZ A;  2XGQ A;  2BE5 A;  3PW7 A;  3CTR A;  3SQO P;  4ZMM A;  4DL4 A;  2CVE A;  4KRW A;  1RWV B;  2UUC J;  3FGV A;  4MFB A;  3JTO A;  4ZPV R;  5KFS A;  3KNG A;  4PYD A;  2Y3P A;  1WAC A;  2OIH A;  1RTD A;  2DXF A;  3LOU A;  3KJN B;  2F8M A;  1RAH B;  3Q8S B;  2CPE A;  1RU1 A;  2POK A;  5KFF A;  5KFU A;  3DLK A;  3UDV A;  5KFT A;  3NGU A;  5K8M A;  2KXH A;  2B51 A;  3VAI A;  3PVX A;  1U26 A;  2CZ9 A;  4PAB A;  2RUG A;  4X4P A;  2KN4 A;  4K59 A;  2BYC A;  1QAI A;  1I5O B;  1EKR A;  3I5A A;  1Q5Y A;  5JUM A;  4O3O A;  2AJQ A;  3AAW B;  3AJD A;  1R9T A;  1D9F A;  2XLI A;  2K1R B;  1EX8 A;  4UOH A;  4OZ3 A;  2M88 A;  4C8L A;  3A8K A;  1FJG F;  3ZTR A;  2LQJ A;  2XZD B;  4MAK A;  1YWX A;  1HI1 A;  4I69 A;  1VQ5 S;  4PXD A;  4M5G A;  1IWG A;  4WYW A;  4ZJO A;  4GKJ J;  3QSY B;  4FF3 A;  1N6Q B;  3UFC X;  2B43 A;  1IJE B;  1N33 F;  1G51 A;  3D6H B;  2KM8 C;  2R7Z A;  2PI4 A;  4B9N A;  4DWI A;  3GFZ A;  1Y1V K;  1NSA A;  4OX6 A;  1YIJ S;  5HQM A;  4PQU A;  4DV2 F;  5KG2 A;  3CCL S;  3LP2 A;  5JFE A;  4ID8 A;  2A18 A;  3KK3 B;  2K7J A;  5C3E C;  4K4Y A;  3MML B;  1S6O A;  4A8X A;  2YKN B;  3DOM B;  1WHX A;  5J2M A;  1Q4R A;  1I3Q K;  1N6Q A;  4JBC A;  3TZZ A;  1YRX A;  1ZH5 A;  3POT A;  3PXG a;  4GTD A;  2DR7 A;  1USM A;  4A3M C;  5K14 A;  2Y1I A;  3JS9 A;  2ASD A;  1EKS A;  4GT9 A;  4YR2 A;  4LFB J;  3KJV B;  1S1W B;  1GX6 A;  1WC3 A;  4DUZ J;  1K1S A;  3I32 A;  3IC1 A;  2H5J B;  5J2N A;  1S9F A;  3D7S B;  3BBF A;  2VL1 A;  2HK2 A;  5ETL A;  2V69 A;  2J0W A;  4L72 B;  3PKM A;  3UCZ P;  4NLW A;  3TEG A;  3GTK C;  5L1K A;  1UPM B;  1S9G A;  1HNW F;  2E9R X;  3HHE A;  3R8Y A;  3ONQ A;  4J9N A;  3BSA A;  3P96 A;  1SH3 A;  4CO1 A;  3K5L A;  5IZH A;  4RL1 A;  2PFF B;  4QYR A;  1URR A;  3FBC A;  4KH0 B;  1QAX A;  1IUJ A;  5L8R C;  3GTQ C;  4NXM J;  2QA4 S;  1TWF A;  3CNQ P;  3CCR S;  3T6J A;  2B5J A;  4PUO B;  1FJ7 A;  2D3U A;  1UW4 A;  4A3F C;  3NKY A;  4JP8 A;  2VKZ G;  2O5I A;  2KVI A;  4J7C A;  3S2D C;  3GFH A;  1BWV A;  1B0T A;  2PA8 L;  1RTH B;  3W9J A;  2CFA A;  1LFP A;  3M9N B;  2GX8 A;  4ZLP A;  4ETZ A;  4UY8 T;  1VGY A;  3DHW C;  4Y28 C;  2AMC B;  2IM3 A;  5IM0 B;  3CJ2 A;  1GXL A;  3PRD A;  1UJ5 A;  4NX9 A;  3HJF A;  3DRP B;  4DUZ F;  4FBT A;  5SZT A;  1Q81 T;  3I0S B;  3V81 B;  1VQ7 S;  4OHZ A;  1MWY A;  2P9G A;  2DNY A;  4OV1 A;  1F9H A;  5SUH A;  4WBF A;  1WEL A;  5GAE U;  1TR0 A;  3K89 A;  1SKS A;  2A2D A;  2V2Z A;  4EUV A;  1Y5I B;  2YNH A;  4DU7 A;  2E5L J;  3SEO A;  3ELH A;  5HLF A;  2MLY A;  3P6Y C;  1SIW B;  3BSC A;  1G3O A;  2HRU A;  5GAG U;  3BP8 C;  4O44 A;  4KT0 C;  5H1S V;  4C48 A;  4NCB A;  5L1I A;  3FJ2 A;  2MQN A;  2RIJ A;  3H5S A;  4MH8 A;  2LLZ A;  5C2C A;  1MML A;  5KT7 A;  3T1H F;  5AJ3 J;  2WSC C;  4ZVP B;  4N8N A;  3DYA B;  1T9V A;  3M2U B;  1DTQ A;  3MD1 A;  3OXL A;  4OV6 A;  4A8K A;  4DR5 F;  4DQS A;  2RDD A;  3DRX A;  3POT B;  3HOV K;  4FF4 A;  2KZZ A;  1NRK A;  3MTK A;  2QRR A;  4P72 A;  2FHJ A;  1S12 A;  4USV A;  2HFN A;  3M4O K;  2LEB A;  4IH5 A;  2XBP A;  3CJ5 A;  4J3N A;  5IQ6 A;  1EFW A;  1X5P A;  4HH0 A;  1LK5 A;  4BY1 C;  4EEY A;  4H4K C;  2VUM A;  2DCU B;  3CCZ A;  4DR2 J;  1TVR A;  3FOE A;  4CLL A;  1X9S A;  5T7L B;  2Y3Y A;  3W9H A;  2AZ1 A;  2D1C A;  4I6A A;  4NRU A;  4B9L A;  4LR2 A;  4K4X A;  5KG4 A;  4C8M A;  2LU2 A;  2HRY A;  3JTN A;  3TNV A;  1RT4 B;  2RU3 A;  2PD1 A;  1X9M A;  5I42 B;  3Q2T C;  4DR1 F;  4A3C K;  4M5H A;  3W8G A;  3M2R B;  3A12 A;  5KG0 A;  1KFS A;  3UNY A;  1FXL A;  1TL7 B;  1HD1 A;  1I94 J;  3HKZ D;  3KUG A;  3R5J B;  3HVR A;  3CCQ S;  2AU0 A;  1DD5 A;  1S1U B;  3EVO A;  2ZE2 B;  4OJH A;  5T41 A;  2YQ1 A;  3GII A;  2YXL A;  3T01 A;  5ETO A;  3M05 A;  4ZLN A;  3C16 B;  2Z2M A;  4A3B K;  3N0B A;  2BZ2 A;  5E2Q A;  1Z1Z A;  2HZA A;  1U7L A;  1OSC A;  5AT1 B;  4C45 A;  1SH0 A;  1T05 B;  2JFK A;  1FTC A;  2A69 A;  2OEJ A;  1WHV A;  3N9U C;  2KXN B;  5HO4 A;  4ZP8 A;  1N0U A;  4WP9 A;  4WKR A;  4C97 A;  1YJ9 S;  2ADB A;  1Y3J A;  3QGP A;  3KLH B;  3D3C J;  3H2V E;  2OPR A;  4X64 F;  1FJC A;  4Q44 A;  1VJQ A;  3ZZO A;  3MWB A;  2CQI A;  4DUT A;  3H20 A;  2ZDP A;  4GRS A;  2M8D B;  1A9N B;  1WOP A;  3QWU A;  1SV5 B;  3RB6 A;  4ZVT B;  5KT6 A;  1T9W A;  1KQ4 A;  2W9C A;  1H74 A;  1NUE A;  2VBZ A;  1DRZ A;  3KUH A;  3RBZ A;  4FYW B;  2RQM A;  5F8L A;  3MR3 A;  4B3O B;  1BJT A;  1UL3 A;  5KFB A;  3CF5 Q;  3TX8 A;  1YCL A;  2XZW A;  1TKZ B;  3N28 A;  5AXL A;  2JDJ A;  4IFY A;  4K8R A;  4NLG A;  4GKK J;  3GLJ A;  4JV2 A;  2D3O 1;  3UE2 A;  1GTE A;  4LSN B;  1CQN A;  1FE0 A;  1EH1 A;  3H25 A;  4KIA A;  3P5T L;  2MKY A;  4BWM A;  4ELT A;  2FGO A;  3ISZ A;  4Y2A A;  1RT2 B;  4KPY A;  1PC5 A;  1F5A A;  4HI1 A;  1WHY A;  4LF2 A;  2ZUG A;  5CYQ B;  4CLU A;  4Q0B A;  2BBE A;  1TWH K;  2FY1 A;  2MKC A;  3HOY K;  2WK4 A;  1RZM A;  1VI7 A;  1Y5N B;  2QLJ B;  1N56 A;  3H4D A;  2MZJ A;  2CQ1 A;  3D0I E;  1HHQ A;  1U1R A;  1WDT A;  1S59 A;  3A3O B;  3GFY A;  3JSB A;  4UT4 A;  1GH8 A;  1EJ7 L;  2YKO A;  4NLP A;  3GTG K;  2CJK A;  3CDW A;  4W90 B;  3KK2 A;  1D3W A;  3CCT A;  3V4M A;  1VYA A;  1EQR A;  3QZ8 A;  5C4X K;  1IWA A;  4CYU A;  2UXD J;  4TQR A;  3V6D B;  3W2V B;  1W2I A;  3TFH A;  2EG2 A;  4WP3 A;  3NWG A;  2IBK A;  5D0H A;  3H98 A;  3KHL A;  2HMI B;  1RAO A;  4IG3 A;  4YUD A;  3ET6 A;  2JRS A;  1SI9 A;  3EGW B;  4K5R A;  2AX0 A;  3PEH A;  1N8R T;  5KT5 A;  1YGY A;  2RF2 B;  3BZQ A;  2W2Q P;  1O2B A;  2G13 A;  4XLP A;  4WTY A;  2XWX A;  2CFX A;  4I68 A;  4CLW A;  2ERR A;  3MCM A;  2XY5 A;  2Z2Y B;  1WSR A;  4DSK A;  3CJ4 A;  1J5O A;  3N0C A;  2NVT K;  2PO4 A;  1LW2 B;  3VCD A;  3TZW A;  1N5V A;  1KD1 T;  2BKO A;  2ROG A;  1C0U A;  4X4T A;  1U2R A;  1RT3 A;  2BE7 D;  1MU2 A;  3S17 C;  1HR0 J;  4WJB A;  2A0F B;  2DGQ A;  1PIE A;  4DCO B;  5KFA A;  2HW3 A;  5LMU F;  2X7I A;  2LEA A;  5KFV A;  2GJI A;  4PG8 A;  1SFO A;  3H5Y A;  1DFD A;  2BQU A;  3GE9 A;  3DRR B;  2IVY A;  4U96 A;  4P10 A;  2Q79 A;  1JVI A;  1XZP B;  5CCL A;  1REG X;  5IT9 Y;  1U02 A;  1ZA1 B;  1CS4 B;  1J5O B;  3S1R K;  4NEY A;  4X4V A;  3ENV A;  1F93 A;  4ED7 A;  3CW2 C;  3KKF A;  4A8M P;  1VHI A;  1I6H C;  4E8U A;  4C4W A;  4TU8 A;  5D4L A;  1GMV A;  3H0G C;  2QN6 B;  4DV4 F;  3NS6 A;  5F0U A;  3HDS A;  1GMW A;  1YKW A;  4OIQ A;  2HGM A;  2R7T A;  1PYT A;  3ZZR A;  4LUB A;  5HAT A;  4IDK B;  2MMY A;  2RB7 A;  4Z37 A;  1IBM J;  1H73 A;  4QW9 A;  2W2M P;  4CYU B;  4YHH F;  4UW2 A;  2Z0G A;  1GNK A;  1SUQ B;  2CQP A;  2QZ8 A;  4F2S A;  1DHM A;  3B82 A;  2CPD A;  2OLW A;  3NS7 B;  4Y34 A;  2W7P A;  4O44 B;  1C4A A;  2B3T B;  4BLG A;  2NCK L;  3BO2 A;  1XXB A;  1FVQ A;  2OFH X;  3FOF A;  4Y7N K;  3KTQ A;  4Q0B B;  4A3I K;  4FZV A;  1KTQ A;  5LOQ A;  3PO3 K;  4RPF A;  4DFJ A;  4Y2M A;  4B02 A;  1HNZ J;  3HLU A;  2Z4P A;  2HIY A;  1IM4 A;  5BR8 J;  1YK9 A;  2UVR A;  2F7V A;  5E68 A;  4Z2X A;  1TKT B;  4YQW A;  2J0S D;  3MM5 B;  3BF4 A;  2XHC A;  4X4U A;  5IM0 A;  2VU5 A;  4RKU C;  1XZQ B;  4IFY B;  1QY7 A;  4WPA A;  1EZZ B;  4X66 F;  3MAA B;  4JI3 F;  2CFA B;  2E1M C;  3L7U A;  1RTI A;  1RTH A;  2RRA A;  4NE9 C;  4FVM A;  1K83 K;  3E2E A;  1MLA A;  4IOB A;  3S6E A;  4FM9 A;  2FQO A;  3LGN A;  1LWE A;  4G1P A;  3I87 A;  4BBR C;  5M2U A;  4BY7 K;  2HHH F;  3H4B A;  4LRE A;  5HVG A;  1V9O A;  3MAQ A;  4X4N A;  7FDR A;  2G0J A;  2H1Y A;  4ZLL A;  4EBE A;  1FNM A;  2HQ3 A;  4A3J K;  2HQG A;  5EUH A;  3GG1 A;  2EI5 A;  2E1R A;  4KAI A;  2B4V A;  2XCO A;  4AL7 A;  2FJB B;  4GTB A;  4KBI A;  1T8E A;  1H3D A;  2VAS A;  1VC6 A;  4J9V A;  5K8P A;  2CYY A;  3D66 A;  3WX8 A;  2V2V A;  3BO3 A;  1UJ6 A;  1RA7 A;  3MM8 B;  3C16 A;  4KHP F;  2V6U A;  1FWL A;  1S1U A;  4BCA A;  3OW2 R;  4R8U A;  4TLQ A;  5HMW A;  5C2G A;  2M7S A;  5J2N B;  4I7F A;  1VQN S;  3CIZ A;  3GTP A;  2A1B A;  1CJU B;  4C3M A;  2BA9 A;  3GIK A;  3QFH A;  3F41 A;  4DV0 F;  3CDE A;  3S7R A;  4DF4 A;  2VBW A;  3GIR A;  4BLA A;  1X4D A;  3ZFV A;  3RG6 A;  2AZ3 A;  1PYS B;  3THP A;  5M2P A;  2B9X A;  3WIV A;  4KAT A;  2QG9 B;  5T7L A;  3GJS B;  3IWN C;  2HYI B;  1TFW A;  1JLB B;  1HI0 P;  2EK6 A;  3SCL E;  3PHT A;  3H59 A;  3PYF A;  2ACY A;  5IYC K;  1FRM A;  3CCM S;  1UVK A;  3R5D A;  1VBX A;  4QQB A;  3A8E A;  3CD0 A;  4WCE Q;  3Q24 A;  1XR7 A;  1JLQ B;  2XO6 A;  1U1K A;  2MXY A;  2GZO A;  2I38 A;  4M5D A;  4DLG A;  3KHR A;  3C6U B;  2NR0 A;  5F8H A;  1TK8 A;  3T41 A;  1O51 A;  5CZV A;  4A8W A;  2OD4 A;  4KGM A;  4JOU A;  2P9C A;  4DLE A;  5KFE A;  2V67 A;  2E1A A;  1Y7P A;  3LAL A;  2KZM A;  2B63 A;  1TWC A;  2F4F A;  5LSL A;  2KL8 A;  4BLB A;  2QMU B;  2ZH2 A;  3RB0 A;  4KMA A;  4U7C A;  5KFG A;  3FZB A;  1TFY A;  3BS9 A;  5KFJ A;  4AYB D;  1ARO P;  3KLF B;  3KHH A;  5DDO C;  4X2B A;  4FYD A;  3MPD A;  2P9E A;  2FDN A;  3L3C A;  5D4N A;  1BWE A;  4XLN A;  3QPI A;  4JI2 F;  1TL1 B;  5D15 A;  3HHD A;  2AYE A;  2R92 K;  5ETS A;  1P9Q C;  1S1X A;  2W2N P;  2N3L A;  4FYV B;  2H5I B;  3L4K A;  3CMA S;  3MEK A;  5EGY A;  5DDQ C;  2ZD1 B;  4K7Q A;  3M8P B;  2XS2 A;  1B4S A;  4X4R A;  1UZD A;  1NKE A;  5HP1 A;  4ZVH A;  3HCX A;  2DHX A;  2ZBP A;  3DHX A;  3TR5 A;  2JA7 K;  4MFB B;  4RUC A;  5CXT A;  4CNY A;  3T19 A;  3QJP A;  3N5F A;  2CJX B;  2ASJ A;  1F9F A;  3FKI A;  3LUY A;  2A3J A;  4XDD A;  3K0J A;  5MAO A;  3L4J A;  3PX0 A;  1M5K C;  3SCJ E;  1BC6 A;  1Q8K A;  2R7V A;  1XNR J;  2FJX A;  2ASL A;  5DG8 A;  3HP6 A;  1VQL S;  1PO6 A;  2DNZ A;  4ZVF A;  3EX7 B;  3V6J A;  1LWC A;  2CAD A;  4R0J A;  1EK8 A;  2R93 A;  3C15 B;  1S1X B;  2V50 A;  2VOP A;  4NML A;  3DLL Q;  4NA3 A;  1B7Y B;  4JI2 J;  4DPY A;  3TO8 A;  2C42 A;  1KNZ A;  1AW0 A;  1VGX A;  3S1M C;  4OIO A;  2MKI A;  3TUZ C;  2Y1L B;  1VQ6 S;  1SL2 A;  2N82 B;  1NHV A;  3MMA A;  1FFW B;  4LSL A;  3L95 X;  1U0H B;  4ZVU B;  2IA0 A;  4YB6 A;  1KVJ A;  4DL6 A;  2NS1 B;  1XNQ F;  4V19 X;  4JI1 J;  3UWT A;  5C5J A;  1AB4 A;  3VAH A;  3GTL C;  2W8K A;  4DZD A;  3QIP B;  4EYI B;  3R7B B;  4M5L A;  5M3F K;  5DG7 A;  1V3R A;  3HM9 A;  4E2F B;  4YY3 F;  2MHE A;  4C2M A;  1MN9 A;  2XSF A;  2JHE A;  3C19 A;  5IC4 B;  4NLT A;  2J9D E;  2BV3 A;  3S2H C;  2UV8 G;  1O0P A;  2V4R A;  1SVD A;  2BKP A;  3RBX A;  2SXL A;  4ZLJ A;  4DFP A;  2HQD A;  3SZY A;  3DOM A;  1UW9 A;  1RQ0 A;  4WIQ A;  1MW7 A;  3VVU A;  3W1Y C;  4M5M A;  3ZTQ A;  4RZR A;  1XNQ J;  5MLC V;  3S01 A;  1UPP A;  4NCG A;  2LDY A;  1R9T C;  5J1E A;  2E1C A;  3QGH A;  4KMH A;  4DUY J;  4A3E K;  2AT1 B;  5C44 K;  2IM1 A;  3HVW A;  3BEG B;  1RT1 A;  3IR6 B;  1LW0 A;  2WRM A;  3D4J A;  3RR8 A;  1R3N A;  1KRP A;  2XLJ A;  2QLW A;  1LFW A;  5EGH A;  2AJ1 A;  1Q7L B;  4ER8 A;  2G9O A;  2GFF A;  3MDF A;  2FY8 A;  2OPS B;  3IM8 A;  4DL3 A;  1YG0 A;  5GAD U;  2G1H A;  2XMM A;  1OO0 B;  5IOQ A;  4B3M F;  1W2B R;  3RRH A;  3AXK A;  1X4H A;  5IXU A;  4MK9 A;  3R27 A;  1TUV A;  2GHW A;  2IJF A;  1Q8B A;  1WQG A;  2CWK A;  4N41 A;  1TWH C;  1HL6 A;  4C3H K;  2Z2Z A;  3RGI A;  4A3L K;  3G4A A;  3VWS A;  2VDI A;  1JB0 C;  1NME B;  3RZO K;  2VA3 A;  2YWE A;  4ZIW A;  4H4M B;  1LWF B;  1SJQ A;  5FII A;  4QZV B;  1C1B A;  2FHO B;  3PRB A;  2ZM6 F;  3VR1 A;  2AEJ A;  4U8Y A;  3CSK A;  5C4X C;  4DL0 C;  2OKQ A;  3NS5 A;  1EQM A;  2QA4 G;  3PFO A;  3T1Y J;  3O44 A;  2AW0 A;  2N7Y A;  2JA6 K;  2IYI A;  4J9O A;  3CCU S;  4ID5 B;  2GA7 A;  2GAG C;  3V6K A;  2J6T A;  3IA0 A;  1YJR A;  5FLX Y;  4OL8 A;  4JI4 J;  5KFD A;  1HBU A;  3PYG A;  2XYG B;  2QYG A;  2ZHO A;  1ZXO A;  3QJL A;  2F4V J;  3HT0 A;  5U47 A;  4KSE B;  2UVV A;  3HVT A;  4U7U D;  3T1H J;  2HZC A;  4YFX A;  2WB4 A;  1RCO B;  4DR7 F;  2QJ3 A;  2HFO A;  3GJR B;  1VFJ A;  3M32 A;  3GTK K;  4EK2 A;  2XMT A;  1IBL F;  2R4F A;  4B9M A;  2RKI B;  4URG A;  4IO9 Q;  3NOC A;  2HVH A;  1ROF A;  2Y0S D;  1XZQ A;  3MEE A;  3C46 A;  2QLB B;  4RNN A;  3PX6 A;  2WVE A;  5F3Z A;  4B3S J;  4KN7 A;  1SL0 A;  2DR9 A;  1M5P C;  1PSD A;  2WAQ L;  3TFJ A;  2ZJP Q;  1NZA A;  4OJG A;  2HND A;  4K0K J;  4O4G A;  1FF2 A;  4N5S A;  1CSJ A;  3RZD K;  2B8P A;  2V63 A;  4XSZ A;  1X5O A;  4YY3 J;  2ZH5 A;  4WP8 A;  4L74 A;  3FFI A;  1JKH A;  1UWB B;  2QT7 A;  1IKV B;  2O67 A;  2RQK A;  3LP0 A;  3NOG A;  3TQ1 A;  2V8H A;  2VIC A;  3EGN A;  1NDP A;  2L9N A;  3D2W A;  4F4Z A;  3OTE A;  1HHT P;  1Q79 A;  4YB5 A;  1WSV A;  1DCP A;  3EJM A;  5B08 A;  4A3F K;  2K8G A;  1ZAX A;  3MMB B;  2XY7 A;  2IFX A;  3LTO A;  2PGC A;  2AJ0 A;  3R6L B;  4R5P A;  5FJ8 K;  3GTO A;  5EX3 A;  3R2D J;  1KLM B;  2VQF F;  1WEZ A;  3DLE A;  5GAG I;  2WVC A;  1C0T A;  4OI1 A;  4HTJ A;  3H0G K;  3I6P A;  4OZJ A;  2HWI A;  4C3L A;  3S1M K;  2QLF B;  2FPH X;  2W24 A;  5IFM A;  1TV6 B;  1JJC B;  4PG6 A;  3W7B A;  4K2X A;  1OMS A;  3GJQ B;  2NXC A;  4WIL A;  4U95 A;  1PGZ A;  3MMJ A;  4IDK A;  4DV5 F;  1R8P A;  3MR6 A;  2QL5 B;  1S6Q B;  3PYE A;  4O23 A;  1YBU A;  2YWF A;  5T14 A;  4CH0 S;  3I31 A;  3GEH A;  2B6A A;  1E6V A;  4DHV A;  4NOI A;  2IYG A;  3KMQ A;  1CJV A;  3PCO B;  3ITH B;  3PR5 B;  4DSI A;  4LFC F;  4QPX A;  3W5X A;  1UVJ A;  3LAN A;  5F8N A;  1J5E J;  2P6S A;  2XC9 A;  3C14 B;  2Z8Q A;  2IBO A;  1YJV A;  3P3D A;  2O3D A;  3HHL B;  4G0U A;  2WSE C;  3SV3 A;  2OMO A;  3T1Y F;  1SH2 A;  2QV6 A;  3N5B A;  3RRK A;  1KBR A;  2DIV A;  3IFE A;  3NGS A;  4KGV B;  4G3I A;  2MQM A;  3GTJ C;  4YDX A;  1O24 A;  3HOV C;  4ECY A;  4LF4 F;  2JEF A;  2DH9 A;  2F8E X;  3FZ2 A;  5C24 A;  2IAJ A;  5LXY A;  1L3S A;  4A3I C;  1TMJ A;  1AFI A;  1R0A A;  4JI5 J;  2GSU A;  3I56 S;  2VUM C;  5IOT A;  1SKU B;  2HFS A;  4Q43 A;  4IR9 A;  1RYR A;  3T5J A;  5IV4 A;  2MQ8 A;  3FMB A;  1Q53 A;  2RH6 A;  1HW8 A;  2B9E A;  3JTP A;  4EZ6 A;  5CH7 B;  5DJB A;  1KLN A;  1WG1 A;  1XXA A;  1J27 A;  1YNJ A;  2J9D A;  2CA9 A;  1U2F A;  3BN7 A;  4Q5V A;  2NXE A;  1FWK A;  4DEZ A;  5A8W A;  1R8C A;  1U2C A;  2KWA A;  2ZM6 J;  4DV1 F;  4A3J C;  4DPT A;  1N34 J;  2OI2 A;  3UCU P;  2F8H A;  1KC8 T;  2RAQ A;  2A2C A;  4N7T A;  4LBI A;  4DV3 F;  1I3Q A;  4BY7 C;  2KT2 A;  4OQJ A;  3SFU A;  1X9W A;  1YSJ A;  1J6X A;  2V0N A;  2RHS B;  4XIU A;  4PRF A;  4C8K A;  3GV5 B;  2WBM A;  4M5I A;  3DU5 A;  3HSZ A;  2CJ9 A;  2FIU A;  4A3B C;  3S1Q C;  2GIQ A;  1D9D A;  4ED1 A;  1T95 A;  2F9D A;  5ETM A;  3F44 A;  1P9Y A;  1WUU A;  1S49 A;  4I2P A;  2K3K A;  1Y1W C;  3HKW A;  4CM0 A;  5DDP C;  4IO1 A;  1I6V A;  4OIR A;  1P8G A;  3ISN D;  1N34 F;  1VJE A;  3Q8Y A;  1RAA B;  3TVK A;  5A8R B;  3PFE A;  1JX4 A;  3BBB A;  2DO0 A;  4LSN A;  3KJQ B;  3PJ9 A;  4HDG A;  4OLO A;  1OYD A;  5L1J A;  3I4M K;  1FWP A;  1B0V A;  1Y5L B;  4DR6 J;  4IUF A;  4ZPA A;  4NOH A;  3ZC4 A;  5C42 B;  4JI0 J;  2RS8 A;  2W9C B;  2CNK B;  2VON A;  4RW9 A;  4JV5 F;  3BJY A;  4KO0 B;  5GMD A;  3WC2 A;  2DB1 A;  2J9E A;  1WCM A;  4XDC A;  4GO5 X;  5AE3 A;  3UD3 P;  2HNY B;  3QGI A;  4ZVS B;  2YPZ A;  2PMW A;  5A0Y B;  1R0C B;  1IKX A;  2AJ4 A;  2Q3P A;  2VG5 B;  3U1N A;  2HNZ A;  4GVB B;  1W25 A;  1LEO A;  3BGR A;  1HQU A;  2XMA A;  1RSC A;  3BQ2 A;  2ALZ A;  2O1P A;  3H0P A;  1KR4 A;  4QPT A;  2W25 A;  3H8Y A;  3EYZ A;  4M5N A;  1S7H A;  2DGU A;  1FT8 A;  3OFE A;  4KKO A;  4DR4 J;  1ZBS A;  5LMU J;  1TP7 A;  3M9O B;  1OPI A;  3O5T B;  1GTH A;  2B63 C;  1JLF B;  2B9W A;  4Y2K A;  4NI2 A;  2JC0 A;  2YU9 K;  2VBY A;  5I3P A;  3HOX C;  1R8H A;  3VHQ A;  3TRG A;  2EC0 A;  1N36 F;  2E29 A;  4CP5 A;  2PFD A;  3ERE D;  1GXU A;  2PA8 D;  3BRE A;  2LQ5 A;  3BP3 A;  2WBR A;  5I42 A;  1RT4 A;  4DSF A;  4TY9 A;  4LJM A;  1M5V C;  2Q66 A;  2VOO A;  5I3Q A;  5TJ3 A;  1JXE A;  4RLE A;  1CPZ A;  1JLE B;  3GFX A;  3TTG A;  2UXD F;  4ZKA A;  4UUX A;  3HO1 A;  1J5E F;  3Q22 A;  4RUA A;  1K73 T;  2E5L F;  3VAF A;  1J98 A;  2XZT B;  4OX9 F;  4ZHR A;  4V1A k;  3W3S A;  1REV B;  6AT1 B;  5EGE A;  4EO6 A;  2KFZ A;  2N4C A;  3NCR A;  4ZCK A;  1TKX A;  1QSY A;  2YWG A;  4F50 A;  4A48 A;  4MK8 A;  2KFY A;  4DV7 F;  4GO7 X;  2GQQ A;  4DL2 A;  5A8K A;  3GTG A;  4JI7 J;  4KTQ A;  2JWN A;  3AY0 A;  4W4M A;  3FSI A;  4RNO A;  2VUM K;  1WF1 A;  3CJR A;  5TMC A;  3N6M A;  3CME S;  4NYP A;  2L3M A;  1SQF A;  3DOK A;  2DO4 A;  2NVQ C;  3JSM A;  1LXN A;  3MUM P;  3OTB A;  1A0O B;  4XO0 A;  3OHA A;  1EP4 B;  2E2H A;  3PW4 A;  2ZKU A;  3AB4 B;  3UVJ A;  2OH2 A;  4TY8 A;  1X4E A;  2WON A;  2CZ4 A;  1RAG B;  4PQA A;  1YVF A;  5D78 A;  3C8Y A;  3NMR A;  2HGN A;  3MTJ A;  4AL6 A;  2HEK A;  4Q2M A;  1S72 S;  1CUL A;  2G0C A;  5H9F J;  5KG7 A;  5HJX A;  1QVG R;  2DTJ A;  4JI4 F;  3PZP A;  3HUL A;  1NHU A;  3CJ0 A;  2HHT A;  2NYI A;  3H2L A;  3K8W A;  4FDF A;  2G1D A;  2NVY C;  3T9Z A;  5L9N A;  3DXS X;  1O25 A;  1KVI A;  3DRP A;  3TEH B;  2C2K B;  1OYE A;  2X3D A;  2F63 A;  3QSI A;  4P5B A;  1KON A;  2W9B B;  1RU0 A;  1FD8 A;  3S2H K;  1IBL J;  5LSO A;  4C2M C;  1ZBT A;  3O3L A;  4KV8 A;  2DR5 A;  3BH7 B;  4WE1 A;  4EGL A;  1HQE B;  5F8I A;  1H6K X;  1AA1 B;  2W8L A;  5FJ4 A;  3G87 A;  1NPR A;  2ZZT A;  4WII A;  5KAK A;  5HL8 A;  1L5U A;  1KDN A;  2NUH A;  2CJA A;  4PUO A;  1VHF A;  4G1Q B;  3P45 B;  1SIZ A;  1YJT A;  1UA0 A;  2FHJ D;  4NPO A;  4WK1 A;  3GU0 A;  3MEG B;  2V9K A;  8AT1 B;  2MKJ A;  1CLF A;  2KHC A;  3MI7 X;  4NZ0 A;  1Q8I A;  4AH6 A;  2ZVS A;  4RUB A;  3EDQ B;  3HHK A;  2PHC B;  2MTL A;  1NKB A;  2WSF C;  2JLF A;  2HUR A;  2H4Y B;  4X6A C;  3MEC B;  2DGO A;  1NK5 A;  1VRU A;  2D7S A;  5HAO A;  4CTA A;  4ZOS A;  3OVA A;  2XNQ A;  4ECT A;  2L41 A;  4K2J A;  1VBY A;  3MPV A;  1WC1 A;  4IG0 B;  2C2N A;  4MKY A;  3C6T B;  1E6Y A;  3W65 A;  4DR2 F;  3QAT A;  4N56 A;  1QUV A;  3OVS A;  4YP3 A;  3NNH A;  3UI3 A;  3S2D K;  3JSR A;  2KG1 A;  1USO A;  3THV A;  3P49 B;  3W9I A;  1SC4 B;  2BEF A;  1YI2 S;  5J2Q B;  3K5P A;  1LKZ A;  2VB6 A;  2NXJ A;  2A68 A;  3KJV A;  3NBP A;  1KP6 A;  1N4L A;  2APO A;  4Y0F A;  4RBV A;  3H3V L;  2R8I A;  4GVL A;  4OZN A;  2C3Y A;  4Q2L A;  3OLA A;  2J76 E;  2V8V A;  1HYS B;  2AEM A;  4ZP9 A;  2MPU A;  3LGM A;  2DPJ A;  3HZG A;  1VIO A;  5EHH A;  2QFJ A;  3DOL B;  5J2M B;  2GV1 A;  2NXU A;  1TL3 A;  4P2F A;  4ED0 A;  3HOX K;  2YKN A;  3TW0 A;  5K9F A;  4C6A A;  5AE2 A;  1F5B A;  1GAO A;  4ZS6 A;  1RWU A;  1O27 A;  4PQU B;  2EVZ A;  2HPU A;  2FQQ B;  2ILZ A;  2CQ2 A;  5L46 A;  4CH1 A;  4RWW A;  2CNN B;  3VQT A;  2KXF A;  2KH9 A;  3GTP C;  2FUG 9;  4LRF A;  2XSJ A;  3HXM A;  5C25 B;  7AT1 B;  4LR8 A;  2XO7 A;  3RYL A;  1OWX A;  2F40 A;  4PWD A;  1P1L A;  1FD2 A;  3CED A;  4RU2 A;  1QLN A;  3L4B C;  3EIC A;  1WOR A;  1KHW A;  2VFS A;  1FRH A;  4QIV A;  2B9Y A;  4BS2 A;  2CW0 A;  3C2P A;  3T00 A;  3RZD C;  4ECQ A;  2I9S A;  1V6H A;  3Q3Q A;  5HAN A;  1SQE A;  4QIW L;  3OL9 A;  2K1R A;  2C3P A;  3K8V A;  5HBM A;  2DJW A;  2IPO B;  2DRA A;  4ZP6 A;  1H7X A;  2YWH A;  4ZN1 A;  1OY6 A;  3AJ2 A;  4U7U K;  4B3R F;  1HLW A;  2JZ5 A;  3OTD A;  3M3Y C;  3GCX P;  3ZZU A;  4B3R J;  5KFN A;  5A76 A;  2R3V A;  3WIU A;  2E9T A;  2BXJ A;  1T03 B;  2HK3 A;  2HVD A;  3WBZ A;  4IH7 A;  4B9U A;  3IS9 B;  1IKW B;  2HAF A;  4A3K C;  4KMD A;  3HXA A;  3NGK A;  2HS4 A;  3AD9 C;  3MPY A;  3Q8P B;  5CAB A;  4DPW A;  1UVL A;  3BGL A;  4DDF A;  2HRT A;  2OEL A;  5L38 A;  1YIT S;  2R7W A;  4DFM A;  3A13 A;  1RTZ A;  3TAR A;  3EMT A;  1TUG B;  1ZQ1 C;  5ETV A;  3A8J A;  4EZ9 A;  2BRL A;  1FKO A;  3ISN C;  5JMN A;  1NK8 A;  3A3N B;  3AHP A;  5KFR A;  4A46 A;  1IXK A;  4ECV A;  2XMJ A;  4WFA Q;  1RWO B;  3I9Z A;  3BBC A;  2AHO B;  2WVD A;  3OL6 A;  3D67 A;  2RDI A;  5FD1 A;  1HNV A;  4LFA F;  3LQV A;  2BAN A;  2DHH A;  1S1T B;  2L9W A;  4HT7 A;  4WTO B;  3HX9 A;  2BDP A;  3S15 C;  4NZ6 A;  4FN5 A;  1VRT B;  3G8S A;  2MJU A;  3UN3 A;  2R92 C;  4NL5 A;  3U27 A;  3QZ7 A;  4LBP A;  4J9Q A;  4NYO A;  3JST A;  3MMC A;  4OIX A;  3GON A;  5CHC B;  4ECW A;  3D68 A;  5KFI A;  1NBE B;  3MED A;  4CI0 B;  1KEK A;  2VJU A;  3R5G A;  4P5A A;  4DV7 J;  2IRU A;  3AFG A;  1TWG A;  2DNN A;  4GTE A;  4TQS A;  1WDD A;  1R8B A;  5HMX A;  2M5Y A;  1QM9 A;  2GO8 A;  2I5J A;  4HYK A;  1U1Q A;  2GO9 A;  5H9E K;  2GHV C;  2RNE A;  3LGH A;  1N5Y B;  1T03 A;  3MM9 A;  2FB0 A;  2CQ0 A;  4FXD A;  3PM9 A;  4KAW X;  4I1T A;  2DHS A;  3GP9 A;  2DEI A;  2VC1 A;  2JA5 K;  1RWP B;  3LAM A;  3ENQ A;  3QYY A;  2D9P A;  3JYT B;  1XER A;  2EFO A;  5G4D A;  2ZH8 A;  4H4K A;  1JLA A;  3J80 Y;  4B3S F;  3MM6 A;  4UQG A;  2YNF A;  4Y6I A;  1P27 B;  2NPF A;  4HHJ A;  4ES3 A;  5HBM B;  2DNP A;  2VQE J;  9ATC B;  2JEG A;  3TOQ A;  1WG4 A;  2C2O B;  3HOW K;  3IG1 A;  4LFC J;  1MWQ A;  2VFU A;  3RBD A;  4F3Q A;  2E1P A;  4IOC Q;  2I6W A;  5L39 A;  1TWG C;  2WHO A;  4BDP A;  1FRI A;  3QGG A;  1BY9 A;  2MQP A;  3K59 A;  4C8Z A;  5IYD K;  3L7P A;  2OTL S;  1K9M T;  2D74 B;  2CWX A;  1HNW J;  1PIL A;  3OJS A;  4QWC A;  2J0X A;  5CYM A;  2RHQ B;  3OJU A;  4NLR A;  3UDE A;  3EVM A;  3OSP A;  2LA4 A;  3K2Y A;  4LF8 J;  2HKE A;  5J2P B;  3CAG A;  1CJT B;  1B4A A;  2HZV A;  1FA0 A;  3M6X A;  2MDA A;  4J9R A;  4ZVE A;  3R6G B;  2NQP A;  3J81 j;  3S14 C;  5AE1 A;  2FLP A;  3PO2 K;  1SC6 A;  4ZIV A;  4CCH A;  2MSS A;  4C7Q A;  5GAE I;  3CUL A;  4DBQ A;  1NPP A;  2C2R A;  4V19 J;  1HYS A;  4OIN A;  2DCL A;  1ZM3 A;  4Y00 A;  3NGD A;  5E41 A;  4R0E A;  4X84 A;  5K8O A;  4F04 B;  2LDI A;  3SDE A;  2R2R A;  4DX5 A;  3GV8 B;  3SCI E;  4LRB A;  3SBM A;  3QWP A;  1FTR A;  5J2Q A;  3I4N C;  3FBB A;  4DN9 A;  2RVJ A;  5DQI A;  3G6X A;  5BXI A;  2XCP A;  5I3U B;  4RW7 B;  2B4O A;  3RB3 A;  4LF5 J;  2MGZ B;  2JEI A;  1FDN A;  4L75 A;  5K5M A;  2Z56 B;  2BW2 A;  4C0O C;  5CCM A;  3W60 A;  1D09 B;  4KB2 A;  1DLO B;  3WZ0 A;  3DGP A;  3M30 B;  4LQ3 A;  4DU8 A;  3BYR A;  3B4M A;  4YN3 B;  4N8O A;  1HMV B;  3R5A A;  2GGP A;  1H72 C;  2QX0 A;  1T11 A;  3BKT A;  1V5V A;  5F0W A;  2UXB J;  1YLX A;  2VJV A;  5D3G B;  3K7A K;  2U2F A;  2BKN A;  4X65 J;  1C1C B;  4QBU A;  1VC5 A;  5FLM C;  4I6W A;  1HNI A;  1JMT A;  1M5H A;  1DQA A;  1FFG B;  2VG6 A;  3BSN A;  3DI6 A;  1ELO A;  3QT8 A;  3M2V A;  1OQ6 A;  2W01 A;  3GWC A;  1OY8 A;  2CPH A;  3AQO A;  1HW9 A;  5HRO A;  3MUV P;  2AJ2 A;  3ZNU A;  3LPX A;  4FYX B;  4C0H A;  2XMU A;  4XCH A;  5ETR A;  1FJE B;  1WQF A;  2RUS A;  2HGL A;  4P6Q A;  3VGU A;  4IFV B;  4KC5 A;  3WHI A;  1S9E B;  2ZH6 A;  4IH6 A;  1QE1 B;  2JA6 C;  3DRS A;  4MTP A;  1HPZ A;  2FLO A;  4C3J K;  3BN4 A;  1EET B;  2ZH4 A;  3W5Z A;  2Q6B A;  4O0N A;  4JV0 A;  3WOD A;  3QX3 A;  4ZCL A;  1BQN A;  1RT5 B;  3R5C A;  4A47 A;  1IBC B;  2RRB A;  1ZM9 A;  4H4O A;  1HWL A;  1CC8 A;  1SBR A;  1F7V A;  4G7O A;  2CZV C;  1DCO A;  4M1K A;  5CD4 H;  3DMJ A;  2VPW B;  1B7F A;  3I5B A;  4WYL A;  2D41 A;  1GQE A;  4MK7 A;  2BQ3 A;  2RJZ A;  3W62 A;  2ZJQ Q;  1RA6 A;  1PAE X;  1GT8 A;  2QC3 A;  1VH2 A;  3E01 A;  4EMD A;  2WON B;  3R7N B;  3CJ8 A;  2EBB A;  5CQG A;  3UN2 A;  1IE0 A;  2KG0 A;  2IVM A;  2DGS A;  1Q5V A;  5DLG A;  2XY6 A;  1VRQ C;  1W26 A;  4UTG A;  4GFQ A;  3PO3 C;  3GZ7 A;  1K8A T;  5AJ3 F;  3L09 A;  4CLP A;  1FKP B;  2EKN A;  2X1G A;  1VQK S;  3K5O A;  3A1Y G;  4DV5 J;  2YKM B;  5C4J C;  5B7W A;  2EG1 A;  3JSM B;  1WWH A;  2O01 C;  5DGB A;  1X4G A;  1TKD A;  1YZ6 A;  2IDL A;  3AB2 B;  4ILR A;  4ECR A;  2EK1 A;  2F5G A;  3CDB A;  4OX8 A;  4QWB A;  2W7A A;  4A3G C;  3PNI A;  4X65 F;  3Q89 A;  4PXC A;  1ZVU A;  3G71 S;  4RW4 A;  1RLD A;  5E7O B;  1OIA A;  2ZUF A;  2R7Z C;  3QBC A;  1X4B A;  2YNG A;  2K3I A;  5DZ6 A;  3DGV A;  3DU6 A;  2MQQ A;  3M7V A;  4USK A;  1VK8 A;  4X62 J;  2MZS A;  3OPK A;  3HOU C;  1TWG K;  1TL5 A;  2AP6 A;  2ATC B;  1N0V C;  2KJV A;  4ICL A;  2AV5 A;  4CIO A;  3KK1 A;  3HKZ L;  5IYD C;  1BE4 A;  1O8B A;  1R6Y A;  2LCW A;  3VAM A;  1WEY A;  4BBY A;  3I5C A;  5D0R A;  2GML A;  2O5J A;  3RRG A;  2VUG A;  2OJ3 A;  2PMZ D;  4BWJ A;  4F25 A;  1VC0 A;  1S48 A;  3FCW A;  1HWU A;  2C3M A;  4KB7 A;  5HL7 Q;  2YX1 A;  3QRQ A;  4FZB A;  5D6G A;  2UUB F;  2LQ8 A;  4RWX A;  3CMQ A;  3S14 K;  3OTC A;  1BLU A;  1RWK B;  5G0R B;  1SB6 A;  2ALY B;  4I2Q B;  2E2H K;  4DZ6 A;  4KE5 A;  4U9R A;  2BX6 A;  4KKO B;  1U47 A;  3US5 A;  4YHH J;  4LBH A;  1VR6 A;  3BUE A;  1HBM A;  4L3K A;  3HHL D;  2V8P A;  1UCN A;  1DBD A;  4J90 A;  3OT9 A;  1NK0 A;  2F65 A;  3G8T A;  4AE5 A;  1JK9 B;  2ACM A;  2VG7 A;  3K7R A;  2YKM A;  4B9T A;  4NXN F;  3K5N A;  1S0M A;  5KFL A;  2VG5 A;  1FK9 A;  3AA9 A;  4X6A K;  2UUB J;  4F4K A;  3TAM A;  2V4Q A;  3VTI A;  1VDH A;  3DLJ A;  3MGJ A;  1U49 A;  2IDE A;  4X62 F;  4K4W A;  4O3R A;  4QU6 A;  2BE2 A;  1F60 B;  3DLH A;  4YG2 A;  1I6J A;  4KN4 A;  4HAC B;  1TZ0 A;  4JI6 F;  3N79 A;  1JQW A;  3MAH A;  2IC3 B;  1NND A;  1RHR B;  2VD3 A;  4Y2C A;  4ZH4 A;  2R7U A;  3B78 A;  4UZC A;  1RT6 B;  4JI5 F;  5ETQ A;  1XTZ A;  1QSL A;  1RGV A;  3D6T B;  4MIB A;  1DTT B;  4MKB A;  3QQC D;  4DSE A;  3EZ5 A;  1NB2 A;  3LAJ A;  1UA1 A;  1FDA A;  4B17 A;  3AJ1 A;  4FS2 A;  3SCK E;  3QNW B;  4OYX A;  2AGO A;  1D8Y A;  3IBC B;  2C2D A;  1NU4 A;  4HVZ A;  3AA8 A;  2CPI A;  4BBS K;  3M6U A;  3Q86 A;  1F1B B;  4J9K A;  5A8R A;  4HT5 A;  5KT4 A;  4ZN3 A;  3R7S B;  4E98 A;  2IC3 A;  4QWD A;  1W7W A;  3HI9 A;  3MM7 A;  3ETM A;  3GTG C;  3TUI C;  1R27 B;  1WJ9 A;  4LRD A;  1O2F B;  1RTJ A;  3LP1 A;  3K17 A;  3CB4 A;  1B3T A;  1WCM C;  2BOP A;  1DUR A;  3MPU B;  1U1L A;  4O3Q A;  1FK9 B;  1U0S A;  5EWF A;  4B08 A;  3B54 A;  1ZTW A;  2VFT A;  3IXQ A;  3TQE A;  1M1K T;  2OFG X;  1I51 B;  5EX0 A;  2XS7 A;  5IP7 K;  3FBF A;  1UWA A;  2V5H G;  4LF9 J;  4HHU A;  2CQG A;  1K0T A;  1X5S A;  4C0B A;  2W4D A;  2GGP B;  5KFM A;  3I4M C;  2CAJ A;  4AND A;  1ULR A;  2C1E B;  2BJ3 A;  5M5X K;  2YTC A;  1RWX B;  4OYZ A;  2A6O A;  3IAS 9;  4FP9 A;  1HWI A;  3HFK A;  2YKQ A;  3GPA A;  2MGZ A;  2MHN A;  1WI8 A;  4FXV A;  1UEK A;  2CPZ A;  4PEO A;  2EBE A;  2DY1 A;  1NK6 A;  1JLG A;  5H9E J;  5IOS A;  1RXO B;  1S6P B;  4MYT A;  3WQP A;  4O2D A;  3OQ2 A;  4TVA B;  3OHB A;  1S76 D;  3SDE B;  4NLV A;  1SXL A;  2JC1 A;  1OSD A;  3I0R B;  3VGV A;  3TZX A;  2CG4 A;  2H4W B;  3S1R C;  5HI7 A;  5C24 B;  1SC3 B;  2ZHB A;  1GMU A;  2VOD A;  1HA1 A;  3CD7 A;  4IYQ A;  4PZV A;  1UKU A;  2HQC A;  2R7Z K;  4GC6 A;  4M5J A;  3G82 A;  3QLH B;  1WF2 A;  1R6V A;  3PIO Q;  2YWK A;  4LT6 A;  3SQG B;  1IKY B;  1KVK A;  4RW4 B;  5ITH A;  1TWC C;  3W2W B;  2B63 K;  3PJW A;  1OQ3 A;  2OGU A;  2F4V F;  4PG4 A;  4CDI A;  3J7Z T;  3D1H A;  1PJ7 A;  2R7R A;  3SV4 A;  3UCG A;  1BGW A;  1TUW A;  2W2O P;  3HOZ C;  2E5J A;  2AX1 A;  2NUU G;  3TA2 A;  3BPS P;  4DV4 J;  4DSJ A;  5IV3 A;  4OI0 A;  2OSQ A;  3FRZ A;  5HMY A;  2ZOM A;  4X64 J;  3OR1 A;  1DY3 A;  3J80 U;  4LMZ A;  1XC9 A;  2WB1 L;  3DXJ A;  1VCT A;  2VA2 A;  2LP4 A;  2R92 A;  4WU2 A;  2ZZN A;  3N4W A;  4H54 A;  4Y7N C;  3O6Q A;  1Y11 A;  1KQK A;  4CLK A;  3MFH A;  4KY3 A;  3RUB L;  2DXE A;  1NSK L;  3JYT A;  3PTW A;  5J1P A;  4O3P A;  3DLE B;  3CC7 S;  3I55 S;  4HI2 A;  4UZB A;  5BJR A;  2HFV A;  3M1V B;  3GB0 A;  1Z2L A;  2YH1 A;  4A3E C;  3M8W A;  1KOO A;  1I94 F;  2V34 A;  4FF1 A;  3KFW X;  1SQG A;  1L3U A;  4USJ C;  4H4O B;  4HLB A;  1Y00 A;  2M8H A;  3VAK A;  2JA5 C;  1BGX T;  4RX6 A;  3J7A N;  3JQK A;  3C3L A;  3OD2 A;  4Q8E A;  5DGA A;  4HEA 9;  5DRK A;  4U6P A;  4J37 A;  3UD5 A;  3PW0 A;  1M0S A;  2DR8 A;  5IQQ A;  1VRT A;  4ED2 A;  4IQM A;  5IC6 B;  1PKU A;  3GSD A;  3R3T A;  2DRD A;  2OPQ A;  3U7J A;  3RU0 A;  3JAM U;  4LF7 J;  2KT3 A;  4OJ3 A;  4C3K A;  3G6Y A;  4ES2 A;  1K83 C;  4QIG A;  1XMQ F;  1U1O A;  3NAI A;  5FDL A;  3M32 B;  1OJ4 A;  5CD4 A;  3DI6 B;  1K44 A;  1QTN B;  2KJW A;  2MQO A;  2W2P P;  4M8L A;  4F3O A;  1X8D A;  1RK8 A;  3IGV A;  3GMG A;  3CQZ K;  1S0V A;  2V2K A;  2YX4 A;  5IP9 C;  1HMV A;  2ZJR Q;  1Y3K A;  2OTJ S;  2HVZ A;  4NA2 A;  3FCH A;  4C2M K;  2R2T A;  3M30 A;  2P2C B;  1H0H B;  2L08 A;  2EXU A;  1RKI A;  4AT1 B;  4MIA A;  2QSW A;  3IS9 A;  2DNR A;  4LIR A;  4URS A;  3PO2 C;  1C1B B;  1MN7 A;  4YR3 A;  4MEY A;  4Y52 K;  1IR1 A;  4GC7 A;  3HFV A;  2EWH A;  1KN6 A;  2MZT A;  4KDD A;  2FJE B;  4MYU A;  3TJ9 A;  3BGF A;  1ZM2 A;  5KFH A;  1H38 A;  1OS5 A;  1RT7 B;  4JI8 F;  2B4U A;  3RAQ A;  3GQC A;  3RBE A;  1T3N A;  4ZPC A;  4MIW A;  4DR3 F;  2CDR B;  4G6V B;  1WC0 A;  4WFN Q;  4G65 A;  4CH7 A;  4CLZ A;  1F0X A;  2Y8W A;  3HK2 A;  1GEH A;  4A4J A;  2IM2 A;  4PCQ A;  1Y1W A;  5IT9 U;  2JVO A;  4EWT A;  3LW5 C;  1KKH A;  3ICL A;  3W8P A;  1URN A;  2CPY A;  4OYM A;  1VK3 A;  2DH8 A;  4EYH B;  2KRB A;  5CJ9 A;  3Q83 A;  1GX5 A;  5IT4 A;  5F3T A;  1QD1 A;  2AJF E;  2YY3 A;  2X51 A;  4F4W A;  3X3U A;  2HQI A;  5GVQ A;  1OY9 A;  1FDD A;  4IR1 A;  5FLM K;  4DQP A;  3D6M B;  3TX0 A;  5H9F K;  2E44 A;  1KQF B;  2FVS A;  2XI2 A;  2AYM A;  2WOM A;  5D4P A;  1Q0N A;  1BHN A;  3KG4 A;  1MSW D;  2JA7 A;  1H2V Z;  1INN A;  3OTO F;  1FJG J;  2R9L A;  5GME A;  2E7V A;  1VIX A;  4DDQ A;  1U45 A;  2WW4 A;  1NJY A;  2CJQ A;  4LRC A;  4GKJ F;  3RZA A;  2R2S A;  8RUC A;  1U25 A;  3MM6 B;  4E0D A;  3IWX A;  1IR2 A;  2AEF A;  4GTC A;  1U8W A;  2VBX A;  1I50 C;  2FZK B;  2C2Z B;  4UF4 A;  1Q1K A;  2DH7 A;  4B9S A;  3CJK A;  3GCW P;  1N88 A;  3DKD A;  1H7W A;  4OHY A;  5E3Q A;  5KFQ A;  1S1V B;  2H3E B;  1Z4U A;  1V3S A;  1PG5 B;  4LSL B;  3C66 A;  2QL9 B;  5JVO A;  3MMA B;  3MZI A;  2ZKT A;  1ZPV A;  3OUY B;  2HHS A;  4TLR A;  4ED6 A;  3ILI A;  3GG0 A;  3IR7 B;  2E66 A;  2V4J B;  4TN2 A;  3BR9 A;  1DQ9 A;  5DZ7 A;  3CUN A;  3BM7 A;  3LPY A;  3KLI A;  1Y4Z B;  4WXW A;  2WB1 D;  2JA8 K;  2QEX S;  3W66 A;  3E8O A;  2MLZ A;  5BYS A;  4KFB A;  2VFR A;  4Z7C A;  4ZIT A;  1NK4 A;  4C9D A;  4LFA J;  2UU9 J;  1U1M A;  5L1L A;  1PJ5 A;  1HNV B;  2QFI A;  5LL6 d;  5TMF A;  2H65 B;  3PDN A;  1TQL A;  1RAB B;  1T9X A;  5A6W A;  2BJ8 A;  2ZBR A;  3RTV A;  4UY8 5;  1BQM A;  1U4B A;  4OYA A;  1YJ7 A;  4ZA1 A;  4TYB A;  3KYL A;  3R97 A;  1JJH A;  2HAI A;  3SZ2 A;  4LK0 A;  3HD2 A;  2ASY A;  4UST A;  2OPP A;  2R42 A;  3BPD A;  2GNK A;  1AZS A;  2CQD A;  3IRX A;  3GYX B;  1VLO A;  1RBA A;  5LJ3 Y;  2FLL A;  2W9A A;  1VIS A;  4QW8 A;  4QIW D;  3M8P A;  2RGR A;  2XMK A;  3DNC A;  4URQ U;  1IKW A;  4EI2 A;  3HOU K;  4FVC A;  1Q8L A;  4NLO A;  4MJK A;  3GTL K;  3UPF A;  3WC0 A;  3M1V A;  1BDF A;  2OML A;  1PCA A;  2HS3 A;  3IO1 A;  1WG5 A;  4RMF A;  4ENO A;  3MOJ B;  2RML A;  3QO9 A;  2G2Z A;  2J7W A;  3OBI A;  4FKY A;  4OI2 A;  2J6S A;  4K4Z A;  1NXI A;  2E7W A;  2YNI B;  1UTA A;  1ZA2 B;  3G9C A;  5GAH U;  3M8Q B;  2Q6C A;  2ABY A;  3K58 A;  3UDL A;  3DOK B;  5KTQ A;  2XM3 A;  4KAS A;  3FKI C;  4A8Y A;  2FD2 A;  1EB0 A;  5A2Q U;  1JLQ A;  1G2E A;  2WCX A;  1D0E A;  5DQG A;  4DG1 B;  4JI0 F;  1R31 A;  3MF5 A;  2A6H A;  1U48 A;  3SQG A;  2GVZ B;  1M90 T;  4KHR A;  5G0R A;  1RI7 A;  4DXL A;  2BJE A;  3AOA A;  4AD6 A;  5LXR A;  3BO4 A;  5LMN J;  1L3V A;  4GTA A;  3TA1 A;  3EUN A;  2EFP A;  3GTY X;  3PIP Q;  5KFK A;  2HHV A;  2KU7 A;  1S4E A;  1FEE A;  3ULH A;  4ETX A;  5BR8 F;  1F7U A;  3OSN A;  4C3H C;  1AB8 A;  3G6E S;  1I1G A;  5M3M K;  2GMJ A;  2EFG A;  1MWZ A;  2NSC A;  4G0W A;  4ED8 A;  3D28 A;  5ETK A;  3JB9 k;  1UFK A;  2XS5 A;  1MRO A;  3BYP A;  1UEU A;  4K4V A;  3RZO C;  2GVZ A;  4NI2 B;  4QR0 A;  3GEE A;  1N5S A;  4BC7 A;  1VLY A;  3KLG A;  3N3Y A;  3J7Y U;  4DPU A;  4XSX A;  3MM8 A;  2DIS A;  2MKH A;  3E3X A;  4PYA A;  4DG1 A;  1H2U X;  5EWG A;  3VV2 B;  2R7Q A;  3CC4 S;  2YU9 C;  5B0B A;  3LH2 S;  3AQP A;  2BR0 A;  4AQY F;  5A2Q Y;  1QAY A;  3MEC A;  3T02 A;  1R0B G;  5DM7 Q;  1CJK B;  1S4F A;  4OZ1 A;  3M8Q A;  3BGR B;  1RB0 A;  3FDS A;  1SC1 B;  4CNZ A;  2ZZM A;  1FKP A;  5THW A;  4CLS A;  2VIH A;  1JJ4 A;  5A0Y A;  4FS1 A;  1GXT A;  3BB5 A;  1RTJ B;  1XMB A;  3MD3 A;  1VMB A;  2C28 A;  4RW9 B;  1S97 A;  3LAP A;  4ZK7 M;  3V4I A;  4CLF A;  4DV0 J;  2VQE F;  2UP1 A;  4C8Y A;  1HQE A;  3FEX B;  3BSO A;  4UUW A;  4JI8 J;  4WE1 B;  1NDL A;  1RTI B;  3P8B B;  1XXC A;  2CQH A;  4KR0 B;  4FF2 A;  3TAP A;  3D1Q A;  2DHG A;  5F9N A;  2R8G A;  4QWE A;  4OJ1 A;  4RW6 B;  1YBA A;  3ZZT A;  9RUB A;  2DIU A;  2UUA F;  2ILY A;  1I3O B;  2YX7 A;  3P4U B;  2GSN A;  1FEH A;  1AZS B;  1MG7 A;  2XYH B;  3IRX B;  4CWB A;  2DR6 A;  1F3V A;  1UMJ A;  3Q23 A;  2BVZ A;  1V3Z A;  5IWA F;  4AQY J;  1PBA A;  3IBF B;  3G4S S;  3Q8Q B;  5F41 A;  1X4A A;  4JI6 J;  1BQM B;  4LLG A;  4F36 A;  3F56 A;  3VGS A;  1WTF A;  4RW8 A;  3EWG A;  3W5Y A;  2ZNY A;  3ILJ A;  1NM2 A;  4CT9 A;  4B3M J;  2EEY A;  3F0N A;  3UR3 C;  4ERD A;  1SUQ A;  2H9Z A;  4PAA A;  1XMO J;  1GK8 A;  4I0W A;  2LYV A;  1FXR A;  2DNQ A;  1UJ4 A;  1TWF C;  4F2R A;  5IOR A;  2BJ7 A;  2GVD A;  3ZZP A;  2MST A;  5EWE A;  3GDZ A;  2JFD A;  3LWL A;  2NVY K;  3GTL A;  1S10 A;  3OV7 A;  1CJK A;  2OO4 A;  2OUG A;  2KKH A;  4QU7 A;  2IRX A;  2V4J A;  4IOA Q;  5D3G A;  4LF7 F;  4LK1 A;  3EM1 A;  3SIP B;  3BGO P;  2UXB F;  1CG2 A;  4DV1 J;  1UFW A;  4I4B A;  2DNH A;  2F1F A;  1TAQ A;  1HBM B;  3L9Z A;  4PWU A;  2W4P A;  4X4Q A;  2VQF J;  4QIE A;  2VHG A;  4GTF A;  2Y9H A;  2MLX A;  2JX2 A;  1A6L A;  1ZPW X;  4B3T J;  3DCA A;  1S1V A;  3QT7 A;  3KLG B;  1TKX B;  3W61 A;  4I67 A;  3GTJ K;  3M8R A;  2LXI A;  1FX2 A;  2ZBC A;  4RUH A;  4RW7 A;  4AYB L;  3X1L B;  1AFJ A;  4RBU A;  5M5W K;  1WTB A;  2CRL A;  1CS4 A;  3KDN A;  4ZHR B;  2D6F C;  4C3I K;  1QSS A;  3KXD A;  3PJX A;  1SJ4 P;  3FKI K;  1YRT A;  1JLE A;  2AIR B;  2G0I A;  3J7Y I;  2CJB A;  1LQ9 A;  4M5K A;  4ECS A;  4DQQ A;  4ICL B;  1X7V A;  2E5I A;  3JAM Y;  3SI8 A;  2X3G A;  2DIT A;  3GTO C;  1CJT A;  4WK3 A;  1MU2 B;  1HNX J;  2C3O A;  5DDR C;  2CUY A;  1C0U B;  5I4M A;  2FJV A;  4BHQ A;  4ZVQ B;  2FJA B;  1ZAV A;  1N5T A;  2GJ2 A;  3DDI A;  2CNO B;  4A8Q A;  5BYQ A;  1XQI A;  2XCR B;  4ILL A;  4ES1 A;  4EO8 A;  3DLB A;  1HI9 A;  1CJV B;  4NLS A;  3CD5 A;  2CIM A;  3UO0 A;  2R8K A;  4X66 J;  2PMZ L;  1C2P A;  2MYF A;  3MPW A;  4Q8F A;  2YNI A;  3IG1 B;  2V8G A;  1HD0 A;  1IKX B;  2GAH C;  4RO0 A;  4P73 A;  1HBN B;  2GQ2 A;  3BDE A;  1SMY A;  2DVI A;  3GTM A;  2YNF B;  2BAB A;  2IY5 B;  4NAS A;  2EBG A;  1UEV A;  1IBK F;  3J81 U;  1QVF R;  2QA2 A;  1SL1 A;  1Q16 B;  3E01 B;  1RE1 B;  1YNN A;  3S1Q K;  2RH3 A;  2ZEJ A;  4IQX A;  3EZO A;  5HQL A;  2OP5 A;  4MMO A;  2MJN A;  3H42 A;  1N5Y A;  3QAE A;  3CCV S;  4NWB A;  1TTH B;  3KMS A;  1K47 A;  2IMO A;  3KDO A;  1JQG A;  2B0G A;  2FZC B;  2GCF A;  4GMK A;  4Y3C A;  3OTO J;  4Y52 C;  5CYQ A;  4NCA A;  3PKY A;  1WOS A;  3FFI B;  3ORE A;  4UQT A;  5EDW A;  1L3T A;  4JYA F;  2BJ9 A;  2NVT C;  2XGP A;  2OPP B;  1QE1 A;  2HIQ A;  4QYZ J;  4YS2 A;  3PYD A;  4DS5 A;  2Z2L A;  4QIF A;  2HS0 A;  1U6Z A;  2ZC3 A;  4TU7 A;  1J2V A;  1ZS6 A;  2K7K A;  3GIL A;  2E7X A;  3M9M B;  4LF9 F;  1GMW D;  1TKZ A;  3SZZ A;  3M3Y K;  4Q7A A;  4J9U E;  2B7C B;  3M8Y A;  4N76 A;  4YB7 A;  2Y1R I;  3TP2 A;  4FKX A;  1G7C B;  2FYX A;  1PJ6 A;  3EE3 A;  4ZJQ A;  3EZU A;  1N33 J;  1XWL A;  2CDQ A;  3TAQ A;  1BXN A;  2FJD B;  1QDU B;  1SV5 A;  5B09 A;  5D4D A;  3OUY A;  3PO5 A;  1VQY A;  1Y9O A;  3OL8 A;  3KLE B;  4FPI A;  3BDP A;  4W92 B;  3QJJ A;  1I6H K;  2OPR B;  2VPY B;  3DGP B;  4Q5S A;  1NEE A;  2ZBQ A;  3S1N K;  1S5Z A;  1WOO A;  1MMN A;  3OR2 B;  4LF8 F;  1LWF A;  4BC9 A;  2HVI A;  3B6B A;  1IJF B;  2DGT A;  3D9B A;  3GIJ A;  3T6B A;  2KI2 A;  2KYZ A;  3MCS A;  3GYN A;  5F8G A;  4J91 A;  3CVK A;  5KFX A;  1WC6 A;  5ETP A;  3JXO A;  4P2X A;  4XK8 C;  3S15 K;  1YBT A;  3GTK A;  3R1L A;  4ZDN A;  4JI7 F;  2XUL A;  3G2X A;  3M6V A;  1UET A;  3VZH A;  3IM9 A;  1S57 A;  3M2R A;  1EI6 A;  3GTJ A;  3KG1 A;  2MZQ A;  2WOM B;  5HQ8 A;  1TK0 A;  4P7V A;  4G7H A;  2FJW A;  3HHL A;  1KSP A;  1NLK L;  5C25 A;  2E5H A;  5AXK A;  3NL0 A;  3CPW R;  3C14 A;  5CYM B;  3UNG C;  2KTQ A;  4DPO A;  3LWM A;  2VC0 A;  1IKY A;  2WZ1 A;  5J1E B;  1C4C A;  1TVR B;  5CHP A;  4JB8 B;  2Y0B B;  1R89 A;  3NRB A;  3PO4 A;  2JA8 C;  1E6V B;  4J9S A;  3AD8 C;  5BYR A;  3PHE A;  2D3O R;  3QLH A;  3CDA A;  1TK5 A;  3OVB A;  3GTO K;  4BY1 K;  1NAQ A;  1S0N A;  2J9C A;  3FQL A;  2VZ9 A;  4OZ0 A;  3Q8U A;  2FC8 A;  3NUH A;  4ZVG A;  2UUW A;  2DK2 A;  1TWA C;  2HHH J;  1RT7 A;  2XWY A;  1RKJ A;  2E2I K;  1RAF B;  3NBP B;  1KQS R;  1RHK B;  2QLX A;  2X1F A;  2RSQ A;  1JLG B;  3BGU A;  4Q4Z A;  4A3C C;  1TWC K;  1RBO B;  1WQH A;  3KNA A;  4R5P B;  3UR0 A;  3MM9 B;  3OR2 A;  3JSY A;  3NNC A;  3TZY A;  1KS2 A;  5E3A A;  3WDO A;  3BV8 A;  4ZVO B;  2N4D A;  3HOZ K;  3AXM A;  2CNL B;  2MEW A;  4P52 A;  1SFO C;  1RJJ A;  3KLE A;  5HLF B;  4A8S A;  2NPI A;  5E3C A;  1VRU B;  3MMC B;  1QTM A;  2QL7 B;  3SSS A;  3FHZ A;  2QE5 A;  3FC9 A;  4NLQ A;  4CT8 A;  1UFL A;  4FXW A;  2FVP A;  4WF9 Q;  1WC5 A;  1LWC B;  3ILO A;  1S1T A;  1F9E B;  2BAN B;  1IR0 A;  3MEE B;  1EIY B;  5FDL B;  1PAU B;  1AUD A;  1B99 A;  4A93 K;  2J8S A;  2DHA A;  3NEK A;  2GMH A;  4DR5 J;  1FKA F;  2GC8 A;  1FO1 A;  4DUY F;  3ZZY A;  3GTM K;  4KV8 B;  2B5J B;  4YB1 P;  1HBU B;  3DFE A;  2XCA A;  3KUE A;  4HR2 A;  3FEY B;  3RAM A;  2AGQ A;  4M94 A;  1IBA A;  3H5U A;  4XPC A;  1YX2 A;  2FVC A;  1NJZ A;  1SCJ B;  4ID5 A;  4EU0 A;  5IYC C;  2YH0 A;  2ZD1 A;  3QT6 A;  3K7A C;  1HHS A;  4OIP A;  5B0F A;  2YBV A;  2G2O A;  2B8Q A;  2R93 K;  4O4R A;  2W7V A;  4NZ7 A;  4DR3 J;  2ZH9 A;  1TL1 A;  1HI8 A;  3NY0 A;  4U67 Q;  2G4B A;  2X1A A;  4LF6 J;  1FXD A;  1RU2 A;  4F0M A;  2AQ4 A;  3OXF A;  1JNR B;  3HPO A;  3FUY A;  1S9G B;  3GJT B;  1SKR A;  1WNE A;  2ZOF A;  4HAC A;  5C3E K;  3KLF A;  3EPG A;  4ZVR B;  2F3J A;  3IWL A;  2RD5 C;  2J7K A;  3WX4 A;  3AOC A;  4ZP7 A;  3OEP A;  3QT5 A;  1EP4 A;  2IM0 A;  3GV7 B;  1HBN A;  1X0F A;  2UVW A;  2JLE A;  2XMV A;  4IRD A;  1JWW A;  3ZXW A;  3ZTP A;  2OEK A;  4CO5 A;  2OPS A;  1S1W A;  5K8N A;  4BXX C;  4FNI A;  5IP9 K;  3R9L A;  2AGP A;  4OI4 A;  3IGN A;  5K14 B;  4PWD B;  4O3N A;  2JOQ A;  2PN6 A;  5HVF A;  1VOM A;  1TL4 A;  4M5D B;  4PPD A;  2CQ3 A;  1Y0H A;  3P5B P;  2C2E A;  2FLN A;  1ITP A;  4DV3 J;  4JUZ A;  3ETO A;  1ACM B;  1RUS A;  4OFZ A;  3EPI A;  1S6U A;  4I2Q A;  2GIR A;  3RJM B;  1TWH A;  3MR5 A;  4WXO A;  3RW6 A;  2NVX A;  4NLY A;  1RHJ B;  3G82 B;  4LSZ B;  1TL3 B;  2JA7 C;  3M6W A;  3S0X A;  2DNM A;  4M95 A;  3QAU A;  3DOL A;  4EBC A;  4KJI A;  1M1G A;  4TKT A;  1WKL A;  1Q7Y T;  4K4U A;  2FVR A;  2VDH A;  2LQ9 A;  4JV1 A;  1XBW A;  3ZNJ 1;  2IIH A;  2R8H A;  2J5A A;  4ZPW R;  3NNA A;  1RHQ B;  4XTT A;  1F6T A;  4NXM F;  1NDK A;  3S16 C;  4KGX B;  1U8S A;  2Z30 B;  1IQZ A;  1DAX A;  1S6P A;  4UOC A;  3F73 A;  5IYB C;  4OI3 A;  2IVF B;  3VQS A;  4I7F B;  2XQC A;  1D9A A;  4WFY A;  3VAJ A;  4WZQ A;  4RNF A;  4R8U B;  3SFG A;  4FBU A;  4NLD A;  4W98 A;  2VKR A;  4XPE A;  3BH6 B;  3N0V A;  2B56 A;  1FNX H;  2DNO A;  1U1P A;  4AUK A;  2JL9 A;  1TWA K;  2I1R A;  3W64 A;  5HVH A;  3N01 A;  4RJV A;  3G86 A;  2P5M A;  1WD6 A;  1ISE A;  3TVY A;  3LPE A;  4OYB A;  4UOF A;  3PW2 A;  1C0A A;  2AF6 A;  3W63 A;  3NLC A;  2DYA A;  4ELV A;  4ANC A;  3HT3 A;  5KFW A;  4R25 A;  2GVD B;  1FRK A;  4DV2 J;  4ALZ A;  2JA6 A;  4QR1 A;  2ZBI A;  4HDH A;  1FDB A;  1S0O A;  2YPY A;  4GTL A;  4LQY A;  2HBY B;  2VFV A;  4P75 A;  4QOT A;  1SFO K;  1I50 K;  1PC4 A;  1TWF K;  4KO0 A;  4RW8 B;  3IAM 9;  1G4C A;  2DRB A;  3MM7 B;  1SJF A;  2XCQ A;  1VQ9 S;  3SXL A;  2Q1L A;  1WKK A;  1WC4 A;  2NRE A;  3FSX A;  4P74 A;  5E3P A;  2E2J K;  3S8S A;  5KT3 A;  2LKZ A;  3TUJ C;  1ZOT A;  2LMI A;  4HTI A;  2BQR A;  1VQ8 S;  4HL9 A;  3MM5 A;  1N36 J;  3MXH P;  6FDR A;  2QMW A;  1NK7 A;  1RT5 A;  3VAG A;  4RW6 A;  1R9T K;  1EET A;  1U24 A;  3DN9 A;  3ZTO A;  1O29 A;  1HPZ B;  1DTT A;  3DRS B;  4C3I C;  4DR7 J;  4NLX A;  3H7H B;  2EFQ A;  1RT6 A;  5EN1 A;  2DNL A;  2BRK A;  1CUL B;  4I2P B;  1BUX A;  2RS2 A;  3FNN A;  3V4I B;  2NVQ K;  1WI6 A;  4DX7 A;  3FVY A;  3CXC R;  1HNX F;  2BE2 B;  2X1B A;  2L48 A;  3A3P B;  2PE8 A;  4F02 A;  3TAM B;  2R93 C;  3I96 A;  2C22 A;  1VQP S;  1Q95 G;  3S1T A;  1CQM A;  3MFI A;  3CGI A;  3SMZ A;  2KYX A;  2FVQ A;  1C1C A;  2ADC A;  2QO3 A;  1GFW B;  3H0G A;  1Y1V A;  3HOW C;  4OYO A;  2V2Q A;  1N32 F;  1IBM F;  2GSO A;  4KAR A;  5AXN A;  1AYE A;  1B64 A;  1SJR A;  5B0C A;  1ZZF A;  3OPF A;  2DT9 A;  5DM6 Q;  3HSD A;  1DLO A;  2YKA A;  3GR1 A;  4DR6 F;  3NGR A;  1R8A A;  1Y10 A;  2Z57 B;  1T94 A;  4ZCM A;  2PII A;  3J7A 1;  3M4X A;  1YZ7 A;  1MRO B;  1S7I A;  2FQT A;  2UU9 F;  2H54 B;  1DQ8 A;  5E5N A;  4BXX K;  2MKS A;  3BKU A;  1REV A;  4X4O A;  2PEB A;  3TJ8 A;  2NZC A;  2PPB A;  2PC6 A;  3GTQ A;  4PG5 A;  1R0A B;  3I82 A;  1A7G E;  1F5C A;  2ZDO A;  1K83 A;  2F9J A;  3HMJ G;  1Q78 A;  1FI4 A;  4O0I A;  2K2P A;  1UP1 A;  5HN0 A;  3KK1 B;  3TUP A;  5DS7 A;  2LA6 A;  2NZ4 A;  4F4A A;  5AXM A;  1NPK A;  3D54 A;  4FNH A;  3UQS A;  2QYC A;  4ELU A;  1KTV A;  1S77 D;  2RT3 A;  5J2P A;  3I4N K;  2HWT A;  2NYH A;  2PEH A;  2ZWO A;  1JLF A;  2AKW B;  4NRT A;  5JXS A;  1V5I B;  3CCW A;  4ZPB A;  1BS2 A;  4WFB Q;  4LF1 A;  1VQO S;  5KOW A;  3I9V 9;  1RWN B;  3AH5 A;  2FHK A;  2Z58 B;  3T5L A;  3QRP A;  3QMQ A;  1EAR A;  3ITH A;  3K57 A;  4CZC A;  5D77 A;  3ZZZ A;  2XG8 A;  2H48 B;  1IS1 A;  4MKA A;  3N6L A;  4CM2 A;  5IYB K;  3GIM A;  2BAC A;  1NJX A;  4GVB A;  1IM6 A;  3CE8 A;  2FC9 A;  3EQL A;  4B3T F;  3D0H E;  2J0Q D;  5JVG Q;  4IRC A;  3K5M A;  1TU0 B;  3JQJ A;  1G1X A;  4NXN J;  2HNY A;  2NVX K;  5LM7 E;  2HMI A;  2A6M A;  1J6V A;  2KO1 A;  1KQG B;  3TVZ A;  2WAQ D;  3QO9 B;  1HBO B;  3PV8 A;  3Q2S C;  2BW7 A;  2EFN A;  4CQ1 A;  1RBL A;  4ILM A;  2HVE A;  3MUT P;  2UUA J;  3PX4 A;  2COL A;  3TJA A;  3THT A;  3EXY A;  4ECZ A;  3MMB A;  1OPZ A;  2R2U A;  1EQ0 A;  2J7U A;  1X5T A;  3BKF A;  2IMW P;  3S1N C;  4YR0 A;  2BJ1 A;  3MED B;  1VJW A;  4DFK A;  1P6T A;  3OFF A;  1BQN B;  3NWR A;  1ZET A;  2CQ4 A;  4F3M A;  3D3B J;  2V9W A;  1VS3 A;  3RW7 A;  3BQ1 A;  2XEX A;  4KPC A;  5M5Y K;  1S9E A;  2MZR A;  2HFU A;  3CJQ A;  4IFV A;  4KH1 B;  1L3K A;  4XAK A;  3LO3 A;  4UOG A;  3NXZ A;  4LVO P;  3CCS S;  1APS A;  1O28 A;  4DSL A;  3G6V A;  4KYZ A;  5HRO B;  3CJ3 A;  4NA1 A;  4B3O A;  2GJF A;  4KFB B;  5C4J K;  3QID A;  2R8J A;  4QCL A;  4KM8 A;  1B0P A;  3H3V D;  2A6E A;  5F9L A;  4DL7 A;  5KFZ A;  2HHU A;  3KLI B;  5HK4 A;  1I50 A;  1LV5 A;  2H5E A;  1FKO B;  3E51 A;  3AH6 A;  4OX7 A;  2BMB A;  1WF0 A;  2ZVI A;  2MB0 B;  2IHR 1;  3BR8 A;  2QGF B;  5A8W B;  1UAW A;  4IRK A;  3MHY A;  4FYY B;  3ENW A;  4ECU A;  2W1B A;  1DJ0 A;  4B9V A;  4C11 B;  4G1I A;  1N5Q A;  4LF5 F;  2OHD A;  1YHQ S;  3UN5 A;  4A3G K;  3V2U C;  1XMQ J;  3VGT A;  1B4B A;  4LR7 A;  1CVJ A;  2LFV A;  3CJK B;  4PXE A;  1VBZ A;  2RIL A;  1KOH A;  3H90 A;  2WW8 A;  1NJW A;  1XZP A;  4J9P A;  2VF3 A;  4WKY A;  2HHX A;  2H51 B;  4YDD B; 
#chains in the Genus database with same CATH homology
 1XZQ B;  3A8I A;  1XZQ A;  1PJ6 A;  1WOR A;  1WSR A;  3GEI A;  1PJ7 A;  3GIR A;  2GAG C;  1VLO A;  3AD7 C;  1YX2 A;  3GEE A;  3TFH A;  1V5V A;  4PAB A;  2GAH C;  3TFJ A;  3ADA C;  3GEH A;  3TTG A;  1VRQ C;  1PJ5 A;  1WOP A;  1XZP B;  4P9S A;  3GSI A;  3TFI A;  3A8J A;  3A8K A;  3AD9 C;  1WSV A;  1XZP A;  1X31 C;  4PAA A;  1WOO A;  3AD8 C;  1WOS A;  5L46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...