3AD7C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with methylthio acetate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subunit alpha of sarcosine oxidase
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad7C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad7C01
4PABA 1XZPB 1XZQB 1WOSA 1V5VA 3A8JA 3GEIA 2GAGC 3AD9C 1PJ6A 3TTGA 5L46A 2GAHC 1WSVA 3GEHA 3TFHA 3AD7C 4P9SA 1WOPA 1VRQC 1WOOA 1XZPA 3TFJA 3AD8C 1XZQA 4PAAA 3A8IA 1YX2A 3ADAC 3A8KA 1WORA 1X31C 1VLOA 3TFIA 1PJ7A 1PJ5A 1WSRA 3GEEA 3GIRA 3GSIA
chains in the Genus database with same CATH superfamily
3C14B 1MW7A 4HHJA 2HFOA 1IWGA 3Q2TC 1ZAXA 3Q2SC 4IRCA 1VDHA 4O3NA 1TKTB 3VQTA 2CQ4A 1NSPA 1RT4B 3ELHA 1AROP 5FDLA 1RAHB 2ROPA 4ZVGA 3DXBA 3VAIA 1VRUB 4OHYA 3NS6A 1I5OB 2R2TA 4RLEA 1TK5A 5KFCA 3DLLQ 3HCXA 4KJIA 1P6TA 2YNHA 3ULHA 4ZPWR 2HHUA 4YB5A 4ZCIA 5D8HB 1HHSA 4IUFA 4A46A 4ECZA 4DUYF 4WJ4A 2Y0BB 2ASYA 2OPPA 4NCBA 5KFNA 2OPRA 3KMSA 3PEHA 1IE0A 4PQAA 3KLIA 4FPIA 4ZP8A 2VFUA 4XDCA 4B9NA 3GTQC 1U09A 3HHLB 3CMQA 3GDZA 2HNYB 2YU9C 2GQQA 1M5KC 4O3QA 4A93C 1XIQA 2JDJA 4ZVOB 2LEPA 3CO0P 1FI4A 3TO8A 4YFNA 4MT1A 5I42A 2UXBF 3NGKA 5C2CA 3T6BA 3FKIK 4A3CC 3CDWA 2PN6A 3EXYA 3TI0A 4LRDA 3OT9A 5C25B 2H4WB 2CQIA 4XPCA 5LSLA 2Z2ZA 4MYUA 3RZOK 1SJ1A 1VRTB 3H0PA 1HNIA 1QE1B 5BYQA 3QRPA 2MQPA 4P2XA 4F4ZA 5L38A 4WWSA 3FFIB 3FMBA 3GILA 3R1HA 2R7QA 1KONA 1LXNA 4F2RA 3CCQS 2EFQA 4G1QB 2UXCF 2Q43A 4DDQA 4DQPA 3T19A 1LW0B 1D09B 1PG5B 3R97A 3AQOA 1CS4B 4J90A 4X64J 4BKWA 1RE1B 3MR2A 4J9MA 3G6VA 1J6WA 2VG7A 1NHVA 3MCMA 3PYGA 3KLVA 5C4XC 3EVMA 5I3UB 1RYRA 2V4JA 4AT1B 2N82B 2YWWA 3L4KA 1R9TK 3HO1A 2GS8A 3L09A 2CJXB 5B0DA 3H5SA 4NASA 2XMAA 4USVA 1KLMB 5IP9K 1H7XA 1R9TA 5FD1A 2RHSB 2B5JA 2QMWA 5HJXA 1S1WB 3LUYA 3G86A 1FDAA 1RQ0A 2YQ3A 2J0QD 3FUYA 2Z2YB 1RADB 4OZ0A 2OSRA 1NK8A 1HQEA 2W7VA 3FNNA 3Q0AA 1J6VA 1M0SA 3T1HF 3IXQA 2I1RA 5KT5A 2RS8A 3LP2B 4H4KA 5IOTA 3GYGA 4XSZA 1FRHA 2EFVA 4QWEA 2HNZA 1L0WA 1VBXA 1RYSA 4ELVA 4P73A 5E33A 4NYPA 1S97A 4CLSA 3TFHA 1UA0A 1LOUA 5HROB 3D1HA 4TU7A 2RH6A 1CJTA 2ZZMA 3W2WA 4KTQA 4EU0A 2WOMB 2HFVA 4G1PA 4P10A 3EZOA 3T5LA 4NXNJ 4FF3A 2KYXA 4NX9A 1LXJA 3IG1A 4BHQA 4DPWA 1Q81T 1RXOB 1S1TB 3HOVK 2DY9A 3RYLA 2PMZD 3P4UB 1NH8A 1WCMK 4ZVRB 3MM8B 1FESA 1RT2B 1VHFA 3IM8A 3BEGB 3MM5B 4UUXA 4LIWA 5CYMA 1GTHA 4MKAA 3TEHB 1IVZA 3RG6A 4LFAF 1P9YA 3S01A 1VQYA 1N5YB 4G0UA 4L76A 4UZBA 3MF5A 2IDEA 4C0HA 2ZVIA 2W9BA 1T05A 4NL5A 4CM2A 2P9GA 3TEGA 3QFHA 4C48A 1R27B 1ZBTA 4I69A 2HHQA 3I32A 3KJVB 1TKXA 1VQ8S 3QJLA 2MY8A 3AT1B 3T1AA 4I6WA 2R7SA 3TAPA 1WQGA 1XNRJ 1HD1A 1BJTA 3R5JB 3B8HA 2IMOA 4IRDA 4QIWD 4DQRA 1FVSA 1XMQF 1VQNS 3ZTOA 4DR4F 1M1KT 1RT3A 2B51A 2HMIB 1S10A 1HKAA 4RUAA 3CEDA 4KYZA 3HOYK 2GW8A 3MOJB 4DPTA 2A6MA 4KGXB 3CD7A 1TL1B 3OBIA 3WQPA 2VHGA 2VFRA 1RTIB 2OO4A 1WD6A 3X1LB 5C24B 4J9PA 2MHNA 4ECRA 4USKA 5A0YB 4DV0F 4G0VA 1RA7A 2IM2A 1RTDB 3LTOA 4OZNA 3ILOA 4HT5A 2OTLS 4CH1A 3GLJA 4RW6A 4X6AC 4FS1A 2ASLA 2DISA 2OPQA 2YH1A 4ED4A 1S6UA 4WFNQ 2A1BA 1HBOA 2IRUA 2E7VA 3TUZC 3SCJE 1N33J 1IR1A 4MEYA 4H4KC 1GXTA 4EO6A 4KC6A 5HVHA 5A8KB 3THPA 1Q78A 1M5PC 4MIAA 2A0FB 1VQ4S 1RT7B 3T9NA 4DMZA 1Y3KA 1Q0NA 2HQGA 3KWMA 5L1IA 1FHTA 3K5MA 2HK3A 2B56A 1D3WA 1WIHA 3W64A 1FEHA 4C3IC 1RAOA 2NCKL 3QPIA 1ZPVA 4ANDA 1FEEA 4DDFA 2AJFE 4K0KJ 4DR2F 3S14C 4X65J 4YY3F 2A10A 1OY8A 3MGJA 3N79A 1NK7A 1Y1VK 2E9ZA 2AHOB 1YVFA 2XY7A 5C5JA 3M3YC 3A13A 2FLLA 2D74B 1Y1VA 1V3RA 2FHJD 3R6GB 4LF7J 3OLAA 4NA1A 1EB0A 2FLOA 1VC0A 2C2NA 1R8HA 5E3CA 4Q2MA 1K44A 1F9EB 2WVDA 3GJSB 3M2RB 3QBCA 2Y0SL 1VQ7S 5CZXA 3MMCB 3GQCA 3KK1A 1AZSA 4UY85 1H74A 3HOZC 1NJWA 2HBQB 3BQ2A 1HNXJ 3UDVA 1R3NA 3HFVA 2PFFB 2ZC3A 4C3HC 2DHGA 4F3QA 1OWXA 1RHRB 1RAFB 2RAQA 4YMEA 2OUGA 4ECTA 2MGZB 3KJQB 4C8YA 2JVRA 4KN4A 3QZ8A 2R7ZK 4QR2A 3HT3A 2V8GA 2DBBA 4TLRA 4H4MB 2CFAA 2CJQA 4W4MA 4ZVQB 2VIHA 2R7ZA 4B9TA 4KC5A 2MSSA 1VS3A 3H42A 4M5GA 4YDXA 3I5AA 3U27A 4K4VA 1O2AA 2MKSA 3D2WA 2MPUA 4A3KK 1RAEB 1IW7A 2CPFA 2LQBA 5KFHA 1SKUB 2ZE2A 4HI2A 2FYXA 2D3OR 1NCLA 3CUNA 2GJ2A 3R8YA 5J2NB 1UCNA 4USWA 3U1NA 3J7AN 2R93K 2JLEA 1TVRB 2XSJB 3W63A 1IKYB 1SKSA 2MLYA 3FCWA 1M1HA 5F8HA 1GMWA 3ETMA 3RAXA 4X4VA 3GV7B 2R93A 3MUTP 1TL5A 2CW0A 2YQ1A 2CIMA 4DFPA 4ETZA 4QCLA 3ZO7A 1FVQA 4YG2A 4IO9Q 4NLGA 3S1QC 3M05A 1WC0A 4HR2A 3CCWA 2OFGX 3RTVA 1N5QA 2ZWOA 1B64A 3M8PB 4CO5A 1NNDA 4CQ1A 1T3OA 3IWLA 2DCLA 3I4HX 1FJGF 4MH8A 1TWAK 4M5IA 4LF4F 4OI0A 3DKDA 4EMDA 4YFKA 1K8AT 1J5OA 2OTJS 3BP3A 1OS5A 3BBCA 4N77A 1T03B 1HNZF 1TWAA 4KAWX 3DOKB 3M8RA 2NVTK 1A0OB 1CQMA 4R0JA 4IRKA 4MKVA 4PABA 4ED2A 1IQ0A 4KY3A 2HS4A 3JS9A 3ENQA 1LKZA 1Z2ZA 4OI6A 1JQGA 1QJHA 3GCXP 3ZZZA 1FE4A 4JYAF 1C0TA 2DGVA 4OHVA 5B0CA 4DG1B 3Q8QB 3BR8A 2LXFA 1T9XA 1U1OA 2W7OA 2AGQA 1N34F 2HRTA 3LAMA 2V68A 1UVJA 2DNKA 3IR7B 2ZOFA 1TAUA 4LR2A 3HX9A 1KOOA 4RUCA 4ILMA 4P5BA 2H9ZA 3EPGA 1FWLA 3CDAA 3FEYB 4O3RA 2KT5A 3AB4B 2WB1D 4M5KA 4G0WA 2R92K 2HAFA 5CYQA 1X4FA 2J8SA 3NLCA 1S1VB 1N8RT 2MQOA 4OLPA 2XO6A 1K0TA 3GTLA 4KHPF 1H2UX 5KG7A 5AE1A 2C3PA 2XCPA 3G2XA 1XERA 2PI5A 4Y65A 5M2PA 1B0VA 3BPSP 3H4DA 1UVNA 4WJ3M 4I2PA 1FRXA 2B9EA 3GTMK 3OHBA 4ECUA 3EVWA 2NZCA 2FVRA 4Q0BB 4YQWA 2GAHC 4PXBA 3GTMA 2MSTA 2P5MA 4PAAA 4KM9A 4IH5A 4HACA 2OJ3A 1NJZA 1WF1A 2L9DA 1XZPB 3LAPA 1REVA 1JLBB 3ZNUA 2R7RA 5F8JA 1U02A 4P72A 2BKPA 4MEXA 4Q4ZA 1FTCA 2EXUA 3D0IE 4IFYB 4QWAA 1HIYA 4QJVB 1YJRA 4ZOSA 1P9QC 2RDJA 1XMBA 1EKRA 5KFLA 3KYLA 2I5JA 1PYTA 4DV5F 5C7PA 5CXTA 2VKZG 2NS1B 1YLXA 2RGRA 1Q1KA 2JC0A 4E8UA 3UN3A 3KLEA 2X1GA 4LBIA 2DR9A 1HPZB 2X51A 3VAMA 3S16K 1YGYA 4FBUA 3P49B 4LRAA 3RBZA 3M9NB 1TAQA 2YX7A 2ZC4A 2BM0A 1JLFB 3OR2A 4RW7A 4IG0B 1VC5A 4Y2IA 1KR4A 2RE1A 3CDBA 5IT9U 1O26A 2CPHA 5ETKA 1RUSA 2D1CA 4DOZA 1EFWA 5GAEI 3CJQA 4LSLA 5F3TA 3ILIA 1VJEA 4GTCA 2BE7D 3H3VD 4LVOP 4HEA9 3W60A 3TAMB 4HHHA 2O01C 4R8UA 5AT1B 3RBXA 5L9XA 5B7WA 4DJBA 1QUVA 5DS7A 2HS0A 2XNQA 5K14B 3ILJA 3T5KA 3QO9B 3RJMB 4DX8H 2ZUFA 2ZH3A 4PG5A 1QVGR 3T01A 3IAM9 5KT3A 1KQKA 1R43A 4NZ0A 4BLBA 3TFJA 1PBAA 2DEJA 3CMES 3NY0A 3GTLC 1PJ5A 1B99A 3UDLA 4OX9F 1JK9B 5HMYA 2LP4A 4LRCA 3G6YA 5L46A 5FLMC 4YFXA 1Q4RA 3B78A 3N0CA 5FDLB 5IOSA 4RNOA 3BH6B 5GAEU 3QJPA 3C6TB 3B54A 4WXOA 1WSRA 1SQFA 1Y5NB 2F3JA 2YNHB 4TNOA 4M95A 3DYAA 1A7GE 1F9NA 4OIQA 3MM7A 4NLOA 4GFQA 4LF6F 3KUHA 3OFGA 2OPPB 4OZ2A 2ALZA 1SJFA 2HQDA 2OPRB 2NQPA 1DCOA 4TN2A 2HFZA 1KD1T 2P9EA 3JXOA 3VV2B 3N28A 1G7CB 1NPRA 2X3DA 4ZLLA 3CJTA 1NSKL 4O23A 2QL7B 1UW9A 4A3MC 4IOBA 1R0AA 1S9FA 1F3VA 4I68A 2DB1A 3EDQB 3VVUA 3LPYA 5I42B 4BLGA 1N0VC 2HKEA 2OEMA 4ED0A 2AF6A 4WKRA 2GMLA 4O3OA 3KMQA 4O4RA 3W61A 3JTOA 2BJ8A 4A3IC 4CLLA 3K59A 2EKNA 1FE0A 3KG4A 1HNIB 1J5EF 4ZK7M 5KAKA 3PO4A 2IAJB 1M5OC 1N6QA 3M2UA 4JI2F 8RUCA 3KK2B 4DX6A 1UPPA 2AEJA 2NYIA 4B9UA 3K7RA 5CAAA 2VPWB 2E2IA 4FPRA 5KFIA 3BQ1A 3NNCA 5D4PA 4I0WA 1S1XA 3I5BA 2BJEA 2AX1A 1PO6A 3OW2R 5AXLA 2LEBA 1HWKA 2QLJB 5D4DA 1YBUA 3FCVA 2HFSA 2A3JA 4N76A 3QSYB 3PKMA 3T1YJ 2MZSA 4WK1A 3CDUA 1EZZB 3CCLS 1N32F 1Q8BA 4GTBA 4P2FA 4USJC 4LJZA 2CPEA 4XTTA 3VGUA 5E41A 1FX2A 2AT1B 5M5XK 4WFBQ 1UZHA 2R42A 2N7CA 2P5VA 4X4QA 3K7AK 4FVCA 2VBYA 1O28A 1T11A 4EBEA 3A8EA 2HYIB 1SH2A 1JNZB 1IR0A 4A8KA 2XC9A 5CCLA 3MCNA 2L48A 1UJ5A 1VJWA 3E8OA 2GMJA 1O29A 2ZNYA 5A8RA 2AGPA 4FYWB 4K5RA 5IFMA 3ZTQA 3G4CA 5HMXA 5DDQC 4TU8A 4OFZA 2CQDA 4U9RA 1Y5IB 4KV8A 4IOAQ 5CABA 3CCTA 2WSCC 4ZJLA 2GHVC 1O2FB 4U7UD 3I55S 2XQCA 2YNGA 4DL4A 1ZTTA 2HNZB 3NKYA 2J9CA 4RU9A 4UT4A 4ILLA 5JVOA 1F1BB 1QLNA 4OI4A 5DLGA 1CJTB 3OL7A 2FZKB 4CNYA 2FHMA 4F8RA 5KOXA 3M8ZA 5IC4B 1ITPA 5EGHA 4E2FB 3DMJA 2ZDPA 2FDNA 4FNHA 4GTEA 3GR1A 4ID5A 5IWAF 4FS2A 2CZVC 2PHCB 3M8QA 4AUKA 3SFGA 2OPSA 4WIIA 4K59A 3P5BP 2FGCA 3GG0A 4O0NA 3BSOA 1U6ZA 1ZVUA 1RKJA 3EZUA 1SJ4P 1K83K 2D7SA 2HHXA 1RTHA 2FVQA 3D0GE 2W9BB 3KK3A 3BKUA 3LP1A 4I6YA 2AJ4A 1R8PA 4F04B 3W3SA 1QY7A 2BZ2A 5H9FJ 4FXDA 3W9IA 3PDNA 3W8GA 4JI4F 2PPBA 1XK8A 4A8XA 2ADCA 1DRZA 2GSUA 3OTBA 3G87A 3ADAC 3AH5A 2OIHA 3LAJA 1WG1A 1RKIA 2HBZB 2VA2A 3OXLA 4L3KA 4DLEA 3S2DK 4CO3A 1S12A 4AYBL 3PW0A 4OI2A 1HFEL 3M4OK 3CCVS 1ZM2A 2XCOA 3TFIA 2KG0A 2C2KB 3H8YA 3SYZA 3I4PA 1MN7A 2C2EA 3M2VA 3T5JA 1WC6A 1FK9A 4OYMA 1HYSA 2GVZB 4PZVA 3HOXK 1NSQA 1IBMJ 2DRDA 3WHIA 1U2CA 2QZ8A 2Q1LA 1F0XA 4XK8C 5KFSA 1NKBA 3NRBA 2QSFA 2OPQB 4RR5A 3UPFA 3VGVA 2BXJA 2IVMA 2R8IA 4F3MA 2GGPB 2GCFA 1HBOB 3ICLA 3I82A 4LR7A 1F9HA 1S79A 3UD3P 2LQJA 3WDOA 1H98A 4X4PA 3EGNA 2R8KA 3C46A 4WYWA 2UUAJ 1U2FA 4C8MA 4GTDA 2GFFA 4UOCA 4OINA 1QSYA 3HLUA 3SCIE 2VQEF 4B9SA 1HNVA 1ZETA 4PQUA 1ROFA 4LF5J 2GNKA 2RVJA 1GEHA 1R8CA 3IBCB 1M1GA 2WTFA 4TXSA 3SEOA 2VG5A 2ZWPA 4J9OA 1U1PA 3J7ZT 4DFMA 3UW1A 4Y28C 3CQZK 3LGMA 2GSOA 3GIMA 2PMHA 3W65A 2KWAA 4ED1A 4OYAA 5K9FA 2JC1A 4K4TA 1RDRA 3TVYA 4M5DA 2HPUA 4MMOA 5IYBC 2HWHA 4MKYA 4JI0F 2XTJP 3ZTPA 3E3XA 5A76A 4B3TJ 1YK9A 2IYIA 4YDDB 1AZSB 1TWHA 3HVRA 1UV7A 1YJWS 2P2CB 3C2PA 3SBMA 2BJDA 2M0GB 3K0JA 5D0EA 1TKZA 2XMTA 2DGTA 2W9AA 1LNQA 2M52A 1KNZA 3NGTA 3GE9A 1PSDA 4JI3F 2Q6BA 1GXUA 3I0RA 4KPCA 1ZBSA 2KO1A 4C7QA 3VWSA 1XR5A 1VGYA 4LRBA 4B9LA 2PSZA 2RNEA 3QX3A 3BR9A 2BQ3A 2V6UA 4NOHA 2MB0B 4KN7A 3KG1A 3HOWK 2W4PA 4CDIA 2HVDA 4DU7A 3OD2A 1Q8LA 4PCQA 2HIYA 4HT7A 4LBHA 4DV7F 4O0IA 1YJNS 1DTTB 2IA0A 2ZBCA 2ZH7A 1BS2A 1RU1A 2R7XA 2J8AA 3QT8A 5KG6A 3S1MC 1ICEB 3Q23A 4ZVTB 3QLHB 4DV3J 2F7VA 1KRPA 1YJUA 1EARA 2V5HG 4CLKA 3DDIA 4K4WA 2HLTA 2CNLB 2DRAA 3D0HE 2DT9A 1T9UA 3S17K 2ZNZA 2KDOA 2B63A 2YH0A 4ZP7A 1U1MA 3BGFA 1FKOB 2YWKA 5HL7Q 4A4JA 4ES1A 5F8NA 3PNIA 1N5SA 4LSNB 3TARA 1T7PA 4PG4A 1O51A 3C19A 2QSWA 2BKOA 1NHUA 2J0XA 2A2CA 1VQPS 3BSAA 4QZVB 4KE5A 1G3OA 1LK5A 5HVFA 4RBVA 3FSXA 3DLEA 2E9RX 2OMOA 3EWGA 3EMTA 9ATCB 2Z4PA 3SIPB 3RAMA 4ZPTR 2CG4A 4LFBF 2Y1IA 2QE5A 3ZZRA 2G1DA 3VALA 3MFHA 2JFKA 2BX6A 2GVDA 4I67A 1DBDA 4TYAA 4CWBA 4AXJA 5A6WA 1SQEA 1NMEB 1TKTA 3HSGA 2YKNA 1TWHC 1RT4A 3B4DA 4NPOA 5C44C 4GTAA 1MMDA 2JA6A 2OD4A 1VRUA 5IOLA 2Z58B 4DS4A 4MYTA 1EHWA 1AFJA 1C0TB 2C28A 4PKDB 1M5VC 3O2IA 3FCHA 2VBXA 4O3SA 1DLOA 2HRUA 4HLBA 4ED3A 1UZDA 2R2UA 3D4JA 3P96A 2UVVA 2A2DA 4A3BK 1VOMA 2VFVA 3E2EA 4C97A 4AXIA 4NYZA 5CYQB 3HHLA 3SCLE 5LOQA 3G8TA 1C0AA 4MK9A 4E98A 3SQOP 1Y1WK 3HOUK 1HI1A 5GAHI 2LVWA 5KFBA 4CTAB 3BSNA 4Z7YA 1ZXOA 4TQRA 3KJFB 3Q8UA 1CJKB 1R31A 4I2PB 2CYYA 4X84A 1NBEB 4MK8A 3JB9k 1ACMB 2XYGB 4C2MA 4ZCKA 4P7TA 1JJ4A 5HJYA 1QE1A 3MR7A 3PX6A 3PVXA 2ZUGA 1NZAA 5CH7B 1I6VA 3B4MA 2CNKB 4GRSA 3FFIA 1KFSA 3RB6A 4FXVA 3F56A 4JP8A 5KTQA 3OTCA 4HH0A 2B63C 5K8NA 3CJ4A 3SQGA 3RGIA 2AJ0A 1RI7A 2XULA 1WTBA 2PEHA 2VODA 3HMJG 4EBCA 4NCAA 1EI6A 3R9LA 1REVB 1TWCK 2WSEC 2W9CB 3M8YA 2DNQA 4RNFA 1MSWD 3Q89A 4PEOA 1UJ4A 4A3KC 1OJ4A 2J9DA 2WK4A 1TWCA 2NVXA 4ZIWA 5GAHU 3Q24A 5FJ4A 2J9DE 1OIAA 4BBRK 5M2UA 5KG1A 2W24A 5I3UA 2C2DA 4Y2MA 1UFWA 2F8HA 2KFNA 4ZITA 2CZ4A 2E5LF 4DV6J 2CWKA 2H1YA 3I6PA 2C42A 3U7JA 1C1BB 2HGLA 3LA0A 3OR2B 2B8PA 1R0CB 2GAGC 3W5XA 5DJBA 4PR6A 4DV4F 1F7VA 3FSYA 2Q6CA 2R7UA 4EBDA 1RCOB 2JA6C 3PJXA 3QIPA 3VZIA 2DXFA 4URQU 3GTJC 1X5TA 1PCAA 3HP6A 1EP4B 3JAMY 2UU9F 4CH7A 3H40A 3MR5A 2L08A 1XBWA 2RRAA 3OLBA 3UVJB 3OTDA 4WXWA 2ZH6A 2KYZA 1UEUA 3ZNJ1 2MZJA 3K57A 4R8UB 2LA6A 1XXBA 3EICA 2YPYA 4DS5A 1WC4A 1JB0C 3T6JA 4L3NA 1R8BA 4WJBA 3AFGA 3F44A 4OX6A 2NVYC 1H7WA 2WOMA 3IR6B 3GJTB 5KOWA 4RMFA 4Y00A 2GMHA 5KT7A 1QAJA 3LGNA 1FRKA 5IYCC 4A3JC 2M4MA 2CQ0A 4Y34A 2Z30B 4F4WA 3GIRA 1NJYA 4PYAA 4ETXA 3H59A 2H3EB 4NI2B 5LSOA 3I0SA 3T5HA 3BDPA 4K4UA 1WF0A 3MM8A 3RRHA 2DYAA 4U95A 3DOLB 2NUUG 3MM5A 1EIYB 1HR0J 4LQ3A 1IUJA 1NKCA 2HQFA 1SKRA 2ZEJA 4C2MC 1DJ0A 1AB4A 4X4UA 4NWBA 1RLDA 3LPEA 4DR6F 1O6XA 4K4YA 2Y9HA 2KB2A 2MJUA 3RZDC 1HNWJ 4A3DC 3P3DA 4RZRA 4Z2XA 1YX2A 3RBEA 1DURA 4PYDA 1F9FA 1XJWB 5ETOA 2XZWA 4CO0A 1Q79A 3OVSA 1RU0A 4ZVSB 2DH7A 3RAQA 2HWIA 1BLUA 4W90B 4PWDA 2EWHA 2BBEA 5D0GA 1KSPA 1NDCA 4AD6A 1RK8A 2DO4A 3OJSA 4LK0A 1T95A 2NPFA 2X7IA 2FZGB 2YX4A 4K4XA 1FNMA 3OR1B 2XMMA 1KEKA 1NSAA 5ETRA 4KB2A 1YBAA 2BJ1A 2KXNB 3BO4A 4LF9J 4PPDA 2MZTA 2ZFHA 3W66A 3S2HK 2PFDA 2H5IB 3LGHA 3OL8A 4DR3J 3D67A 3BBBA 1RTIA 1I94J 4QU7A 1JVIA 3CC4S 2ZZNA 2J76E 2O5JA 4BY7C 1Z1ZA 4U96A 1N6QB 2MQMA 1RTDA 1C0UB 3ITHA 4EO8A 5BYSA 5KFFA 2UXDF 5A2QY 5C4JC 4CLYA 5DDPC 3W9HA 1D0EA 4GTLA 2J7WA 2NR0A 1HI0P 4XLPA 4NRTA 1TWFC 4LR8A 4MAKA 2QX0A 1VISA 3DC2A 1FNOA 4X66F 4CCHA 4MTPA 1RT7A 4JI6J 2VC1A 1K1SA 2EI5A 2YQ0A 3TJ9A 2M88A 5ITHA 4FF1A 2V63A 1EQRA 3Q8VA 2QA4G 1B7YB 1R8AA 3TA0A 5IT4A 3S16C 3QWPA 1IQTA 4FF2A 2EPIA 3OL9A 3HHDA 2QA4S 2APOA 1O0PA 4C0OC 2VJVA 4OJHA 3PCOB 3GTPK 3GP9A 2JSXA 2HS3A 2FVPA 2QLWA 2H4YB 1TUWA 5A8RB 4GZYA 3MR6A 3HK2A 3PO3K 4USMA 3NGUA 3G6ES 2B9XA 3HSDA 2BOPA 3OL6A 3DHXA 4JI1J 2HFUA 2VQFJ 1PC4A 3BGOP 2DH8A 3D1QA 3M2RA 3PW4A 2YTCA 2YNGB 1JOEA 3MMCA 4W98A 3LWLA 1OY6A 1XNQJ 3SDEA 4FVMA 4DV2F 1V3ZA 4F0MA 2IBOA 2EFOA 1OYDA 2LQ5A 1RA6A 3PV8A 2K7KA 5ETLA 4B3RJ 4L72B 2KT3A 1XEZA 1HBUB 2FQQB 5K8MA 3U1LA 5CHPA 2RIJA 2XS5A 2XG8A 4EFAC 2AU0A 5H1SV 1KOHA 2KT2A 1SQGA 3WODA 4ID5B 1FTRA 1TL7A 4A3GC 1CQNA 1WKKA 3KUGA 1N5TA 3V4IB 5EWFA 2KXFA 4A3LC 1VQOS 2OPSB 2QV6A 3D9BA 1U1KA 4RL1A 1FXLA 3DLGA 1HBNA 1HQ2A 1XMOJ 4M94A 1U1NA 5LT5A 3TR5A 4LFCJ 5F8LA 4KMDA 4YS2A 4A3FK 1JJCB 3FKBA 4FZVA 3J81j 4HVZA 4V19J 4PRFA 2I38A 2GZOA 1NEEA 1FD2A 3D1OA 1RTHB 2Y3YA 3KK3B 3MZIA 2G0JA 1UWBB 3G6XA 3DLKA 2MZ1A 3CCMS 3EM1A 1I50A 5DM6Q 3PW2A 1IKYA 3R3TA 1VK8A 2R8GA 2PMWA 5HP1B 3DDNA 3TA1A 3N0BA 3IFEA 2GC8A 1ZM4A 3FBEA 2JFDA 3VAHA 4JV5J 1WF2A 4DX7A 2JWNA 3ENAA 5LL6d 1R89A 4U8YA 4YHHJ 4QW8A 1VCTA 1FFGB 4P2MA 2ZHOA 4CRJA 4F25A 2FY1A 2E2JK 1S1UB 5M5WK 5DM7Q 2WAQD 1NAQA 1ZPWX 2KXHA 5IP7K 1EETA 5CYJA 4XLNA 2QJ3A 1RLCL 3KKFA 3CD6S 1S6OA 3S15K 3PO5A 4DR5J 1XR6A 5CJ9A 3M2VB 3AQPA 3I4NK 1HYSB 1RWMB 3VZHA 1YCLA 2XCQA 3UWTA 1S0MA 4XO0A 4KSEB 3CJ0A 3H5XA 2H65B 1BDFA 2UUCF 5KT6A 3PO2K 2VBWA 1DCPA 5KG0A 2DNMA 2GX8A 2CVEA 3A3PB 3O5TB 2JA7C 2KFZA 4NEZA 2WBRA 4AQYF 1VGXA 1I3QC 4QIFA 5D0RA 2DIVA 3BKTA 2HAIA 1BGWA 3OTOF 1QTMA 3LWMA 3OSNA 3EDRB 4RPFA 1OSCA 5IM0B 3JTPA 3FRYA 3GEIA 2FC8A 2XI2A 2POKA 3R1LA 2PD1A 4DG1A 2ZH2A 2LKZA 2HHHJ 3S1RC 1PYSB 1SKWA 5KG5A 3AD8C 3TWZA 1DY3A 1J98A 1HNVB 5M5YK 2RRBA 1N36F 4PQUB 2BACA 8AT1B 4W92B 4WU3A 3EGZA 1TELA 1L3SA 2R2RA 2ZJPQ 5IQQA 2VG5B 3N5BA 2AW0A 2MXYA 2JLFA 3BF4A 2DGSA 2D3ZA 5KG2A 2F5GA 4WTYA 4KH0B 2M7SA 3UO0A 2A18A 3PYDA 1SV5A 1IBAA 2V0NA 4FNIA 1Q53A 2FHJA 2QTWA 4B3MJ 4M5DB 3TW0A 5B08A 1JLQB 4CO2A 4N56A 1I50C 4KMUA 3POTB 4NZ7A 4ENOA 4GC7A 2MDAA 2BM1A 3MEEB 4QYZK 3CCSS 2GIQA 1AT1B 3HT0A 1RBOB 3H2LA 2CPDA 2C3YA 4KMAA 5J2QB 4Y0FA 1PYOB 2C2MB 5DG7A 2ZJRQ 1DD5A 2J6UA 3I0RB 1XZPA 2NVQC 5F3ZA 5IC6B 1VLOA 1RT5A 3AH6A 1FRLA 1TWGC 1JLBA 1Z2LA 1RWVB 3HULA 3J80Y 3RRGA 2AJQA 1S72S 3MM9A 4A93K 2Q66A 4I64A 3RW6A 4IFYA 2BOAA 3GTQA 4QJVA 5EX3A 2YU9A 3IN5A 4A3CK 2AZ1A 1U8WA 2NYHA 1DQAA 2JX2A 1T8EA 4PUOA 1PAUB 3MAHA 4NLQA 2OP5A 3RZAA 2JA5A 2LEAA 3EJMA 1HPZA 3NWRA 5FJ8K 4I6AA 4CI0B 1LQ9A 2ZBPA 2IYGA 2C2RA 2WW8A 3QT6A 5EUHA 5D15A 4CO1A 3CCZA 4QR0A 2VUMA 3MD3A 4KARA 4QOTA 2VDHA 3AD7C 2QLFB 4USTA 2XMJA 3MPDA 2KRBA 5KFXA 1SJQA 1PJ7A 4U6PA 1REGX 4Q8FA 2XNRA 3KJNB 4X62F 4Z7CA 1X4BA 1UP1A 3BH7B 3TX0A 2N3LA 3H7HB 2UUBF 3UCGA 1TFWA 2ILZA 3TAMA 3MD1A 1FX4A 1RT1A 3IMQJ 5C4XK 3BPDA 3HZGA 1LWEA 3DRSB 1L3VA 3SI8A 4BBSC 3DLEB 2N4DA 3SSRA 3QO9A 3IC1A 2PMZL 2IJFA 1XPPA 1VRQC 3IBWA 3QT7A 1K0VA 4OYBA 2E1PA 4ZMMA 4J9SA 4RW8A 3DRPB 3CJSA 5K20B 2AP6A 3GTGA 3TJ8A 2GVDB 4IH6A 4PWUA 3DLJA 2M3DA 2U2FA 2JZ5A 1IBKJ 2R2SA 5E3PA 2YKNB 3K5OA 4DSIA 1LWXA 3SFUA 5F9LA 1TK0A 1WC3A 4FM9A 3C6TA 1B4AA 1RU2A 1TR0A 3D6MB 1GAOA 4NLPA 2DIUA 1L3KA 1KN6A 2W4CA 4O44A 1Y3JA 3V6DB 4K8RA 4HYKA 1LWFA 3BYPA 1DLOB 2XI3A 2EFPA 5JJBA 3MUMP 4QIWL 4BCAA 2JA8C 2MKJA 4LR9A 1JJ2R 3FBBA 3HI9A 3GV8B 1IJEB 3CC7S 1LFWA 3B82A 3DLHA 4K2JA 1GK8A 4JI5J 1ZZFA 4RKUC 1T9TA 4F4YA 2ZOGA 5BR8J 3AJ1A 4XAKA 1H3DA 2ROGA 2H48B 7FD1A 2DNRA 1SIZA 3KDOA 4KAIA 1U1QA 2QLXA 5AJ3J 2XHWA 4PPZA 2JA5C 3ILLA 2LLZA 2OEJA 1HHTP 5B0EA 4NMXA 4DHVA 1RWNB 1MROA 4ZPBA 5KG4A 2X1FA 5LJ5Y 3QGHA 4J9VA 3HVTA 2OELA 1FXRA 2IAJA 3QWUA 2VUMC 2JEFA 1O24A 1C4AA 1TTHB 2W4DA 4YN3B 4CIOA 3KK2A 1S99A 2K7JA 3GFZA 1HI9A 2PA8D 4UW2A 2OEKA 2R9LA 4ER8A 5D77A 1Q7YT 3SQGB 3C66A 1BWEA 5LMUF 1QAXA 2C2ZB 4J37A 3Q83A 1OPIA 2GHPA 3V81A 1ZA1B 5KFKA 5KT4A 4ICLA 1VQMS 5CCMA 3EXCX 2HVZA 1TV6A 1SPBP 3P5TL 3MCSA 3M9OB 2BE2B 2QRRA 4KO0A 1WKJA 4RUBA 3I96A 2B4UA 1RCXB 4YFUA 3GTGC 5FIIA 2VBZA 3UNGC 3CAGA 1WDDA 1Q82T 3QAUA 1F7UA 1IBLF 1S0VA 1Z4UA 4X6AK 4P6QA 2CA9A 4C3MA 1IQZA 3S17C 2YKMA 4B08A 2R7TA 3JSMB 3QIPB 4C11A 4YR2A 1U0SA 4N41A 4WF9Q 1FRJA 2KHDA 3SSSA 4F4KA 2RB7A 1ZAVA 3DI6B 2P8IA 1LK7A 5IYDC 2DNYA 4XCHA 1U26A 3Q3QA 3R5DA 4OLOA 2LFVA 4U67Q 3NS5A 2DGQA 2VOOA 3CJKA 4DL7A 4C3IK 4B3SF 2BW2A 3C15A 1KQSR 3L7UA 5LMNF 2CQCA 3PRBA 5KFOA 2B7CB 4K5SA 4DSFA 4OHXA 3PRDA 4NXMF 4OZ3A 4FBTA 3TZYA 1XXAA 1XXCA 3BUEA 4D3GA 1WEZA 4KGMA 4DUZJ 2C2OB 2C1EB 5D4OA 5L9NA 3M3YK 2F4VJ 3LANA 3V4MA 1SC3B 2LU2A 2E5HA 3I0SB 5KFYA 1NK0A 5BXIA 3CF5Q 4WIQA 4C3LA 4USHA 2ZZTA 3VGSA 3PRVA 4GVLA 4IDKA 4RW9A 4GT9A 5A6PA 2VV5A 2XBPA 3HVWA 3I5CA 4LF8F 3K89A 4DV1F 3NBPB 3MECA 1YQHA 3QGIA 5KFUA 3MTKA 4MK7A 3UFCX 3HOZK 2E7WA 5FLXY 3W5YA 2XS2A 1F3FA 2AQ4A 1I6HC 3ETOA 4DCPB 1GMUA 4DLGA 4C3HK 4WU2A 1WORA 4PWDB 3W7BA 2B4VA 1RT6A 4PXDA 4IO1A 3KHLA 2ZHBA 2N4CA 2FHOB 2KJWA 2V6SA 4ELUA 4DCJB 1Y1WC 1WJ9A 5CD4H 3PJ9A 4A8QA 4C3KA 4N47A 1JXLA 2AV5A 5GVQA 4GKKF 2YNFB 5ETPA 2DJWA 4DWIA 2XCRB 5I3PA 4DR1F 4LREA 2CG8A 3H0GA 2UUWA 7FDRA 2GVZA 4JI8F 3TJAA 1FO1A 2CQPA 3ITHB 1WUUA 3IO1A 3D66A 3L9ZA 2DGUA 4IR1A 1JQWA 5DDRC 3X3UA 4NLDA 3HF5A 2E29A 2GGPA 3Q86A 1KQ4A 2KZZA 1DCHA 4N5SA 2V6AA 3J7A1 4I7FB 5B0GA 2D3UA 2DNPA 1V6HA 5AE2A 3EX7B 2WONA 4JI7J 3KOAA 1DTQA 4ZKAA 1S6PA 1KDNA 1UVMA 3ET6A 3KLGA 1ZS6A 3O3LA 3MWBA 1CULA 5HI7A 4ZHRA 4DR7F 3PR4A 3BN4A 1WSVA 3S1QK 1NJXA 4AL5A 2W8LA 1X4HA 1XTZA 1BQNA 3D6TB 4KT0C 3GTOA 3GFYA 4GKJJ 2GIFA 2ZM6F 5CZVA 5DQIA 4OI3A 1ZQ1C 4PG6A 2K1RB 4K4SA 3K17A 2IJRA 2DR5A 2MLXA 1P1LA 5HQLA 3UCZP 2E9TA 3U02A 2PE8A 1U49A 3RB4A 5U47A 3IWXA 4DPOA 2Z8QA 3FDSA 3W9JA 3WZ0A 2FLNA 1VQSA 1YRUA 3NOGA 3A3NB 3SDEB 1X7VA 1HWLA 2VUGA 2IM1A 1SC4B 5MAOA 3KTQA 2ALYB 2O67A 3ZZ0A 2OD6A 4BXXC 1NKEA 1NK9A 4N8NA 3A1YG 2AJ1A 3HKWA 1UWAA 2DKOB 3JAMU 1NU4A 4ZA1A 3NNAA 2FQOA 3IGVA 1K1QA 4DUYJ 4Y52C 2CKWA 2BQRA 1TL7B 2G13A 1P27B 3JSTA 4R5PA 3P8BB 3N6LA 5GAGI 4F02A 4OYZA 1TL4A 4MJKA 3N0VA 2XWYA 2EKYA 3DLGB 1PKUA 2QEXS 2RMLA 1HBNB 5J1PA 3ZTSA 2MKCA 3H0GC 4P75A 3D68A 2HNDB 4OI1A 1A6LA 2V34A 1DQ9A 2UXBJ 2VFSA 1SUQB 2G1HA 3QZ7A 2IC3A 4TY8A 1DTTA 4Q44A 3QQCD 2EBBA 2R3VA 4X4OA 4DL0C 3KLFB 3DLKB 2F9DA 2C3OA 1IL2A 2KI2A 3OUYB 1L3UA 1YIJS 4OMFG 2V2KA 4AL7A 3LW5C 1CC8A 1VYAA 3QLHA 5C42B 5HL8A 1U6FA 3MOZA 3GTKC 1NUEA 2KL8A 3CGIA 3H3VL 2F40A 4DPYA 1RHJB 4JV0A 5GAGU 3TNVA 2NREA 2UXCJ 2B6AA 1FKOA 3GTOC 1EETB 4OZJA 1CVJA 1F60B 1M5SA 4I56A 2NSBA 1U4BA 2YWEA 4LSNA 3KNGA 1O2BA 1WWHA 4CLFA 2RQMA 2H5JB 3PACA 2VFTA 3MTJA 1YSJA 3BS9A 3WIVA 4ILRA 3D28A 4DF8A 4DEZA 4WYLA 3KFWX 2GJFA 1BQMB 1RBLA 2E1MC 1A9NB 2CXEA 1MMNA 1WI6A 4X64F 2JEGA 4X4RA 2XCAA 5IORA 1INNA 2FIUA 1TFYA 3UDEA 1NZ8A 3NXZA 1WG5A 1OYEA 1R6VA 1B4BA 2MHEA 2LECA 2E1CA 3CMAS 5IS2A 1JMTA 1FRMA 1HARA 1WTFA 3CD5A 5BYRA 5A2QU 2RS2A 4KASA 4EK2A 5J1EA 1JLGA 2HIQA 2V4QA 4EYIB 2V9WA 2QL5B 4CLTA 3T1HJ 4KHRA 3F41A 4OIPA 4EUVA 4BY1K 3HSJA 4FYYB 3VVTA 4NLTA 4KPYA 1JLAA 4KFBA 1O5JA 3WIUA 1L3TA 5EWGA 3R7NB 3CTRA 3NCPA 2RF2A 4R0EA 4LBPA 3GG1A 1X60A 5B0BA 2DXEA 3P6YC 2V8VA 1LEOA 3N5FA 5D3GA 5KFGA 4Y7NC 3ZXWA 3GTLK 4OJGA 1SFOA 1SV5B 1NPPA 3AHPA 1S9GB 5FLMK 1AA1B 4CTAA 4A3EC 2QMXA 1X4GA 2FB0A 2Y8YA 3AOBA 2EC0A 3LAKA 2XLIA 1AYEA 1TUVA 1X4DA 1CJKA 1WOOA 4TQSA 2CZ9A 1PILA 2Z0GA 5JUMA 4NXNF 5DRKA 4F50A 2CQGA 4LFAJ 1NLKL 1X9MA 3DLBA 3D54A 1NDLA 2KVQE 2AKWB 2OSQA 3FQKA 3GEHA 2FTRA 3OJUA 2E66A 4RJVA 1X4AA 3A8IA 1Y0HA 1WEXA 1RHMB 4RWWA 4UQTA 3MI7X 5T14A 2W2NP 1XZQB 3UNYA 5IZHA 5GADI 3AD9C 5DGAA 3OV7A 1SB6A 1RT5B 2XMWA 4OYXA 4RNHA 4A3MK 2J0WA 3MM9B 3KUEA 2W9CA 2ILYA 3A3OB 3MEGA 3BQ0A 3JTNA 1UVKA 4KGKA 2XGPA 1PAEX 2W2QP 1XMQJ 1JX4A 4DR4J 3BGRB 3UE2A 2EVZA 4ECQA 4PUOB 4EI2A 5DZ6A 3IR5B 4A3IK 3PR5B 3KXDA 1XNRF 4JK1A 2C3UA 2XSFA 4OHWA 4CYUB 4DL3A 2B3TB 4DV0J 1C1BA 1BGXT 2HVHA 2PEBA 1T02A 1VK3A 2AWZA 3G82B 3W2VB 2G0IA 3TQ1A 4J9KA 2NPIA 1TKDA 4WTOB 1S4EA 3MURP 2MQQA 2JLGA 1S49A 5GADU 3Q8RB 3VGTA 4H54A 1EP4A 1L5UA 2O66A 2X1AA 2FJDB 4RWXA 1RTZA 4Q2LA 4USIA 3UVJA 4LK1A 4EZ6A 1RHUB 2RUGA 1RT1B 4ZPDA 4AE5A 2FPHX 4LSZB 3NS7B 1LWEB 1W25A 2AYMA 3BV8A 4ECYA 3VAJA 4OL8A 2MEWA 1V9OA 1N33F 4DR2J 4RW8B 2E2HC 3E51A 4F26A 2V2QA 1SFOC 4YY3J 3LF0A 1FERA 4C4WA 4DX5A 3C8YA 2XO7A 3DXJA 4NI2A 3LALA 3BP8C 4LLGA 2B7BB 3UR3C 4CLUA 3DOLA 2W7AA 1F5BA 4TVAB 1KLNA 5HATA 2ZH4A 3PFEA 3IWNC 1UVIA 3M1VA 2BA9A 1U2RA 3ZC4A 4OIXA 4K0KF 4F0HA 5EGEA 4X65F 3M6VA 4ZPCA 3D7SB 5KFJA 4ZP6A 1B3TA 1G51A 4O44B 2UVRA 5D6GA 1LWFB 1SIWB 2F65A 1IM4A 4E0DA 4C8OA 2R8JA 3M9MB 4LF7F 3GSIA 1O8BA 1TMJA 4N8OA 3N3YA 2EFGA 1NO8A 4DQSA 3JQKA 3M7VA 2P9CA 2B8QA 1HBMA 3ERED 1VH2A 3OR1A 1R0BG 1K73T 2NSCA 3R5AA 3L3CA 2E7XA 3UQSA 5D4NA 1S7HA 1HNXF 1S5ZA 2R7WA 4DL6A 2DEIA 1NK4A 9RUBA 1UPMB 5J2PA 5K8OA 2CVIA 4LUBA 1MROB 5EX0A 2CWXA 3QT5A 2ZH5A 2CPIA 2W1BA 4J9QA 2WRMA 1CG2A 2IA6A 2COLA 3GYNA 3HVTB 4Y2CA 1C0UA 2BJ9A 1KFDA 1WC1A 4B9MA 2HVIA 1S59A 1IWAA 1RGVA 2E2IK 3TVZA 1VQKS 1JKHB 4ALZA 1U7LA 5EGYA 5L1LA 1UJ6A 1HWUA 4I4BA 4Q8EA 4GMKA 3QFWA 4DQQA 1X4CA 2MKYA 2BRLA 3M32A 1RBAA 3V81B 2ZD1A 1N52B 1UA1A 4ICLB 1TV6B 3L95X 3PY8A 4FXWA 1OQ3A 3S1NC 5F8IA 4KO0B 1BY9A 3MAAB 1E6VA 2IBKA 5EN1A 3FKIA 4C3JC 3TRGA 2ZBIA 1DFDA 3FQLA 4QR1A 3J80U 2NXCA 4KMHA 4LF2A 2MKKA 2DVIA 4B17A 3N01A 3MMLB 4C98A 4NLYA 3QJJA 1WQFA 3GCWP 1FJGJ 4LF4J 4G3IA 2OGUA 3MMAB 1OO0B 4JV1A 5HSPA 1V5VA 1JXVA 2YKMB 1HNZJ 2VPXB 3FHZA 4C11B 2WVEA 3AA9A 3DHWC 3HKZD 2GQ2A 2HHVA 4O4GB 2V67A 5HO4A 3O1LA 4BWJA 5K8PA 4NRUA 1DARA 2HZCA 2OKQA 5F8MA 5C3EC 4IFVB 1TMMA 3J81U 2YWFA 4A8MP 2FY8A 3OFEA 4A8OA 3MPUB 1CC7A 3CJKB 4P9SA 4DZ6A 1Q8KA 3H90A 3BGLA 3C15B 2QMUB 1HW9A 3I4MC 4JYAJ 1HBUA 2MTLA 1P8GA 1ELOA 4B3OB 4FN5A 2CQ3A 2V2VA 1N34J 3LH2S 4RW4B 3M4XA 1SL2A 3R2DJ 3R7BB 2O1PA 3TVKA 1IR2A 5IV4A 4LF1A 1UAWA 2H51B 3V4IA 1PJ6A 5IQ6A 4DPXA 2WVCA 4N7TA 4JV2A 4IDKB 4RW9B 4CO4A 4NMLA 2DNLA 3OFHA 2BANA 1QUPA 1KQFB 4CH0S 3L7PA 2CPZA 5KFRA 2YKOA 4CLZA 5IYBK 3C16A 3AOCA 4DXLA 3MECB 2J0SD 4A8FA 1X4EA 4KHPJ 2K3IA 1UWBA 5F0UA 1K9MT 4F3OA 4BWMA 1VQ6S 5KFPA 3AB2B 1UETA 1FNXH 4YB6A 1FCAA 1RT6B 2AZ3A 2LMIA 2XGQA 2JRSA 2J6TA 4EYHB 5HP1A 2KTQA 1MLAA 1E6YB 2VONA 3EQLA 5M3MK 1F6TA 5D4LA 5M2RA 3MEDA 5KFEA 3FKIC 3NNHA 3QGPA 4TYBA 1WCMA 1S1UA 2HHTA 2ZBQA 5J1NA 4V19X 3M8SA 1NJIT 1H6KX 2HBRB 3RZOC 3FRZA 3OPFA 3I31A 5JXSA 3ZTRA 2BYCA 4DV5J 2GJIA 4BLAA 1LW2B 2QA1A 1X9WA 1UFKA 2J7KA 3S1MK 2W25A 2VPYB 1NXIA 3VAKA 4DUTA 2Q79A 3OVBA 2NUHA 2CQ1A 3IS9A 3HD1A 4DN0A 3EE3A 5ETQA 3M8WA 2WONB 1SL1A 3J7YI 5KFQA 1DTQB 3K8WA 1S6PB 1RWKB 3ET6B 3KLGB 2G2YA 4KQZA 2AYGA 1S77D 1CULB 4NLUA 1JLEA 5IM0A 4ZHRB 1RTJB 1T9YA 5KFTA 3KLHB 1YKWA 1FJEB 5E3QA 4QPTA 2ACYA 2CFXA 1FD8A 1BQNB 2EEYA 5LSRA 3H5YA 1R9TC 4J3NA 5IP9C 2QL9B 3CJ3A 5JVHQ 1DZ5A 1GH8A 2HRYA 1G6BA 4ZPAA 3GJQB 1MWQA 2I6WA 1FKPA 3PEJA 1R7IA 3G9CA 1WI8A 3EGWB 5KFZA 1TWHK 3J7YU 4I1TA 1NHKL 2RT3A 1CJUA 2W01A 1JLQA 2BVZA 1HQUB 1N48A 2LQ9A 4OX9J 2YWHA 4FZBA 5C44K 2RSQA 5GMDA 5D78A 1YI2S 1I6JA 5A8WA 2DGWA 2DR8A 1RACB 4QIVA 3POTA 4KKOA 4MIWA 3V6JA 3MEEA 3A8JA 3DM2B 4LIRA 3ISND 4ZS6A 2B0GA 2HQIA 2PA3A 5J2QA 1X8DA 4IG3B 1USMA 1NDKA 3CJ5A 2F1FA 4CT8A 1H2TZ 2XM3A 3HSZA 3NMAA 2JOQA 3HOVC 2VL1A 2RU9A 1QTNB 4LF6J 3D6HB 4I2QA 1WCMC 1WHVA 1RABB 4YR3A 2W2PP 2HG4A 4R5PB 3ZZYA 4ED5A 4BC9A 1FWKA 1VC6A 1KC8T 3A8KA 3ONQA 1JLCA 1YJ7A 3CCRS 2XS7A 1KVIA 2XMVA 1HLWA 1H0HB 3G4AA 4OYWA 2FHKA 1G2EA 4DN9A 1YG0A 2EBGA 2F8EX 2IC3B 3IM9A 4TY8B 3CB4A 1S0OA 3RU0A 2LA4A 5F8GA 3DRYA 4WP8A 2QIFA 2HBYB 4M1XA 2UVWA 4LT6A 4WE1B 3C6UA 2K8GA 4ECWA 5SZTA 3CPWR 2E5JA 3Q8SB 1J5EJ 4C45A 4FYDA 1B7FA 4C9DA 5E7OB 2C3MA 1C1CA 4JI2J 1LFPA 4CNZA 2B63K 2OAUA 1B0TA 3VF0B 5FLXU 1D9FA 1U45A 2EK1A 3HOYC 3NAIA 1UTAA 4DSLA 2KJVA 2BKNA 2B6AB 2PI4A 1AB8A 2YY3A 3M30A 1RAIB 1EH1A 1FA0A 2CJAA 1ZYRA 4FYVB 1X5PA 1EK8A 5ETMA 1N54B 3NP5A 4XSXA 3DRSA 3MM6B 1N32J 2AJ2A 3DXSX 4H4OA 4Q43A 2CJ9A 4Z37A 5IT0A 3DRRA 4KATA 3IPJA 3DU6A 3QYYA 3DRPA 1QAYA 2VG6A 3NL0A 4DQIA 2L3MA 2FJVA 1IKWA 4ES3A 5J2MB 4DFKA 3HFKA 1U25A 2QGFB 4F67A 4F0KA 3T1YF 1N56A 2VOPA 1T9WA 2JA6K 5B09A 1UEKA 2HHPA 3GTJK 4KGZB 4ZVEA 2CRLA 4DU8A 3MCOA 2X3GA 2BJ7A 3NCRA 3BN7A 3DOMA 1WNEA 5J1EB 1JLGB 3R6LB 2KHCA 3L4JA 3T3FA 3GTJA 4QW9A 1SVDA 3LQVA 2IY5B 3MEKA 3FEXB 8ATCB 3V6DA 5HBMA 3EVOA 4A8SA 2MQLA 2KN4A 1Y1VC 3G96A 5EDWA 1JLAB 1TL3B 4FYXB 4KFBB 3K5LA 4URGA 2RF2B 3HZEA 4YEAA 2DTJA 1KP6A 2NVYK 2Y8WA 4ITSA 1D1UA 5IYCK 1HQMA 2A6OA 4A3JK 3OREA 1SCJB 2RQ4A 1BE4A 4RU2A 5D3GB 5HLFB 4X4NA 2NVYA 2OH2A 3MAQA 4QYZJ 4PXEA 4ZN3A 5IWAJ 4G1IA 5IOQA 2Z2LA 4NA3A 1IBCB 2IVFB 4F2SA 1X9SA 2J7UA 4C2MK 4NLWA 4FKXA 2VU5A 1GNKA 5L1JA 4KB7A 2DHHA 3T00A 1NDPA 4KDDA 3RZDK 4A3DK 1OQ6A 4A48A 4MFBA 3MMBB 1I51B 1NB2A 3AOAA 3D3BJ 3R2CJ 3I56S 1X31C 2R7ZC 4V1Ak 4KM8A 2NLWA 3UD4P 3IRXB 2PC6A 2P6TA 4QIEA 5EWEA 2HFNA 2CDRB 4JI4J 2P6SA 3VAGA 1H38A 4HL9A 3V6KA 5ETVA 1Y10A 5E0OA 1EJ7L 2R92A 2NVXK 4K2XA 4HHUA 2FJBB 3MEGB 2F9JA 1RZMA 1YZ7A 2IHR1 2BE2A 1KVJA 3CDEA 1J27A 4JUZA 1HMVB 3KHGA 4NEYA 1HW8A 2Y0SD 1VJQA 2RH3A 4BY7K 2R93C 2IM0A 1D9AA 1WOPA 4X4TA 1AUDA 1Y00A 5C4JK 2HVEA 2ZH9A 2M2BA 2DNOA 2VZ9A 5E68A 2O5DA 3CULA 3PX4A 4X2BA 3CC2S 1J2VA 2ZBRA 3TZZA 3JSMA 3PHEA 1TWFK 3AJ2A 1TK8A 1T9VA 2Y3PA 3QATA 2ZFZA 2DCUB 1YRTA 2V4RA 4ZCMA 3DI6A 4NE9C 1TWFA 1QAIA 1RSCA 1IBMF 3QNWB 2G2OA 4EGLA 1KQGB 2W7PA 3JYTA 4Q5VA 5E5NA 1TWAC 3PYEA 3V4GA 2UUTA 5DQHA 4Y3CA 5HAOA 4ELTA 1WHXA 2KVIA 2VQEJ 2KKHA 4M5NA 4UOGA 2HSEB 4UUWA 3HD2A 3LO3A 2NVTC 1UKUA 5E3AA 3D5MA 5G0RA 4OYPA 4KH1B 3ENWA 2LQ8A 2V50A 3A4TA 1ZM3A 3DGPB 2UUAF 4WP3A 4R25A 3VQSA 5KFDA 1SMYA 1PC5A 2E5GA 1RP5A 3GIJA 3M1VB 2ERRA 1Q8IA 2PT0A 3NBPA 4LF5F 3AJDA 4BY1C 1I3OB 2G2ZA 2XY6A 5DG8A 2XB2D 2O3DA 1FDBA 2CUYA 1F5CA 4JI0J 4TLQA 3T9ZA 5AXMA 2MYFA 3BGUA 1HI8A 1LWCB 3CE8A 3IAS9 4NLXA 3BM7A 1U0HA 2R92C 2HGNA 3CWJA 2XYHB 3KHHA 2WAQL 1WELA 5L8RC 2G0CA 1HBMB 4USUA 4RO0A 4HTIA 4A3GK 3PX0A 1VLYA 4ZLPA 1WC5A 4JI3J 4A3LK 4B3TF 1YNJA 1GMVA 2RD5C 2K06A 1RISA 1B4SA 3MUVP 2RQCA 4HDGA 2YNFA 1OMSA 3OSPA 4ZJOA 4BBYA 5J2PB 1X5OA 3Q8PB 5LXRA 2AMCB 4AFFA 3GTMC 2CADA 2J5AA 2D69A 4QPXA 2GIRA 1RWXB 4L74A 3WBZA 2QA2A 2QT7A 4DV7J 1FRIA 2OI2A 1IN0A 2HK2A 3KLIB 4I7FA 2BQUA 3EUNA 4Y6IA 3ENVA 4ILDA 5KFAA 3ZZOA 2V8PA 4O2DA 3M32B 4PWWA 4PG8A 2ZD1B 2V9KA 4F4XA 2XLJA 3FOFA 4CP5A 2ZUAA 4RNMA 4KBIA 2YXLA 4WFXA 1E6VB 1OY9A 1SXLA 4G7OA 4FP9A 2RKIA 6FDRA 1MWZA 1WKLA 2BV3A 2OHDA 1NH7A 1C2PA 3FOEA 4DV3F 1TU0B 1NB7A 4F36A 3TP2A 2MZQA 3TZWA 2K1RA 1WOSA 4HDHA 5DO2A 3W1YC 2KH9A 4LFBJ 4OX8A 2Y1RI 3A12A 2OLWA 2JJ4D 4WCEQ 2MJNA 3DU5A 2JA7K 4XIUA 1RHKB 1T0TV 3TUPA 3JQMA 1I3QK 2ZUEA 5AXNA 2BW7A 4WPAA 1JIHA 2VG7B 3IP0A 2JA7A 2RRNA 1I3QA 4P52A 5B0AA 1VQ9S 2JL9A 2BUNA 2DK2A 1P1TA 4K7QA 1W2BR 2V4JB 1I1GA 1BXNA 3S1RK 3QMQA 2GHWA 3JQJA 2RQKA 1NRKA 3H5UA 3CIZA 3VCDA 3VAFA 3H25A 1RAJA 4RX6A 2KM8C 2LDYA 4ZH4A 4QQBA 3T41A 6FD1A 4ERDA 5DDOC 3TYTA 2MKHA 3HVAA 4M5MA 4J5OA 2B5JB 2GO8A 2DHSA 5IV3A 5HMZA 2JVOA 2ZITA 3OXGA 1HQEB 3RW7A 2SXLA 4XDDA 2E5IA 1YJ9S 3GONA 3AA8A 1EQMA 2BANB 1MG7A 4ED8A 2DRBA 3GV5B 2DO0A 2HNDA 4YP3A 2WCXA 3C16B 4QBUA 1VBYA 2K3KA 2JNJA 1F5AA 1SUQA 2OMLA 1B0PA 2DGXA 4GO7X 2HEKA 1I50K 1U1LA 1IKXA 3HXAA 3KLFA 1SBRA 1GXLA 1U1RA 3W2WB 3OUYA 2GO9A 3EGVA 4M8LA 4RBUA 3W62A 1YTYA 1SJRA 1CEZA 1RB0A 4UY8T 3IG1B 5C42A 2M70A 3AXKA 2Y1JA 4LVNP 2YBVA 2N7YA 4ZCLA 3SCKE 2VD3A 4J9UE 2CQ2A 4G65A 2NVQK 3MEDB 3CCUS 5JFEA 4DCOB 1TWGK 2Q3PA 1KBRA 1GTEA 2RJZA 3JSRA 3U1MA 3PHTA 5CYMB 3BDEA 5LM7E 3E01A 1UEVA 1TWGA 3GIIA 2A6EA 1CJVA 1U47A 1N4LA 1H73A 1WHWA 2M8DB 1T05B 3PM9A 2DXDA 1GMWD 3QIDA 1HWJA 1X0FA 2E2IC 2AIRB 1K83A 1D8YA 2FJXA 4OYOA 1TKXB 1SI9A 1V5IB 4LJMA 5T41A 3BJYA 4CT9A 1BQMA 3GTYX 2FQTA 2E5LJ 2IM3A 3CVKA 1XR7A 4U8VA 2YKAA 1S48A 3IS9B 5DG9A 4IOCQ 1Q7LB 1FT8A 4CLWA 1RT3B 1VIXA 3I9V9 4MIBA 4DV4J 5AXKA 3H4BA 1IKVA 3C3LA 1MN9A 1EQ0A 2B4OA 4OZ5A 3OHAA 2CDQA 3SXLA 1JLEB 2V69A 1GT8A 4DV6F 2NZ4A 2ASJA 4J9LA 3N9UC 3K7AC 4LRFA 2UU9J 1X5SA 2AYEA 1IJFB 2D6FC 2ASDA 2KFYA 3GMGA 4L73A 2V8HA 4BBSK 4RW6B 5JVGQ 1S6QA 1UFLA 2B4PA 1ZTWA 5CHCB 4GVBA 2F8MA 2EBEA 2W2OP 4QYRA 2GQCA 1TZ0A 4WFYA 2UV8A 3VTIA 2ZDOA 3GB0A 1FKPB 2CPYA 2IIHA 4OQJA 3TTGA 4ZIVA 2U1AA 2BE5A 1QSLA 1S9GA 1MU2A 1CJUB 4ANEA 2YPZA 2XLKA 1ULRA 3NGSA 4WILA 1F2HA 1SJ3P 3GZ7A 5THWA 1APSA 3TA2A 5A8WB 3FJ2A 3RB0A 4ZLNA 4ECVA 4KKOB 2PA8L 1YRXA 1D9DA 2JEJA 3CW2C 4IQMA 3W5ZA 4DR6J 2N3OA 2ZH1A 2VB6A 4UF4A 1LV5A 5I4MA 2JA8K 2IRYA 1KHVA 2VJUA 1JWWA 4I2QB 2VH7A 1HR0F 1NM2A 1XZQA 1VIOA 2DNNA 3BREA 3TZXA 3GTQK 3SMZA 2HZVA 4F4AA 2EC2A 2RDDA 5T7LA 3PFOA 1SH3A 3CQZA 2PO4A 4LOWA 2YU9K 1YJTA 1JLCB 3LP0A 1HNWF 1VQ5S 2V2ZA 4BC7A 4OV6A 2YNIA 5KFVA 4NCGA 3V2UC 3N4WA 4WFAQ 2XZDB 2WW4A 4A47A 3KK1B 3BGRA 1DHMA 3G8SA 2JA5K 1S4FA 1K83C 1BQXA 4NLRA 3RRKA 2GV1A 1B70B 3MR3A 4ZJQA 3KHRA 2WBMA 3S6EA 1ZAWA 3L7OA 2VUMK 3UN5A 3C6UB 1U48A 4CYUA 1KHWA 4ZVHA 1KWMA 3J81Y 3IA0A 1DQ8A 2PIIA 2ZVSA 3WX4A 2AGOA 1C1CB 1FFSB 2CFAB 1GE9A 2UXDJ 5G4DA 3G82A 3W2VA 4LF9F 3GJRB 2MQ8A 5DLFA 3S2DC 3PYFA 4NYOA 3HHNB 4C0BA 2BRKA 4DR3F 3M4OC 2YX1A 1VHIA 1I94F 3TUJC 1XC9A 3ZZPA 3IRWP 3M30B 1R6YA 2UVUA 3NOCA 4X66J 2R7VA 2ZE2B 2FJAB 4KB4A 2BDPA 3GFHA 3HOXC 2B43A 2XWXA 1ZYQA 3I87A 2B9YA 2WVBA 3CJ8A 3SV4A 4GO5X 4H4OB 2DH9A 3GTGK 1EAYC 3DRRB 4QU6A 2G9OA 1YWXA 2IJNA 4IR9A 5BJRA 1N5VA 4OIOA 4AL6A 3PIPQ 2VG6B 3HJFA 2YKPA 1JNRB 2LDIA 4IH7A 1IKWB 3ZZTA 1URRA 4JI6F 1U6BA 2I2YA 1MNEA 1UL3A 2BABA 3UD5A 1FXDA 2ADBA 2FGOA 1CBKA 1Y4ZB 2QO3A 1Y7PA 1CPZA 5E3RA 4QIGA 2RHQB 3PXGa 3FBCA 5LJ3Y 2AYBA 2E44A 3S1TA 4K4ZA 3DOMB 1HL6A 2DPIA 5IYDK 4UTGA 4AYBD 2DGOA 3Q8YA 1FKAF 5HBMB 2IRXA 2O5IA 3TQEA 4ECXA 3AXMA 1FJ7A 4DV2J 2XYPB 4A8YA 4OJ1A 1S9EA 1J5OB 4LQYA 1KKHA 4ES2A 3R27A 3OQ2A 2LYVA 4S0MA 4XPEA 3CQZC 3C14A 4RNNA 4K50A 2ZOMA 3CO9A 2EG2A 4JI1F 4DBQA 3MMJA 5C2GA 2VKRA 2VA3A 2VQFF 2R4FA 4YR0A 2IFXA 4WP9A 2ZKUA 4C8LA 3CXCR 1XNQF 5LXYA 3K5NA 2M8HA 1N0UA 4DSJA 1G1XA 4OX7A 2FUG9 2X1BA 4ZDNA 3GEEA 2DR7A 1VMBA 4B3RF 2A6HA 1W2IA 4EEYA 3L4BC 1VI7A 2OFHX 2RDIA 1RAGB 4Y2AA 3CJRA 2A68A 2BR0A 4MFBB 4G7HA 3THTA 5JMNA 1I6HK 3R5CA 2J9EA 4DI6A 5ADZA 1JKHA 4KRWA 1OPZA 3MHYA 3H20A 2M9KA 5B0FA 4WZQA 3OEPA 4DSEA 4KIAA 4D3HA 1XMOF 4LFCF 1WACA 2HNYA 1ZH5A 5H9EJ 2E1RA 3FC9A 3T02A 5DQGA 3HOWC 3BO3A 3TUIC 1YDLA 4HI1A 2UZAA 1Y1WA 1IM6A 4ZVFA 4ZPVR 2LCWA 4GTFA 3MAAA 1Q86T 4M63A 2Z56B 5C25A 3OXFA 2LXIA 3HM9A 3PW7A 4OIRA 1VRTA 3OPKA 5ETNA 1GX6A 5E2QA 2ZHAA 3SZZA 4JV5F 2JH3A 1S57A 1Q95G 4HKQA 2CPJA 2DY1A 4YHHF 4OZLA 2ROEA 4WZMA 4HACB 3BBFA 3S8SA 2FLPA 1GFWB 1T94A 3RB3A 4UOHA 4G1QA 3MMAA 2UUCJ 2RU3A 2QC3A 2FJWA 1UVLA 1LW0A 3GPAA 1CS4A 2HLUA 3EYZA 3NMRA 4O4GA 1KS2A 1QDUB 1CLFA 4DR5F 1Q5VA 1RWPB 5L1KA 3OTEA 4AQYJ 3D6FB 2QG9B 2R7OA 2Y1LB 4IFVA 4QWCA 2I5JB 2YKQA 1X0PA 3VA7A 2XHCA 3PG9A 4ZLJA 3OTOJ 4YOEA 2BEFA 3JYTB 3KLEB 4JBCA 5MLCV 4TY9A 2CQHA 1USOA 3S14K 1QD1A 2G4BA 4B3OA 2YWGA 2QFIA 1KLMA 4RW4A 1T3NA 3CSKA 5G0RB 1N36J 1FF2A 4RW7B 3F73A 2V6TA 4YUDA 2BE9B 1S1WA 4ZVPB 1YNNA 4HH1A 2WHOA 3BZQA 2F4FA 1G4CA 1WDTA 2PGCA 4OHZA 3JSYA 5CQGA 4A8WA 2JEIA 2Z2MA 1WEYA 2W8KA 4LSLB 2HHHF 3LP2A 3G8QA 1UMJA 4J91A 1Y11A 2ZKTA 1D8ZA 4EZ9A 2GSNA 3NG8A 4Q45A 1QSSA 3RBDA 2I9SA 1MWYA 3DDKA 5HROA 1BWVA 1CSJA 4UQGA 2NXUA 3R5BA 4A3BC 5GMKa 4ED6A 1SH0A 3V6HA 3HHLC 4BXXK 3MDFA 4C8KA 2HGMA 2WB4A 4P71A 4NZ6A 1Y9OA 3TAQA 3SZYA 1U0HB 1S1TA 4P74A 2CAJA 1E6YA 4LMZA 2KM8B 4B3MF 4Y52K 3HOUC 1YJVA 2ATLA 4ID8A 4OV1A 4OZ1A 1XQIA 3VHQA 3LOUA 1RT2A 4PG7A 3V5RA 5F41A 4JB8B 4FKYA 4IKAA 3NWGA 5DGBA 1HHQA 1FWPA 1FFWB 2KU7A 3H0GK 2BMBA 1TP7A 2PDAA 1Q16B 1GX5A 4ECSA 3US5A 1N5YA 2KG1A 3HPOA 1J6XA 2DNHA 4RBTA 3DYAB 4ZP9A 3MM7B 3CIMA 2VC0A 5EHHA 3K5PA 1LW2A 4C8NA 3KJVA 5I3QA 3K58A 4TKTA 1RWUA 4UZCA 2VASA 1AFIA 2FZCB 2FD2A 3H2VE 4M1KA 3RUBL 2QYGA 1TWCC 2CPXA 5KT2A 3W8PA 3GTKK 2NVXC 4CZCA 1C4CA 1R0AB 2HMIA 2D9PA 4DPUA 4P5AA 2L41A 5H9FK 3AAWB 1SC6A 3GTKA 3GR0A 2XY5A 3R5GA 4BBRC 3GTOK 2HHSA 3WC2A 4DFJA 2EFNA 1TL1A 1RTJA 3KLHA 3FZ2A 4X62J 1V3SA 2RKIB 5C24A 2QLBB 4DSKA 3B6BA 3HHEA 2IPOB 2UUBJ 5A0YA 2WB1L 1PGZA 1ISEA 2HW3A 1JXEA 3M2UB 2L9NA 3BB5A 4FF4A 4L75A 3N6NA 1S0NA 3N6MA 3OFFA 5CA5A 2KRRA 3GU0A 5ETSA 3GYXB 1YBTA 1ZA2B 1BC6A 4J9NA 1RWWB 1S1XB 2W2MP 5A8KA 6AT1B 3KDNA 2ACMA 1F93A 2CJBA 3GSDA 3DGVA 1FJCA 1HQUA 4U7UK 3G4SS 3VR1A 4L6V3 4YB1P 2D9OA 3OVAA 2QYCA 1Q5YA 2F63A 4Q7AA 3LPXA 2HHWA 3CCJS 1M5HA 3MFIA 4PXCA 3DM2A 3HFZB 1EX8A 3S0XA 1TQLA 2IMWP 3WX8A 5RUBA 4IYQA 2QFJA 4J9RA 1OSDA 2WVFA 4IG3A 1RAAB 4HTJA 4RUHA 3DN9A 1HWIA 3PJWA 1VQLS 3CT9A 2P8TA 3FMWA 1IBKF 1TUGB 4P2SA 3GIKA 4NA2A 3MPVA 3GTPA 1BMQB 4ANCA 1SC1B 3HHKA 1U8SA 4Q5SA 4X4SA 4Y7NK 1NPKA 2XMUA 2EK6A 2AEMA 4KV8B 4M5JA 2XMKA 3K2YA 1RHQB 4BS2A 2H54B 3QGGA 3H98A 3TOQA 2J6SA 3UDCA 3MXHP 4LQ9A 1VBZA 3TANA 4A3EK 4NLSA 2DHXA 1QM9A 2WZ1A 3M6XA 1KTVA 1IKXB 5HVGA 5KG3A 3DCAA 5K5MA 3G71S 4JI5F 1KTQA 4WBFA 4DL2A 1AW0A 4WE1A 3RR8A 3DMJB 5BR8F 2MGZA 3DFEA 4KGVB 1ZZNA 4MQ9A 3PKYA 5KFWA 4C8ZA 3FBFA 3M8QB 4H4MA 5AJ3F 3JSBA 3NGDA 1NK6A 1UW4A 5IXUA 2C22A 4NOIA 5AE3A 2B9WA 4KR0B 3NAHA 4ZVUB 4U7CA 5LMUJ 3CD0A 1RJJA 3GWCA 2NXJA 2D3O1 1HA1A 3S2HC 1AXQA 3E01B 3S7RA 3M6UA 1CJVB 5IT9Y 1IS1A 2KZMA 2XZTB 1YITS 1BHNA 3LP1B 4ATNA 2ATCB 3MM6A 3K8VA 2H5EA 5J2NA 2CNNB 3MPYA 2CJYB 5TMCA 4ED7A 4NLVA 2IVYA 1TVRA 2XSJA 3D3CJ 3QSIA 2VPZB 2M5YA 2QN6B 4WKYA 5J2MA 3BO2A 2DITA 2IDLA 2RUSA 1IBLJ 3PIOQ 3HXMA 1N88A 1EKSA 3R7SB 2I0XA 2V94A 3PTWA 1IKVB 1VBKA 1W26A 1NK5A 2MZRA 4G7ZA 4M5HA 2DNGA 3FK4A 3EZ5A 4AH6A 4M5LA 3SSQA 3QAEA 3M8PA 4JOUA 4DL5A 3UN2A 3J7Z5 1FK9B 2V8DA 3I9ZA 5HQ8A 3DRXA 3FSIA 1RWOB 2RILA 4OYIA 5TMFA 2A69A 2HURA 4DF4A 2E1AA 1TL3A 1ZOTA 4B3SJ 3GTPC 4URSA 3CJ2A 1S6QB 5LMNJ 2JHEA 3PW5A 1T03A 2UP1A 4GVBB 1PBUA 2WSFC 3AODA 3DNCA 3HJVA 3M6WA 3DOKA 2E2HK 1K47A 2HQCA 2CJKA 3BYRA 3FZBA 1SFOK 2L9WA 3GFXA 3PO3C 3NGRA 5HLFA 1JJHA 1HD0A 2ZH8A 2EW9A 4NXMJ 2E2HA 1QVFR 1YZ6A 4CM0A 3CNQP 3UCUP 1FDNA 4J7CA 1DAXA 1MU2B 2FVCA 1O25A 1URNA 5DZ7A 5CD4A 5F0WA 1ZM9A 3P45B 3SV3A 1U24A 1GQEA 1H2VZ 4IQXA 4LF8J 2HQ3A 4DV1J 1KVKA 4DUZF 3MMBA 1WG4A 1M90T 1AUSL 1PIEA 2R8HA 2F4VF 2ZJQQ 3HHLD 2DPJA 5GMEA 3IRXA 5F9NA 2FC9A 3UI3A 4DZDA 2FVSA 3PZPA 4FDFA 1FDDA 1WQHA 3Q22A 3THVA 5T7LB 7AT1B 3FEZA 3IBFB 3O8WA 1VR6A 1S1VA 3LP0B 5KFMA 4A3FC 1VFJA 2YNIB 4NCGB 3SZ2A 2MQNA 4YB7A 3ISZA 4EWTA 4WFZA 2MKIA 2BJ3A 4C6AA 1XWLA 4GKKJ 3H2UB 2VICA 1HMVA 1TKZB 5H9EK 4Q0BA 4TU9A 4P7VA 2FJEB 3QRQA 2MMYA 3BSCA 4MKBA 4DR1J 5HN0A 5HMWA 3HKZL 3NCQA 4JI8J 1Y5LB 2HWTA 4G6VB 1YHQS 2YVSA 5D0HA 5HANA 1H72C 5L39A 2NXEA 4CLPA 2E2JC 2K2PA 5M3FK 3UR0A 3QRRA 5IP7C 3KG0A 1F2GA 1IXKA 5DETA 2AD9A 2DR6A 2VDIA 3S15C 4QWDA 4KHMA 3EPIA 1W7WA 3S1NK 2CQBA 3I4NC 2DNZA 4C3JK 2LU1A 1XN9A 2GA7A 3FGVA 4O3PA 4GC6A 1BUXA 4DR7J 3IGNA 1WHYA 4BDPA 1BD6A 3ZFVA 3WC0A 3PO2C 3NEKA 4UOFA 1O27A 3BKFA 2Z57B 3FVYA 2NXNA 3KNAA 4JI7F 3TX8A 2ZM6J 2EG1A 1JLFA 4IG0A 2AEFA 2DHAA 3MPWA 2CNOB 2XEXA 3F0NA 3DGPA 5HK4A 4Y2KA 2HZAA 2VF3A 3O44A 1SL0A 5HQMA 3CCES 4B9VA 4F7VA 3NUHA 3AY0A 5TJ3A 4QWBA 4OJ3A 4B02A 4GKJF 5C3EK 2DD8S 1MMLA 2ABYA 2MLZA 2LXUA 2I8EA 4ZN1A 3ISNC 5K14A 2MY7A 1S76D 2D41A 2UV8G 3I4MK 3RR7A 1S7IA 4WK3A 1S9EB 3ZZUA 2AX0A 3HDSA 5ETTA 3O6QA 1LWCA 5SUHA
chains in the Genus database with same CATH topology
4PABA 1XZPB 1XZQB 1WOSA 1V5VA 3A8JA 3GEIA 2GAGC 3AD9C 1PJ6A 3TTGA 5L46A 2GAHC 1WSVA 3GEHA 3TFHA 3AD7C 4P9SA 1WOPA 1VRQC 1WOOA 1XZPA 3TFJA 3AD8C 1XZQA 4PAAA 3A8IA 1YX2A 3ADAC 3A8KA 1WORA 1X31C 1VLOA 3TFIA 1PJ7A 1PJ5A 1WSRA 3GEEA 3GIRA 3GSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAB A;  1XZP B;  1XZQ B;  1WOS A;  1V5V A;  3A8J A;  3GEI A;  2GAG C;  3AD9 C;  1PJ6 A;  3TTG A;  5L46 A;  2GAH C;  1WSV A;  3GEH A;  3TFH A;  3AD7 C;  4P9S A;  1WOP A;  1VRQ C;  1WOO A;  1XZP A;  3TFJ A;  3AD8 C;  1XZQ A;  4PAA A;  3A8I A;  1YX2 A;  3ADA C;  3A8K A;  1WOR A;  1X31 C;  1VLO A;  3TFI A;  1PJ7 A;  1PJ5 A;  1WSR A;  3GEE A;  3GIR A;  3GSI A; 
#chains in the Genus database with same CATH topology
 3C14 B;  1MW7 A;  4HHJ A;  2HFO A;  1IWG A;  3Q2T C;  1ZAX A;  3Q2S C;  4IRC A;  1VDH A;  4O3N A;  1TKT B;  3VQT A;  2CQ4 A;  1NSP A;  1RT4 B;  3ELH A;  1ARO P;  5FDL A;  1RAH B;  2ROP A;  4ZVG A;  3DXB A;  3VAI A;  1VRU B;  4OHY A;  3NS6 A;  1I5O B;  2R2T A;  4RLE A;  1TK5 A;  5KFC A;  3DLL Q;  3HCX A;  4KJI A;  1P6T A;  2YNH A;  3ULH A;  4ZPW R;  2HHU A;  4YB5 A;  4ZCI A;  5D8H B;  1HHS A;  4IUF A;  4A46 A;  4ECZ A;  4DUY F;  4WJ4 A;  2Y0B B;  2ASY A;  2OPP A;  4NCB A;  5KFN A;  2OPR A;  3KMS A;  3PEH A;  1IE0 A;  4PQA A;  3KLI A;  4FPI A;  4ZP8 A;  2VFU A;  4XDC A;  4B9N A;  3GTQ C;  1U09 A;  3HHL B;  3CMQ A;  3GDZ A;  2HNY B;  2YU9 C;  2GQQ A;  1M5K C;  4O3Q A;  4A93 C;  1XIQ A;  2JDJ A;  4ZVO B;  2LEP A;  3CO0 P;  1FI4 A;  3TO8 A;  4YFN A;  4MT1 A;  5I42 A;  2UXB F;  3NGK A;  5C2C A;  3T6B A;  3FKI K;  4A3C C;  3CDW A;  2PN6 A;  3EXY A;  3TI0 A;  4LRD A;  3OT9 A;  5C25 B;  2H4W B;  2CQI A;  4XPC A;  5LSL A;  2Z2Z A;  4MYU A;  3RZO K;  1SJ1 A;  1VRT B;  3H0P A;  1HNI A;  1QE1 B;  5BYQ A;  3QRP A;  2MQP A;  4P2X A;  4F4Z A;  5L38 A;  4WWS A;  3FFI B;  3FMB A;  3GIL A;  3R1H A;  2R7Q A;  1KON A;  1LXN A;  4F2R A;  3CCQ S;  2EFQ A;  4G1Q B;  2UXC F;  2Q43 A;  4DDQ A;  4DQP A;  3T19 A;  1LW0 B;  1D09 B;  1PG5 B;  3R97 A;  3AQO A;  1CS4 B;  4J90 A;  4X64 J;  4BKW A;  1RE1 B;  3MR2 A;  4J9M A;  3G6V A;  1J6W A;  2VG7 A;  1NHV A;  3MCM A;  3PYG A;  3KLV A;  5C4X C;  3EVM A;  5I3U B;  1RYR A;  2V4J A;  4AT1 B;  2N82 B;  2YWW A;  3L4K A;  1R9T K;  3HO1 A;  2GS8 A;  3L09 A;  2CJX B;  5B0D A;  3H5S A;  4NAS A;  2XMA A;  4USV A;  1KLM B;  5IP9 K;  1H7X A;  1R9T A;  5FD1 A;  2RHS B;  2B5J A;  2QMW A;  5HJX A;  1S1W B;  3LUY A;  3G86 A;  1FDA A;  1RQ0 A;  2YQ3 A;  2J0Q D;  3FUY A;  2Z2Y B;  1RAD B;  4OZ0 A;  2OSR A;  1NK8 A;  1HQE A;  2W7V A;  3FNN A;  3Q0A A;  1J6V A;  1M0S A;  3T1H F;  3IXQ A;  2I1R A;  5KT5 A;  2RS8 A;  3LP2 B;  4H4K A;  5IOT A;  3GYG A;  4XSZ A;  1FRH A;  2EFV A;  4QWE A;  2HNZ A;  1L0W A;  1VBX A;  1RYS A;  4ELV A;  4P73 A;  5E33 A;  4NYP A;  1S97 A;  4CLS A;  3TFH A;  1UA0 A;  1LOU A;  5HRO B;  3D1H A;  4TU7 A;  2RH6 A;  1CJT A;  2ZZM A;  3W2W A;  4KTQ A;  4EU0 A;  2WOM B;  2HFV A;  4G1P A;  4P10 A;  3EZO A;  3T5L A;  4NXN J;  4FF3 A;  2KYX A;  4NX9 A;  1LXJ A;  3IG1 A;  4BHQ A;  4DPW A;  1Q81 T;  1RXO B;  1S1T B;  3HOV K;  2DY9 A;  3RYL A;  2PMZ D;  3P4U B;  1NH8 A;  1WCM K;  4ZVR B;  3MM8 B;  1FES A;  1RT2 B;  1VHF A;  3IM8 A;  3BEG B;  3MM5 B;  4UUX A;  4LIW A;  5CYM A;  1GTH A;  4MKA A;  3TEH B;  1IVZ A;  3RG6 A;  4LFA F;  1P9Y A;  3S01 A;  1VQY A;  1N5Y B;  4G0U A;  4L76 A;  4UZB A;  3MF5 A;  2IDE A;  4C0H A;  2ZVI A;  2W9B A;  1T05 A;  4NL5 A;  4CM2 A;  2P9G A;  3TEG A;  3QFH A;  4C48 A;  1R27 B;  1ZBT A;  4I69 A;  2HHQ A;  3I32 A;  3KJV B;  1TKX A;  1VQ8 S;  3QJL A;  2MY8 A;  3AT1 B;  3T1A A;  4I6W A;  2R7S A;  3TAP A;  1WQG A;  1XNR J;  1HD1 A;  1BJT A;  3R5J B;  3B8H A;  2IMO A;  4IRD A;  4QIW D;  4DQR A;  1FVS A;  1XMQ F;  1VQN S;  3ZTO A;  4DR4 F;  1M1K T;  1RT3 A;  2B51 A;  2HMI B;  1S10 A;  1HKA A;  4RUA A;  3CED A;  4KYZ A;  3HOY K;  2GW8 A;  3MOJ B;  4DPT A;  2A6M A;  4KGX B;  3CD7 A;  1TL1 B;  3OBI A;  3WQP A;  2VHG A;  2VFR A;  1RTI B;  2OO4 A;  1WD6 A;  3X1L B;  5C24 B;  4J9P A;  2MHN A;  4ECR A;  4USK A;  5A0Y B;  4DV0 F;  4G0V A;  1RA7 A;  2IM2 A;  1RTD B;  3LTO A;  4OZN A;  3ILO A;  4HT5 A;  2OTL S;  4CH1 A;  3GLJ A;  4RW6 A;  4X6A C;  4FS1 A;  2ASL A;  2DIS A;  2OPQ A;  2YH1 A;  4ED4 A;  1S6U A;  4WFN Q;  2A1B A;  1HBO A;  2IRU A;  2E7V A;  3TUZ C;  3SCJ E;  1N33 J;  1IR1 A;  4MEY A;  4H4K C;  1GXT A;  4EO6 A;  4KC6 A;  5HVH A;  5A8K B;  3THP A;  1Q78 A;  1M5P C;  4MIA A;  2A0F B;  1VQ4 S;  1RT7 B;  3T9N A;  4DMZ A;  1Y3K A;  1Q0N A;  2HQG A;  3KWM A;  5L1I A;  1FHT A;  3K5M A;  2HK3 A;  2B56 A;  1D3W A;  1WIH A;  3W64 A;  1FEH A;  4C3I C;  1RAO A;  2NCK L;  3QPI A;  1ZPV A;  4AND A;  1FEE A;  4DDF A;  2AJF E;  4K0K J;  4DR2 F;  3S14 C;  4X65 J;  4YY3 F;  2A10 A;  1OY8 A;  3MGJ A;  3N79 A;  1NK7 A;  1Y1V K;  2E9Z A;  2AHO B;  1YVF A;  2XY7 A;  5C5J A;  3M3Y C;  3A13 A;  2FLL A;  2D74 B;  1Y1V A;  1V3R A;  2FHJ D;  3R6G B;  4LF7 J;  3OLA A;  4NA1 A;  1EB0 A;  2FLO A;  1VC0 A;  2C2N A;  1R8H A;  5E3C A;  4Q2M A;  1K44 A;  1F9E B;  2WVD A;  3GJS B;  3M2R B;  3QBC A;  2Y0S L;  1VQ7 S;  5CZX A;  3MMC B;  3GQC A;  3KK1 A;  1AZS A;  4UY8 5;  1H74 A;  3HOZ C;  1NJW A;  2HBQ B;  3BQ2 A;  1HNX J;  3UDV A;  1R3N A;  3HFV A;  2PFF B;  2ZC3 A;  4C3H C;  2DHG A;  4F3Q A;  1OWX A;  1RHR B;  1RAF B;  2RAQ A;  4YME A;  2OUG A;  4ECT A;  2MGZ B;  3KJQ B;  4C8Y A;  2JVR A;  4KN4 A;  3QZ8 A;  2R7Z K;  4QR2 A;  3HT3 A;  2V8G A;  2DBB A;  4TLR A;  4H4M B;  2CFA A;  2CJQ A;  4W4M A;  4ZVQ B;  2VIH A;  2R7Z A;  4B9T A;  4KC5 A;  2MSS A;  1VS3 A;  3H42 A;  4M5G A;  4YDX A;  3I5A A;  3U27 A;  4K4V A;  1O2A A;  2MKS A;  3D2W A;  2MPU A;  4A3K K;  1RAE B;  1IW7 A;  2CPF A;  2LQB A;  5KFH A;  1SKU B;  2ZE2 A;  4HI2 A;  2FYX A;  2D3O R;  1NCL A;  3CUN A;  2GJ2 A;  3R8Y A;  5J2N B;  1UCN A;  4USW A;  3U1N A;  3J7A N;  2R93 K;  2JLE A;  1TVR B;  2XSJ B;  3W63 A;  1IKY B;  1SKS A;  2MLY A;  3FCW A;  1M1H A;  5F8H A;  1GMW A;  3ETM A;  3RAX A;  4X4V A;  3GV7 B;  2R93 A;  3MUT P;  1TL5 A;  2CW0 A;  2YQ1 A;  2CIM A;  4DFP A;  4ETZ A;  4QCL A;  3ZO7 A;  1FVQ A;  4YG2 A;  4IO9 Q;  4NLG A;  3S1Q C;  3M05 A;  1WC0 A;  4HR2 A;  3CCW A;  2OFG X;  3RTV A;  1N5Q A;  2ZWO A;  1B64 A;  3M8P B;  4CO5 A;  1NND A;  4CQ1 A;  1T3O A;  3IWL A;  2DCL A;  3I4H X;  1FJG F;  4MH8 A;  1TWA K;  4M5I A;  4LF4 F;  4OI0 A;  3DKD A;  4EMD A;  4YFK A;  1K8A T;  1J5O A;  2OTJ S;  3BP3 A;  1OS5 A;  3BBC A;  4N77 A;  1T03 B;  1HNZ F;  1TWA A;  4KAW X;  3DOK B;  3M8R A;  2NVT K;  1A0O B;  1CQM A;  4R0J A;  4IRK A;  4MKV A;  4PAB A;  4ED2 A;  1IQ0 A;  4KY3 A;  2HS4 A;  3JS9 A;  3ENQ A;  1LKZ A;  1Z2Z A;  4OI6 A;  1JQG A;  1QJH A;  3GCX P;  3ZZZ A;  1FE4 A;  4JYA F;  1C0T A;  2DGV A;  4OHV A;  5B0C A;  4DG1 B;  3Q8Q B;  3BR8 A;  2LXF A;  1T9X A;  1U1O A;  2W7O A;  2AGQ A;  1N34 F;  2HRT A;  3LAM A;  2V68 A;  1UVJ A;  2DNK A;  3IR7 B;  2ZOF A;  1TAU A;  4LR2 A;  3HX9 A;  1KOO A;  4RUC A;  4ILM A;  4P5B A;  2H9Z A;  3EPG A;  1FWL A;  3CDA A;  3FEY B;  4O3R A;  2KT5 A;  3AB4 B;  2WB1 D;  4M5K A;  4G0W A;  2R92 K;  2HAF A;  5CYQ A;  1X4F A;  2J8S A;  3NLC A;  1S1V B;  1N8R T;  2MQO A;  4OLP A;  2XO6 A;  1K0T A;  3GTL A;  4KHP F;  1H2U X;  5KG7 A;  5AE1 A;  2C3P A;  2XCP A;  3G2X A;  1XER A;  2PI5 A;  4Y65 A;  5M2P A;  1B0V A;  3BPS P;  3H4D A;  1UVN A;  4WJ3 M;  4I2P A;  1FRX A;  2B9E A;  3GTM K;  3OHB A;  4ECU A;  3EVW A;  2NZC A;  2FVR A;  4Q0B B;  4YQW A;  2GAH C;  4PXB A;  3GTM A;  2MST A;  2P5M A;  4PAA A;  4KM9 A;  4IH5 A;  4HAC A;  2OJ3 A;  1NJZ A;  1WF1 A;  2L9D A;  1XZP B;  3LAP A;  1REV A;  1JLB B;  3ZNU A;  2R7R A;  5F8J A;  1U02 A;  4P72 A;  2BKP A;  4MEX A;  4Q4Z A;  1FTC A;  2EXU A;  3D0I E;  4IFY B;  4QWA A;  1HIY A;  4QJV B;  1YJR A;  4ZOS A;  1P9Q C;  2RDJ A;  1XMB A;  1EKR A;  5KFL A;  3KYL A;  2I5J A;  1PYT A;  4DV5 F;  5C7P A;  5CXT A;  2VKZ G;  2NS1 B;  1YLX A;  2RGR A;  1Q1K A;  2JC0 A;  4E8U A;  3UN3 A;  3KLE A;  2X1G A;  4LBI A;  2DR9 A;  1HPZ B;  2X51 A;  3VAM A;  3S16 K;  1YGY A;  4FBU A;  3P49 B;  4LRA A;  3RBZ A;  3M9N B;  1TAQ A;  2YX7 A;  2ZC4 A;  2BM0 A;  1JLF B;  3OR2 A;  4RW7 A;  4IG0 B;  1VC5 A;  4Y2I A;  1KR4 A;  2RE1 A;  3CDB A;  5IT9 U;  1O26 A;  2CPH A;  5ETK A;  1RUS A;  2D1C A;  4DOZ A;  1EFW A;  5GAE I;  3CJQ A;  4LSL A;  5F3T A;  3ILI A;  1VJE A;  4GTC A;  2BE7 D;  3H3V D;  4LVO P;  4HEA 9;  3W60 A;  3TAM B;  4HHH A;  2O01 C;  4R8U A;  5AT1 B;  3RBX A;  5L9X A;  5B7W A;  4DJB A;  1QUV A;  5DS7 A;  2HS0 A;  2XNQ A;  5K14 B;  3ILJ A;  3T5K A;  3QO9 B;  3RJM B;  4DX8 H;  2ZUF A;  2ZH3 A;  4PG5 A;  1QVG R;  3T01 A;  3IAM 9;  5KT3 A;  1KQK A;  1R43 A;  4NZ0 A;  4BLB A;  3TFJ A;  1PBA A;  2DEJ A;  3CME S;  3NY0 A;  3GTL C;  1PJ5 A;  1B99 A;  3UDL A;  4OX9 F;  1JK9 B;  5HMY A;  2LP4 A;  4LRC A;  3G6Y A;  5L46 A;  5FLM C;  4YFX A;  1Q4R A;  3B78 A;  3N0C A;  5FDL B;  5IOS A;  4RNO A;  3BH6 B;  5GAE U;  3QJP A;  3C6T B;  3B54 A;  4WXO A;  1WSR A;  1SQF A;  1Y5N B;  2F3J A;  2YNH B;  4TNO A;  4M95 A;  3DYA A;  1A7G E;  1F9N A;  4OIQ A;  3MM7 A;  4NLO A;  4GFQ A;  4LF6 F;  3KUH A;  3OFG A;  2OPP B;  4OZ2 A;  2ALZ A;  1SJF A;  2HQD A;  2OPR B;  2NQP A;  1DCO A;  4TN2 A;  2HFZ A;  1KD1 T;  2P9E A;  3JXO A;  3VV2 B;  3N28 A;  1G7C B;  1NPR A;  2X3D A;  4ZLL A;  3CJT A;  1NSK L;  4O23 A;  2QL7 B;  1UW9 A;  4A3M C;  4IOB A;  1R0A A;  1S9F A;  1F3V A;  4I68 A;  2DB1 A;  3EDQ B;  3VVU A;  3LPY A;  5I42 B;  4BLG A;  1N0V C;  2HKE A;  2OEM A;  4ED0 A;  2AF6 A;  4WKR A;  2GML A;  4O3O A;  3KMQ A;  4O4R A;  3W61 A;  3JTO A;  2BJ8 A;  4A3I C;  4CLL A;  3K59 A;  2EKN A;  1FE0 A;  3KG4 A;  1HNI B;  1J5E F;  4ZK7 M;  5KAK A;  3PO4 A;  2IAJ B;  1M5O C;  1N6Q A;  3M2U A;  4JI2 F;  8RUC A;  3KK2 B;  4DX6 A;  1UPP A;  2AEJ A;  2NYI A;  4B9U A;  3K7R A;  5CAA A;  2VPW B;  2E2I A;  4FPR A;  5KFI A;  3BQ1 A;  3NNC A;  5D4P A;  4I0W A;  1S1X A;  3I5B A;  2BJE A;  2AX1 A;  1PO6 A;  3OW2 R;  5AXL A;  2LEB A;  1HWK A;  2QLJ B;  5D4D A;  1YBU A;  3FCV A;  2HFS A;  2A3J A;  4N76 A;  3QSY B;  3PKM A;  3T1Y J;  2MZS A;  4WK1 A;  3CDU A;  1EZZ B;  3CCL S;  1N32 F;  1Q8B A;  4GTB A;  4P2F A;  4USJ C;  4LJZ A;  2CPE A;  4XTT A;  3VGU A;  5E41 A;  1FX2 A;  2AT1 B;  5M5X K;  4WFB Q;  1UZH A;  2R42 A;  2N7C A;  2P5V A;  4X4Q A;  3K7A K;  4FVC A;  2VBY A;  1O28 A;  1T11 A;  4EBE A;  3A8E A;  2HYI B;  1SH2 A;  1JNZ B;  1IR0 A;  4A8K A;  2XC9 A;  5CCL A;  3MCN A;  2L48 A;  1UJ5 A;  1VJW A;  3E8O A;  2GMJ A;  1O29 A;  2ZNY A;  5A8R A;  2AGP A;  4FYW B;  4K5R A;  5IFM A;  3ZTQ A;  3G4C A;  5HMX A;  5DDQ C;  4TU8 A;  4OFZ A;  2CQD A;  4U9R A;  1Y5I B;  4KV8 A;  4IOA Q;  5CAB A;  3CCT A;  2WSC C;  4ZJL A;  2GHV C;  1O2F B;  4U7U D;  3I55 S;  2XQC A;  2YNG A;  4DL4 A;  1ZTT A;  2HNZ B;  3NKY A;  2J9C A;  4RU9 A;  4UT4 A;  4ILL A;  5JVO A;  1F1B B;  1QLN A;  4OI4 A;  5DLG A;  1CJT B;  3OL7 A;  2FZK B;  4CNY A;  2FHM A;  4F8R A;  5KOX A;  3M8Z A;  5IC4 B;  1ITP A;  5EGH A;  4E2F B;  3DMJ A;  2ZDP A;  2FDN A;  4FNH A;  4GTE A;  3GR1 A;  4ID5 A;  5IWA F;  4FS2 A;  2CZV C;  2PHC B;  3M8Q A;  4AUK A;  3SFG A;  2OPS A;  4WII A;  4K59 A;  3P5B P;  2FGC A;  3GG0 A;  4O0N A;  3BSO A;  1U6Z A;  1ZVU A;  1RKJ A;  3EZU A;  1SJ4 P;  1K83 K;  2D7S A;  2HHX A;  1RTH A;  2FVQ A;  3D0G E;  2W9B B;  3KK3 A;  3BKU A;  3LP1 A;  4I6Y A;  2AJ4 A;  1R8P A;  4F04 B;  3W3S A;  1QY7 A;  2BZ2 A;  5H9F J;  4FXD A;  3W9I A;  3PDN A;  3W8G A;  4JI4 F;  2PPB A;  1XK8 A;  4A8X A;  2ADC A;  1DRZ A;  2GSU A;  3OTB A;  3G87 A;  3ADA C;  3AH5 A;  2OIH A;  3LAJ A;  1WG1 A;  1RKI A;  2HBZ B;  2VA2 A;  3OXL A;  4L3K A;  4DLE A;  3S2D K;  4CO3 A;  1S12 A;  4AYB L;  3PW0 A;  4OI2 A;  1HFE L;  3M4O K;  3CCV S;  1ZM2 A;  2XCO A;  3TFI A;  2KG0 A;  2C2K B;  3H8Y A;  3SYZ A;  3I4P A;  1MN7 A;  2C2E A;  3M2V A;  3T5J A;  1WC6 A;  1FK9 A;  4OYM A;  1HYS A;  2GVZ B;  4PZV A;  3HOX K;  1NSQ A;  1IBM J;  2DRD A;  3WHI A;  1U2C A;  2QZ8 A;  2Q1L A;  1F0X A;  4XK8 C;  5KFS A;  1NKB A;  3NRB A;  2QSF A;  2OPQ B;  4RR5 A;  3UPF A;  3VGV A;  2BXJ A;  2IVM A;  2R8I A;  4F3M A;  2GGP B;  2GCF A;  1HBO B;  3ICL A;  3I82 A;  4LR7 A;  1F9H A;  1S79 A;  3UD3 P;  2LQJ A;  3WDO A;  1H98 A;  4X4P A;  3EGN A;  2R8K A;  3C46 A;  4WYW A;  2UUA J;  1U2F A;  4C8M A;  4GTD A;  2GFF A;  4UOC A;  4OIN A;  1QSY A;  3HLU A;  3SCI E;  2VQE F;  4B9S A;  1HNV A;  1ZET A;  4PQU A;  1ROF A;  4LF5 J;  2GNK A;  2RVJ A;  1GEH A;  1R8C A;  3IBC B;  1M1G A;  2WTF A;  4TXS A;  3SEO A;  2VG5 A;  2ZWP A;  4J9O A;  1U1P A;  3J7Z T;  4DFM A;  3UW1 A;  4Y28 C;  3CQZ K;  3LGM A;  2GSO A;  3GIM A;  2PMH A;  3W65 A;  2KWA A;  4ED1 A;  4OYA A;  5K9F A;  2JC1 A;  4K4T A;  1RDR A;  3TVY A;  4M5D A;  2HPU A;  4MMO A;  5IYB C;  2HWH A;  4MKY A;  4JI0 F;  2XTJ P;  3ZTP A;  3E3X A;  5A76 A;  4B3T J;  1YK9 A;  2IYI A;  4YDD B;  1AZS B;  1TWH A;  3HVR A;  1UV7 A;  1YJW S;  2P2C B;  3C2P A;  3SBM A;  2BJD A;  2M0G B;  3K0J A;  5D0E A;  1TKZ A;  2XMT A;  2DGT A;  2W9A A;  1LNQ A;  2M52 A;  1KNZ A;  3NGT A;  3GE9 A;  1PSD A;  4JI3 F;  2Q6B A;  1GXU A;  3I0R A;  4KPC A;  1ZBS A;  2KO1 A;  4C7Q A;  3VWS A;  1XR5 A;  1VGY A;  4LRB A;  4B9L A;  2PSZ A;  2RNE A;  3QX3 A;  3BR9 A;  2BQ3 A;  2V6U A;  4NOH A;  2MB0 B;  4KN7 A;  3KG1 A;  3HOW K;  2W4P A;  4CDI A;  2HVD A;  4DU7 A;  3OD2 A;  1Q8L A;  4PCQ A;  2HIY A;  4HT7 A;  4LBH A;  4DV7 F;  4O0I A;  1YJN S;  1DTT B;  2IA0 A;  2ZBC A;  2ZH7 A;  1BS2 A;  1RU1 A;  2R7X A;  2J8A A;  3QT8 A;  5KG6 A;  3S1M C;  1ICE B;  3Q23 A;  4ZVT B;  3QLH B;  4DV3 J;  2F7V A;  1KRP A;  1YJU A;  1EAR A;  2V5H G;  4CLK A;  3DDI A;  4K4W A;  2HLT A;  2CNL B;  2DRA A;  3D0H E;  2DT9 A;  1T9U A;  3S17 K;  2ZNZ A;  2KDO A;  2B63 A;  2YH0 A;  4ZP7 A;  1U1M A;  3BGF A;  1FKO B;  2YWK A;  5HL7 Q;  4A4J A;  4ES1 A;  5F8N A;  3PNI A;  1N5S A;  4LSN B;  3TAR A;  1T7P A;  4PG4 A;  1O51 A;  3C19 A;  2QSW A;  2BKO A;  1NHU A;  2J0X A;  2A2C A;  1VQP S;  3BSA A;  4QZV B;  4KE5 A;  1G3O A;  1LK5 A;  5HVF A;  4RBV A;  3FSX A;  3DLE A;  2E9R X;  2OMO A;  3EWG A;  3EMT A;  9ATC B;  2Z4P A;  3SIP B;  3RAM A;  4ZPT R;  2CG4 A;  4LFB F;  2Y1I A;  2QE5 A;  3ZZR A;  2G1D A;  3VAL A;  3MFH A;  2JFK A;  2BX6 A;  2GVD A;  4I67 A;  1DBD A;  4TYA A;  4CWB A;  4AXJ A;  5A6W A;  1SQE A;  1NME B;  1TKT A;  3HSG A;  2YKN A;  1TWH C;  1RT4 A;  3B4D A;  4NPO A;  5C44 C;  4GTA A;  1MMD A;  2JA6 A;  2OD4 A;  1VRU A;  5IOL A;  2Z58 B;  4DS4 A;  4MYT A;  1EHW A;  1AFJ A;  1C0T B;  2C28 A;  4PKD B;  1M5V C;  3O2I A;  3FCH A;  2VBX A;  4O3S A;  1DLO A;  2HRU A;  4HLB A;  4ED3 A;  1UZD A;  2R2U A;  3D4J A;  3P96 A;  2UVV A;  2A2D A;  4A3B K;  1VOM A;  2VFV A;  3E2E A;  4C97 A;  4AXI A;  4NYZ A;  5CYQ B;  3HHL A;  3SCL E;  5LOQ A;  3G8T A;  1C0A A;  4MK9 A;  4E98 A;  3SQO P;  1Y1W K;  3HOU K;  1HI1 A;  5GAH I;  2LVW A;  5KFB A;  4CTA B;  3BSN A;  4Z7Y A;  1ZXO A;  4TQR A;  3KJF B;  3Q8U A;  1CJK B;  1R31 A;  4I2P B;  2CYY A;  4X84 A;  1NBE B;  4MK8 A;  3JB9 k;  1ACM B;  2XYG B;  4C2M A;  4ZCK A;  4P7T A;  1JJ4 A;  5HJY A;  1QE1 A;  3MR7 A;  3PX6 A;  3PVX A;  2ZUG A;  1NZA A;  5CH7 B;  1I6V A;  3B4M A;  2CNK B;  4GRS A;  3FFI A;  1KFS A;  3RB6 A;  4FXV A;  3F56 A;  4JP8 A;  5KTQ A;  3OTC A;  4HH0 A;  2B63 C;  5K8N A;  3CJ4 A;  3SQG A;  3RGI A;  2AJ0 A;  1RI7 A;  2XUL A;  1WTB A;  2PEH A;  2VOD A;  3HMJ G;  4EBC A;  4NCA A;  1EI6 A;  3R9L A;  1REV B;  1TWC K;  2WSE C;  2W9C B;  3M8Y A;  2DNQ A;  4RNF A;  1MSW D;  3Q89 A;  4PEO A;  1UJ4 A;  4A3K C;  1OJ4 A;  2J9D A;  2WK4 A;  1TWC A;  2NVX A;  4ZIW A;  5GAH U;  3Q24 A;  5FJ4 A;  2J9D E;  1OIA A;  4BBR K;  5M2U A;  5KG1 A;  2W24 A;  5I3U A;  2C2D A;  4Y2M A;  1UFW A;  2F8H A;  2KFN A;  4ZIT A;  2CZ4 A;  2E5L F;  4DV6 J;  2CWK A;  2H1Y A;  3I6P A;  2C42 A;  3U7J A;  1C1B B;  2HGL A;  3LA0 A;  3OR2 B;  2B8P A;  1R0C B;  2GAG C;  3W5X A;  5DJB A;  4PR6 A;  4DV4 F;  1F7V A;  3FSY A;  2Q6C A;  2R7U A;  4EBD A;  1RCO B;  2JA6 C;  3PJX A;  3QIP A;  3VZI A;  2DXF A;  4URQ U;  3GTJ C;  1X5T A;  1PCA A;  3HP6 A;  1EP4 B;  3JAM Y;  2UU9 F;  4CH7 A;  3H40 A;  3MR5 A;  2L08 A;  1XBW A;  2RRA A;  3OLB A;  3UVJ B;  3OTD A;  4WXW A;  2ZH6 A;  2KYZ A;  1UEU A;  3ZNJ 1;  2MZJ A;  3K57 A;  4R8U B;  2LA6 A;  1XXB A;  3EIC A;  2YPY A;  4DS5 A;  1WC4 A;  1JB0 C;  3T6J A;  4L3N A;  1R8B A;  4WJB A;  3AFG A;  3F44 A;  4OX6 A;  2NVY C;  1H7W A;  2WOM A;  3IR6 B;  3GJT B;  5KOW A;  4RMF A;  4Y00 A;  2GMH A;  5KT7 A;  1QAJ A;  3LGN A;  1FRK A;  5IYC C;  4A3J C;  2M4M A;  2CQ0 A;  4Y34 A;  2Z30 B;  4F4W A;  3GIR A;  1NJY A;  4PYA A;  4ETX A;  3H59 A;  2H3E B;  4NI2 B;  5LSO A;  3I0S A;  3T5H A;  3BDP A;  4K4U A;  1WF0 A;  3MM8 A;  3RRH A;  2DYA A;  4U95 A;  3DOL B;  2NUU G;  3MM5 A;  1EIY B;  1HR0 J;  4LQ3 A;  1IUJ A;  1NKC A;  2HQF A;  1SKR A;  2ZEJ A;  4C2M C;  1DJ0 A;  1AB4 A;  4X4U A;  4NWB A;  1RLD A;  3LPE A;  4DR6 F;  1O6X A;  4K4Y A;  2Y9H A;  2KB2 A;  2MJU A;  3RZD C;  1HNW J;  4A3D C;  3P3D A;  4RZR A;  4Z2X A;  1YX2 A;  3RBE A;  1DUR A;  4PYD A;  1F9F A;  1XJW B;  5ETO A;  2XZW A;  4CO0 A;  1Q79 A;  3OVS A;  1RU0 A;  4ZVS B;  2DH7 A;  3RAQ A;  2HWI A;  1BLU A;  4W90 B;  4PWD A;  2EWH A;  2BBE A;  5D0G A;  1KSP A;  1NDC A;  4AD6 A;  1RK8 A;  2DO4 A;  3OJS A;  4LK0 A;  1T95 A;  2NPF A;  2X7I A;  2FZG B;  2YX4 A;  4K4X A;  1FNM A;  3OR1 B;  2XMM A;  1KEK A;  1NSA A;  5ETR A;  4KB2 A;  1YBA A;  2BJ1 A;  2KXN B;  3BO4 A;  4LF9 J;  4PPD A;  2MZT A;  2ZFH A;  3W66 A;  3S2H K;  2PFD A;  2H5I B;  3LGH A;  3OL8 A;  4DR3 J;  3D67 A;  3BBB A;  1RTI A;  1I94 J;  4QU7 A;  1JVI A;  3CC4 S;  2ZZN A;  2J76 E;  2O5J A;  4BY7 C;  1Z1Z A;  4U96 A;  1N6Q B;  2MQM A;  1RTD A;  1C0U B;  3ITH A;  4EO8 A;  5BYS A;  5KFF A;  2UXD F;  5A2Q Y;  5C4J C;  4CLY A;  5DDP C;  3W9H A;  1D0E A;  4GTL A;  2J7W A;  2NR0 A;  1HI0 P;  4XLP A;  4NRT A;  1TWF C;  4LR8 A;  4MAK A;  2QX0 A;  1VIS A;  3DC2 A;  1FNO A;  4X66 F;  4CCH A;  4MTP A;  1RT7 A;  4JI6 J;  2VC1 A;  1K1S A;  2EI5 A;  2YQ0 A;  3TJ9 A;  2M88 A;  5ITH A;  4FF1 A;  2V63 A;  1EQR A;  3Q8V A;  2QA4 G;  1B7Y B;  1R8A A;  3TA0 A;  5IT4 A;  3S16 C;  3QWP A;  1IQT A;  4FF2 A;  2EPI A;  3OL9 A;  3HHD A;  2QA4 S;  2APO A;  1O0P A;  4C0O C;  2VJV A;  4OJH A;  3PCO B;  3GTP K;  3GP9 A;  2JSX A;  2HS3 A;  2FVP A;  2QLW A;  2H4Y B;  1TUW A;  5A8R B;  4GZY A;  3MR6 A;  3HK2 A;  3PO3 K;  4USM A;  3NGU A;  3G6E S;  2B9X A;  3HSD A;  2BOP A;  3OL6 A;  3DHX A;  4JI1 J;  2HFU A;  2VQF J;  1PC4 A;  3BGO P;  2DH8 A;  3D1Q A;  3M2R A;  3PW4 A;  2YTC A;  2YNG B;  1JOE A;  3MMC A;  4W98 A;  3LWL A;  1OY6 A;  1XNQ J;  3SDE A;  4FVM A;  4DV2 F;  1V3Z A;  4F0M A;  2IBO A;  2EFO A;  1OYD A;  2LQ5 A;  1RA6 A;  3PV8 A;  2K7K A;  5ETL A;  4B3R J;  4L72 B;  2KT3 A;  1XEZ A;  1HBU B;  2FQQ B;  5K8M A;  3U1L A;  5CHP A;  2RIJ A;  2XS5 A;  2XG8 A;  4EFA C;  2AU0 A;  5H1S V;  1KOH A;  2KT2 A;  1SQG A;  3WOD A;  4ID5 B;  1FTR A;  1TL7 A;  4A3G C;  1CQN A;  1WKK A;  3KUG A;  1N5T A;  3V4I B;  5EWF A;  2KXF A;  4A3L C;  1VQO S;  2OPS B;  2QV6 A;  3D9B A;  1U1K A;  4RL1 A;  1FXL A;  3DLG A;  1HBN A;  1HQ2 A;  1XMO J;  4M94 A;  1U1N A;  5LT5 A;  3TR5 A;  4LFC J;  5F8L A;  4KMD A;  4YS2 A;  4A3F K;  1JJC B;  3FKB A;  4FZV A;  3J81 j;  4HVZ A;  4V19 J;  4PRF A;  2I38 A;  2GZO A;  1NEE A;  1FD2 A;  3D1O A;  1RTH B;  2Y3Y A;  3KK3 B;  3MZI A;  2G0J A;  1UWB B;  3G6X A;  3DLK A;  2MZ1 A;  3CCM S;  3EM1 A;  1I50 A;  5DM6 Q;  3PW2 A;  1IKY A;  3R3T A;  1VK8 A;  2R8G A;  2PMW A;  5HP1 B;  3DDN A;  3TA1 A;  3N0B A;  3IFE A;  2GC8 A;  1ZM4 A;  3FBE A;  2JFD A;  3VAH A;  4JV5 J;  1WF2 A;  4DX7 A;  2JWN A;  3ENA A;  5LL6 d;  1R89 A;  4U8Y A;  4YHH J;  4QW8 A;  1VCT A;  1FFG B;  4P2M A;  2ZHO A;  4CRJ A;  4F25 A;  2FY1 A;  2E2J K;  1S1U B;  5M5W K;  5DM7 Q;  2WAQ D;  1NAQ A;  1ZPW X;  2KXH A;  5IP7 K;  1EET A;  5CYJ A;  4XLN A;  2QJ3 A;  1RLC L;  3KKF A;  3CD6 S;  1S6O A;  3S15 K;  3PO5 A;  4DR5 J;  1XR6 A;  5CJ9 A;  3M2V B;  3AQP A;  3I4N K;  1HYS B;  1RWM B;  3VZH A;  1YCL A;  2XCQ A;  3UWT A;  1S0M A;  4XO0 A;  4KSE B;  3CJ0 A;  3H5X A;  2H65 B;  1BDF A;  2UUC F;  5KT6 A;  3PO2 K;  2VBW A;  1DCP A;  5KG0 A;  2DNM A;  2GX8 A;  2CVE A;  3A3P B;  3O5T B;  2JA7 C;  2KFZ A;  4NEZ A;  2WBR A;  4AQY F;  1VGX A;  1I3Q C;  4QIF A;  5D0R A;  2DIV A;  3BKT A;  2HAI A;  1BGW A;  3OTO F;  1QTM A;  3LWM A;  3OSN A;  3EDR B;  4RPF A;  1OSC A;  5IM0 B;  3JTP A;  3FRY A;  3GEI A;  2FC8 A;  2XI2 A;  2POK A;  3R1L A;  2PD1 A;  4DG1 A;  2ZH2 A;  2LKZ A;  2HHH J;  3S1R C;  1PYS B;  1SKW A;  5KG5 A;  3AD8 C;  3TWZ A;  1DY3 A;  1J98 A;  1HNV B;  5M5Y K;  2RRB A;  1N36 F;  4PQU B;  2BAC A;  8AT1 B;  4W92 B;  4WU3 A;  3EGZ A;  1TEL A;  1L3S A;  2R2R A;  2ZJP Q;  5IQQ A;  2VG5 B;  3N5B A;  2AW0 A;  2MXY A;  2JLF A;  3BF4 A;  2DGS A;  2D3Z A;  5KG2 A;  2F5G A;  4WTY A;  4KH0 B;  2M7S A;  3UO0 A;  2A18 A;  3PYD A;  1SV5 A;  1IBA A;  2V0N A;  4FNI A;  1Q53 A;  2FHJ A;  2QTW A;  4B3M J;  4M5D B;  3TW0 A;  5B08 A;  1JLQ B;  4CO2 A;  4N56 A;  1I50 C;  4KMU A;  3POT B;  4NZ7 A;  4ENO A;  4GC7 A;  2MDA A;  2BM1 A;  3MEE B;  4QYZ K;  3CCS S;  2GIQ A;  1AT1 B;  3HT0 A;  1RBO B;  3H2L A;  2CPD A;  2C3Y A;  4KMA A;  5J2Q B;  4Y0F A;  1PYO B;  2C2M B;  5DG7 A;  2ZJR Q;  1DD5 A;  2J6U A;  3I0R B;  1XZP A;  2NVQ C;  5F3Z A;  5IC6 B;  1VLO A;  1RT5 A;  3AH6 A;  1FRL A;  1TWG C;  1JLB A;  1Z2L A;  1RWV B;  3HUL A;  3J80 Y;  3RRG A;  2AJQ A;  1S72 S;  3MM9 A;  4A93 K;  2Q66 A;  4I64 A;  3RW6 A;  4IFY A;  2BOA A;  3GTQ A;  4QJV A;  5EX3 A;  2YU9 A;  3IN5 A;  4A3C K;  2AZ1 A;  1U8W A;  2NYH A;  1DQA A;  2JX2 A;  1T8E A;  4PUO A;  1PAU B;  3MAH A;  4NLQ A;  2OP5 A;  3RZA A;  2JA5 A;  2LEA A;  3EJM A;  1HPZ A;  3NWR A;  5FJ8 K;  4I6A A;  4CI0 B;  1LQ9 A;  2ZBP A;  2IYG A;  2C2R A;  2WW8 A;  3QT6 A;  5EUH A;  5D15 A;  4CO1 A;  3CCZ A;  4QR0 A;  2VUM A;  3MD3 A;  4KAR A;  4QOT A;  2VDH A;  3AD7 C;  2QLF B;  4UST A;  2XMJ A;  3MPD A;  2KRB A;  5KFX A;  1SJQ A;  1PJ7 A;  4U6P A;  1REG X;  4Q8F A;  2XNR A;  3KJN B;  4X62 F;  4Z7C A;  1X4B A;  1UP1 A;  3BH7 B;  3TX0 A;  2N3L A;  3H7H B;  2UUB F;  3UCG A;  1TFW A;  2ILZ A;  3TAM A;  3MD1 A;  1FX4 A;  1RT1 A;  3IMQ J;  5C4X K;  3BPD A;  3HZG A;  1LWE A;  3DRS B;  1L3V A;  3SI8 A;  4BBS C;  3DLE B;  2N4D A;  3SSR A;  3QO9 A;  3IC1 A;  2PMZ L;  2IJF A;  1XPP A;  1VRQ C;  3IBW A;  3QT7 A;  1K0V A;  4OYB A;  2E1P A;  4ZMM A;  4J9S A;  4RW8 A;  3DRP B;  3CJS A;  5K20 B;  2AP6 A;  3GTG A;  3TJ8 A;  2GVD B;  4IH6 A;  4PWU A;  3DLJ A;  2M3D A;  2U2F A;  2JZ5 A;  1IBK J;  2R2S A;  5E3P A;  2YKN B;  3K5O A;  4DSI A;  1LWX A;  3SFU A;  5F9L A;  1TK0 A;  1WC3 A;  4FM9 A;  3C6T A;  1B4A A;  1RU2 A;  1TR0 A;  3D6M B;  1GAO A;  4NLP A;  2DIU A;  1L3K A;  1KN6 A;  2W4C A;  4O44 A;  1Y3J A;  3V6D B;  4K8R A;  4HYK A;  1LWF A;  3BYP A;  1DLO B;  2XI3 A;  2EFP A;  5JJB A;  3MUM P;  4QIW L;  4BCA A;  2JA8 C;  2MKJ A;  4LR9 A;  1JJ2 R;  3FBB A;  3HI9 A;  3GV8 B;  1IJE B;  3CC7 S;  1LFW A;  3B82 A;  3DLH A;  4K2J A;  1GK8 A;  4JI5 J;  1ZZF A;  4RKU C;  1T9T A;  4F4Y A;  2ZOG A;  5BR8 J;  3AJ1 A;  4XAK A;  1H3D A;  2ROG A;  2H48 B;  7FD1 A;  2DNR A;  1SIZ A;  3KDO A;  4KAI A;  1U1Q A;  2QLX A;  5AJ3 J;  2XHW A;  4PPZ A;  2JA5 C;  3ILL A;  2LLZ A;  2OEJ A;  1HHT P;  5B0E A;  4NMX A;  4DHV A;  1RWN B;  1MRO A;  4ZPB A;  5KG4 A;  2X1F A;  5LJ5 Y;  3QGH A;  4J9V A;  3HVT A;  2OEL A;  1FXR A;  2IAJ A;  3QWU A;  2VUM C;  2JEF A;  1O24 A;  1C4A A;  1TTH B;  2W4D A;  4YN3 B;  4CIO A;  3KK2 A;  1S99 A;  2K7J A;  3GFZ A;  1HI9 A;  2PA8 D;  4UW2 A;  2OEK A;  2R9L A;  4ER8 A;  5D77 A;  1Q7Y T;  3SQG B;  3C66 A;  1BWE A;  5LMU F;  1QAX A;  2C2Z B;  4J37 A;  3Q83 A;  1OPI A;  2GHP A;  3V81 A;  1ZA1 B;  5KFK A;  5KT4 A;  4ICL A;  1VQM S;  5CCM A;  3EXC X;  2HVZ A;  1TV6 A;  1SPB P;  3P5T L;  3MCS A;  3M9O B;  2BE2 B;  2QRR A;  4KO0 A;  1WKJ A;  4RUB A;  3I96 A;  2B4U A;  1RCX B;  4YFU A;  3GTG C;  5FII A;  2VBZ A;  3UNG C;  3CAG A;  1WDD A;  1Q82 T;  3QAU A;  1F7U A;  1IBL F;  1S0V A;  1Z4U A;  4X6A K;  4P6Q A;  2CA9 A;  4C3M A;  1IQZ A;  3S17 C;  2YKM A;  4B08 A;  2R7T A;  3JSM B;  3QIP B;  4C11 A;  4YR2 A;  1U0S A;  4N41 A;  4WF9 Q;  1FRJ A;  2KHD A;  3SSS A;  4F4K A;  2RB7 A;  1ZAV A;  3DI6 B;  2P8I A;  1LK7 A;  5IYD C;  2DNY A;  4XCH A;  1U26 A;  3Q3Q A;  3R5D A;  4OLO A;  2LFV A;  4U67 Q;  3NS5 A;  2DGQ A;  2VOO A;  3CJK A;  4DL7 A;  4C3I K;  4B3S F;  2BW2 A;  3C15 A;  1KQS R;  3L7U A;  5LMN F;  2CQC A;  3PRB A;  5KFO A;  2B7C B;  4K5S A;  4DSF A;  4OHX A;  3PRD A;  4NXM F;  4OZ3 A;  4FBT A;  3TZY A;  1XXA A;  1XXC A;  3BUE A;  4D3G A;  1WEZ A;  4KGM A;  4DUZ J;  2C2O B;  2C1E B;  5D4O A;  5L9N A;  3M3Y K;  2F4V J;  3LAN A;  3V4M A;  1SC3 B;  2LU2 A;  2E5H A;  3I0S B;  5KFY A;  1NK0 A;  5BXI A;  3CF5 Q;  4WIQ A;  4C3L A;  4USH A;  2ZZT A;  3VGS A;  3PRV A;  4GVL A;  4IDK A;  4RW9 A;  4GT9 A;  5A6P A;  2VV5 A;  2XBP A;  3HVW A;  3I5C A;  4LF8 F;  3K89 A;  4DV1 F;  3NBP B;  3MEC A;  1YQH A;  3QGI A;  5KFU A;  3MTK A;  4MK7 A;  3UFC X;  3HOZ K;  2E7W A;  5FLX Y;  3W5Y A;  2XS2 A;  1F3F A;  2AQ4 A;  1I6H C;  3ETO A;  4DCP B;  1GMU A;  4DLG A;  4C3H K;  4WU2 A;  1WOR A;  4PWD B;  3W7B A;  2B4V A;  1RT6 A;  4PXD A;  4IO1 A;  3KHL A;  2ZHB A;  2N4C A;  2FHO B;  2KJW A;  2V6S A;  4ELU A;  4DCJ B;  1Y1W C;  1WJ9 A;  5CD4 H;  3PJ9 A;  4A8Q A;  4C3K A;  4N47 A;  1JXL A;  2AV5 A;  5GVQ A;  4GKK F;  2YNF B;  5ETP A;  2DJW A;  4DWI A;  2XCR B;  5I3P A;  4DR1 F;  4LRE A;  2CG8 A;  3H0G A;  2UUW A;  7FDR A;  2GVZ A;  4JI8 F;  3TJA A;  1FO1 A;  2CQP A;  3ITH B;  1WUU A;  3IO1 A;  3D66 A;  3L9Z A;  2DGU A;  4IR1 A;  1JQW A;  5DDR C;  3X3U A;  4NLD A;  3HF5 A;  2E29 A;  2GGP A;  3Q86 A;  1KQ4 A;  2KZZ A;  1DCH A;  4N5S A;  2V6A A;  3J7A 1;  4I7F B;  5B0G A;  2D3U A;  2DNP A;  1V6H A;  5AE2 A;  3EX7 B;  2WON A;  4JI7 J;  3KOA A;  1DTQ A;  4ZKA A;  1S6P A;  1KDN A;  1UVM A;  3ET6 A;  3KLG A;  1ZS6 A;  3O3L A;  3MWB A;  1CUL A;  5HI7 A;  4ZHR A;  4DR7 F;  3PR4 A;  3BN4 A;  1WSV A;  3S1Q K;  1NJX A;  4AL5 A;  2W8L A;  1X4H A;  1XTZ A;  1BQN A;  3D6T B;  4KT0 C;  3GTO A;  3GFY A;  4GKJ J;  2GIF A;  2ZM6 F;  5CZV A;  5DQI A;  4OI3 A;  1ZQ1 C;  4PG6 A;  2K1R B;  4K4S A;  3K17 A;  2IJR A;  2DR5 A;  2MLX A;  1P1L A;  5HQL A;  3UCZ P;  2E9T A;  3U02 A;  2PE8 A;  1U49 A;  3RB4 A;  5U47 A;  3IWX A;  4DPO A;  2Z8Q A;  3FDS A;  3W9J A;  3WZ0 A;  2FLN A;  1VQS A;  1YRU A;  3NOG A;  3A3N B;  3SDE B;  1X7V A;  1HWL A;  2VUG A;  2IM1 A;  1SC4 B;  5MAO A;  3KTQ A;  2ALY B;  2O67 A;  3ZZ0 A;  2OD6 A;  4BXX C;  1NKE A;  1NK9 A;  4N8N A;  3A1Y G;  2AJ1 A;  3HKW A;  1UWA A;  2DKO B;  3JAM U;  1NU4 A;  4ZA1 A;  3NNA A;  2FQO A;  3IGV A;  1K1Q A;  4DUY J;  4Y52 C;  2CKW A;  2BQR A;  1TL7 B;  2G13 A;  1P27 B;  3JST A;  4R5P A;  3P8B B;  3N6L A;  5GAG I;  4F02 A;  4OYZ A;  1TL4 A;  4MJK A;  3N0V A;  2XWY A;  2EKY A;  3DLG B;  1PKU A;  2QEX S;  2RML A;  1HBN B;  5J1P A;  3ZTS A;  2MKC A;  3H0G C;  4P75 A;  3D68 A;  2HND B;  4OI1 A;  1A6L A;  2V34 A;  1DQ9 A;  2UXB J;  2VFS A;  1SUQ B;  2G1H A;  3QZ7 A;  2IC3 A;  4TY8 A;  1DTT A;  4Q44 A;  3QQC D;  2EBB A;  2R3V A;  4X4O A;  4DL0 C;  3KLF B;  3DLK B;  2F9D A;  2C3O A;  1IL2 A;  2KI2 A;  3OUY B;  1L3U A;  1YIJ S;  4OMF G;  2V2K A;  4AL7 A;  3LW5 C;  1CC8 A;  1VYA A;  3QLH A;  5C42 B;  5HL8 A;  1U6F A;  3MOZ A;  3GTK C;  1NUE A;  2KL8 A;  3CGI A;  3H3V L;  2F40 A;  4DPY A;  1RHJ B;  4JV0 A;  5GAG U;  3TNV A;  2NRE A;  2UXC J;  2B6A A;  1FKO A;  3GTO C;  1EET B;  4OZJ A;  1CVJ A;  1F60 B;  1M5S A;  4I56 A;  2NSB A;  1U4B A;  2YWE A;  4LSN A;  3KNG A;  1O2B A;  1WWH A;  4CLF A;  2RQM A;  2H5J B;  3PAC A;  2VFT A;  3MTJ A;  1YSJ A;  3BS9 A;  3WIV A;  4ILR A;  3D28 A;  4DF8 A;  4DEZ A;  4WYL A;  3KFW X;  2GJF A;  1BQM B;  1RBL A;  2E1M C;  1A9N B;  2CXE A;  1MMN A;  1WI6 A;  4X64 F;  2JEG A;  4X4R A;  2XCA A;  5IOR A;  1INN A;  2FIU A;  1TFY A;  3UDE A;  1NZ8 A;  3NXZ A;  1WG5 A;  1OYE A;  1R6V A;  1B4B A;  2MHE A;  2LEC A;  2E1C A;  3CMA S;  5IS2 A;  1JMT A;  1FRM A;  1HAR A;  1WTF A;  3CD5 A;  5BYR A;  5A2Q U;  2RS2 A;  4KAS A;  4EK2 A;  5J1E A;  1JLG A;  2HIQ A;  2V4Q A;  4EYI B;  2V9W A;  2QL5 B;  4CLT A;  3T1H J;  4KHR A;  3F41 A;  4OIP A;  4EUV A;  4BY1 K;  3HSJ A;  4FYY B;  3VVT A;  4NLT A;  4KPY A;  1JLA A;  4KFB A;  1O5J A;  3WIU A;  1L3T A;  5EWG A;  3R7N B;  3CTR A;  3NCP A;  2RF2 A;  4R0E A;  4LBP A;  3GG1 A;  1X60 A;  5B0B A;  2DXE A;  3P6Y C;  2V8V A;  1LEO A;  3N5F A;  5D3G A;  5KFG A;  4Y7N C;  3ZXW A;  3GTL K;  4OJG A;  1SFO A;  1SV5 B;  1NPP A;  3AHP A;  1S9G B;  5FLM K;  1AA1 B;  4CTA A;  4A3E C;  2QMX A;  1X4G A;  2FB0 A;  2Y8Y A;  3AOB A;  2EC0 A;  3LAK A;  2XLI A;  1AYE A;  1TUV A;  1X4D A;  1CJK A;  1WOO A;  4TQS A;  2CZ9 A;  1PIL A;  2Z0G A;  5JUM A;  4NXN F;  5DRK A;  4F50 A;  2CQG A;  4LFA J;  1NLK L;  1X9M A;  3DLB A;  3D54 A;  1NDL A;  2KVQ E;  2AKW B;  2OSQ A;  3FQK A;  3GEH A;  2FTR A;  3OJU A;  2E66 A;  4RJV A;  1X4A A;  3A8I A;  1Y0H A;  1WEX A;  1RHM B;  4RWW A;  4UQT A;  3MI7 X;  5T14 A;  2W2N P;  1XZQ B;  3UNY A;  5IZH A;  5GAD I;  3AD9 C;  5DGA A;  3OV7 A;  1SB6 A;  1RT5 B;  2XMW A;  4OYX A;  4RNH A;  4A3M K;  2J0W A;  3MM9 B;  3KUE A;  2W9C A;  2ILY A;  3A3O B;  3MEG A;  3BQ0 A;  3JTN A;  1UVK A;  4KGK A;  2XGP A;  1PAE X;  2W2Q P;  1XMQ J;  1JX4 A;  4DR4 J;  3BGR B;  3UE2 A;  2EVZ A;  4ECQ A;  4PUO B;  4EI2 A;  5DZ6 A;  3IR5 B;  4A3I K;  3PR5 B;  3KXD A;  1XNR F;  4JK1 A;  2C3U A;  2XSF A;  4OHW A;  4CYU B;  4DL3 A;  2B3T B;  4DV0 J;  1C1B A;  1BGX T;  2HVH A;  2PEB A;  1T02 A;  1VK3 A;  2AWZ A;  3G82 B;  3W2V B;  2G0I A;  3TQ1 A;  4J9K A;  2NPI A;  1TKD A;  4WTO B;  1S4E A;  3MUR P;  2MQQ A;  2JLG A;  1S49 A;  5GAD U;  3Q8R B;  3VGT A;  4H54 A;  1EP4 A;  1L5U A;  2O66 A;  2X1A A;  2FJD B;  4RWX A;  1RTZ A;  4Q2L A;  4USI A;  3UVJ A;  4LK1 A;  4EZ6 A;  1RHU B;  2RUG A;  1RT1 B;  4ZPD A;  4AE5 A;  2FPH X;  4LSZ B;  3NS7 B;  1LWE B;  1W25 A;  2AYM A;  3BV8 A;  4ECY A;  3VAJ A;  4OL8 A;  2MEW A;  1V9O A;  1N33 F;  4DR2 J;  4RW8 B;  2E2H C;  3E51 A;  4F26 A;  2V2Q A;  1SFO C;  4YY3 J;  3LF0 A;  1FER A;  4C4W A;  4DX5 A;  3C8Y A;  2XO7 A;  3DXJ A;  4NI2 A;  3LAL A;  3BP8 C;  4LLG A;  2B7B B;  3UR3 C;  4CLU A;  3DOL A;  2W7A A;  1F5B A;  4TVA B;  1KLN A;  5HAT A;  2ZH4 A;  3PFE A;  3IWN C;  1UVI A;  3M1V A;  2BA9 A;  1U2R A;  3ZC4 A;  4OIX A;  4K0K F;  4F0H A;  5EGE A;  4X65 F;  3M6V A;  4ZPC A;  3D7S B;  5KFJ A;  4ZP6 A;  1B3T A;  1G51 A;  4O44 B;  2UVR A;  5D6G A;  1LWF B;  1SIW B;  2F65 A;  1IM4 A;  4E0D A;  4C8O A;  2R8J A;  3M9M B;  4LF7 F;  3GSI A;  1O8B A;  1TMJ A;  4N8O A;  3N3Y A;  2EFG A;  1NO8 A;  4DQS A;  3JQK A;  3M7V A;  2P9C A;  2B8Q A;  1HBM A;  3ERE D;  1VH2 A;  3OR1 A;  1R0B G;  1K73 T;  2NSC A;  3R5A A;  3L3C A;  2E7X A;  3UQS A;  5D4N A;  1S7H A;  1HNX F;  1S5Z A;  2R7W A;  4DL6 A;  2DEI A;  1NK4 A;  9RUB A;  1UPM B;  5J2P A;  5K8O A;  2CVI A;  4LUB A;  1MRO B;  5EX0 A;  2CWX A;  3QT5 A;  2ZH5 A;  2CPI A;  2W1B A;  4J9Q A;  2WRM A;  1CG2 A;  2IA6 A;  2COL A;  3GYN A;  3HVT B;  4Y2C A;  1C0U A;  2BJ9 A;  1KFD A;  1WC1 A;  4B9M A;  2HVI A;  1S59 A;  1IWA A;  1RGV A;  2E2I K;  3TVZ A;  1VQK S;  1JKH B;  4ALZ A;  1U7L A;  5EGY A;  5L1L A;  1UJ6 A;  1HWU A;  4I4B A;  4Q8E A;  4GMK A;  3QFW A;  4DQQ A;  1X4C A;  2MKY A;  2BRL A;  3M32 A;  1RBA A;  3V81 B;  2ZD1 A;  1N52 B;  1UA1 A;  4ICL B;  1TV6 B;  3L95 X;  3PY8 A;  4FXW A;  1OQ3 A;  3S1N C;  5F8I A;  4KO0 B;  1BY9 A;  3MAA B;  1E6V A;  2IBK A;  5EN1 A;  3FKI A;  4C3J C;  3TRG A;  2ZBI A;  1DFD A;  3FQL A;  4QR1 A;  3J80 U;  2NXC A;  4KMH A;  4LF2 A;  2MKK A;  2DVI A;  4B17 A;  3N01 A;  3MML B;  4C98 A;  4NLY A;  3QJJ A;  1WQF A;  3GCW P;  1FJG J;  4LF4 J;  4G3I A;  2OGU A;  3MMA B;  1OO0 B;  4JV1 A;  5HSP A;  1V5V A;  1JXV A;  2YKM B;  1HNZ J;  2VPX B;  3FHZ A;  4C11 B;  2WVE A;  3AA9 A;  3DHW C;  3HKZ D;  2GQ2 A;  2HHV A;  4O4G B;  2V67 A;  5HO4 A;  3O1L A;  4BWJ A;  5K8P A;  4NRU A;  1DAR A;  2HZC A;  2OKQ A;  5F8M A;  5C3E C;  4IFV B;  1TMM A;  3J81 U;  2YWF A;  4A8M P;  2FY8 A;  3OFE A;  4A8O A;  3MPU B;  1CC7 A;  3CJK B;  4P9S A;  4DZ6 A;  1Q8K A;  3H90 A;  3BGL A;  3C15 B;  2QMU B;  1HW9 A;  3I4M C;  4JYA J;  1HBU A;  2MTL A;  1P8G A;  1ELO A;  4B3O B;  4FN5 A;  2CQ3 A;  2V2V A;  1N34 J;  3LH2 S;  4RW4 B;  3M4X A;  1SL2 A;  3R2D J;  3R7B B;  2O1P A;  3TVK A;  1IR2 A;  5IV4 A;  4LF1 A;  1UAW A;  2H51 B;  3V4I A;  1PJ6 A;  5IQ6 A;  4DPX A;  2WVC A;  4N7T A;  4JV2 A;  4IDK B;  4RW9 B;  4CO4 A;  4NML A;  2DNL A;  3OFH A;  2BAN A;  1QUP A;  1KQF B;  4CH0 S;  3L7P A;  2CPZ A;  5KFR A;  2YKO A;  4CLZ A;  5IYB K;  3C16 A;  3AOC A;  4DXL A;  3MEC B;  2J0S D;  4A8F A;  1X4E A;  4KHP J;  2K3I A;  1UWB A;  5F0U A;  1K9M T;  4F3O A;  4BWM A;  1VQ6 S;  5KFP A;  3AB2 B;  1UET A;  1FNX H;  4YB6 A;  1FCA A;  1RT6 B;  2AZ3 A;  2LMI A;  2XGQ A;  2JRS A;  2J6T A;  4EYH B;  5HP1 A;  2KTQ A;  1MLA A;  1E6Y B;  2VON A;  3EQL A;  5M3M K;  1F6T A;  5D4L A;  5M2R A;  3MED A;  5KFE A;  3FKI C;  3NNH A;  3QGP A;  4TYB A;  1WCM A;  1S1U A;  2HHT A;  2ZBQ A;  5J1N A;  4V19 X;  3M8S A;  1NJI T;  1H6K X;  2HBR B;  3RZO C;  3FRZ A;  3OPF A;  3I31 A;  5JXS A;  3ZTR A;  2BYC A;  4DV5 J;  2GJI A;  4BLA A;  1LW2 B;  2QA1 A;  1X9W A;  1UFK A;  2J7K A;  3S1M K;  2W25 A;  2VPY B;  1NXI A;  3VAK A;  4DUT A;  2Q79 A;  3OVB A;  2NUH A;  2CQ1 A;  3IS9 A;  3HD1 A;  4DN0 A;  3EE3 A;  5ETQ A;  3M8W A;  2WON B;  1SL1 A;  3J7Y I;  5KFQ A;  1DTQ B;  3K8W A;  1S6P B;  1RWK B;  3ET6 B;  3KLG B;  2G2Y A;  4KQZ A;  2AYG A;  1S77 D;  1CUL B;  4NLU A;  1JLE A;  5IM0 A;  4ZHR B;  1RTJ B;  1T9Y A;  5KFT A;  3KLH B;  1YKW A;  1FJE B;  5E3Q A;  4QPT A;  2ACY A;  2CFX A;  1FD8 A;  1BQN B;  2EEY A;  5LSR A;  3H5Y A;  1R9T C;  4J3N A;  5IP9 C;  2QL9 B;  3CJ3 A;  5JVH Q;  1DZ5 A;  1GH8 A;  2HRY A;  1G6B A;  4ZPA A;  3GJQ B;  1MWQ A;  2I6W A;  1FKP A;  3PEJ A;  1R7I A;  3G9C A;  1WI8 A;  3EGW B;  5KFZ A;  1TWH K;  3J7Y U;  4I1T A;  1NHK L;  2RT3 A;  1CJU A;  2W01 A;  1JLQ A;  2BVZ A;  1HQU B;  1N48 A;  2LQ9 A;  4OX9 J;  2YWH A;  4FZB A;  5C44 K;  2RSQ A;  5GMD A;  5D78 A;  1YI2 S;  1I6J A;  5A8W A;  2DGW A;  2DR8 A;  1RAC B;  4QIV A;  3POT A;  4KKO A;  4MIW A;  3V6J A;  3MEE A;  3A8J A;  3DM2 B;  4LIR A;  3ISN D;  4ZS6 A;  2B0G A;  2HQI A;  2PA3 A;  5J2Q A;  1X8D A;  4IG3 B;  1USM A;  1NDK A;  3CJ5 A;  2F1F A;  4CT8 A;  1H2T Z;  2XM3 A;  3HSZ A;  3NMA A;  2JOQ A;  3HOV C;  2VL1 A;  2RU9 A;  1QTN B;  4LF6 J;  3D6H B;  4I2Q A;  1WCM C;  1WHV A;  1RAB B;  4YR3 A;  2W2P P;  2HG4 A;  4R5P B;  3ZZY A;  4ED5 A;  4BC9 A;  1FWK A;  1VC6 A;  1KC8 T;  3A8K A;  3ONQ A;  1JLC A;  1YJ7 A;  3CCR S;  2XS7 A;  1KVI A;  2XMV A;  1HLW A;  1H0H B;  3G4A A;  4OYW A;  2FHK A;  1G2E A;  4DN9 A;  1YG0 A;  2EBG A;  2F8E X;  2IC3 B;  3IM9 A;  4TY8 B;  3CB4 A;  1S0O A;  3RU0 A;  2LA4 A;  5F8G A;  3DRY A;  4WP8 A;  2QIF A;  2HBY B;  4M1X A;  2UVW A;  4LT6 A;  4WE1 B;  3C6U A;  2K8G A;  4ECW A;  5SZT A;  3CPW R;  2E5J A;  3Q8S B;  1J5E J;  4C45 A;  4FYD A;  1B7F A;  4C9D A;  5E7O B;  2C3M A;  1C1C A;  4JI2 J;  1LFP A;  4CNZ A;  2B63 K;  2OAU A;  1B0T A;  3VF0 B;  5FLX U;  1D9F A;  1U45 A;  2EK1 A;  3HOY C;  3NAI A;  1UTA A;  4DSL A;  2KJV A;  2BKN A;  2B6A B;  2PI4 A;  1AB8 A;  2YY3 A;  3M30 A;  1RAI B;  1EH1 A;  1FA0 A;  2CJA A;  1ZYR A;  4FYV B;  1X5P A;  1EK8 A;  5ETM A;  1N54 B;  3NP5 A;  4XSX A;  3DRS A;  3MM6 B;  1N32 J;  2AJ2 A;  3DXS X;  4H4O A;  4Q43 A;  2CJ9 A;  4Z37 A;  5IT0 A;  3DRR A;  4KAT A;  3IPJ A;  3DU6 A;  3QYY A;  3DRP A;  1QAY A;  2VG6 A;  3NL0 A;  4DQI A;  2L3M A;  2FJV A;  1IKW A;  4ES3 A;  5J2M B;  4DFK A;  3HFK A;  1U25 A;  2QGF B;  4F67 A;  4F0K A;  3T1Y F;  1N56 A;  2VOP A;  1T9W A;  2JA6 K;  5B09 A;  1UEK A;  2HHP A;  3GTJ K;  4KGZ B;  4ZVE A;  2CRL A;  4DU8 A;  3MCO A;  2X3G A;  2BJ7 A;  3NCR A;  3BN7 A;  3DOM A;  1WNE A;  5J1E B;  1JLG B;  3R6L B;  2KHC A;  3L4J A;  3T3F A;  3GTJ A;  4QW9 A;  1SVD A;  3LQV A;  2IY5 B;  3MEK A;  3FEX B;  8ATC B;  3V6D A;  5HBM A;  3EVO A;  4A8S A;  2MQL A;  2KN4 A;  1Y1V C;  3G96 A;  5EDW A;  1JLA B;  1TL3 B;  4FYX B;  4KFB B;  3K5L A;  4URG A;  2RF2 B;  3HZE A;  4YEA A;  2DTJ A;  1KP6 A;  2NVY K;  2Y8W A;  4ITS A;  1D1U A;  5IYC K;  1HQM A;  2A6O A;  4A3J K;  3ORE A;  1SCJ B;  2RQ4 A;  1BE4 A;  4RU2 A;  5D3G B;  5HLF B;  4X4N A;  2NVY A;  2OH2 A;  3MAQ A;  4QYZ J;  4PXE A;  4ZN3 A;  5IWA J;  4G1I A;  5IOQ A;  2Z2L A;  4NA3 A;  1IBC B;  2IVF B;  4F2S A;  1X9S A;  2J7U A;  4C2M K;  4NLW A;  4FKX A;  2VU5 A;  1GNK A;  5L1J A;  4KB7 A;  2DHH A;  3T00 A;  1NDP A;  4KDD A;  3RZD K;  4A3D K;  1OQ6 A;  4A48 A;  4MFB A;  3MMB B;  1I51 B;  1NB2 A;  3AOA A;  3D3B J;  3R2C J;  3I56 S;  1X31 C;  2R7Z C;  4V1A k;  4KM8 A;  2NLW A;  3UD4 P;  3IRX B;  2PC6 A;  2P6T A;  4QIE A;  5EWE A;  2HFN A;  2CDR B;  4JI4 J;  2P6S A;  3VAG A;  1H38 A;  4HL9 A;  3V6K A;  5ETV A;  1Y10 A;  5E0O A;  1EJ7 L;  2R92 A;  2NVX K;  4K2X A;  4HHU A;  2FJB B;  3MEG B;  2F9J A;  1RZM A;  1YZ7 A;  2IHR 1;  2BE2 A;  1KVJ A;  3CDE A;  1J27 A;  4JUZ A;  1HMV B;  3KHG A;  4NEY A;  1HW8 A;  2Y0S D;  1VJQ A;  2RH3 A;  4BY7 K;  2R93 C;  2IM0 A;  1D9A A;  1WOP A;  4X4T A;  1AUD A;  1Y00 A;  5C4J K;  2HVE A;  2ZH9 A;  2M2B A;  2DNO A;  2VZ9 A;  5E68 A;  2O5D A;  3CUL A;  3PX4 A;  4X2B A;  3CC2 S;  1J2V A;  2ZBR A;  3TZZ A;  3JSM A;  3PHE A;  1TWF K;  3AJ2 A;  1TK8 A;  1T9V A;  2Y3P A;  3QAT A;  2ZFZ A;  2DCU B;  1YRT A;  2V4R A;  4ZCM A;  3DI6 A;  4NE9 C;  1TWF A;  1QAI A;  1RSC A;  1IBM F;  3QNW B;  2G2O A;  4EGL A;  1KQG B;  2W7P A;  3JYT A;  4Q5V A;  5E5N A;  1TWA C;  3PYE A;  3V4G A;  2UUT A;  5DQH A;  4Y3C A;  5HAO A;  4ELT A;  1WHX A;  2KVI A;  2VQE J;  2KKH A;  4M5N A;  4UOG A;  2HSE B;  4UUW A;  3HD2 A;  3LO3 A;  2NVT C;  1UKU A;  5E3A A;  3D5M A;  5G0R A;  4OYP A;  4KH1 B;  3ENW A;  2LQ8 A;  2V50 A;  3A4T A;  1ZM3 A;  3DGP B;  2UUA F;  4WP3 A;  4R25 A;  3VQS A;  5KFD A;  1SMY A;  1PC5 A;  2E5G A;  1RP5 A;  3GIJ A;  3M1V B;  2ERR A;  1Q8I A;  2PT0 A;  3NBP A;  4LF5 F;  3AJD A;  4BY1 C;  1I3O B;  2G2Z A;  2XY6 A;  5DG8 A;  2XB2 D;  2O3D A;  1FDB A;  2CUY A;  1F5C A;  4JI0 J;  4TLQ A;  3T9Z A;  5AXM A;  2MYF A;  3BGU A;  1HI8 A;  1LWC B;  3CE8 A;  3IAS 9;  4NLX A;  3BM7 A;  1U0H A;  2R92 C;  2HGN A;  3CWJ A;  2XYH B;  3KHH A;  2WAQ L;  1WEL A;  5L8R C;  2G0C A;  1HBM B;  4USU A;  4RO0 A;  4HTI A;  4A3G K;  3PX0 A;  1VLY A;  4ZLP A;  1WC5 A;  4JI3 J;  4A3L K;  4B3T F;  1YNJ A;  1GMV A;  2RD5 C;  2K06 A;  1RIS A;  1B4S A;  3MUV P;  2RQC A;  4HDG A;  2YNF A;  1OMS A;  3OSP A;  4ZJO A;  4BBY A;  5J2P B;  1X5O A;  3Q8P B;  5LXR A;  2AMC B;  4AFF A;  3GTM C;  2CAD A;  2J5A A;  2D69 A;  4QPX A;  2GIR A;  1RWX B;  4L74 A;  3WBZ A;  2QA2 A;  2QT7 A;  4DV7 J;  1FRI A;  2OI2 A;  1IN0 A;  2HK2 A;  3KLI B;  4I7F A;  2BQU A;  3EUN A;  4Y6I A;  3ENV A;  4ILD A;  5KFA A;  3ZZO A;  2V8P A;  4O2D A;  3M32 B;  4PWW A;  4PG8 A;  2ZD1 B;  2V9K A;  4F4X A;  2XLJ A;  3FOF A;  4CP5 A;  2ZUA A;  4RNM A;  4KBI A;  2YXL A;  4WFX A;  1E6V B;  1OY9 A;  1SXL A;  4G7O A;  4FP9 A;  2RKI A;  6FDR A;  1MWZ A;  1WKL A;  2BV3 A;  2OHD A;  1NH7 A;  1C2P A;  3FOE A;  4DV3 F;  1TU0 B;  1NB7 A;  4F36 A;  3TP2 A;  2MZQ A;  3TZW A;  2K1R A;  1WOS A;  4HDH A;  5DO2 A;  3W1Y C;  2KH9 A;  4LFB J;  4OX8 A;  2Y1R I;  3A12 A;  2OLW A;  2JJ4 D;  4WCE Q;  2MJN A;  3DU5 A;  2JA7 K;  4XIU A;  1RHK B;  1T0T V;  3TUP A;  3JQM A;  1I3Q K;  2ZUE A;  5AXN A;  2BW7 A;  4WPA A;  1JIH A;  2VG7 B;  3IP0 A;  2JA7 A;  2RRN A;  1I3Q A;  4P52 A;  5B0A A;  1VQ9 S;  2JL9 A;  2BUN A;  2DK2 A;  1P1T A;  4K7Q A;  1W2B R;  2V4J B;  1I1G A;  1BXN A;  3S1R K;  3QMQ A;  2GHW A;  3JQJ A;  2RQK A;  1NRK A;  3H5U A;  3CIZ A;  3VCD A;  3VAF A;  3H25 A;  1RAJ A;  4RX6 A;  2KM8 C;  2LDY A;  4ZH4 A;  4QQB A;  3T41 A;  6FD1 A;  4ERD A;  5DDO C;  3TYT A;  2MKH A;  3HVA A;  4M5M A;  4J5O A;  2B5J B;  2GO8 A;  2DHS A;  5IV3 A;  5HMZ A;  2JVO A;  2ZIT A;  3OXG A;  1HQE B;  3RW7 A;  2SXL A;  4XDD A;  2E5I A;  1YJ9 S;  3GON A;  3AA8 A;  1EQM A;  2BAN B;  1MG7 A;  4ED8 A;  2DRB A;  3GV5 B;  2DO0 A;  2HND A;  4YP3 A;  2WCX A;  3C16 B;  4QBU A;  1VBY A;  2K3K A;  2JNJ A;  1F5A A;  1SUQ A;  2OML A;  1B0P A;  2DGX A;  4GO7 X;  2HEK A;  1I50 K;  1U1L A;  1IKX A;  3HXA A;  3KLF A;  1SBR A;  1GXL A;  1U1R A;  3W2W B;  3OUY A;  2GO9 A;  3EGV A;  4M8L A;  4RBU A;  3W62 A;  1YTY A;  1SJR A;  1CEZ A;  1RB0 A;  4UY8 T;  3IG1 B;  5C42 A;  2M70 A;  3AXK A;  2Y1J A;  4LVN P;  2YBV A;  2N7Y A;  4ZCL A;  3SCK E;  2VD3 A;  4J9U E;  2CQ2 A;  4G65 A;  2NVQ K;  3MED B;  3CCU S;  5JFE A;  4DCO B;  1TWG K;  2Q3P A;  1KBR A;  1GTE A;  2RJZ A;  3JSR A;  3U1M A;  3PHT A;  5CYM B;  3BDE A;  5LM7 E;  3E01 A;  1UEV A;  1TWG A;  3GII A;  2A6E A;  1CJV A;  1U47 A;  1N4L A;  1H73 A;  1WHW A;  2M8D B;  1T05 B;  3PM9 A;  2DXD A;  1GMW D;  3QID A;  1HWJ A;  1X0F A;  2E2I C;  2AIR B;  1K83 A;  1D8Y A;  2FJX A;  4OYO A;  1TKX B;  1SI9 A;  1V5I B;  4LJM A;  5T41 A;  3BJY A;  4CT9 A;  1BQM A;  3GTY X;  2FQT A;  2E5L J;  2IM3 A;  3CVK A;  1XR7 A;  4U8V A;  2YKA A;  1S48 A;  3IS9 B;  5DG9 A;  4IOC Q;  1Q7L B;  1FT8 A;  4CLW A;  1RT3 B;  1VIX A;  3I9V 9;  4MIB A;  4DV4 J;  5AXK A;  3H4B A;  1IKV A;  3C3L A;  1MN9 A;  1EQ0 A;  2B4O A;  4OZ5 A;  3OHA A;  2CDQ A;  3SXL A;  1JLE B;  2V69 A;  1GT8 A;  4DV6 F;  2NZ4 A;  2ASJ A;  4J9L A;  3N9U C;  3K7A C;  4LRF A;  2UU9 J;  1X5S A;  2AYE A;  1IJF B;  2D6F C;  2ASD A;  2KFY A;  3GMG A;  4L73 A;  2V8H A;  4BBS K;  4RW6 B;  5JVG Q;  1S6Q A;  1UFL A;  2B4P A;  1ZTW A;  5CHC B;  4GVB A;  2F8M A;  2EBE A;  2W2O P;  4QYR A;  2GQC A;  1TZ0 A;  4WFY A;  2UV8 A;  3VTI A;  2ZDO A;  3GB0 A;  1FKP B;  2CPY A;  2IIH A;  4OQJ A;  3TTG A;  4ZIV A;  2U1A A;  2BE5 A;  1QSL A;  1S9G A;  1MU2 A;  1CJU B;  4ANE A;  2YPZ A;  2XLK A;  1ULR A;  3NGS A;  4WIL A;  1F2H A;  1SJ3 P;  3GZ7 A;  5THW A;  1APS A;  3TA2 A;  5A8W B;  3FJ2 A;  3RB0 A;  4ZLN A;  4ECV A;  4KKO B;  2PA8 L;  1YRX A;  1D9D A;  2JEJ A;  3CW2 C;  4IQM A;  3W5Z A;  4DR6 J;  2N3O A;  2ZH1 A;  2VB6 A;  4UF4 A;  1LV5 A;  5I4M A;  2JA8 K;  2IRY A;  1KHV A;  2VJU A;  1JWW A;  4I2Q B;  2VH7 A;  1HR0 F;  1NM2 A;  1XZQ A;  1VIO A;  2DNN A;  3BRE A;  3TZX A;  3GTQ K;  3SMZ A;  2HZV A;  4F4A A;  2EC2 A;  2RDD A;  5T7L A;  3PFO A;  1SH3 A;  3CQZ A;  2PO4 A;  4LOW A;  2YU9 K;  1YJT A;  1JLC B;  3LP0 A;  1HNW F;  1VQ5 S;  2V2Z A;  4BC7 A;  4OV6 A;  2YNI A;  5KFV A;  4NCG A;  3V2U C;  3N4W A;  4WFA Q;  2XZD B;  2WW4 A;  4A47 A;  3KK1 B;  3BGR A;  1DHM A;  3G8S A;  2JA5 K;  1S4F A;  1K83 C;  1BQX A;  4NLR A;  3RRK A;  2GV1 A;  1B70 B;  3MR3 A;  4ZJQ A;  3KHR A;  2WBM A;  3S6E A;  1ZAW A;  3L7O A;  2VUM K;  3UN5 A;  3C6U B;  1U48 A;  4CYU A;  1KHW A;  4ZVH A;  1KWM A;  3J81 Y;  3IA0 A;  1DQ8 A;  2PII A;  2ZVS A;  3WX4 A;  2AGO A;  1C1C B;  1FFS B;  2CFA B;  1GE9 A;  2UXD J;  5G4D A;  3G82 A;  3W2V A;  4LF9 F;  3GJR B;  2MQ8 A;  5DLF A;  3S2D C;  3PYF A;  4NYO A;  3HHN B;  4C0B A;  2BRK A;  4DR3 F;  3M4O C;  2YX1 A;  1VHI A;  1I94 F;  3TUJ C;  1XC9 A;  3ZZP A;  3IRW P;  3M30 B;  1R6Y A;  2UVU A;  3NOC A;  4X66 J;  2R7V A;  2ZE2 B;  2FJA B;  4KB4 A;  2BDP A;  3GFH A;  3HOX C;  2B43 A;  2XWX A;  1ZYQ A;  3I87 A;  2B9Y A;  2WVB A;  3CJ8 A;  3SV4 A;  4GO5 X;  4H4O B;  2DH9 A;  3GTG K;  1EAY C;  3DRR B;  4QU6 A;  2G9O A;  1YWX A;  2IJN A;  4IR9 A;  5BJR A;  1N5V A;  4OIO A;  4AL6 A;  3PIP Q;  2VG6 B;  3HJF A;  2YKP A;  1JNR B;  2LDI A;  4IH7 A;  1IKW B;  3ZZT A;  1URR A;  4JI6 F;  1U6B A;  2I2Y A;  1MNE A;  1UL3 A;  2BAB A;  3UD5 A;  1FXD A;  2ADB A;  2FGO A;  1CBK A;  1Y4Z B;  2QO3 A;  1Y7P A;  1CPZ A;  5E3R A;  4QIG A;  2RHQ B;  3PXG a;  3FBC A;  5LJ3 Y;  2AYB A;  2E44 A;  3S1T A;  4K4Z A;  3DOM B;  1HL6 A;  2DPI A;  5IYD K;  4UTG A;  4AYB D;  2DGO A;  3Q8Y A;  1FKA F;  5HBM B;  2IRX A;  2O5I A;  3TQE A;  4ECX A;  3AXM A;  1FJ7 A;  4DV2 J;  2XYP B;  4A8Y A;  4OJ1 A;  1S9E A;  1J5O B;  4LQY A;  1KKH A;  4ES2 A;  3R27 A;  3OQ2 A;  2LYV A;  4S0M A;  4XPE A;  3CQZ C;  3C14 A;  4RNN A;  4K50 A;  2ZOM A;  3CO9 A;  2EG2 A;  4JI1 F;  4DBQ A;  3MMJ A;  5C2G A;  2VKR A;  2VA3 A;  2VQF F;  2R4F A;  4YR0 A;  2IFX A;  4WP9 A;  2ZKU A;  4C8L A;  3CXC R;  1XNQ F;  5LXY A;  3K5N A;  2M8H A;  1N0U A;  4DSJ A;  1G1X A;  4OX7 A;  2FUG 9;  2X1B A;  4ZDN A;  3GEE A;  2DR7 A;  1VMB A;  4B3R F;  2A6H A;  1W2I A;  4EEY A;  3L4B C;  1VI7 A;  2OFH X;  2RDI A;  1RAG B;  4Y2A A;  3CJR A;  2A68 A;  2BR0 A;  4MFB B;  4G7H A;  3THT A;  5JMN A;  1I6H K;  3R5C A;  2J9E A;  4DI6 A;  5ADZ A;  1JKH A;  4KRW A;  1OPZ A;  3MHY A;  3H20 A;  2M9K A;  5B0F A;  4WZQ A;  3OEP A;  4DSE A;  4KIA A;  4D3H A;  1XMO F;  4LFC F;  1WAC A;  2HNY A;  1ZH5 A;  5H9E J;  2E1R A;  3FC9 A;  3T02 A;  5DQG A;  3HOW C;  3BO3 A;  3TUI C;  1YDL A;  4HI1 A;  2UZA A;  1Y1W A;  1IM6 A;  4ZVF A;  4ZPV R;  2LCW A;  4GTF A;  3MAA A;  1Q86 T;  4M63 A;  2Z56 B;  5C25 A;  3OXF A;  2LXI A;  3HM9 A;  3PW7 A;  4OIR A;  1VRT A;  3OPK A;  5ETN A;  1GX6 A;  5E2Q A;  2ZHA A;  3SZZ A;  4JV5 F;  2JH3 A;  1S57 A;  1Q95 G;  4HKQ A;  2CPJ A;  2DY1 A;  4YHH F;  4OZL A;  2ROE A;  4WZM A;  4HAC B;  3BBF A;  3S8S A;  2FLP A;  1GFW B;  1T94 A;  3RB3 A;  4UOH A;  4G1Q A;  3MMA A;  2UUC J;  2RU3 A;  2QC3 A;  2FJW A;  1UVL A;  1LW0 A;  3GPA A;  1CS4 A;  2HLU A;  3EYZ A;  3NMR A;  4O4G A;  1KS2 A;  1QDU B;  1CLF A;  4DR5 F;  1Q5V A;  1RWP B;  5L1K A;  3OTE A;  4AQY J;  3D6F B;  2QG9 B;  2R7O A;  2Y1L B;  4IFV A;  4QWC A;  2I5J B;  2YKQ A;  1X0P A;  3VA7 A;  2XHC A;  3PG9 A;  4ZLJ A;  3OTO J;  4YOE A;  2BEF A;  3JYT B;  3KLE B;  4JBC A;  5MLC V;  4TY9 A;  2CQH A;  1USO A;  3S14 K;  1QD1 A;  2G4B A;  4B3O A;  2YWG A;  2QFI A;  1KLM A;  4RW4 A;  1T3N A;  3CSK A;  5G0R B;  1N36 J;  1FF2 A;  4RW7 B;  3F73 A;  2V6T A;  4YUD A;  2BE9 B;  1S1W A;  4ZVP B;  1YNN A;  4HH1 A;  2WHO A;  3BZQ A;  2F4F A;  1G4C A;  1WDT A;  2PGC A;  4OHZ A;  3JSY A;  5CQG A;  4A8W A;  2JEI A;  2Z2M A;  1WEY A;  2W8K A;  4LSL B;  2HHH F;  3LP2 A;  3G8Q A;  1UMJ A;  4J91 A;  1Y11 A;  2ZKT A;  1D8Z A;  4EZ9 A;  2GSN A;  3NG8 A;  4Q45 A;  1QSS A;  3RBD A;  2I9S A;  1MWY A;  3DDK A;  5HRO A;  1BWV A;  1CSJ A;  4UQG A;  2NXU A;  3R5B A;  4A3B C;  5GMK a;  4ED6 A;  1SH0 A;  3V6H A;  3HHL C;  4BXX K;  3MDF A;  4C8K A;  2HGM A;  2WB4 A;  4P71 A;  4NZ6 A;  1Y9O A;  3TAQ A;  3SZY A;  1U0H B;  1S1T A;  4P74 A;  2CAJ A;  1E6Y A;  4LMZ A;  2KM8 B;  4B3M F;  4Y52 K;  3HOU C;  1YJV A;  2ATL A;  4ID8 A;  4OV1 A;  4OZ1 A;  1XQI A;  3VHQ A;  3LOU A;  1RT2 A;  4PG7 A;  3V5R A;  5F41 A;  4JB8 B;  4FKY A;  4IKA A;  3NWG A;  5DGB A;  1HHQ A;  1FWP A;  1FFW B;  2KU7 A;  3H0G K;  2BMB A;  1TP7 A;  2PDA A;  1Q16 B;  1GX5 A;  4ECS A;  3US5 A;  1N5Y A;  2KG1 A;  3HPO A;  1J6X A;  2DNH A;  4RBT A;  3DYA B;  4ZP9 A;  3MM7 B;  3CIM A;  2VC0 A;  5EHH A;  3K5P A;  1LW2 A;  4C8N A;  3KJV A;  5I3Q A;  3K58 A;  4TKT A;  1RWU A;  4UZC A;  2VAS A;  1AFI A;  2FZC B;  2FD2 A;  3H2V E;  4M1K A;  3RUB L;  2QYG A;  1TWC C;  2CPX A;  5KT2 A;  3W8P A;  3GTK K;  2NVX C;  4CZC A;  1C4C A;  1R0A B;  2HMI A;  2D9P A;  4DPU A;  4P5A A;  2L41 A;  5H9F K;  3AAW B;  1SC6 A;  3GTK A;  3GR0 A;  2XY5 A;  3R5G A;  4BBR C;  3GTO K;  2HHS A;  3WC2 A;  4DFJ A;  2EFN A;  1TL1 A;  1RTJ A;  3KLH A;  3FZ2 A;  4X62 J;  1V3S A;  2RKI B;  5C24 A;  2QLB B;  4DSK A;  3B6B A;  3HHE A;  2IPO B;  2UUB J;  5A0Y A;  2WB1 L;  1PGZ A;  1ISE A;  2HW3 A;  1JXE A;  3M2U B;  2L9N A;  3BB5 A;  4FF4 A;  4L75 A;  3N6N A;  1S0N A;  3N6M A;  3OFF A;  5CA5 A;  2KRR A;  3GU0 A;  5ETS A;  3GYX B;  1YBT A;  1ZA2 B;  1BC6 A;  4J9N A;  1RWW B;  1S1X B;  2W2M P;  5A8K A;  6AT1 B;  3KDN A;  2ACM A;  1F93 A;  2CJB A;  3GSD A;  3DGV A;  1FJC A;  1HQU A;  4U7U K;  3G4S S;  3VR1 A;  4L6V 3;  4YB1 P;  2D9O A;  3OVA A;  2QYC A;  1Q5Y A;  2F63 A;  4Q7A A;  3LPX A;  2HHW A;  3CCJ S;  1M5H A;  3MFI A;  4PXC A;  3DM2 A;  3HFZ B;  1EX8 A;  3S0X A;  1TQL A;  2IMW P;  3WX8 A;  5RUB A;  4IYQ A;  2QFJ A;  4J9R A;  1OSD A;  2WVF A;  4IG3 A;  1RAA B;  4HTJ A;  4RUH A;  3DN9 A;  1HWI A;  3PJW A;  1VQL S;  3CT9 A;  2P8T A;  3FMW A;  1IBK F;  1TUG B;  4P2S A;  3GIK A;  4NA2 A;  3MPV A;  3GTP A;  1BMQ B;  4ANC A;  1SC1 B;  3HHK A;  1U8S A;  4Q5S A;  4X4S A;  4Y7N K;  1NPK A;  2XMU A;  2EK6 A;  2AEM A;  4KV8 B;  4M5J A;  2XMK A;  3K2Y A;  1RHQ B;  4BS2 A;  2H54 B;  3QGG A;  3H98 A;  3TOQ A;  2J6S A;  3UDC A;  3MXH P;  4LQ9 A;  1VBZ A;  3TAN A;  4A3E K;  4NLS A;  2DHX A;  1QM9 A;  2WZ1 A;  3M6X A;  1KTV A;  1IKX B;  5HVG A;  5KG3 A;  3DCA A;  5K5M A;  3G71 S;  4JI5 F;  1KTQ A;  4WBF A;  4DL2 A;  1AW0 A;  4WE1 A;  3RR8 A;  3DMJ B;  5BR8 F;  2MGZ A;  3DFE A;  4KGV B;  1ZZN A;  4MQ9 A;  3PKY A;  5KFW A;  4C8Z A;  3FBF A;  3M8Q B;  4H4M A;  5AJ3 F;  3JSB A;  3NGD A;  1NK6 A;  1UW4 A;  5IXU A;  2C22 A;  4NOI A;  5AE3 A;  2B9W A;  4KR0 B;  3NAH A;  4ZVU B;  4U7C A;  5LMU J;  3CD0 A;  1RJJ A;  3GWC A;  2NXJ A;  2D3O 1;  1HA1 A;  3S2H C;  1AXQ A;  3E01 B;  3S7R A;  3M6U A;  1CJV B;  5IT9 Y;  1IS1 A;  2KZM A;  2XZT B;  1YIT S;  1BHN A;  3LP1 B;  4ATN A;  2ATC B;  3MM6 A;  3K8V A;  2H5E A;  5J2N A;  2CNN B;  3MPY A;  2CJY B;  5TMC A;  4ED7 A;  4NLV A;  2IVY A;  1TVR A;  2XSJ A;  3D3C J;  3QSI A;  2VPZ B;  2M5Y A;  2QN6 B;  4WKY A;  5J2M A;  3BO2 A;  2DIT A;  2IDL A;  2RUS A;  1IBL J;  3PIO Q;  3HXM A;  1N88 A;  1EKS A;  3R7S B;  2I0X A;  2V94 A;  3PTW A;  1IKV B;  1VBK A;  1W26 A;  1NK5 A;  2MZR A;  4G7Z A;  4M5H A;  2DNG A;  3FK4 A;  3EZ5 A;  4AH6 A;  4M5L A;  3SSQ A;  3QAE A;  3M8P A;  4JOU A;  4DL5 A;  3UN2 A;  3J7Z 5;  1FK9 B;  2V8D A;  3I9Z A;  5HQ8 A;  3DRX A;  3FSI A;  1RWO B;  2RIL A;  4OYI A;  5TMF A;  2A69 A;  2HUR A;  4DF4 A;  2E1A A;  1TL3 A;  1ZOT A;  4B3S J;  3GTP C;  4URS A;  3CJ2 A;  1S6Q B;  5LMN J;  2JHE A;  3PW5 A;  1T03 A;  2UP1 A;  4GVB B;  1PBU A;  2WSF C;  3AOD A;  3DNC A;  3HJV A;  3M6W A;  3DOK A;  2E2H K;  1K47 A;  2HQC A;  2CJK A;  3BYR A;  3FZB A;  1SFO K;  2L9W A;  3GFX A;  3PO3 C;  3NGR A;  5HLF A;  1JJH A;  1HD0 A;  2ZH8 A;  2EW9 A;  4NXM J;  2E2H A;  1QVF R;  1YZ6 A;  4CM0 A;  3CNQ P;  3UCU P;  1FDN A;  4J7C A;  1DAX A;  1MU2 B;  2FVC A;  1O25 A;  1URN A;  5DZ7 A;  5CD4 A;  5F0W A;  1ZM9 A;  3P45 B;  3SV3 A;  1U24 A;  1GQE A;  1H2V Z;  4IQX A;  4LF8 J;  2HQ3 A;  4DV1 J;  1KVK A;  4DUZ F;  3MMB A;  1WG4 A;  1M90 T;  1AUS L;  1PIE A;  2R8H A;  2F4V F;  2ZJQ Q;  3HHL D;  2DPJ A;  5GME A;  3IRX A;  5F9N A;  2FC9 A;  3UI3 A;  4DZD A;  2FVS A;  3PZP A;  4FDF A;  1FDD A;  1WQH A;  3Q22 A;  3THV A;  5T7L B;  7AT1 B;  3FEZ A;  3IBF B;  3O8W A;  1VR6 A;  1S1V A;  3LP0 B;  5KFM A;  4A3F C;  1VFJ A;  2YNI B;  4NCG B;  3SZ2 A;  2MQN A;  4YB7 A;  3ISZ A;  4EWT A;  4WFZ A;  2MKI A;  2BJ3 A;  4C6A A;  1XWL A;  4GKK J;  3H2U B;  2VIC A;  1HMV A;  1TKZ B;  5H9E K;  4Q0B A;  4TU9 A;  4P7V A;  2FJE B;  3QRQ A;  2MMY A;  3BSC A;  4MKB A;  4DR1 J;  5HN0 A;  5HMW A;  3HKZ L;  3NCQ A;  4JI8 J;  1Y5L B;  2HWT A;  4G6V B;  1YHQ S;  2YVS A;  5D0H A;  5HAN A;  1H72 C;  5L39 A;  2NXE A;  4CLP A;  2E2J C;  2K2P A;  5M3F K;  3UR0 A;  3QRR A;  5IP7 C;  3KG0 A;  1F2G A;  1IXK A;  5DET A;  2AD9 A;  2DR6 A;  2VDI A;  3S15 C;  4QWD A;  4KHM A;  3EPI A;  1W7W A;  3S1N K;  2CQB A;  3I4N C;  2DNZ A;  4C3J K;  2LU1 A;  1XN9 A;  2GA7 A;  3FGV A;  4O3P A;  4GC6 A;  1BUX A;  4DR7 J;  3IGN A;  1WHY A;  4BDP A;  1BD6 A;  3ZFV A;  3WC0 A;  3PO2 C;  3NEK A;  4UOF A;  1O27 A;  3BKF A;  2Z57 B;  3FVY A;  2NXN A;  3KNA A;  4JI7 F;  3TX8 A;  2ZM6 J;  2EG1 A;  1JLF A;  4IG0 A;  2AEF A;  2DHA A;  3MPW A;  2CNO B;  2XEX A;  3F0N A;  3DGP A;  5HK4 A;  4Y2K A;  2HZA A;  2VF3 A;  3O44 A;  1SL0 A;  5HQM A;  3CCE S;  4B9V A;  4F7V A;  3NUH A;  3AY0 A;  5TJ3 A;  4QWB A;  4OJ3 A;  4B02 A;  4GKJ F;  5C3E K;  2DD8 S;  1MML A;  2ABY A;  2MLZ A;  2LXU A;  2I8E A;  4ZN1 A;  3ISN C;  5K14 A;  2MY7 A;  1S76 D;  2D41 A;  2UV8 G;  3I4M K;  3RR7 A;  1S7I A;  4WK3 A;  1S9E B;  3ZZU A;  2AX0 A;  3HDS A;  5ETT A;  3O6Q A;  1LWC A;  5SUH A; 
#chains in the Genus database with same CATH homology
 4PAB A;  1XZP B;  1XZQ B;  1WOS A;  1V5V A;  3A8J A;  3GEI A;  2GAG C;  3AD9 C;  1PJ6 A;  3TTG A;  5L46 A;  2GAH C;  1WSV A;  3GEH A;  3TFH A;  3AD7 C;  4P9S A;  1WOP A;  1VRQ C;  1WOO A;  1XZP A;  3TFJ A;  3AD8 C;  1XZQ A;  4PAA A;  3A8I A;  1YX2 A;  3ADA C;  3A8K A;  1WOR A;  1X31 C;  1VLO A;  3TFI A;  1PJ7 A;  1PJ5 A;  1WSR A;  3GEE A;  3GIR A;  3GSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...