3AD7C

Heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with methylthio acetate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
QLRRSPAAHLAAAMEAAEVAGERAVTLREVAFTTQLGLRAVPGSTGHAALAAATGVGLPAAVGEVAGDVSGTAVLWLGPDEFLLAAEENPALLDTLQGALGQEPGQVLDLSANRSVLQLEGPAAALVLRKSCPADLHPREFGVNRAITTSLANIPVLLWRTGEQSWRILPRASFTEHTVHWLIDAMSEFSAAEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subunit alpha of sarcosine oxidase
publication title Channeling and conformational changes in the heterotetrameric sarcosine oxidase from Corynebacterium sp. U-96.
pubmed doi rcsb
source organism Corynebacterium sp. u-96
molecule tags Oxidoreductase
total genus 49
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04268 SoxG Sarcosine oxidase, gamma subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1520 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Heterotetrameric sarcosine oxidase 3ad7C02
3.30.1360.120 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Probable tRNA modification gtpase trme; domain 1 3ad7C01
3A8JA 1WSVA 5L46A 1PJ5A 4P9SA 4PABA 3GSIA 1WOPA 1XZPA 2GAGC 1PJ7A 3GIRA 1WORA 2GAHC 1WOOA 1XZPB 3GEEA 1VLOA 3TFHA 1VRQC 1WOSA 3TFJA 1PJ6A 3A8IA 3GEIA 3ADAC 3GEHA 1WSRA 1X31C 3AD8C 1V5VA 1XZQA 3TFIA 3AD7C 3A8KA 1XZQB 1YX2A 4PAAA 3TTGA 3AD9C
chains in the Genus database with same CATH superfamily
2BJ7A 3L7OA 3QIPA 3QSYB 4Y00A 3P8BB 4Y28C 4ZK7M 1TWAK 3UNGC 4IDKB 2CADA 4DQIA 5H9EK 3ERED 2VOPA 1C1BA 2UUBJ 2KJWA 4MFBA 3KK1B 3CNQP 4TLQA 2CJ9A 3OSNA 3VVTA 2FJEB 1MG7A 1VQ8S 3I31A 1JB0C 3M3YK 2G4BA 5J1EA 1RWWB 4OQJA 5IM0A 1KTVA 2DISA 1QSLA 4G1PA 3PJXA 4S0MA 3W9IA 1IKVA 2O67A 3LOUA 2XNRA 3C14A 4LVNP 5L9XA 5GVQA 4Y2AA 3UO0A 2WW4A 4U6PA 3FMWA 2QL9B 3NGUA 1FF2A 1YQHA 3MM9B 2PMZL 3MUVP 2IC3B 5IV4A 3CMES 2DNMA 2CZ9A 1RT2B 5CABA 4ECZA 2YBVA 2CNOB 4XTTA 1MN7A 5LXYA 3T9ZA 1SC1B 1HW9A 3DLEB 2VUMC 4LUBA 3CO0P 4WFZA 3ZFVA 2WSCC 5KFMA 1UA1A 2UVRA 4CLZA 4ED8A 2HNDB 3GSDA 1Q4RA 4EI2A 2QLJB 2C3MA 1M5PC 5JJBA 5F3ZA 3HJVA 4USTA 1DCHA 4MK8A 3LH2S 5M3FK 4RUHA 4IH7A 3DOMA 1S9EA 3HSGA 4KB7A 5IZHA 1EK8A 4B02A 2Y3PA 5HMYA 1MNEA 3HMJG 4GTCA 4ILLA 1WC1A 3ETMA 4RNMA 1GMVA 4HHJA 4JOUA 2V6SA 2YQ0A 5B0CA 1J6XA 5M5XK 2F8MA 4NXMJ 1N5TA 3P3DA 3OREA 2NXJA 3O6QA 4LSLB 1DZ5A 4A3IK 1RQ0A 2XMWA 3DRRA 2K3IA 2NXNA 4KAWX 2Q6CA 3R97A 2V8VA 2W7AA 5GADI 4XLPA 3JQKA 1JWWA 4FF1A 1UWBA 3W3SA 1QUPA 2B63K 2LLZA 1GFWB 3UPFA 4YB1P 3R6LB 1NH8A 2ZC4A 2IRYA 5E3RA 4LF8J 2CVEA 4OYPA 4QWDA 2VBXA 3AFGA 1O27A 4BS2A 4DR3J 2E2IA 4WJ4A 4PZVA 2AGPA 1AYEA 1TWGA 3CJRA 4M95A 1HI1A 1TK8A 2YNGB 1P1LA 5J2QA 2EI5A 1R7IA 3I4MK 5L39A 4JI7J 3HF5A 3KJNB 4DSIA 4DBQA 4CLTA 2EKYA 5LOQA 2FUG9 1XPPA 4J9SA 1D09B 2CRLA 3FC9A 4IOBA 2RHSB 2CPFA 3CDEA 3TAPA 3G9CA 4F4ZA 4EK2A 4BBSC 4P5BA 1ZVUA 3NOCA 4KC6A 2KTQA 4ZVGA 1XNQF 2WBMA 2CPYA 3DKDA 5KFKA 2LXIA 4M5HA 4NXNF 3MURP 3GTQA 2XMVA 4PKDB 4HT7A 2AP6A 1IBLJ 2AEFA 5L8RC 1CC7A 2W1BA 2M88A 2XBPA 5I3QA 3LAJA 2E44A 4NE9C 1LXJA 4GKKF 5E3QA 3T1AA 3ENQA 2JA8C 1S0NA 3NY0A 3MMBA 3IG1A 2FB0A 5GAGI 3KLGB 3QT6A 1N33F 1FJCA 1LQ9A 4PCQA 2F9JA 2YWFA 1WIHA 5EGEA 3QO9A 3VA7A 2HQ3A 1EETB 1URNA 3NXZA 3H0GA 1S7HA 4DN9A 4ITSA 2PDAA 2EG1A 3KFWX 1V5VA 4DXLA 2ZUFA 1YJTA 2QYCA 2A6HA 1WC6A 1PJ5A 4A3BC 3DRYA 3KDOA 4UZCA 1HARA 2LMIA 2WSEC 3S6EA 1EQMA 1VYAA 1RAHB 1TELA 4MIAA 3KOAA 2IDLA 3J81Y 4C8OA 2JRSA 2UV8G 4LR9A 5THWA 2JEFA 3BR9A 1ZETA 4DSFA 3PIPQ 4JV5F 1RBLA 4V1Ak 2ADBA 2DEJA 1F93A 2XTJP 2A1BA 4Y2CA 4A93K 4O44A 2HZVA 4ATNA 2WVDA 3Q3QA 4RW4B 2MZ1A 5IWAF 2CPDA 4YFNA 3HOVC 3Q8PB 2M3DA 1BDFA 2WBRA 4F3MA 5C44C 3ET6B 1IR1A 3D4JA 2GIFA 3M8QB 1VGYA 1QAJA 4LJZA 5C25A 1TV6B 4W98A 1IBKJ 4I7FB 2C28A 2OMOA 2JLEA 4U96A 4NWBA 1AB8A 1TFWA 2E66A 3MECA 1NK0A 3Q89A 4C8LA 4LR2A 5D0HA 1IKXB 2OP5A 2E2JK 1FEEA 3B78A 4UUWA 3I4NK 2AJ1A 1YKWA 1W7WA 3HHKA 2V6AA 5AXMA 2DIUA 3ELHA 1HNXJ 1VIXA 1T9TA 4OV1A 3SI8A 1Z2LA 2B8PA 4ED3A 1HL6A 1RWNB 4P2FA 5L1LA 3A12A 3S17K 1P9QC 2R4FA 1WNEA 1MROB 2AW0A 4A3GK 1JQGA 3BH6B 3MXHP 4ZDNA 1WQHA 4KATA 2CNLB 3WIUA 2YNIA 4LVOP 4RR5A 3ZNJ1 2YU9C 1I3QA 1S72S 2WTFA 2FJXA 4FM9A 4ILMA 4NCGB 1RU2A 4CO5A 2Y8WA 2UU9F 4C2MC 3FFIB 2F4FA 4DMZA 1P6TA 5HBMB 1GX6A 3ISNC 1R89A 1RADB 2F8EX 2BKOA 2ZBRA 3Q86A 1RLDA 2B5JA 5EWFA 1DCOA 5EN1A 4M5KA 2BM1A 2YQ1A 4WCEQ 4ETXA 3QGIA 4I68A 2HNYA 2DGUA 2K7JA 4IG0A 3NGKA 1PC4A 1OWXA 4ZPCA 2KG0A 1VQ4S 4A3KC 1GMWD 4FF4A 2CJBA 1T7PA 4LF4J 1KP6A 2PA3A 3W5YA 2CQPA 3MCSA 2PHCB 2W2QP 4USWA 4ZCKA 4DZDA 3WIVA 2CFAA 1M1GA 2DO4A 2W4CA 2B9WA 4CYUA 2V8HA 3AHPA 4PQUA 2XSFA 2B4OA 4V19X 1VR6A 2HRYA 3QSIA 1FVQA 1R8AA 3BSNA 3UCGA 2A2DA 2MQNA 3IM8A 2XYPB 4DX5A 3D1QA 2BANA 3FK4A 1NK5A 2P8TA 2R7OA 1YITS 4DR4J 2M8HA 2U2FA 4DR2F 2OPSA 1BGWA 5CYQB 1RISA 4B3SF 2CPZA 2FD2A 3Q83A 1TK5A 1DHMA 4OL8A 3EJMA 3F44A 2JDJA 3GTGK 4EZ6A 1RT7B 4M5IA 3GTOC 1K47A 2B6AA 2DNLA 1NLKL 1YIJS 2HS0A 3OTEA 4GVLA 3D1HA 2XMUA 4H4KA 3SCIE 2ZHAA 4TY8A 2BJDA 1DCPA 3HXAA 4KV8A 1WKKA 5C3EK 4B9SA 2DNNA 4PEOA 2DO0A 2C3PA 1O25A 2D6FC 1CJUA 3CDAA 2DR8A 5IP9C 1E6YA 5LMUJ 4CO2A 3C6TB 3PVXA 4A3MC 3ICLA 3M8PA 4NA1A 4UT4A 4DV3J 3LA0A 3LGNA 4IUFA 4MKBA 2LA6A 2V63A 3GIMA 1SJFA 5M2UA 1T03B 5CD4H 4NRUA 5EWGA 1UETA 4L74A 1R6YA 2ZH6A 2BE7D 3L4BC 1U47A 5D4LA 1WEZA 2EBBA 4J9NA 4OZJA 3HHDA 4DR1F 4MEXA 3H59A 4QU7A 2A2CA 3M9OB 1ELOA 4ICLB 4OYMA 4BY1C 2E29A 2WONA 3ETOA 2VIHA 4DCOB 2Z0GA 4J9UE 1RTIA 1TKTB 3ZNUA 4LF6J 3VGTA 1USOA 1HHSA 3QT8A 3T9NA 2VL1A 1XBWA 2AZ1A 3I56S 1RT5B 3H40A 4RWXA 4DFKA 1WEXA 2LEPA 2CNKB 3NCRA 3HOXK 1NM2A 1TWFA 2F65A 3KUHA 3FRYA 1VRUB 1LXNA 1TWHA 2LDYA 4PPDA 4NLQA 4Q7AA 1NNDA 1JVIA 2LQBA 1IBAA 2ASYA 5ETQA 1NDLA 2BV3A 5E3AA 4KIAA 4MMOA 2BJ8A 4XLNA 2DNQA 3OQ2A 4X4SA 1RTHA 4OI4A 2XGQA 2RUSA 4LSNA 1FWPA 3GQCA 5HJXA 2QZ8A 3KLHB 3G6XA 3CJKB 4A8QA 1BXNA 2YNFB 5J2MB 2I5JA 3QRPA 3OTCA 2DNPA 3OPFA 1S0VA 2FQQB 4M94A 4DPTA 1PG5B 4ID5B 2C2MB 2N3OA 1O51A 1XXAA 3QBCA 1YG0A 4GO5X 2OTLS 2JA5K 2PO4A 3GJTB 3H25A 1HNWF 1U1PA 1M1HA 3EGWB 4AYBL 4LRCA 3WQPA 3GR0A 1ZQ1C 2Z2MA 2VPYB 4DG1A 1SBRA 5HMWA 3OFEA 3PO3K 3RAMA 1U1MA 5C7PA 2DNYA 2HBZB 4PG4A 1OJ4A 1UCNA 1VBKA 4YP3A 3IN5A 2ZOMA 5D4OA 4KQZA 2UVVA 3PX0A 5C24A 3TJ8A 3TJ9A 3HULA 3Q2SC 1W25A 7FD1A 4K4UA 2VA2A 3G6VA 3BBFA 3ZZ0A 3GCWP 3M32B 4QIEA 2OMLA 1B99A 3EWGA 3UFCX 1NJZA 2CQBA 4Q2MA 1UW4A 1TL5A 4WBFA 4NEYA 1FCAA 1S4EA 4ZVFA 4OI1A 1Q8BA 1ZA2B 1PBAA 1H38A 3UWTA 5F8LA 2Z4PA 1Q1KA 2HRTA 2HFUA 5IYDK 4NLGA 4HL9A 2M8DB 1HQ2A 2MY7A 1UW9A 2DPIA 4CLKA 1FJ7A 5GAEI 1SV5B 3GTLA 1HQEA 2Q79A 1X9WA 2Q6BA 2XGPA 3OTOF 3OD2A 3WZ0A 7AT1B 4MEYA 3GEHA 3LP1A 1CQNA 3MMCA 4OIOA 4URSA 4UOGA 3NWRA 3K89A 5B0EA 4DPUA 2D3OR 3SQGA 1SJ1A 1SJQA 3BYPA 3G8QA 5J2NB 2FHJA 2JWNA 4KB4A 3JS9A 4RZRA 4BWMA 1JNRB 3G2XA 3I5CA 2DR5A 5D78A 1HNIB 2QLBB 3KLIA 2DXFA 1VJWA 4DV5F 3NUHA 4GRSA 4C11A 3GYNA 4Q5SA 3G4AA 3GTPA 3QX3A 5BR8J 1SQEA 3LGMA 2B9YA 4X4QA 4ZH4A 4OIXA 3UD3P 1KHVA 1NB7A 3SBMA 2F4VJ 1XIQA 3N0CA 2XG8A 2UVWA 2IPOB 2R2TA 5B09A 3DMJA 2NSBA 4A3CK 1VC6A 3MMAA 1ZOTA 3DLGA 1M5OC 3OJSA 4GTFA 4M5NA 4RPFA 2PD1A 3SV4A 3QRQA 4DV2F 1K0VA 1X0FA 1N5YA 2GO8A 4R5PA 1KTQA 2W9BB 3LP0B 1HHTP 4A3EC 4DQSA 2MQPA 1HIYA 3K57A 3VAFA 3MPDA 3LQVA 2V6TA 3AB4B 2DGTA 2BA9A 1FKOB 3HOWK 4DU7A 3GV7B 4DL7A 1PJ7A 1PO6A 2JA6C 1HQUB 2JEGA 1CG2A 4IFYB 3CIMA 3AJ2A 1IKYB 3UN2A 3CCJS 3V4MA 2NVQK 3DRXA 1ULRA 2XMMA 4YB7A 2VKZG 1C4CA 2XYGB 3AJ1A 4ZVSB 3PW4A 5F9LA 1Q81T 3VAGA 3M6VA 1N56A 2XMAA 4F8RA 4YFXA 4ED0A 1KNZA 2XNQA 2VDHA 3SCLE 2DNKA 4A48A 5KT5A 2WVBA 4A8MP 1KQFB 4U8VA 3THPA 2NREA 1SB6A 4UOFA 3PV8A 3VAKA 1U02A 3Q23A 4P73A 3QGPA 3KUGA 2GAGC 3RB4A 3TW0A 4YN3B 1SFOK 2YQ3A 1TKXB 4ECSA 2R93K 1K9MT 5D0RA 5A0YA 5KT6A 5D0GA 3HFKA 1R9TA 2ZNYA 3F0NA 3NLCA 3M8WA 1JLFA 3I0SB 2RIJA 1I3OB 3T3FA 4C8KA 4L76A 4OIQA 1BQXA 3UN5A 4QYZK 2FHMA 2HBRB 4RNOA 1WF1A 4ERDA 1KLNA 2PSZA 4NPOA 5FDLB 3IGVA 2YNHB 5IT0A 2J7KA 4USIA 1PCAA 4OI2A 3TUJC 3OLAA 2EWHA 3W5XA 3JYTA 1VHFA 3M8ZA 4C97A 3RZDK 3EDRB 2B9EA 3UI3A 1B4BA 3I4PA 3BO3A 2MKIA 2XZDB 3OV7A 3W2VA 4RUAA 1Y9OA 1P8GA 3AD9C 1X4HA 1GX5A 1VFJA 2EFVA 4DLEA 2FGOA 4LFBF 4WKRA 2A0FB 2RNEA 2YX7A 3RBDA 2V0NA 4ECTA 3RZOK 4HEA9 3GSIA 2OH2A 4Y7NK 5LMNF 5E3PA 2OGUA 4ID8A 3KK3A 4YFKA 4RMFA 5E0OA 1DLOB 1JLGB 3CB4A 5IYBK 3TA0A 1OO0B 1YX2A 3QIDA 2HK3A 3NBPB 2KKHA 2J9DA 1FE0A 2MLYA 2OSQA 1UMJA 1X5SA 3ZZPA 2R7TA 1KFDA 4NA2A 1BQMA 5KFCA 2CWKA 4KH1B 2VDIA 4LIRA 2C2NA 2ACMA 2PT0A 1R8PA 1RBOB 3TQEA 5IP7C 3I6PA 3MM6B 3X1LB 3RRHA 4I6WA 2OD6A 3CAGA 4EFAC 2W9AA 5J2PB 3LUYA 1I50C 1WOSA 3HKZD 1C0UA 3HI9A 5A8RA 2ZWOA 1U2RA 1SVDA 2E1PA 1X7VA 2JA7K 3AB2B 3J7Z5 4LRDA 2B43A 2FLNA 4FVMA 4XPEA 5E3CA 4P7TA 1VQ5S 5FJ4A 1ZS6A 2J9CA 1TL4A 1ZPVA 3IBFB 1B7FA 3LALA 3MEKA 2V2VA 2X1FA 4U7UD 2AIRB 1J98A 1H2TZ 4EYHB 2GJ2A 1U24A 2CWXA 3W9HA 1NHKL 3J7A1 1N32J 5U47A 2DIVA 1KWMA 2E1CA 4LBHA 3VVUA 3GTJC 3D68A 3GJRB 3QRRA 2YKMA 2GV1A 3D6HB 4JV2A 4X64F 3MEEA 1VDHA 4IOCQ 4DOZA 2B4VA 4ZVRB 3FOFA 2W2MP 4QW9A 3VAIA 2AJ4A 1J6VA 3HHLD 3W5ZA 2ZH7A 4FZBA 2OPRB 2HZAA 2RU3A 4QIWL 3HKZL 4MTPA 1FNOA 2EG2A 1XZQB 2LEBA 4P52A 1IQZA 4DL3A 2K1RB 1L3KA 2NUHA 2X1GA 4KC5A 4IKAA 3PKMA 1TWGK 2F3JA 4TQRA 2DGSA 3DYAA 3TX8A 1SIWB 3CCUS 4KN4A 5EX0A 2UUCJ 4JI1J 3TR5A 2UP1A 4BXXK 5C4XC 2EK6A 5AE2A 4M1XA 4P75A 3PYGA 4CT9A 1UEVA 2GO9A 3M4OK 5E7OB 1KVJA 3UDCA 8RUCA 1TKZB 5M5WK 3AY0A 2QGFB 1B70B 1I6JA 2UXCF 4FXVA 1HBNA 2OUGA 2RE1A 2OTJS 1LWEB 1RT1A 3FCHA 1TP7A 1RBAA 3R5GA 4Y3CA 3H0PA 1VQOS 3OEPA 3GB0A 2WHOA 1YNJA 1VK8A 2JFKA 1IJEB 2ZDOA 1O2BA 1T95A 2VF3A 1I94J 5E41A 1REGX 3BUEA 2E9RX 2MKHA 1RUSA 3M30A 5C4JC 3SZ2A 2X7IA 1KC8T 1WACA 3FBFA 2MKKA 2OPQA 5KFJA 1WCMC 3CCES 1S6QB 4NZ7A 3TFIA 1FXDA 1JJ2R 2IVMA 3J7ZT 3E01B 1GTEA 1XMOJ 2IJFA 5C42A 2XS7A 4QR2A 3FVYA 4A3LC 1RA7A 4K0KF 4AUKA 3TRGA 1WHXA 1B0PA 3NGRA 4ZJLA 4RW6A 2HQDA 1HBOA 2EK1A 3S14K 2AWZA 4YEAA 4F0KA 3RYLA 1RHQB 4ALZA 4K8RA 3CCLS 4HYKA 3NMRA 2G2ZA 3HT0A 5FJ8K 3CF5Q 3VV2B 2OJ3A 1NPKA 2CQ4A 4DQQA 5KFEA 2CUYA 1AFJA 1TWAA 3FKIC 3LF0A 2BRLA 1NH7A 1LWFA 2A6EA 4TU8A 2XO6A 4LK0A 5KOXA 4LF2A 3G6YA 3QWPA 1VIOA 1CJVA 4O3OA 4DF4A 4IH6A 5AJ3J 4FS2A 3NKYA 4DDFA 2OPPA 3DRPA 3C6UA 2GX8A 4WXOA 2BACA 2JHEA 2HBQB 1NK9A 3W9JA 1JLAB 3S1NK 5E68A 1S49A 4G6VB 4JI4F 1CS4A 4DPXA 3F41A 1RAIB 3T1YF 2UXBJ 3RBZA 2FVCA 5KFNA 2DYAA 3OTBA 2G0JA 1QAYA 5ADZA 1F5CA 1OYEA 1JJCB 2R92K 2YKNA 4USKA 3LAPA 4MK7A 2HVZA 2Q3PA 1JXEA 4F67A 4IFVA 4O0NA 4WIQA 2FJDB 3MAQA 3OT9A 3DLHA 2BKNA 3GE9A 3CWJA 1NDCA 2GVZB 3PACA 2LU2A 3V2UC 5AT1B 4CTAB 2V6UA 2E5LF 3CCMS 4H4OA 2QLWA 2NR0A 3D3CJ 3I32A 1ZYQA 2R8KA 2X51A 4GTEA 1LV5A 1RT6A 2HLTA 5CXTA 3OTDA 4CH7A 3PRDA 1MSWD 4JK1A 3HP6A 1CBKA 2PE8A 5KG3A 1VLOA 1RAAB 2MSSA 2M52A 1HI0P 2ZJRQ 1F3VA 4F3OA 4DL4A 3S2DC 3H2VE 1USMA 2ZJQQ 4DR7F 3CDBA 2IM1A 1KDNA 5A2QY 1SL0A 5F3TA 2ZUGA 3B82A 4KM9A 5KT2A 4DV6J 2B63A 3QQCD 4JYAJ 1OY9A 2MQ8A 4AXIA 2AX0A 2HSEB 3ZTRA 4DI6A 4IQMA 4ZVQB 2ZEJA 3PM9A 3ITHB 4F7VA 3H8YA 3AQPA 4J9QA 4EO8A 4GC6A 1VISA 2XHCA 5LSOA 4N5SA 3R27A 3M4XA 2X1BA 2HPUA 1YRUA 3IAS9 1KD1T 4X66J 1NSQA 2BR0A 3J7YI 2WB1L 1S1VB 2Q1LA 2FC9A 1NKBA 4ZVOB 3N5FA 5BXIA 2CQ2A 2XC9A 2BW2A 2J5AA 5AXKA 2RQ4A 2NVYC 4EBEA 1Q8LA 4YR3A 3M2RB 1S1XA 4U7CA 5K14B 3V81B 1HPZA 3W8GA 3JQJA 2HIQA 2CJYB 3A8KA 4P7VA 1XMQF 4LK1A 4URGA 1OY6A 1TL1B 2GSNA 2OD4A 5DM7Q 3ILIA 1NRKA 1EJ7L 4LF5F 1BQNA 2V4JA 4IO1A 1JLQA 2GSUA 2VODA 2H54B 1TL7B 2XY7A 3DDKA 3DDNA 5KFZA 1B4SA 2MQOA 1CJKB 5GADU 2QMWA 4KM8A 3A3PB 2CA9A 3BZQA 5ETNA 2DXDA 2IAJB 1U0HB 3DOKA 3GEIA 1N0VC 4DUZF 4NMLA 4GVBA 3FEZA 2KXFA 1X5OA 5A6WA 1RYSA 4B3OB 3M8YA 4OYBA 4B9UA 2F1FA 2VQEJ 5HP1A 4HKQA 4KYZA 4CP5A 4M5GA 3MEDA 2HGLA 2C2ZB 4LT6A 1YZ6A 1KLMA 3PZPA 5KFXA 3CCZA 4CI0B 3PYFA 2HHHF 4NCBA 3R2DJ 3NS7B 1GNKA 5B0FA 1QVGR 3UNYA 1VH2A 1R6VA 1NSKL 1SUQB 1S7IA 4PYAA 1Y1VK 2RS8A 3MGJA 2HURA 4CLSA 3K7AC 2G2OA 4Y65A 1LWCB 2GHWA 1O2FB 1AZSA 2LQ9A 3SMZA 1N48A 4N41A 2GVDB 4AH6A 5DG7A 3PHEA 3HJFA 1FRJA 2IC3A 2MXYA 1RK8A 1RT2A 5KFOA 2GGPB 4QR1A 4ED6A 3VHQA 3TVYA 1UJ4A 3TA1A 1TWHK 1P1TA 4HH0A 4A47A 3IM9A 2R7ZC 1D3WA 1BMQB 1I1GA 5KFBA 4HLBA 1U1NA 3MAAA 4OZ0A 3BSOA 3SSSA 5I42A 4B9VA 3TWZA 2QFJA 2HNDA 2YWWA 1WC4A 3FNNA 2HIYA 3I96A 4DEZA 3M6XA 3QZ8A 3R2CJ 2KXHA 3H3VD 2KFNA 2ALYB 3BP3A 4AXJA 5M3MK 1LFWA 4QJVA 2O01C 5CCLA 5GAHI 4QIVA 5KOWA 3D3BJ 1SC4B 1S59A 3K5PA 4AQYF 1Y10A 4WYWA 2X3GA 5IQ6A 4USJC 2MQLA 3P6YC 1KSPA 4BCAA 1TUVA 2MSTA 5L1JA 1ISEA 5HANA 4A3JC 4JB8B 4OJHA 2DGXA 1FRXA 5CZXA 1A9NB 3S1QC 3VR1A 1TKDA 3S01A 2HFZA 4MFBB 4KHRA 4DUTA 4P9SA 1WDTA 3M9NB 2E7WA 2FHJD 1OQ3A 3IBWA 1K0TA 5J1EB 5IM0B 1VJQA 2NXUA 5A2QU 1VQPS 1IKVB 3OXGA 2QIFA 1ZM2A 3PO5A 5DQIA 2XZTB 1T9XA 3B54A 2VD3A 1VQNS 3I4MC 1S79A 2R2UA 4ZPTR 2J0XA 2M70A 3UR3C 2QMXA 2QYGA 3EX7B 4ZOSA 4TNOA 4TQSA 3M6WA 1WKLA 3RG6A 4KSEB 2Y0SD 4IG3A 1GQEA 4YHHJ 3D0HE 2WAQD 3FZ2A 2EKNA 2CIMA 3IMQJ 2CJQA 2JC1A 4X4NA 3K0JA 4FKYA 1RT4A 2AF6A 1K1SA 2D41A 2FJBB 5DS7A 2VUMK 3T02A 4NLYA 1MLAA 4WJ3M 3DOMB 2R7SA 1Q8KA 1IN0A 2VG5A 2RILA 2E9ZA 1HBUA 3TZZA 5DLGA 4ZVHA 2DEIA 1IKWA 3HM9A 2EBEA 3K17A 1XNQJ 2V4QA 4RLEA 2MKSA 3PO4A 4UW2A 3V6KA 1H0HB 3DRRB 1JLCA 4BBYA 3SQOP 4NXNJ 4I6AA 1WQGA 2R8HA 2GC8A 4I2QA 1TVRB 2YTCA 4E0DA 2BM0A 2Y1IA 3KK2B 1UWBB 3GTGA 3BPSP 3AOAA 4GKKJ 3KLGA 4OJ1A 3T19A 2WAQL 1HMVB 3PCOB 4C3IC 1XXCA 3PYEA 3S1MC 3MZIA 1RKIA 1X8DA 2XS5A 1EETA 4MKAA 1N33J 4KPCA 5IYCC 1KOOA 2L41A 3CULA 3MAHA 3M8RA 3J80U 2VG7A 3IR5B 3HVRA 4JV0A 4XO0A 1TR0A 1PGZA 1N36F 4F4KA 2MZQA 3MHYA 3ZTPA 3MR7A 2V8GA 5J2QB 2CPHA 2ZM6J 3THVA 2VUGA 2BJ1A 4QWBA 3DRSA 2ZBPA 2WK4A 1RWOB 2YWHA 2HQFA 3BN7A 3WX8A 1X5PA 1U8WA 1IQ0A 1JKHA 1AW0A 5B08A 2NCKL 3CDWA 1YK9A 1FESA 4C45A 3BKTA 3KHRA 4JV5J 3QATA 3H20A 1GMWA 4JI0F 3TARA 1KQSR 5FD1A 1IBLF 2WVCA 2MTLA 5IWAJ 1YJRA 1U09A 3P96A 3M8QA 2OHDA 4BBSK 2N4CA 4J9KA 1Q79A 1AROP 1YSJA 4I7FA 3KWMA 4KH0B 1R27B 4EBCA 4DUYF 2ZBCA 3I4NC 1EX8A 3K8WA 3MMBB 2Z58B 4ECQA 2L48A 1FI4A 2VJVA 2E1MC 1IKXA 2M4MA 4A3DC 4TKTA 1KQGB 1NBEB 1XWLA 1O28A 2JA8K 4DFMA 3QO9B 4P10A 3N28A 1BD6A 1FRLA 3ZTOA 2QEXS 2H4WB 3NRBA 2B4PA 2R8GA 4PUOA 1TWCC 2EFOA 2DCUB 4NX9A 3TO8A 2AYBA 3Q2TC 3I5AA 2P6TA 2YWEA 4JBCA 4YB5A 2YKPA 1JMTA 1Q0NA 2MDAA 2AGOA 4BLAA 3EE3A 1SC6A 2ASDA 2AJFE 2DNHA 2BX6A 4NCGA 4A3BK 5HLFA 4QWAA 2JA5A 4PWWA 3ZZTA 4XSXA 4FXWA 1X4CA 3RW7A 4J91A 2I38A 4O44B 3ISND 3OPKA 3MEGA 3W64A 3PR4A 5BYSA 2BE5A 4BY7C 1UVNA 2RMLA 1F1BB 3NAHA 1U6FA 4KMHA 4F0HA 2C2OB 3DLLQ 3MTKA 2CXEA 3EGNA 2H51B 3A13A 3MD1A 2K3KA 5C25B 2BRKA 1NKCA 3HOVK 1FFSB 2R8JA 4QIFA 5C44K 3SCJE 3QGGA 2RH3A 2YKOA 2Z56B 3TVKA 1U7LA 5DG8A 2AJQA 3MECB 4YR2A 4CRJA 2I9SA 1PYTA 4HH1A 4ZCMA 4TU9A 5DGBA 4ZA1A 1U6ZA 2NVXC 3U27A 1T11A 5A76A 3KNAA 3PFOA 1FK9A 2CJXB 3CXCR 2IIHA 4WK3A 4DSEA 1R43A 4GZYA 1VC0A 2KYXA 3AA9A 1R0AA 3HVTA 3P5BP 2RU9A 5DRKA 2DGOA 2VV5A 2XY6A 1LW0A 1FRKA 1RT7A 2LU1A 2F63A 4DS5A 3T01A 3IFEA 4DR2J 3DGVA 3EXYA 3MOJB 1NO8A 2JEIA 1TUGB 3CQZC 4B3SJ 2BBEA 4DPYA 4WFYA 1TMMA 1U2CA 4G7ZA 5DO2A 5DLFA 2PI5A 3CJ8A 1K1QA 4OZ5A 2QC3A 1N34F 5JVGQ 1F9NA 2I0XA 4RKUC 1RAEB 2IYIA 1VRQC 5LM7E 1FDDA 1PBUA 4G65A 4CM0A 1JX4A 1ACMB 2GCFA 3C6TA 3QT5A 4LF9F 4DFPA 4KRWA 4NLOA 4ZMMA 4KJIA 2QA4G 2B5JB 2VG6B 1ZZFA 2DXEA 4C48A 4NLVA 1GK8A 3KJVA 1HWIA 2JVRA 1RHMB 4JI5F 3BSAA 2UUWA 2Z30B 2FYXA 3UVJA 1JNZB 1IXKA 2CJAA 4IG0B 1RZMA 2APOA 3SFUA 4O0IA 3PY8A 3PYDA 3W1YC 4ICLA 2OIHA 3GFHA 1YJ9S 3M2UA 3AH6A 3G6ES 1IW7A 4P2MA 4DR1J 2FLLA 4DQPA 2CFAB 1VGXA 4CYUB 4A3KK 3AT1B 3L7PA 1IVZA 4PQUB 4U95A 1EAYC 3H2UB 2B7CB 5D6GA 1VI7A 5LXRA 3FQLA 3DLBA 2BANB 4WP9A 1SL2A 3PXGa 3N6LA 2OPSB 4C9DA 1LFPA 2JEJA 2N82B 2ASJA 5D77A 2HHVA 5KT4A 3JSMA 3R7SB 3TQ1A 2B6AB 3UD4P 4L3NA 4TY8B 4KV8B 1ZA1B 4ZIVA 3MM7B 3AA8A 2PA8D 4DV3F 3GTOK 4Y52C 3CJKA 3OHAA 4Q44A 1JQWA 4ES3A 2ZH5A 5DQHA 3VALA 2B8QA 1F2HA 3G8SA 2E2HA 2YH0A 1EQRA 2O3DA 3HZEA 5IP9K 4ID5A 3DXSX 2GJFA 4MH8A 4A3MK 1RA6A 3RZAA 2JC0A 1VRTA 3AAWB 4J37A 2HHQA 5A8KB 1XZPA 4KDDA 2XMKA 2CAJA 4ZLLA 1IBMF 1HNWJ 4LF6F 4QBUA 2WONB 4TN2A 3KMQA 3SCKE 5B0DA 1D0EA 4X62F 1QSSA 1RTIB 1DBDA 1UVIA 4HI1A 5F0WA 4DL0C 2KI2A 4BY1K 2HHXA 1Q53A 3CC2S 3C15B 3OL8A 3VAHA 4JI8F 4CLUA 2PA8L 1SFOA 2R93A 3TNVA 4PQAA 1S77D 5HMXA 3NNHA 3M2VB 2Y9HA 1ZM4A 2OELA 1MMNA 4EU0A 2B51A 3JSRA 5GMEA 3EPGA 4KASA 1P9YA 3AJDA 4BC9A 3LP2A 5HQMA 2C22A 4P2XA 4OZ1A 2XI3A 2PMZD 3QGHA 1LKZA 4CLYA 1RTHB 3N79A 4LSNB 2DVIA 1XMBA 3KJQB 4ES2A 4DSJA 2BXJA 1U25A 3HSDA 3K8VA 3F56A 2I5JB 4NLWA 3L95X 1DQ8A 1HHQA 1IWGA 4ZJQA 3A1YG 4F3QA 1XQIA 1SH0A 2MHNA 1MMDA 1JXVA 2B3TB 1YJWS 4DR6F 2QSFA 3CC4S 2CNNB 4WFAQ 1MWZA 5KG7A 5IOTA 3VAMA 4X2BA 3RR7A 1YLXA 3LAKA 5KG0A 2QLXA 4ILDA 1UAWA 1NEEA 3OTOJ 4USHA 4QIGA 3DI6B 3HHEA 2BDPA 4DG1B 1BWEA 1QTNB 2KO1A 1CPZA 4G0UA 1C2PA 5KFHA 4URQU 3AODA 3CJSA 5HROA 2R7RA 1QM9A 1A0OB 3RAQA 2HWHA 2YWKA 1QLNA 6FDRA 4BBRC 1K83C 4RU9A 3BGFA 2CG4A 2CPEA 1JXLA 1S57A 5KG2A 4DV5J 1HNVB 2JA7A 2G13A 3GIIA 3KLEB 4HT5A 2LA4A 2AKWB 1HD1A 2EW9A 5H9FJ 1AUDA 3BQ2A 4KGXB 2R9LA 3TFJA 3E2EA 4Q0BA 3S8SA 2VFTA 3JB9k 3W7BA 4ZPWR 5T14A 1H7XA 9ATCB 4HI2A 5L9NA 2K8GA 2W9BA 3BS9A 2CQIA 3A8IA 1XR5A 1RE1B 1WEYA 3GTKC 4DV2J 3H5SA 1PAEX 4RW9A 2O5DA 3CCWA 5IOSA 4NEZA 4O3SA 2QV6A 1SQFA 5K20B 1HQEB 1O5JA 2FZKB 2NZCA 4WXWA 3R5JB 3ZXWA 2DCLA 2RRBA 4F2RA 3ILOA 2LECA 4IFYA 3K59A 2B7BB 3LP1B 3DOLA 4IO9Q 1QY7A 2QO3A 1NJXA 4YMEA 4PWDA 3PRVA 4OIRA 5F8NA 3SQGB 5KFFA 3SEOA 1S1UB 4AL5A 1T05A 1Y5IB 2WCXA 4C6AA 3BO4A 1X4DA 3BGUA 2V8PA 4NOIA 3MCNA 3MUTP 4R0EA 1R31A 1X31C 3HD1A 5HI7A 2ZZTA 2ZOFA 2ZE2A 1JK9B 5ETLA 4ZJOA 3FMBA 3IRXA 3FDSA 2WB4A 3JSBA 3KLIB 3QJLA 3DXBA 4P5AA 1WORA 4RJVA 1RHKB 2J6UA 3GV5B 1DY3A 4C11B 3IR7B 1VQ7S 2F4VF 1VQMS 1RWVB 1M1KT 3H4BA 3DC2A 1SJRA 1U4BA 1O24A 1FJGF 1TKXA 1AUSL 1N6QB 2ZZNA 1FDBA 1NJIT 3GTMC 3DMJB 3DLGB 4CH0S 1WELA 1YVFA 2CFXA 1UPPA 3S1TA 1CLFA 2VQFF 4CM2A 2C2KB 3BN4A 4K50A 4R5PB 2B0GA 1U8SA 3E3XA 2HQGA 3EMTA 2Y0BB 1AB4A 1SH2A 1FX4A 3OHBA 4ES1A 3FQKA 2A3JA 1V3ZA 3QFHA 4W90B 1X9MA 1YBTA 4A3EK 2D9PA 4G3IA 1I5OB 3NOGA 3VZIA 2IMWP 1DTQA 4A8OA 2PN6A 5G0RB 3SDEB 1Q7LB 5HK4A 3HHLA 4D3GA 2ZH3A 2JA6K 2KFYA 1FRHA 4Q8FA 2DT9A 1R3NA 1QJHA 2YKQA 1O26A 2V2QA 2AEJA 3OL9A 4Z2XA 2CDQA 2XSJA 2P8IA 1J5OB 3TAMA 4WU2A 2KU7A 3OLBA 1CJTA 4LFBJ 2D9OA 1APSA 2XLJA 4RBUA 2GHVC 3G71S 2CPJA 4DCPB 1KEKA 2FLPA 1G7CB 1HNZF 5LMNJ 3UDVA 4RNHA 4EBDA 3PKYA 2FHKA 1ROFA 1WHWA 2M0GB 3N6NA 4DX6A 1CC8A 2HFOA 2W2OP 3OJUA 1M5VC 1B3TA 4C3HC 1EFWA 2NPFA 4HHHA 1HW8A 5A0YB 3MM6A 1JLBA 1Y1WC 5J2PA 5JUMA 3S15C 4TU7A 5EX3A 3RRKA 2CQDA 5LSRA 2Z57B 4KFBA 3FSYA 4F36A 5KFTA 2ZJPQ 3CVKA 3PX4A 4FYWB 4WPAA 5SUHA 5D4DA 3DN9A 5LSLA 4MQ9A 3UDEA 1TFYA 4Z7CA 5B7WA 2R92A 3FRZA 4DL2A 2PEBA 4QYRA 4OYOA 5CHPA 2FHOB 1NHUA 2ROGA 3CD6S 2CG8A 3ENVA 2N3LA 3JYTB 4O4GB 4R25A 4MKYA 4DLGA 4RW8A 4XDCA 4FXDA 1UKUA 3MF5A 1OS5A 1WSRA 2KT3A 1N5QA 1HYSA 1SIZA 4I69A 2E2IC 2IFXA 3POTA 5KG5A 4OI6A 4X64J 2GJIA 3CCTA 5EGYA 2HVIA 1TWGC 5HQLA 1RACB 2YY3A 2PGCA 5CJ9A 2CQHA 1RI7A 3PW7A 3GFXA 4KGKA 3M9MB 4G1QA 4HTJA 3T41A 2DITA 3V4IA 3D7SB 3TZYA 3LTOA 1LNQA 1BQMB 2WW8A 2XZWA 4C98A 1WTBA 4NMXA 3MUMP 3G87A 4ZN1A 2UXDF 2ATCB 2I2YA 3JSTA 4ED2A 2XWYA 4GTLA 4CO1A 2RSQA 2BQUA 1C0UB 5A8RB 1G4CA 2BEFA 3EVOA 3K5OA 5B0GA 5IP7K 1HI9A 1NMEB 2XHWA 2NPIA 4K4TA 1LWEA 1DARA 4ECYA 1D9FA 2J9EA 3GTQC 2HMIA 2W7PA 1I50K 2UXCJ 4KKOA 1FRIA 2UUTA 1UVJA 1Y4ZB 1AT1B 1RTDB 4USVA 5EGHA 4C0OC 2IYGA 2OEJA 5CHCB 4LFAF 2ZHOA 1Y3KA 4OHWA 4WILA 1S6QA 4A8XA 1X60A 3RB0A 2DTJA 4DZ6A 4HDHA 2P5MA 3MEEB 2ZOGA 3BDPA 3GTJK 3S14C 4C8YA 4ZHRA 3H0GC 2LVWA 4J3NA 4C3JC 1EQ0A 3NNAA 2MGZB 1VQ6S 5FLXY 3R1HA 1MW7A 1S1TA 4WP3A 3KHGA 2G0IA 2MKJA 1SXLA 2KRRA 1OYDA 1SKUB 1OMSA 2GAHC 3VGUA 2J7UA 5D3GA 3PFEA 1EIYB 4FF3A 3DYAB 1ZAXA 2XLKA 5BYRA 1CULA 1U26A 4ZPAA 2HBYB 2W9CA 2CZ4A 2FVSA 4OX7A 4CDIA 1AFIA 3MR3A 1TL3A 2EC0A 5DJBA 5TMFA 1VBXA 3D28A 4L73A 5T41A 2IHR1 4MIBA 4JI3F 4CO4A 1RB0A 3D1OA 3IXQA 1HBNB 2GIRA 1WWHA 4QPXA 4Q4ZA 5DG9A 1Y1VA 3W63A 3ONQA 3CIZA 4NCAA 1H72C 1JLEB 1JLAA 4LR7A 2GA7A 1QSYA 4N47A 3BGOP 3KDNA 3QLHA 1SKWA 2JL9A 2R2SA 1ZBSA 2HHWA 4RO0A 4J9PA 3M30B 3CC7S 2HHSA 4NLPA 1IR0A 2E5GA 4JI4J 1RAJA 3T1YJ 3ISZA 1JIHA 4AYBD 1D9AA 1XJWB 1Q7YT 2X3DA 4JUZA 5C4JK 4MK9A 4V19J 4UTGA 5C42B 4HDGA 2KM8B 3EVMA 1WCMK 5EUHA 2ROEA 3TEGA 3FSXA 1IJFB 2O66A 5J1PA 3DNCA 4A3FC 1WJ9A 1DAXA 3HLUA 3OBIA 1WSVA 3OFFA 1HBOB 1RT3A 3HOYC 4LIWA 3ZZOA 4KHMA 4A3LK 4UQGA 1F7VA 4I56A 1GAOA 2NUUG 1I3QC 2OLWA 4GTBA 1RAGB 2JLFA 4QOTA 3T6JA 2RUGA 5D15A 3SV3A 1M5HA 1F6TA 2OAUA 4U67Q 1RTZA 3I87A 2IM3A 2BOPA 4RUCA 1YBUA 2VPWB 3S16K 1LWFB 2VU5A 3M8SA 2KZMA 2BMBA 1CJVB 4B3MF 2IMOA 4ZLNA 4YOEA 4YB6A 4KBIA 3DRPB 3FKIK 3H42A 2Y1RI 2V8DA 3LGHA 1NHVA 4DR7J 5CYMB 2XCPA 5G4DA 3AQOA 2G2YA 4O4RA 2CQCA 3KMSA 4J9OA 2CPIA 4Q43A 1S6UA 1FA0A 1CS4B 1FDAA 4C3MA 2QL7B 3QJPA 1U1OA 3HOUC 2VOOA 3LAMA 2R42A 4B9MA 1ZM9A 2YKNB 3EICA 3O1LA 4HVZA 3QYYA 3MMJA 2FZCB 3ADAC 1RHRB 1Y5LB 4ZVEA 4DV7F 2IA6A 4GO7X 2B9XA 3EPIA 3TEHB 1QD1A 3C66A 1I6HC 4LLGA 5GAHU 5F8IA 4FZVA 1FTCA 2G1HA 5KFWA 1DTTA 2VUMA 4H4KC 1RAFB 4H4OB 1ZTTA 3RAXA 1TAQA 2JFDA 4WE1B 1RKJA 3EZUA 4PXDA 2ZUEA 4ZVPB 2V94A 1RT6B 2QA2A 5EWEA 1XMQJ 4F0MA 4KGVB 1W2IA 4KTQA 1KOHA 2DHHA 1BLUA 1V3RA 3UR0A 5IXUA 5ETPA 5FLXU 4LF5J 4K5SA 1H2UX 3IBCB 4ZCLA 2YKAA 1QAXA 4I2PA 2RF2A 1NAQA 4H4MA 2HEKA 2VASA 2QL5B 1U1RA 1V9OA 3S2DK 4RW7A 3ENWA 4OYIA 5HVHA 2D74B 4CQ1A 3T00A 4B3OA 2FZGB 3IC1A 4DUZJ 2QT7A 4H54A 3NL0A 5IC6B 2A68A 1T9WA 4DN0A 2HVHA 3PJ9A 4X66F 1YRTA 3WODA 2ATLA 1GMUA 3CD5A 4YDDB 3C2PA 2XI2A 2UVUA 3SIPB 2HHHJ 2DH7A 2VBYA 2G0CA 2C3OA 2CDRB 2AGQA 2AT1B 1SJ3P 1TWFC 1FKAF 1B64A 3KXDA 1BGXT 2P9CA 1T9VA 4DWIA 2BKPA 1X5TA 2GHPA 4B3TF 2GNKA 1S1XB 3IA0A 2GGPA 3C46A 2QJ3A 3RJMB 1F5AA 9RUBA 4OYWA 4DQRA 1YJUA 1HPZB 3B6BA 1YCLA 5KFDA 2NVYK 3ZZRA 3G8TA 1X4BA 1RWXB 3Q8VA 2MPUA 4Y6IA 4UF4A 2AYMA 2V4RA 1REVB 1H74A 3FOEA 1BQNB 2V4JB 1JLQB 4OINA 3J7AN 3SYZA 1X9SA 3IWNC 1LW2A 3BKUA 3C19A 3CD7A 1K73T 5KG4A 2BYCA 2RQKA 2MYFA 4NRTA 4F25A 1XNRF 2C2EA 1S9FA 1D8YA 4F4YA 3DOKB 4ECWA 4LRBA 4LJMA 5ITHA 2H48B 1WHVA 4GVBB 2W01A 2E2HK 4XK8C 1VJEA 4AQYJ 3VWSA 3TA2A 1MU2A 4EEYA 3GCXP 5HP1B 2ALZA 3JSYA 3MEDB 4WP8A 1XN9A 4Y0FA 1S1WB 1KLMB 3TOQA 1N5SA 4LRFA 1SL1A 2X1AA 5LL6d 4ZIWA 4JI2F 1YBAA 4W4MA 3IS9B 1WQFA 4UY85 1RTJA 2SXLA 5E2QA 3IGNA 2BOAA 2JZ5A 1UVMA 2LXFA 4CT8A 2Z8QA 2FJWA 3HOZC 1R8HA 2RKIA 4OX6A 2ILZA 1J5EF 4WU3A 4P71A 1AZSB 3DHWC 3R7BB 4Y2MA 4KO0B 4LBIA 4GMKA 1B7YB 1ZTWA 3K7AK 2IM2A 2PMHA 4LFCF 5AXLA 3LANA 4Q8EA 2AEMA 4ELTA 5KG6A 1I6VA 1S0MA 1ZPWX 1YNNA 3BPDA 1Z4UA 3EZOA 4X65F 5AE3A 3G4CA 3MDFA 3MAAB 3QPIA 3TUIC 3GJSB 3DGPA 2OFHX 5I42B 4GTAA 3CMAS 2NLWA 3OR1A 1B0VA 3N0BA 3HHNB 3V6DA 2R7ZK 4IR9A 2NVTC 2C1EB 4ELUA 4QJVB 4OJ3A 1Y1WA 2F7VA 4KHPF 3EQLA 1WC0A 4C4WA 1C1CA 3GTLC 4PAAA 2AQ4A 3O44A 3HKWA 4X6AC 4DV0F 1PILA 4JV1A 1A7GE 3PO2C 3M1VA 4ECUA 4NLXA 3QZ7A 1FVSA 5K9FA 1TK0A 3UQSA 1R0CB 4RX6A 3DLKB 2VFSA 3UE2A 5IT9Y 5I3UA 1J27A 1TVRA 3TX0A 2VPZB 4TVAB 3KK2A 1HR0J 1M0SA 2OKQA 1EH1A 3NG8A 1T3NA 2W8LA 1WG1A 2V67A 3KYLA 1UWAA 2O1PA 3Q8SB 4CO0A 4ECVA 3K2YA 4A3JK 5IOLA 1HMVA 5M2PA 3S1QK 3P4UB 3S7RA 1N4LA 1DQAA 2PEHA 1V3SA 3DHXA 1S9GB 2DR7A 2V34A 5I4MA 2DKOB 4ZKAA 3PW0A 1IWAA 1S0OA 3QT7A 1U1QA 1RP5A 3GTPC 3H5XA 1S99A 2HRUA 4K2JA 4YHHF 3BGRA 3N01A 2YU9A 3T5KA 3W2WA 2BJ3A 3OVSA 4IG3B 4QIWD 4C2MA 2V2KA 2IBKA 2XEXA 1N36J 5HAOA 4RNNA 2QA1A 1Y7PA 4UY8T 1IM6A 5E33A 3U1LA 4DS4A 4QU6A 1XXBA 4DX7A 2ZNZA 4GKJF 1YJNS 2F40A 1RT4B 4OX9F 4ED4A 3CW2C 3QNWB 1SH3A 2H9ZA 4YY3F 4P74A 1BC6A 2BJEA 4DV4F 2VG5B 5A8WA 1HBUB 3GIKA 5HO4A 5F8GA 1VCTA 3CEDA 3KLVA 1TTHB 1IKWB 2C2RA 4JI0J 4Q45A 1FD8A 4I1TA 2GZOA 2DBBA 4M5LA 4IRDA 3MFIA 1KN6A 4A4JA 1HFEL 1JLCB 3OR2A 4K4SA 3GDZA 4FN5A 2FTRA 4I2QB 1RWUA 2XMTA 2W25A 1NZAA 5T7LB 1IM4A 4DUYJ 4QQBA 1INNA 2ZH9A 4ANCA 4J9VA 2ZD1A 3K5NA 2MY8A 4G1IA 5FLMC 2YPZA 3W8PA 5KG1A 4C3LA 4O3RA 1UFKA 1HBMA 2VG7B 3GTOA 4C3IK 2ZM6F 2D69A 3S1MK 1GXTA 2UUAF 1J6WA 4CLWA 5IYCK 4IRKA 2HHTA 3GFZA 1QAIA 2J0SD 1M5SA 2M2BA 1S6OA 1R9TC 3DRSB 2DD8S 2D1CA 4LF7F 3IP0A 1ZM3A 3I9ZA 2J8AA 1NK8A 4LOWA 4FS1A 1PKUA 3ILLA 1JKHB 4I64A 1T9UA 3UCZP 5LJ5Y 1CQMA 2AHOB 2CQGA 2LXUA 1T3OA 1U6BA 2HNZA 3MM5A 1SQGA 1F0XA 3ULHA 4QW8A 2I1RA 1C0TA 3D6TB 1EP4A 1FFWB 2HVDA 1VHIA 3W62A 5DZ7A 1GH8A 3AXKA 4DPWA 3MR5A 3C16A 1WC5A 1SPBP 3K7RA 4XDDA 2BE2B 4X84A 3FKBA 3IO1A 2V9WA 5IORA 1SKSA 2C2DA 4M8LA 5LJ3Y 1OSDA 2XO7A 3I0RA 4NLDA 4P6QA 1SC3B 2EEYA 2DGQA 5DDPC 4DL6A 4I6YA 4PYDA 3TVZA 5KFYA 4A3DK 4FPRA 3S2HK 3MR6A 3A3NB 4PUOB 4NOHA 4TLRA 3U1MA 1DQ9A 4B3RF 5IT9U 3I4HX 3IPJA 3PR5B 4RWWA 3R6GB 2FY8A 3PDNA 2XB2D 1TWCK 5L1KA 1QUVA 1N52B 3QMQA 5ETSA 3E8OA 2U1AA 3ZZZA 5IS2A 1X4GA 3HO1A 4LQYA 4OJGA 2DY1A 5CZVA 2M7SA 5HLFB 2FDNA 3J81j 4OLOA 1T9YA 3CDUA 1U48A 4HACB 3OVBA 4WFBQ 1N34J 2OI2A 2BVZA 4A8SA 2VG6A 3MEGB 3MWBA 4LSZB 4YR0A 1RGVA 4MKVA 1QTMA 4K4XA 4AE5A 1B0TA 4F4WA 4LF9J 4WZMA 4EZ9A 1PJ6A 1FKPB 3G82A 2AD9A 1C4AA 3KNGA 1TUWA 1QE1A 4JI5J 4BLGA 4KN7A 4BY7K 2P9GA 1UA0A 4C8ZA 4KMAA 3WHIA 4B9NA 3S1RC 2EPIA 1B4AA 2ROPA 5JVOA 2HQIA 1S48A 2CJKA 3FCWA 1JOEA 1FK9B 5DDQC 4OX8A 1Z2ZA 2ERRA 2HWIA 1KVIA 4LMZA 1XERA 2GMHA 1T8EA 2WB1D 2V69A 1R0AB 3HVTB 2YH1A 2VBZA 2WRMA 4M1KA 3W60A 2NVXK 3O3LA 2LCWA 1LW0B 2E9TA 2IBOA 1RU1A 1ZYRA 1NPPA 3EUNA 1XR7A 3RW6A 4EO6A 4ZLJA 1U49A 3MM7A 4ZP8A 3EYZA 2JX2A 1RCOB 4LF1A 2CQ3A 1UL3A 4PXCA 2KL8A 3EDQB 1TMJA 1WOOA 4FYXB 1KVKA 3CQZK 1FERA 4ELVA 1VOMA 5CCMA 2W2PP 1Z1ZA 4NI2A 2CZVC 3R9LA 1G51A 3T1HF 2DRBA 2N7YA 4OYZA 2VFRA 3U02A 2KT2A 3KJVB 1T94A 4R8UA 3KLFA 5F0UA 2GMJA 1VBZA 4DV1F 4KMDA 1XC9A 3MPVA 4XPCA 2H3EB 3UVJB 2Z2ZA 3J81U 4PXBA 2RDIA 3FEYB 1Q5YA 5A8KA 4DSKA 2A69A 4RL1A 5H9EJ 3MM8A 3D5MA 3M2UB 1L0WA 3JTPA 4F26A 2PC6A 3RTVA 2ZITA 1IBMJ 3M6UA 2E5HA 2KM8C 3DM2B 3C15A 3BJYA 4X62J 3IRWP 3HX9A 2GSOA 2DNRA 2FPHX 2KYZA 1EI6A 3GPAA 5CA5A 4J90A 3X3UA 4JI8J 2W2NP 3M2VA 3D67A 1X0PA 4OZLA 4BLBA 5ETOA 3CUNA 3VAJA 1NK4A 3NS5A 2QTWA 2GQQA 3R1LA 3JSMB 2CW0A 1AXQA 4ZLPA 3GIJA 3GP9A 3BSCA 8AT1B 1UZHA 2Y1JA 4M5DA 3HCXA 4FBUA 4CWBA 5KFGA 2LEAA 4W92B 1TWAC 3W66A 1C0AA 3ZTSA 3HFVA 1S6PA 5HVGA 4A46A 3PRBA 2OEMA 1VQ9S 1NUEA 1UPMB 2P6SA 1EKSA 4FBTA 3MD3A 2EFPA 3J80Y 3M3YC 3R5CA 4IDKA 1FWLA 5F8MA 3PEJA 4TY9A 4Y52K 2JA6A 6AT1B 3OXFA 3KK1A 5D0EA 1XEZA 1RSCA 2HLUA 3GMGA 3I82A 4UQTA 2RD5C 2J0QD 1FXLA 1MMLA 4JI6F 1VRTB 1VQLS 1HKAA 2VKRA 3PEHA 3L9ZA 4OHVA 1XZPB 1Q5VA 4NZ6A 3WC0A 2C42A 3N9UC 4YS2A 4DR6J 5HVFA 1XR6A 4DR5F 4N8OA 1E6VB 4BC7A 3PW2A 3I5BA 3V4GA 4PG5A 3DI6A 3ZTQA 2IVFB 3MM9A 1VC5A 2GQCA 1G6BA 4K2XA 3GONA 4NA3A 2WOMB 2MLXA 3TP2A 4I67A 5JVHQ 3CJQA 3H2LA 3TZXA 3AH5A 3R5AA 3KG1A 5MLCV 3LPEA 1IR2A 3SSRA 3DLEA 2HAFA 1ZZNA 5KFRA 1AA1B 1L5UA 4CNZA 4OI3A 4DF8A 4QWCA 4WWSA 1HNVA 3RU0A 3H5UA 4EWTA 4O3QA 3KLEA 4IOAQ 2FVRA 1VK3A 3LP2B 4FYDA 4K4WA 1EKRA 3DCAA 1Q86T 4A3IC 2H1YA 5GAGU 2BUNA 4J9RA 5DQGA 3KTQA 3OUYB 4PR6A 4ZN3A 2Q66A 5F41A 2HAIA 2AJ0A 2PI4A 3S0XA 1K44A 3QIPB 2R7QA 2LQ8A 2UUBF 4LQ3A 4LSLA 2B63C 4OI0A 5EDWA 3JAMY 2E7VA 1S76D 2CQ1A 1C1BB 4YQWA 3FHZA 4Q5VA 2K06A 1EB0A 1OSCA 1FX2A 2CVIA 4QCLA 1S4FA 2DRAA 4PG8A 2L9NA 3T5LA 1P27B 1L3TA 5DM6Q 1L3SA 3C14B 2I6WA 4BHQA 2H5JB 2C3YA 5H1SV 4DCJB 1S1UA 2NXCA 3BV8A 4KAIA 5TMCA 3BM7A 5KFVA 5IT4A 5L38A 1HD0A 5J1NA 3D9BA 3D66A 4LQ9A 2V68A 3P5TL 5K5MA 3K5MA 1UVLA 2YNGA 2UZAA 3HDSA 5K8OA 5HROB 4WFXA 3MPYA 1R8CA 1G1XA 1BWVA 1U1KA 3MMLB 3B4DA 1NZ8A 2PFDA 3VF0B 3T6BA 3AD7C 2EXUA 1WKJA 4AFFA 4FDFA 4WK1A 1VQYA 2F8HA 2W24A 2N4DA 3JXOA 4BBRK 1K83K 5IFMA 4KY3A 1N6QA 4EUVA 5K8NA 1I50A 1S9EB 1KRPA 2RRAA 3MPUB 3NS6A 2DB1A 2G1DA 3TUZC 3CJ5A 4NYOA 4NXMF 4O23A 1FJGJ 2OSRA 4Q0BB 4L6V3 1X4EA 3Q24A 2IA0A 4F4AA 3TJAA 5IOQA 1KS2A 2RDJA 2BJ9A 1JJ4A 2VQFJ 1ICEB 4RW9B 1RU0A 2E5JA 4PPZA 3OL7A 3GTJA 4A8WA 4LF8F 2D3ZA 3BH7B 3GTKK 4DR3F 1YZ7A 4ZVTB 2MKYA 3NWGA 5G0RA 3SDEA 5F9NA 2COLA 3DOLB 1RDRA 3GG0A 5IQQA 1CSJA 2LQ5A 4PWDB 3QFWA 2ZZMA 1XK8A 2FJAB 2YX1A 4OHXA 1YHQS 3R8YA 1T05B 3V6HA 3AXMA 1VQSA 2EFGA 2N7CA 1NK6A 5CAAA 1F3FA 4JI7F 1YJ7A 1N8RT 4CIOA 1J5OA 1X4FA 2DNOA 4ANEA 2ZE2B 5HL7Q 4OZNA 3IRXB 4XIUA 3G96A 2HZCA 5H9FK 2VHGA 5I3PA 3ZZUA 2ZC3A 2RS2A 4OZ2A 3BQ0A 4A93C 4FVCA 2J6TA 3P45B 4FP9A 3HD2A 1FFGB 5IC4B 4CNYA 2EVZA 1LK5A 1U0SA 2QRRA 3I55S 5JXSA 2VA3A 4KT0C 3NMAA 2XULA 5BJRA 2DY9A 3D6FB 2XM3A 1HNZJ 3Q8UA 3FGVA 4RW4A 1IUJA 3H7HB 4K4VA 1FNXH 1HQMA 4M5MA 1GXUA 1W26A 4EMDA 1RWMB 4YUDA 3ET6A 2QN6B 1VQKS 4ED5A 5B0BA 1RHUB 4YDXA 2P5VA 1N54B 1TV6A 3GTMK 3GYXB 2BABA 5IV3A 3A8JA 4QWEA 2FY1A 1Q8IA 2E2JC 4Q2LA 1DFDA 4ZVUB 4UUXA 2YPYA 3IG1B 4DJBA 3TI0A 1O29A 1RWKB 1MWYA 1DTQB 3ENAA 2ZH4A 4WZQA 1WCMA 2VH7A 5KFQA 3R5BA 4O4GA 3N5BA 3CJ2A 1WUUA 1FE4A 3HHLB 8ATCB 3S17C 4KE5A 4KR0B 2DH9A 3GILA 4A3GC 1L3VA 1IE0A 1PIEA 3JAMU 1WC3A 2HW3A 2NSCA 2W8KA 1ITPA 2XSJB 1RCXB 3GJQB 3TAMB 1MROA 3VQTA 4ZP6A 4TYBA 1CJTB 3Q8YA 2RAQA 1UV7A 2W7OA 2H5EA 2HHPA 3KG0A 3MOZA 3FFIA 5D8HB 4WYLA 1UJ6A 5HBMA 2KWAA 2XYHB 1U1LA 2ZUAA 1Q95G 1FXRA 2VONA 1VLYA 3FCVA 4N8NA 4UOHA 3FKIA 1ZBTA 2UU9J 3HT3A 4K4ZA 2J6SA 4GTDA 2DRDA 2V9KA 1JLBB 2YWGA 2UXDJ 1IBKF 4C3HK 1T0TV 4KFBB 2DHXA 4RUBA 2JH3A 4HR2A 1OQ6A 2GS8A 3R7NB 1NK7A 2AV5A 2Q43A 4XSZA 1Y1WK 3MI7X 3S15K 2F9DA 1DJ0A 4DFJA 4G0WA 2NS1B 1WF2A 1RYRA 1NSPA 4ENOA 1RXOB 4OLPA 3NP5A 1RTDA 3V5RA 4QPTA 1HNXF 3NCPA 1RLCL 1Y0HA 4WF9Q 3NGSA 3GTGC 3ZO7A 2ZH8A 4FYYB 4RW8B 3D2WA 2R3VA 2IJNA 1A6LA 1OY8A 4M63A 4WKYA 5CYQA 2MB0B 4LFAJ 2J8SA 1HYSB 4CLLA 5C3EC 5HN0A 4E98A 3G86A 2LQJA 3ZC4A 4U8YA 2VICA 3POTB 5KFAA 2MGZA 2HVEA 5ETKA 3CTRA 2YNIB 2E2IK 1L3UA 3Q0AA 4F2SA 2Z2YB 5KFIA 4G1QB 2AJ2A 2RRNA 3V4IB 2M5YA 1UZDA 4L3KA 1PSDA 4CZCA 2P2CB 5KT7A 1TZ0A 2YU9K 4MAKA 1Y3JA 1UJ5A 3GLJA 4FF2A 1Y11A 4C2MK 1T03A 3C3LA 4ECXA 5FIIA 4ZP7A 2K2PA 2HNYB 1GE9A 1NB2A 4LF4F 2DNZA 3GZ7A 4FYVB 4C8MA 2HMIB 2M9KA 4K7QA 4JI3J 1JLEA 4KKOB 2RH6A 4KARA 2KH9A 1TKTA 3HOXC 5CD4A 2FQTA 4O3NA 4U7UK 4P72A 4F02A 4DR4F 3GTQK 1BUXA 1RT5A 2ZH2A 4CCHA 3CO9A 2BQ3A 1EZZB 2JSXA 4OZ3A 2NZ4A 2ZKUA 3VGSA 1RWPB 1VRUA 2IM0A 2GIQA 3KG4A 4NLUA 2I8EA 5SZTA 3VTIA 3IR6B 2NVYA 4ZHRB 7FDRA 4OHZA 2ZKTA 1KFSA 1NSAA 5KFSA 2ZH1A 1S1TB 5GAEU 4DSLA 1DRZA 2GFFA 4R0JA 1HWKA 2Y8YA 2DHSA 1W2BR 5HMZA 3H0GK 5LMUF 4C3JK 3HPOA 2E1RA 1OPZA 3PW5A 1EARA 4K5RA 3KLHA 3DXJA 4KMUA 1CJUB 5D3GB 4AL7A 3BREA 4ZS6A 2YNFA 1E6YB 3S16C 5KTQA 5J2MA 1CULB 2VC0A 4PXEA 5JFEA 3M8PB 2JA5C 2W9CB 2KFZA 3WDOA 3NNCA 1YGYA 1TL3B 1PC5A 5CYJA 3PHTA 1G2EA 5RUBA 2IJRA 4PWUA 3K58A 1HWJA 3U1NA 4USUA 3PO3C 3GYGA 4ZP9A 2E7XA 1S10A 3NGTA 5CYMA 3OL6A 1BY9A 1SKRA 4NYZA 4B3MJ 2ZBQA 2J76E 1KKHA 1J2VA 4ZPBA 3VZHA 3QLHB 2ZDPA 4IRCA 1WOPA 1TU0B 3E51A 3HXMA 3AOBA 1D8ZA 4J7CA 6FD1A 3CCQS 2MZTA 3CD0A 5DETA 2OFGX 2MZRA 2MQMA 3M32A 2L08A 3CJTA 2UV8A 5IYDC 2MZSA 3GTYX 4CO3A 1Y5NB 2R7ZA 3TANA 2KZZA 1FT8A 4DV7J 4MYTA 4HTIA 4X4VA 1RT3B 1HWLA 4X4OA 3CGIA 3N0VA 4WE1A 2HS4A 4FNIA 2MHEA 4A3FK 2IY5B 1GT8A 5GMDA 2IRUA 1UFLA 1CVJA 3RBEA 4LR8A 4U9RA 3HOYK 2HFSA 3CE8A 1I3QK 1SV5A 1IQTA 1F9HA 3NCQA 1I51B 2J7WA 5M5YK 2JLGA 2R2RA 4ZITA 4QR0A 5CQGA 3UDLA 3KJFB 5J2NA 4I0WA 1F5BA 2MJNA 3SFGA 4KPYA 1QVFR 1NCLA 3JQMA 4MYUA 2QE5A 1IS1A 3FZBA 1HNIA 2MZJA 2OO4A 5C24B 3MCMA 3PIOQ 4PRFA 2FC8A 5C2CA 4UOCA 3MR2A 2ZVIA 2VC1A 2KJVA 4M5JA 3A4TA 4OYAA 2G9OA 3NAIA 1FNMA 2OEKA 3MTJA 4LBPA 4A3CC 2HQCA 3HOUK 1D9DA 1GTHA 2MMYA 1FJEB 1IBCB 2A18A 4DX8H 3AOCA 3V6JA 4XCHA 2ZBIA 3SSQA 4A8KA 3D6MB 4CLFA 1DTTB 4NZ0A 3HSZA 4B3TJ 2ILYA 3RB3A 4G0VA 1I6HK 3HOWC 3LP0A 4B08A 3SXLA 1REVA 3IWLA 4PG7A 5KFLA 2ABYA 1LWXA 1UVKA 4KGMA 3QWUA 1FKOA 5ETVA 4Y34A 4A8FA 3O8WA 3DDIA 3RR8A 2E2HC 3CJ0A 2H65B 2EFQA 2NVQC 1HQUA 2HKEA 2YX4A 4I2PB 2RF2B 3PNIA 3VGVA 4H4MB 1UTAA 2VJUA 4QYZJ 2CPXA 1IKYA 3MMCB 1XNRJ 4RW7B 2JOQA 2AYGA 4IYQA 2RQCA 4WJBA 3EZ5A 3W65A 2D3UA 2WSFC 3DU6A 5HL8A 1S1WA 4GFQA 2HS3A 3L7UA 3PG9A 3IS9A 1S5ZA 2W4DA 5BR8F 2O5JA 3HK2A 1SFOC 2B56A 4LRAA 4JI2J 3KHLA 2R93C 3OW2R 2DPJA 5L1IA 3TZWA 4KO0A 2KVIA 4EYIB 2H4YB 1V6HA 4DL5A 3CMQA 3Q22A 1H73A 4G7HA 4YG2A 3CSKA 3AD8C 4A8YA 3A3OB 1J5EJ 1TWFK 3MMAB 3TTGA 2E1AA 4EGLA 5DDRC 1RABB 2XLIA 5L46A 2AZ3A 1H7WA 3I0SA 4LFCJ 2ADCA 1ZAWA 1N5YB 2CYYA 2JNJA 2QFIA 3N4WA 4RBTA 1KR4A 1YDLA 1VS3A 1BE4A 2R7WA 1WDDA 3TUPA 2IDEA 1K8AT 4X65J 2NXEA 4YFUA 4I4BA 4QZVB 1LW2B 5FDLA 1BHNA 5ETRA 5E5NA 4E2FB 2LKZA 2YNHA 4TXSA 2VPXB 3RZDC 4L75A 4K59A 3GG1A 3BR8A 2DJWA 4OMFG 3FBCA 2DGVA 3FUYA 1Q16B 2ACYA 2QSWA 1U2FA 2QLFB 1WI6A 4KHPJ 2F5GA 1BS2A 4AL6A 3RZOC 1SMYA 2AX1A 4GC7A 4Y7NC 3WX4A 2Y1LB 4NASA 4PG6A 2HGNA 2EFNA 1MU2B 5B0AA 1SI9A 4DV0J 5IYBC 3KHHA 1JJHA 3LPXA 3DLKA 4ZPDA 3MPWA 4Y2IA 4B9LA 2IRXA 3UCUP 5C5JA 1DLOA 1JLGA 1OPIA 4F50A 3LPYA 1RTJB 2EBGA 2VZ9A 4HHUA 4DPOA 3BYRA 3NBPA 4RU2A 5GMKa 4C0HA 2FIUA 1TWCA 1S9GA 2A10A 2V2ZA 2RKIB 4NLSA 4OIPA 2AYEA 4P2SA 3H3VL 1UEKA 1O6XA 2FVPA 2EC2A 2JA7C 3Q8QB 2BZ2A 4DU8A 1WG5A 2FGCA 2RT3A 1DURA 3HOZK 2R7UA 1YJVA 4MIWA 1F2GA 2VFUA 5KFUA 1JLFB 2RB7A 3FJ2A 4G7OA 1YTYA 2MJUA 3DGPB 4ECRA 4IH5A 3BF4A 3OR1B 5ETTA 2HWTA 5ETMA 3L09A 3VQSA 3WBZA 3V6DB 5F8JA 2YVSA 2GQ2A 3LWLA 2HYIB 4LREA 4L72B 3A8EA 1FHTA 1KBRA 1RJJA 5A6PA 2LP4A 3B4MA 2XQCA 2E5IA 4GKJJ 1C1CB 4OX9J 2NVTK 4YY3J 2W4PA 1V5IB 4DV4J 4N56A 2R8IA 2QG9B 3M1VB 4MT1A 3W2VB 1NPRA 3UW1A 3GU0A 3GTLK 1HR0F 2MEWA 2FQOA 1FEHA 1F7UA 4X6AK 1O2AA 4XAKA 3D0IE 3PO2K 2OPRA 5I3UB 4RNFA 2Y0SL 2NVXA 4WTYA 5C2GA 3BB5A 2HK2A 1ZH5A 3KK3B 2ZFZA 5T7LA 2L9DA 1XZQA 1YWXA 3RRGA 3N3YA 2C3UA 2K1RA 1NXIA 4IR1A 4BXXC 3H90A 2A6MA 2LDIA 4OFZA 3FBBA 2JJ4D 5DZ6A 4ED7A 3GEEA 3M4OC 4FNHA 3B8HA 3CQZA 2W7VA 2PFFB 3C8YA 2DHAA 3BBBA 3EM1A 3BGRB 3W2WB 3BP8C 4NLRA 5KAKA 3Q8RB 2DNGA 3BBCA 1F60B 4B9TA 1TKZA 4ED1A 2VBWA 3GTPK 3CJ3A 2UUAJ 4OV6A 3GR1A 2DGWA 3JTNA 2ZHBA 2ZWPA 5K8MA 1WTFA 2DHGA 2MQQA 3ILJA 4Z7YA 3R5DA 2J9DE 1N32F 4LF7J 4ILRA 5AXNA 1M90T 4C8NA 1UEUA 3I9V9 1H98A 2XMJA 5F8HA 2DR6A 2QA4S 3L4JA 5A8WB 1R0BG 4PABA 5MAOA 2KG1A 1FRMA 3CT9A 1F9EB 2YKMB 1URRA 1FTRA 4C0BA 4X4PA 1TAUA 1QDUB 4AT1B 1G3OA 2VB6A 3E01A 2BE2A 1Q82T 3HHLC 3RUBL 3OR2B 4BWJA 1O8BA 1RHJB 2YXLA 2WZ1A 1D1UA 1SJ4P 4AD6A 1EHWA 3H4DA 1NJWA 1LOUA 4KB2A 2RDDA 2KT5A 1PAUB 3NGDA 4X4RA 3FEXB 4E8UA 2KB2A 3S2HC 2HFVA 1HLWA 3SZYA 4N7TA 4CH1A 3CPWR 4K0KJ 2CQ0A 4Z37A 2UUCF 4JI1F 2Y3YA 5KT3A 2ZD1B 4ZPVR 2RGRA 2H5IB 3HVAA 4NLTA 3QJJA 3EGVA 3SZZA 1HBMB 1VMBA 1WD6A 1IL2A 3OFHA 1NU4A 4RBVA 2CKWA 5FLMK 1KQKA 2O5IA 4ZCIA 4CLPA 2PIIA 2NYHA 4WTOB 4B3RJ 5C4XK 3S1NC 1ZXOA 4J9MA 3J7YU 1RT1B 1ZAVA 4HACA 1I94F 5K8PA 3RGIA 4F04B 2QX0A 3KUEA 1R9TK 1LK7A 5AE1A 1FDNA 2Z2LA 3EGZA 2R92C 1UFWA 5TJ3A 2PMWA 1FWKA 4NYPA 1CEZA 2HNZB 3MM5B 2R7XA 1FKPA 3L4KA 1C0TB 1EP4B 2OPQB 1XMOF 2KVQE 4OYXA 3BEGB 1N5VA 3C16B 3F73A 4J5OA 2BE9B 1GEHA 1T02A 4UZBA 5CH7B 2BW7A 5DDOC 3M05A 2RQMA 2IVYA 2HHUA 4NL5A 2GVZA 4O3PA 3I0RB 3GFYA 3OSPA 3K5LA 4CTAA 4RW6B 3CCVS 3PTWA 2POKA 3PX6A 2KN4A 2HG4A 3GIRA 2KHCA 3MFHA 3O5TB 3H5YA 3U7JA 3CCSS 2E5LJ 1WI8A 5HQ8A 1KONA 1LEOA 1Q78A 2V50A 3KKFA 3BQ1A 4WIIA 3D54A 3NEKA 2DK2A 1MWQA 3LW5C 3D0GE 1HA1A 1OIAA 2HGMA 5AJ3F 2LYVA 2L9WA 4ER8A 2HFNA 1MN9A 4ETZA 4K4YA 2OPPB 4B17A 3C6UB 1NDKA 1N88A 2ZFHA 1FO1A 1PYOB 1KHWA 5BYQA 1H2VZ 2UXBF 3JTOA 4WFNQ 2WVFA 5JMNA 3ITHA 3N6MA 2QMUB 3R3TA 2WVEA 2XCQA 3RBXA 1PYSB 3T1HJ 5DGAA 4FKXA 1BJTA 1HWUA 1O0PA 3G82B 2KXNB 5D4PA 1WG4A 1QE1B 4FPIA 4DV1J 4BKWA 1S1VA 3BGLA 3ZZYA 2RHQB 2MLZA 3QAUA 4Y2KA 1XTZA 4IFVB 3TYTA 3P49B 4N76A 2B4UA 1DD5A 2NQPA 2AU0A 1NDPA 5HATA 2RVJA 3HVWA 3M2RA 4JP8A 3US5A 4X4UA 3OVAA 3DM2A 3LO3A 2V5HG 3BKFA 5K14A 3V81A 1N0UA 4C3KA 1K83A 3S1RK 2PPBA 1Y00A 3VCDA 1TL1A 4KGZB 3DLJA 3TAQA 1RAOA 2XWXA 3HSJA 2RJZA 5M2RA 2R7VA 1TL7A 1R8BA 3LWMA 1CJKA 4D3HA 4N77A 1WHYA 4DV6F 2BQRA 2FLOA 4JYAF 3GV8B 2IAJA 1U0HA 1X4AA 2KDOA 2JVOA 4O2DA 3GTKA 3M7VA 1S12A 5KFPA 1GXLA 4NI2B 1TQLA 3BDEA 3UD5A 3CJ4A 3OFGA 4F4XA 2FVQA 1U45A 2A6OA 4OHYA 2NYIA 2DR9A 1Y1VC 2LFVA 4R8UB 3KLFB 1SCJB 1WF0A 2XCAA 5D4NA 1M5KC 2K7KA 1YI2S 2DH8A 1SUQA 3L3CA 5LT5A 3GWCA 3BO2A 1NJYA 2AMCB 3THTA 2XCRB 1H3DA 1VBYA 2D7SA 1E6VA 1KQ4A 4JI6J 2XCOA 3DFEA 3MM8B 4ANDA 3WC2A 3O2IA 3EXCX 1LWCA 3RB6A 3T5JA 1TWHC 3FSIA 4DR5J 2GVDA 4X4TA 1FD2A 2VFVA 3G4SS 1NKEA 4IQXA 2WOMA 2KHDA 2XY5A 3OXLA 2L3MA 3IAM9 5HSPA 2J0WA 3MCOA 1S97A 4TYAA 4DDQA 3UN3A 5HJYA 4BDPA 2GW8A 1YRXA 3FBEA 3TFHA 4GT9A 3CCRS 3DU5A 3HZGA 2D3O1 4C7QA 3QAEA 2ASLA 3IWXA 3GTMA 3HFZB 1F9FA 2P9EA 4MJKA 4DHVA 5EHHA 2ZVSA 3EVWA 3PJWA 4M5DB 1H6KX 3T5HA 1HI8A 2GMLA 2XS2A 3H98A 2FJVA 2MKCA 1S6PB 1UP1A 4USMA 2KRBA 2VQEF 3OUYA 3W61A 4J9LA
chains in the Genus database with same CATH topology
3A8JA 1WSVA 5L46A 1PJ5A 4P9SA 4PABA 3GSIA 1WOPA 1XZPA 2GAGC 1PJ7A 3GIRA 1WORA 2GAHC 1WOOA 1XZPB 3GEEA 1VLOA 3TFHA 1VRQC 1WOSA 3TFJA 1PJ6A 3A8IA 3GEIA 3ADAC 3GEHA 1WSRA 1X31C 3AD8C 1V5VA 1XZQA 3TFIA 3AD7C 3A8KA 1XZQB 1YX2A 4PAAA 3TTGA 3AD9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8J A;  1WSV A;  5L46 A;  1PJ5 A;  4P9S A;  4PAB A;  3GSI A;  1WOP A;  1XZP A;  2GAG C;  1PJ7 A;  3GIR A;  1WOR A;  2GAH C;  1WOO A;  1XZP B;  3GEE A;  1VLO A;  3TFH A;  1VRQ C;  1WOS A;  3TFJ A;  1PJ6 A;  3A8I A;  3GEI A;  3ADA C;  3GEH A;  1WSR A;  1X31 C;  3AD8 C;  1V5V A;  1XZQ A;  3TFI A;  3AD7 C;  3A8K A;  1XZQ B;  1YX2 A;  4PAA A;  3TTG A;  3AD9 C; 
#chains in the Genus database with same CATH topology
 2BJ7 A;  3L7O A;  3QIP A;  3QSY B;  4Y00 A;  3P8B B;  4Y28 C;  4ZK7 M;  1TWA K;  3UNG C;  4IDK B;  2CAD A;  4DQI A;  5H9E K;  3ERE D;  2VOP A;  1C1B A;  2UUB J;  2KJW A;  4MFB A;  3KK1 B;  3CNQ P;  4TLQ A;  2CJ9 A;  3OSN A;  3VVT A;  2FJE B;  1MG7 A;  1VQ8 S;  3I31 A;  1JB0 C;  3M3Y K;  2G4B A;  5J1E A;  1RWW B;  4OQJ A;  5IM0 A;  1KTV A;  2DIS A;  1QSL A;  4G1P A;  3PJX A;  4S0M A;  3W9I A;  1IKV A;  2O67 A;  3LOU A;  2XNR A;  3C14 A;  4LVN P;  5L9X A;  5GVQ A;  4Y2A A;  3UO0 A;  2WW4 A;  4U6P A;  3FMW A;  2QL9 B;  3NGU A;  1FF2 A;  1YQH A;  3MM9 B;  2PMZ L;  3MUV P;  2IC3 B;  5IV4 A;  3CME S;  2DNM A;  2CZ9 A;  1RT2 B;  5CAB A;  4ECZ A;  2YBV A;  2CNO B;  4XTT A;  1MN7 A;  5LXY A;  3T9Z A;  1SC1 B;  1HW9 A;  3DLE B;  2VUM C;  4LUB A;  3CO0 P;  4WFZ A;  3ZFV A;  2WSC C;  5KFM A;  1UA1 A;  2UVR A;  4CLZ A;  4ED8 A;  2HND B;  3GSD A;  1Q4R A;  4EI2 A;  2QLJ B;  2C3M A;  1M5P C;  5JJB A;  5F3Z A;  3HJV A;  4UST A;  1DCH A;  4MK8 A;  3LH2 S;  5M3F K;  4RUH A;  4IH7 A;  3DOM A;  1S9E A;  3HSG A;  4KB7 A;  5IZH A;  1EK8 A;  4B02 A;  2Y3P A;  5HMY A;  1MNE A;  3HMJ G;  4GTC A;  4ILL A;  1WC1 A;  3ETM A;  4RNM A;  1GMV A;  4HHJ A;  4JOU A;  2V6S A;  2YQ0 A;  5B0C A;  1J6X A;  5M5X K;  2F8M A;  4NXM J;  1N5T A;  3P3D A;  3ORE A;  2NXJ A;  3O6Q A;  4LSL B;  1DZ5 A;  4A3I K;  1RQ0 A;  2XMW A;  3DRR A;  2K3I A;  2NXN A;  4KAW X;  2Q6C A;  3R97 A;  2V8V A;  2W7A A;  5GAD I;  4XLP A;  3JQK A;  1JWW A;  4FF1 A;  1UWB A;  3W3S A;  1QUP A;  2B63 K;  2LLZ A;  1GFW B;  3UPF A;  4YB1 P;  3R6L B;  1NH8 A;  2ZC4 A;  2IRY A;  5E3R A;  4LF8 J;  2CVE A;  4OYP A;  4QWD A;  2VBX A;  3AFG A;  1O27 A;  4BS2 A;  4DR3 J;  2E2I A;  4WJ4 A;  4PZV A;  2AGP A;  1AYE A;  1TWG A;  3CJR A;  4M95 A;  1HI1 A;  1TK8 A;  2YNG B;  1P1L A;  5J2Q A;  2EI5 A;  1R7I A;  3I4M K;  5L39 A;  4JI7 J;  3HF5 A;  3KJN B;  4DSI A;  4DBQ A;  4CLT A;  2EKY A;  5LOQ A;  2FUG 9;  1XPP A;  4J9S A;  1D09 B;  2CRL A;  3FC9 A;  4IOB A;  2RHS B;  2CPF A;  3CDE A;  3TAP A;  3G9C A;  4F4Z A;  4EK2 A;  4BBS C;  4P5B A;  1ZVU A;  3NOC A;  4KC6 A;  2KTQ A;  4ZVG A;  1XNQ F;  2WBM A;  2CPY A;  3DKD A;  5KFK A;  2LXI A;  4M5H A;  4NXN F;  3MUR P;  3GTQ A;  2XMV A;  4PKD B;  4HT7 A;  2AP6 A;  1IBL J;  2AEF A;  5L8R C;  1CC7 A;  2W1B A;  2M88 A;  2XBP A;  5I3Q A;  3LAJ A;  2E44 A;  4NE9 C;  1LXJ A;  4GKK F;  5E3Q A;  3T1A A;  3ENQ A;  2JA8 C;  1S0N A;  3NY0 A;  3MMB A;  3IG1 A;  2FB0 A;  5GAG I;  3KLG B;  3QT6 A;  1N33 F;  1FJC A;  1LQ9 A;  4PCQ A;  2F9J A;  2YWF A;  1WIH A;  5EGE A;  3QO9 A;  3VA7 A;  2HQ3 A;  1EET B;  1URN A;  3NXZ A;  3H0G A;  1S7H A;  4DN9 A;  4ITS A;  2PDA A;  2EG1 A;  3KFW X;  1V5V A;  4DXL A;  2ZUF A;  1YJT A;  2QYC A;  2A6H A;  1WC6 A;  1PJ5 A;  4A3B C;  3DRY A;  3KDO A;  4UZC A;  1HAR A;  2LMI A;  2WSE C;  3S6E A;  1EQM A;  1VYA A;  1RAH B;  1TEL A;  4MIA A;  3KOA A;  2IDL A;  3J81 Y;  4C8O A;  2JRS A;  2UV8 G;  4LR9 A;  5THW A;  2JEF A;  3BR9 A;  1ZET A;  4DSF A;  3PIP Q;  4JV5 F;  1RBL A;  4V1A k;  2ADB A;  2DEJ A;  1F93 A;  2XTJ P;  2A1B A;  4Y2C A;  4A93 K;  4O44 A;  2HZV A;  4ATN A;  2WVD A;  3Q3Q A;  4RW4 B;  2MZ1 A;  5IWA F;  2CPD A;  4YFN A;  3HOV C;  3Q8P B;  2M3D A;  1BDF A;  2WBR A;  4F3M A;  5C44 C;  3ET6 B;  1IR1 A;  3D4J A;  2GIF A;  3M8Q B;  1VGY A;  1QAJ A;  4LJZ A;  5C25 A;  1TV6 B;  4W98 A;  1IBK J;  4I7F B;  2C28 A;  2OMO A;  2JLE A;  4U96 A;  4NWB A;  1AB8 A;  1TFW A;  2E66 A;  3MEC A;  1NK0 A;  3Q89 A;  4C8L A;  4LR2 A;  5D0H A;  1IKX B;  2OP5 A;  2E2J K;  1FEE A;  3B78 A;  4UUW A;  3I4N K;  2AJ1 A;  1YKW A;  1W7W A;  3HHK A;  2V6A A;  5AXM A;  2DIU A;  3ELH A;  1HNX J;  1VIX A;  1T9T A;  4OV1 A;  3SI8 A;  1Z2L A;  2B8P A;  4ED3 A;  1HL6 A;  1RWN B;  4P2F A;  5L1L A;  3A12 A;  3S17 K;  1P9Q C;  2R4F A;  1WNE A;  1MRO B;  2AW0 A;  4A3G K;  1JQG A;  3BH6 B;  3MXH P;  4ZDN A;  1WQH A;  4KAT A;  2CNL B;  3WIU A;  2YNI A;  4LVO P;  4RR5 A;  3ZNJ 1;  2YU9 C;  1I3Q A;  1S72 S;  2WTF A;  2FJX A;  4FM9 A;  4ILM A;  4NCG B;  1RU2 A;  4CO5 A;  2Y8W A;  2UU9 F;  4C2M C;  3FFI B;  2F4F A;  4DMZ A;  1P6T A;  5HBM B;  1GX6 A;  3ISN C;  1R89 A;  1RAD B;  2F8E X;  2BKO A;  2ZBR A;  3Q86 A;  1RLD A;  2B5J A;  5EWF A;  1DCO A;  5EN1 A;  4M5K A;  2BM1 A;  2YQ1 A;  4WCE Q;  4ETX A;  3QGI A;  4I68 A;  2HNY A;  2DGU A;  2K7J A;  4IG0 A;  3NGK A;  1PC4 A;  1OWX A;  4ZPC A;  2KG0 A;  1VQ4 S;  4A3K C;  1GMW D;  4FF4 A;  2CJB A;  1T7P A;  4LF4 J;  1KP6 A;  2PA3 A;  3W5Y A;  2CQP A;  3MCS A;  2PHC B;  2W2Q P;  4USW A;  4ZCK A;  4DZD A;  3WIV A;  2CFA A;  1M1G A;  2DO4 A;  2W4C A;  2B9W A;  4CYU A;  2V8H A;  3AHP A;  4PQU A;  2XSF A;  2B4O A;  4V19 X;  1VR6 A;  2HRY A;  3QSI A;  1FVQ A;  1R8A A;  3BSN A;  3UCG A;  2A2D A;  2MQN A;  3IM8 A;  2XYP B;  4DX5 A;  3D1Q A;  2BAN A;  3FK4 A;  1NK5 A;  2P8T A;  2R7O A;  1YIT S;  4DR4 J;  2M8H A;  2U2F A;  4DR2 F;  2OPS A;  1BGW A;  5CYQ B;  1RIS A;  4B3S F;  2CPZ A;  2FD2 A;  3Q83 A;  1TK5 A;  1DHM A;  4OL8 A;  3EJM A;  3F44 A;  2JDJ A;  3GTG K;  4EZ6 A;  1RT7 B;  4M5I A;  3GTO C;  1K47 A;  2B6A A;  2DNL A;  1NLK L;  1YIJ S;  2HS0 A;  3OTE A;  4GVL A;  3D1H A;  2XMU A;  4H4K A;  3SCI E;  2ZHA A;  4TY8 A;  2BJD A;  1DCP A;  3HXA A;  4KV8 A;  1WKK A;  5C3E K;  4B9S A;  2DNN A;  4PEO A;  2DO0 A;  2C3P A;  1O25 A;  2D6F C;  1CJU A;  3CDA A;  2DR8 A;  5IP9 C;  1E6Y A;  5LMU J;  4CO2 A;  3C6T B;  3PVX A;  4A3M C;  3ICL A;  3M8P A;  4NA1 A;  4UT4 A;  4DV3 J;  3LA0 A;  3LGN A;  4IUF A;  4MKB A;  2LA6 A;  2V63 A;  3GIM A;  1SJF A;  5M2U A;  1T03 B;  5CD4 H;  4NRU A;  5EWG A;  1UET A;  4L74 A;  1R6Y A;  2ZH6 A;  2BE7 D;  3L4B C;  1U47 A;  5D4L A;  1WEZ A;  2EBB A;  4J9N A;  4OZJ A;  3HHD A;  4DR1 F;  4MEX A;  3H59 A;  4QU7 A;  2A2C A;  3M9O B;  1ELO A;  4ICL B;  4OYM A;  4BY1 C;  2E29 A;  2WON A;  3ETO A;  2VIH A;  4DCO B;  2Z0G A;  4J9U E;  1RTI A;  1TKT B;  3ZNU A;  4LF6 J;  3VGT A;  1USO A;  1HHS A;  3QT8 A;  3T9N A;  2VL1 A;  1XBW A;  2AZ1 A;  3I56 S;  1RT5 B;  3H40 A;  4RWX A;  4DFK A;  1WEX A;  2LEP A;  2CNK B;  3NCR A;  3HOX K;  1NM2 A;  1TWF A;  2F65 A;  3KUH A;  3FRY A;  1VRU B;  1LXN A;  1TWH A;  2LDY A;  4PPD A;  4NLQ A;  4Q7A A;  1NND A;  1JVI A;  2LQB A;  1IBA A;  2ASY A;  5ETQ A;  1NDL A;  2BV3 A;  5E3A A;  4KIA A;  4MMO A;  2BJ8 A;  4XLN A;  2DNQ A;  3OQ2 A;  4X4S A;  1RTH A;  4OI4 A;  2XGQ A;  2RUS A;  4LSN A;  1FWP A;  3GQC A;  5HJX A;  2QZ8 A;  3KLH B;  3G6X A;  3CJK B;  4A8Q A;  1BXN A;  2YNF B;  5J2M B;  2I5J A;  3QRP A;  3OTC A;  2DNP A;  3OPF A;  1S0V A;  2FQQ B;  4M94 A;  4DPT A;  1PG5 B;  4ID5 B;  2C2M B;  2N3O A;  1O51 A;  1XXA A;  3QBC A;  1YG0 A;  4GO5 X;  2OTL S;  2JA5 K;  2PO4 A;  3GJT B;  3H25 A;  1HNW F;  1U1P A;  1M1H A;  3EGW B;  4AYB L;  4LRC A;  3WQP A;  3GR0 A;  1ZQ1 C;  2Z2M A;  2VPY B;  4DG1 A;  1SBR A;  5HMW A;  3OFE A;  3PO3 K;  3RAM A;  1U1M A;  5C7P A;  2DNY A;  2HBZ B;  4PG4 A;  1OJ4 A;  1UCN A;  1VBK A;  4YP3 A;  3IN5 A;  2ZOM A;  5D4O A;  4KQZ A;  2UVV A;  3PX0 A;  5C24 A;  3TJ8 A;  3TJ9 A;  3HUL A;  3Q2S C;  1W25 A;  7FD1 A;  4K4U A;  2VA2 A;  3G6V A;  3BBF A;  3ZZ0 A;  3GCW P;  3M32 B;  4QIE A;  2OML A;  1B99 A;  3EWG A;  3UFC X;  1NJZ A;  2CQB A;  4Q2M A;  1UW4 A;  1TL5 A;  4WBF A;  4NEY A;  1FCA A;  1S4E A;  4ZVF A;  4OI1 A;  1Q8B A;  1ZA2 B;  1PBA A;  1H38 A;  3UWT A;  5F8L A;  2Z4P A;  1Q1K A;  2HRT A;  2HFU A;  5IYD K;  4NLG A;  4HL9 A;  2M8D B;  1HQ2 A;  2MY7 A;  1UW9 A;  2DPI A;  4CLK A;  1FJ7 A;  5GAE I;  1SV5 B;  3GTL A;  1HQE A;  2Q79 A;  1X9W A;  2Q6B A;  2XGP A;  3OTO F;  3OD2 A;  3WZ0 A;  7AT1 B;  4MEY A;  3GEH A;  3LP1 A;  1CQN A;  3MMC A;  4OIO A;  4URS A;  4UOG A;  3NWR A;  3K89 A;  5B0E A;  4DPU A;  2D3O R;  3SQG A;  1SJ1 A;  1SJQ A;  3BYP A;  3G8Q A;  5J2N B;  2FHJ A;  2JWN A;  4KB4 A;  3JS9 A;  4RZR A;  4BWM A;  1JNR B;  3G2X A;  3I5C A;  2DR5 A;  5D78 A;  1HNI B;  2QLB B;  3KLI A;  2DXF A;  1VJW A;  4DV5 F;  3NUH A;  4GRS A;  4C11 A;  3GYN A;  4Q5S A;  3G4A A;  3GTP A;  3QX3 A;  5BR8 J;  1SQE A;  3LGM A;  2B9Y A;  4X4Q A;  4ZH4 A;  4OIX A;  3UD3 P;  1KHV A;  1NB7 A;  3SBM A;  2F4V J;  1XIQ A;  3N0C A;  2XG8 A;  2UVW A;  2IPO B;  2R2T A;  5B09 A;  3DMJ A;  2NSB A;  4A3C K;  1VC6 A;  3MMA A;  1ZOT A;  3DLG A;  1M5O C;  3OJS A;  4GTF A;  4M5N A;  4RPF A;  2PD1 A;  3SV4 A;  3QRQ A;  4DV2 F;  1K0V A;  1X0F A;  1N5Y A;  2GO8 A;  4R5P A;  1KTQ A;  2W9B B;  3LP0 B;  1HHT P;  4A3E C;  4DQS A;  2MQP A;  1HIY A;  3K57 A;  3VAF A;  3MPD A;  3LQV A;  2V6T A;  3AB4 B;  2DGT A;  2BA9 A;  1FKO B;  3HOW K;  4DU7 A;  3GV7 B;  4DL7 A;  1PJ7 A;  1PO6 A;  2JA6 C;  1HQU B;  2JEG A;  1CG2 A;  4IFY B;  3CIM A;  3AJ2 A;  1IKY B;  3UN2 A;  3CCJ S;  3V4M A;  2NVQ K;  3DRX A;  1ULR A;  2XMM A;  4YB7 A;  2VKZ G;  1C4C A;  2XYG B;  3AJ1 A;  4ZVS B;  3PW4 A;  5F9L A;  1Q81 T;  3VAG A;  3M6V A;  1N56 A;  2XMA A;  4F8R A;  4YFX A;  4ED0 A;  1KNZ A;  2XNQ A;  2VDH A;  3SCL E;  2DNK A;  4A48 A;  5KT5 A;  2WVB A;  4A8M P;  1KQF B;  4U8V A;  3THP A;  2NRE A;  1SB6 A;  4UOF A;  3PV8 A;  3VAK A;  1U02 A;  3Q23 A;  4P73 A;  3QGP A;  3KUG A;  2GAG C;  3RB4 A;  3TW0 A;  4YN3 B;  1SFO K;  2YQ3 A;  1TKX B;  4ECS A;  2R93 K;  1K9M T;  5D0R A;  5A0Y A;  5KT6 A;  5D0G A;  3HFK A;  1R9T A;  2ZNY A;  3F0N A;  3NLC A;  3M8W A;  1JLF A;  3I0S B;  2RIJ A;  1I3O B;  3T3F A;  4C8K A;  4L76 A;  4OIQ A;  1BQX A;  3UN5 A;  4QYZ K;  2FHM A;  2HBR B;  4RNO A;  1WF1 A;  4ERD A;  1KLN A;  2PSZ A;  4NPO A;  5FDL B;  3IGV A;  2YNH B;  5IT0 A;  2J7K A;  4USI A;  1PCA A;  4OI2 A;  3TUJ C;  3OLA A;  2EWH A;  3W5X A;  3JYT A;  1VHF A;  3M8Z A;  4C97 A;  3RZD K;  3EDR B;  2B9E A;  3UI3 A;  1B4B A;  3I4P A;  3BO3 A;  2MKI A;  2XZD B;  3OV7 A;  3W2V A;  4RUA A;  1Y9O A;  1P8G A;  3AD9 C;  1X4H A;  1GX5 A;  1VFJ A;  2EFV A;  4DLE A;  2FGO A;  4LFB F;  4WKR A;  2A0F B;  2RNE A;  2YX7 A;  3RBD A;  2V0N A;  4ECT A;  3RZO K;  4HEA 9;  3GSI A;  2OH2 A;  4Y7N K;  5LMN F;  5E3P A;  2OGU A;  4ID8 A;  3KK3 A;  4YFK A;  4RMF A;  5E0O A;  1DLO B;  1JLG B;  3CB4 A;  5IYB K;  3TA0 A;  1OO0 B;  1YX2 A;  3QID A;  2HK3 A;  3NBP B;  2KKH A;  2J9D A;  1FE0 A;  2MLY A;  2OSQ A;  1UMJ A;  1X5S A;  3ZZP A;  2R7T A;  1KFD A;  4NA2 A;  1BQM A;  5KFC A;  2CWK A;  4KH1 B;  2VDI A;  4LIR A;  2C2N A;  2ACM A;  2PT0 A;  1R8P A;  1RBO B;  3TQE A;  5IP7 C;  3I6P A;  3MM6 B;  3X1L B;  3RRH A;  4I6W A;  2OD6 A;  3CAG A;  4EFA C;  2W9A A;  5J2P B;  3LUY A;  1I50 C;  1WOS A;  3HKZ D;  1C0U A;  3HI9 A;  5A8R A;  2ZWO A;  1U2R A;  1SVD A;  2E1P A;  1X7V A;  2JA7 K;  3AB2 B;  3J7Z 5;  4LRD A;  2B43 A;  2FLN A;  4FVM A;  4XPE A;  5E3C A;  4P7T A;  1VQ5 S;  5FJ4 A;  1ZS6 A;  2J9C A;  1TL4 A;  1ZPV A;  3IBF B;  1B7F A;  3LAL A;  3MEK A;  2V2V A;  2X1F A;  4U7U D;  2AIR B;  1J98 A;  1H2T Z;  4EYH B;  2GJ2 A;  1U24 A;  2CWX A;  3W9H A;  1NHK L;  3J7A 1;  1N32 J;  5U47 A;  2DIV A;  1KWM A;  2E1C A;  4LBH A;  3VVU A;  3GTJ C;  3D68 A;  3GJR B;  3QRR A;  2YKM A;  2GV1 A;  3D6H B;  4JV2 A;  4X64 F;  3MEE A;  1VDH A;  4IOC Q;  4DOZ A;  2B4V A;  4ZVR B;  3FOF A;  2W2M P;  4QW9 A;  3VAI A;  2AJ4 A;  1J6V A;  3HHL D;  3W5Z A;  2ZH7 A;  4FZB A;  2OPR B;  2HZA A;  2RU3 A;  4QIW L;  3HKZ L;  4MTP A;  1FNO A;  2EG2 A;  1XZQ B;  2LEB A;  4P52 A;  1IQZ A;  4DL3 A;  2K1R B;  1L3K A;  2NUH A;  2X1G A;  4KC5 A;  4IKA A;  3PKM A;  1TWG K;  2F3J A;  4TQR A;  2DGS A;  3DYA A;  3TX8 A;  1SIW B;  3CCU S;  4KN4 A;  5EX0 A;  2UUC J;  4JI1 J;  3TR5 A;  2UP1 A;  4BXX K;  5C4X C;  2EK6 A;  5AE2 A;  4M1X A;  4P75 A;  3PYG A;  4CT9 A;  1UEV A;  2GO9 A;  3M4O K;  5E7O B;  1KVJ A;  3UDC A;  8RUC A;  1TKZ B;  5M5W K;  3AY0 A;  2QGF B;  1B70 B;  1I6J A;  2UXC F;  4FXV A;  1HBN A;  2OUG A;  2RE1 A;  2OTJ S;  1LWE B;  1RT1 A;  3FCH A;  1TP7 A;  1RBA A;  3R5G A;  4Y3C A;  3H0P A;  1VQO S;  3OEP A;  3GB0 A;  2WHO A;  1YNJ A;  1VK8 A;  2JFK A;  1IJE B;  2ZDO A;  1O2B A;  1T95 A;  2VF3 A;  1I94 J;  5E41 A;  1REG X;  3BUE A;  2E9R X;  2MKH A;  1RUS A;  3M30 A;  5C4J C;  3SZ2 A;  2X7I A;  1KC8 T;  1WAC A;  3FBF A;  2MKK A;  2OPQ A;  5KFJ A;  1WCM C;  3CCE S;  1S6Q B;  4NZ7 A;  3TFI A;  1FXD A;  1JJ2 R;  2IVM A;  3J7Z T;  3E01 B;  1GTE A;  1XMO J;  2IJF A;  5C42 A;  2XS7 A;  4QR2 A;  3FVY A;  4A3L C;  1RA7 A;  4K0K F;  4AUK A;  3TRG A;  1WHX A;  1B0P A;  3NGR A;  4ZJL A;  4RW6 A;  2HQD A;  1HBO A;  2EK1 A;  3S14 K;  2AWZ A;  4YEA A;  4F0K A;  3RYL A;  1RHQ B;  4ALZ A;  4K8R A;  3CCL S;  4HYK A;  3NMR A;  2G2Z A;  3HT0 A;  5FJ8 K;  3CF5 Q;  3VV2 B;  2OJ3 A;  1NPK A;  2CQ4 A;  4DQQ A;  5KFE A;  2CUY A;  1AFJ A;  1TWA A;  3FKI C;  3LF0 A;  2BRL A;  1NH7 A;  1LWF A;  2A6E A;  4TU8 A;  2XO6 A;  4LK0 A;  5KOX A;  4LF2 A;  3G6Y A;  3QWP A;  1VIO A;  1CJV A;  4O3O A;  4DF4 A;  4IH6 A;  5AJ3 J;  4FS2 A;  3NKY A;  4DDF A;  2OPP A;  3DRP A;  3C6U A;  2GX8 A;  4WXO A;  2BAC A;  2JHE A;  2HBQ B;  1NK9 A;  3W9J A;  1JLA B;  3S1N K;  5E68 A;  1S49 A;  4G6V B;  4JI4 F;  1CS4 A;  4DPX A;  3F41 A;  1RAI B;  3T1Y F;  2UXB J;  3RBZ A;  2FVC A;  5KFN A;  2DYA A;  3OTB A;  2G0J A;  1QAY A;  5ADZ A;  1F5C A;  1OYE A;  1JJC B;  2R92 K;  2YKN A;  4USK A;  3LAP A;  4MK7 A;  2HVZ A;  2Q3P A;  1JXE A;  4F67 A;  4IFV A;  4O0N A;  4WIQ A;  2FJD B;  3MAQ A;  3OT9 A;  3DLH A;  2BKN A;  3GE9 A;  3CWJ A;  1NDC A;  2GVZ B;  3PAC A;  2LU2 A;  3V2U C;  5AT1 B;  4CTA B;  2V6U A;  2E5L F;  3CCM S;  4H4O A;  2QLW A;  2NR0 A;  3D3C J;  3I32 A;  1ZYQ A;  2R8K A;  2X51 A;  4GTE A;  1LV5 A;  1RT6 A;  2HLT A;  5CXT A;  3OTD A;  4CH7 A;  3PRD A;  1MSW D;  4JK1 A;  3HP6 A;  1CBK A;  2PE8 A;  5KG3 A;  1VLO A;  1RAA B;  2MSS A;  2M52 A;  1HI0 P;  2ZJR Q;  1F3V A;  4F3O A;  4DL4 A;  3S2D C;  3H2V E;  1USM A;  2ZJQ Q;  4DR7 F;  3CDB A;  2IM1 A;  1KDN A;  5A2Q Y;  1SL0 A;  5F3T A;  2ZUG A;  3B82 A;  4KM9 A;  5KT2 A;  4DV6 J;  2B63 A;  3QQC D;  4JYA J;  1OY9 A;  2MQ8 A;  4AXI A;  2AX0 A;  2HSE B;  3ZTR A;  4DI6 A;  4IQM A;  4ZVQ B;  2ZEJ A;  3PM9 A;  3ITH B;  4F7V A;  3H8Y A;  3AQP A;  4J9Q A;  4EO8 A;  4GC6 A;  1VIS A;  2XHC A;  5LSO A;  4N5S A;  3R27 A;  3M4X A;  2X1B A;  2HPU A;  1YRU A;  3IAS 9;  1KD1 T;  4X66 J;  1NSQ A;  2BR0 A;  3J7Y I;  2WB1 L;  1S1V B;  2Q1L A;  2FC9 A;  1NKB A;  4ZVO B;  3N5F A;  5BXI A;  2CQ2 A;  2XC9 A;  2BW2 A;  2J5A A;  5AXK A;  2RQ4 A;  2NVY C;  4EBE A;  1Q8L A;  4YR3 A;  3M2R B;  1S1X A;  4U7C A;  5K14 B;  3V81 B;  1HPZ A;  3W8G A;  3JQJ A;  2HIQ A;  2CJY B;  3A8K A;  4P7V A;  1XMQ F;  4LK1 A;  4URG A;  1OY6 A;  1TL1 B;  2GSN A;  2OD4 A;  5DM7 Q;  3ILI A;  1NRK A;  1EJ7 L;  4LF5 F;  1BQN A;  2V4J A;  4IO1 A;  1JLQ A;  2GSU A;  2VOD A;  2H54 B;  1TL7 B;  2XY7 A;  3DDK A;  3DDN A;  5KFZ A;  1B4S A;  2MQO A;  1CJK B;  5GAD U;  2QMW A;  4KM8 A;  3A3P B;  2CA9 A;  3BZQ A;  5ETN A;  2DXD A;  2IAJ B;  1U0H B;  3DOK A;  3GEI A;  1N0V C;  4DUZ F;  4NML A;  4GVB A;  3FEZ A;  2KXF A;  1X5O A;  5A6W A;  1RYS A;  4B3O B;  3M8Y A;  4OYB A;  4B9U A;  2F1F A;  2VQE J;  5HP1 A;  4HKQ A;  4KYZ A;  4CP5 A;  4M5G A;  3MED A;  2HGL A;  2C2Z B;  4LT6 A;  1YZ6 A;  1KLM A;  3PZP A;  5KFX A;  3CCZ A;  4CI0 B;  3PYF A;  2HHH F;  4NCB A;  3R2D J;  3NS7 B;  1GNK A;  5B0F A;  1QVG R;  3UNY A;  1VH2 A;  1R6V A;  1NSK L;  1SUQ B;  1S7I A;  4PYA A;  1Y1V K;  2RS8 A;  3MGJ A;  2HUR A;  4CLS A;  3K7A C;  2G2O A;  4Y65 A;  1LWC B;  2GHW A;  1O2F B;  1AZS A;  2LQ9 A;  3SMZ A;  1N48 A;  4N41 A;  2GVD B;  4AH6 A;  5DG7 A;  3PHE A;  3HJF A;  1FRJ A;  2IC3 A;  2MXY A;  1RK8 A;  1RT2 A;  5KFO A;  2GGP B;  4QR1 A;  4ED6 A;  3VHQ A;  3TVY A;  1UJ4 A;  3TA1 A;  1TWH K;  1P1T A;  4HH0 A;  4A47 A;  3IM9 A;  2R7Z C;  1D3W A;  1BMQ B;  1I1G A;  5KFB A;  4HLB A;  1U1N A;  3MAA A;  4OZ0 A;  3BSO A;  3SSS A;  5I42 A;  4B9V A;  3TWZ A;  2QFJ A;  2HND A;  2YWW A;  1WC4 A;  3FNN A;  2HIY A;  3I96 A;  4DEZ A;  3M6X A;  3QZ8 A;  3R2C J;  2KXH A;  3H3V D;  2KFN A;  2ALY B;  3BP3 A;  4AXJ A;  5M3M K;  1LFW A;  4QJV A;  2O01 C;  5CCL A;  5GAH I;  4QIV A;  5KOW A;  3D3B J;  1SC4 B;  1S59 A;  3K5P A;  4AQY F;  1Y10 A;  4WYW A;  2X3G A;  5IQ6 A;  4USJ C;  2MQL A;  3P6Y C;  1KSP A;  4BCA A;  1TUV A;  2MST A;  5L1J A;  1ISE A;  5HAN A;  4A3J C;  4JB8 B;  4OJH A;  2DGX A;  1FRX A;  5CZX A;  1A9N B;  3S1Q C;  3VR1 A;  1TKD A;  3S01 A;  2HFZ A;  4MFB B;  4KHR A;  4DUT A;  4P9S A;  1WDT A;  3M9N B;  2E7W A;  2FHJ D;  1OQ3 A;  3IBW A;  1K0T A;  5J1E B;  5IM0 B;  1VJQ A;  2NXU A;  5A2Q U;  1VQP S;  1IKV B;  3OXG A;  2QIF A;  1ZM2 A;  3PO5 A;  5DQI A;  2XZT B;  1T9X A;  3B54 A;  2VD3 A;  1VQN S;  3I4M C;  1S79 A;  2R2U A;  4ZPT R;  2J0X A;  2M70 A;  3UR3 C;  2QMX A;  2QYG A;  3EX7 B;  4ZOS A;  4TNO A;  4TQS A;  3M6W A;  1WKL A;  3RG6 A;  4KSE B;  2Y0S D;  4IG3 A;  1GQE A;  4YHH J;  3D0H E;  2WAQ D;  3FZ2 A;  2EKN A;  2CIM A;  3IMQ J;  2CJQ A;  2JC1 A;  4X4N A;  3K0J A;  4FKY A;  1RT4 A;  2AF6 A;  1K1S A;  2D41 A;  2FJB B;  5DS7 A;  2VUM K;  3T02 A;  4NLY A;  1MLA A;  4WJ3 M;  3DOM B;  2R7S A;  1Q8K A;  1IN0 A;  2VG5 A;  2RIL A;  2E9Z A;  1HBU A;  3TZZ A;  5DLG A;  4ZVH A;  2DEI A;  1IKW A;  3HM9 A;  2EBE A;  3K17 A;  1XNQ J;  2V4Q A;  4RLE A;  2MKS A;  3PO4 A;  4UW2 A;  3V6K A;  1H0H B;  3DRR B;  1JLC A;  4BBY A;  3SQO P;  4NXN J;  4I6A A;  1WQG A;  2R8H A;  2GC8 A;  4I2Q A;  1TVR B;  2YTC A;  4E0D A;  2BM0 A;  2Y1I A;  3KK2 B;  1UWB B;  3GTG A;  3BPS P;  3AOA A;  4GKK J;  3KLG A;  4OJ1 A;  3T19 A;  2WAQ L;  1HMV B;  3PCO B;  4C3I C;  1XXC A;  3PYE A;  3S1M C;  3MZI A;  1RKI A;  1X8D A;  2XS5 A;  1EET A;  4MKA A;  1N33 J;  4KPC A;  5IYC C;  1KOO A;  2L41 A;  3CUL A;  3MAH A;  3M8R A;  3J80 U;  2VG7 A;  3IR5 B;  3HVR A;  4JV0 A;  4XO0 A;  1TR0 A;  1PGZ A;  1N36 F;  4F4K A;  2MZQ A;  3MHY A;  3ZTP A;  3MR7 A;  2V8G A;  5J2Q B;  2CPH A;  2ZM6 J;  3THV A;  2VUG A;  2BJ1 A;  4QWB A;  3DRS A;  2ZBP A;  2WK4 A;  1RWO B;  2YWH A;  2HQF A;  3BN7 A;  3WX8 A;  1X5P A;  1U8W A;  1IQ0 A;  1JKH A;  1AW0 A;  5B08 A;  2NCK L;  3CDW A;  1YK9 A;  1FES A;  4C45 A;  3BKT A;  3KHR A;  4JV5 J;  3QAT A;  3H20 A;  1GMW A;  4JI0 F;  3TAR A;  1KQS R;  5FD1 A;  1IBL F;  2WVC A;  2MTL A;  5IWA J;  1YJR A;  1U09 A;  3P96 A;  3M8Q A;  2OHD A;  4BBS K;  2N4C A;  4J9K A;  1Q79 A;  1ARO P;  1YSJ A;  4I7F A;  3KWM A;  4KH0 B;  1R27 B;  4EBC A;  4DUY F;  2ZBC A;  3I4N C;  1EX8 A;  3K8W A;  3MMB B;  2Z58 B;  4ECQ A;  2L48 A;  1FI4 A;  2VJV A;  2E1M C;  1IKX A;  2M4M A;  4A3D C;  4TKT A;  1KQG B;  1NBE B;  1XWL A;  1O28 A;  2JA8 K;  4DFM A;  3QO9 B;  4P10 A;  3N28 A;  1BD6 A;  1FRL A;  3ZTO A;  2QEX S;  2H4W B;  3NRB A;  2B4P A;  2R8G A;  4PUO A;  1TWC C;  2EFO A;  2DCU B;  4NX9 A;  3TO8 A;  2AYB A;  3Q2T C;  3I5A A;  2P6T A;  2YWE A;  4JBC A;  4YB5 A;  2YKP A;  1JMT A;  1Q0N A;  2MDA A;  2AGO A;  4BLA A;  3EE3 A;  1SC6 A;  2ASD A;  2AJF E;  2DNH A;  2BX6 A;  4NCG A;  4A3B K;  5HLF A;  4QWA A;  2JA5 A;  4PWW A;  3ZZT A;  4XSX A;  4FXW A;  1X4C A;  3RW7 A;  4J91 A;  2I38 A;  4O44 B;  3ISN D;  3OPK A;  3MEG A;  3W64 A;  3PR4 A;  5BYS A;  2BE5 A;  4BY7 C;  1UVN A;  2RML A;  1F1B B;  3NAH A;  1U6F A;  4KMH A;  4F0H A;  2C2O B;  3DLL Q;  3MTK A;  2CXE A;  3EGN A;  2H51 B;  3A13 A;  3MD1 A;  2K3K A;  5C25 B;  2BRK A;  1NKC A;  3HOV K;  1FFS B;  2R8J A;  4QIF A;  5C44 K;  3SCJ E;  3QGG A;  2RH3 A;  2YKO A;  2Z56 B;  3TVK A;  1U7L A;  5DG8 A;  2AJQ A;  3MEC B;  4YR2 A;  4CRJ A;  2I9S A;  1PYT A;  4HH1 A;  4ZCM A;  4TU9 A;  5DGB A;  4ZA1 A;  1U6Z A;  2NVX C;  3U27 A;  1T11 A;  5A76 A;  3KNA A;  3PFO A;  1FK9 A;  2CJX B;  3CXC R;  2IIH A;  4WK3 A;  4DSE A;  1R43 A;  4GZY A;  1VC0 A;  2KYX A;  3AA9 A;  1R0A A;  3HVT A;  3P5B P;  2RU9 A;  5DRK A;  2DGO A;  2VV5 A;  2XY6 A;  1LW0 A;  1FRK A;  1RT7 A;  2LU1 A;  2F63 A;  4DS5 A;  3T01 A;  3IFE A;  4DR2 J;  3DGV A;  3EXY A;  3MOJ B;  1NO8 A;  2JEI A;  1TUG B;  3CQZ C;  4B3S J;  2BBE A;  4DPY A;  4WFY A;  1TMM A;  1U2C A;  4G7Z A;  5DO2 A;  5DLF A;  2PI5 A;  3CJ8 A;  1K1Q A;  4OZ5 A;  2QC3 A;  1N34 F;  5JVG Q;  1F9N A;  2I0X A;  4RKU C;  1RAE B;  2IYI A;  1VRQ C;  5LM7 E;  1FDD A;  1PBU A;  4G65 A;  4CM0 A;  1JX4 A;  1ACM B;  2GCF A;  3C6T A;  3QT5 A;  4LF9 F;  4DFP A;  4KRW A;  4NLO A;  4ZMM A;  4KJI A;  2QA4 G;  2B5J B;  2VG6 B;  1ZZF A;  2DXE A;  4C48 A;  4NLV A;  1GK8 A;  3KJV A;  1HWI A;  2JVR A;  1RHM B;  4JI5 F;  3BSA A;  2UUW A;  2Z30 B;  2FYX A;  3UVJ A;  1JNZ B;  1IXK A;  2CJA A;  4IG0 B;  1RZM A;  2APO A;  3SFU A;  4O0I A;  3PY8 A;  3PYD A;  3W1Y C;  4ICL A;  2OIH A;  3GFH A;  1YJ9 S;  3M2U A;  3AH6 A;  3G6E S;  1IW7 A;  4P2M A;  4DR1 J;  2FLL A;  4DQP A;  2CFA B;  1VGX A;  4CYU B;  4A3K K;  3AT1 B;  3L7P A;  1IVZ A;  4PQU B;  4U95 A;  1EAY C;  3H2U B;  2B7C B;  5D6G A;  1VI7 A;  5LXR A;  3FQL A;  3DLB A;  2BAN B;  4WP9 A;  1SL2 A;  3PXG a;  3N6L A;  2OPS B;  4C9D A;  1LFP A;  2JEJ A;  2N82 B;  2ASJ A;  5D77 A;  2HHV A;  5KT4 A;  3JSM A;  3R7S B;  3TQ1 A;  2B6A B;  3UD4 P;  4L3N A;  4TY8 B;  4KV8 B;  1ZA1 B;  4ZIV A;  3MM7 B;  3AA8 A;  2PA8 D;  4DV3 F;  3GTO K;  4Y52 C;  3CJK A;  3OHA A;  4Q44 A;  1JQW A;  4ES3 A;  2ZH5 A;  5DQH A;  3VAL A;  2B8Q A;  1F2H A;  3G8S A;  2E2H A;  2YH0 A;  1EQR A;  2O3D A;  3HZE A;  5IP9 K;  4ID5 A;  3DXS X;  2GJF A;  4MH8 A;  4A3M K;  1RA6 A;  3RZA A;  2JC0 A;  1VRT A;  3AAW B;  4J37 A;  2HHQ A;  5A8K B;  1XZP A;  4KDD A;  2XMK A;  2CAJ A;  4ZLL A;  1IBM F;  1HNW J;  4LF6 F;  4QBU A;  2WON B;  4TN2 A;  3KMQ A;  3SCK E;  5B0D A;  1D0E A;  4X62 F;  1QSS A;  1RTI B;  1DBD A;  1UVI A;  4HI1 A;  5F0W A;  4DL0 C;  2KI2 A;  4BY1 K;  2HHX A;  1Q53 A;  3CC2 S;  3C15 B;  3OL8 A;  3VAH A;  4JI8 F;  4CLU A;  2PA8 L;  1SFO A;  2R93 A;  3TNV A;  4PQA A;  1S77 D;  5HMX A;  3NNH A;  3M2V B;  2Y9H A;  1ZM4 A;  2OEL A;  1MMN A;  4EU0 A;  2B51 A;  3JSR A;  5GME A;  3EPG A;  4KAS A;  1P9Y A;  3AJD A;  4BC9 A;  3LP2 A;  5HQM A;  2C22 A;  4P2X A;  4OZ1 A;  2XI3 A;  2PMZ D;  3QGH A;  1LKZ A;  4CLY A;  1RTH B;  3N79 A;  4LSN B;  2DVI A;  1XMB A;  3KJQ B;  4ES2 A;  4DSJ A;  2BXJ A;  1U25 A;  3HSD A;  3K8V A;  3F56 A;  2I5J B;  4NLW A;  3L95 X;  1DQ8 A;  1HHQ A;  1IWG A;  4ZJQ A;  3A1Y G;  4F3Q A;  1XQI A;  1SH0 A;  2MHN A;  1MMD A;  1JXV A;  2B3T B;  1YJW S;  4DR6 F;  2QSF A;  3CC4 S;  2CNN B;  4WFA Q;  1MWZ A;  5KG7 A;  5IOT A;  3VAM A;  4X2B A;  3RR7 A;  1YLX A;  3LAK A;  5KG0 A;  2QLX A;  4ILD A;  1UAW A;  1NEE A;  3OTO J;  4USH A;  4QIG A;  3DI6 B;  3HHE A;  2BDP A;  4DG1 B;  1BWE A;  1QTN B;  2KO1 A;  1CPZ A;  4G0U A;  1C2P A;  5KFH A;  4URQ U;  3AOD A;  3CJS A;  5HRO A;  2R7R A;  1QM9 A;  1A0O B;  3RAQ A;  2HWH A;  2YWK A;  1QLN A;  6FDR A;  4BBR C;  1K83 C;  4RU9 A;  3BGF A;  2CG4 A;  2CPE A;  1JXL A;  1S57 A;  5KG2 A;  4DV5 J;  1HNV B;  2JA7 A;  2G13 A;  3GII A;  3KLE B;  4HT5 A;  2LA4 A;  2AKW B;  1HD1 A;  2EW9 A;  5H9F J;  1AUD A;  3BQ2 A;  4KGX B;  2R9L A;  3TFJ A;  3E2E A;  4Q0B A;  3S8S A;  2VFT A;  3JB9 k;  3W7B A;  4ZPW R;  5T14 A;  1H7X A;  9ATC B;  4HI2 A;  5L9N A;  2K8G A;  2W9B A;  3BS9 A;  2CQI A;  3A8I A;  1XR5 A;  1RE1 B;  1WEY A;  3GTK C;  4DV2 J;  3H5S A;  1PAE X;  4RW9 A;  2O5D A;  3CCW A;  5IOS A;  4NEZ A;  4O3S A;  2QV6 A;  1SQF A;  5K20 B;  1HQE B;  1O5J A;  2FZK B;  2NZC A;  4WXW A;  3R5J B;  3ZXW A;  2DCL A;  2RRB A;  4F2R A;  3ILO A;  2LEC A;  4IFY A;  3K59 A;  2B7B B;  3LP1 B;  3DOL A;  4IO9 Q;  1QY7 A;  2QO3 A;  1NJX A;  4YME A;  4PWD A;  3PRV A;  4OIR A;  5F8N A;  3SQG B;  5KFF A;  3SEO A;  1S1U B;  4AL5 A;  1T05 A;  1Y5I B;  2WCX A;  4C6A A;  3BO4 A;  1X4D A;  3BGU A;  2V8P A;  4NOI A;  3MCN A;  3MUT P;  4R0E A;  1R31 A;  1X31 C;  3HD1 A;  5HI7 A;  2ZZT A;  2ZOF A;  2ZE2 A;  1JK9 B;  5ETL A;  4ZJO A;  3FMB A;  3IRX A;  3FDS A;  2WB4 A;  3JSB A;  3KLI B;  3QJL A;  3DXB A;  4P5A A;  1WOR A;  4RJV A;  1RHK B;  2J6U A;  3GV5 B;  1DY3 A;  4C11 B;  3IR7 B;  1VQ7 S;  2F4V F;  1VQM S;  1RWV B;  1M1K T;  3H4B A;  3DC2 A;  1SJR A;  1U4B A;  1O24 A;  1FJG F;  1TKX A;  1AUS L;  1N6Q B;  2ZZN A;  1FDB A;  1NJI T;  3GTM C;  3DMJ B;  3DLG B;  4CH0 S;  1WEL A;  1YVF A;  2CFX A;  1UPP A;  3S1T A;  1CLF A;  2VQF F;  4CM2 A;  2C2K B;  3BN4 A;  4K50 A;  4R5P B;  2B0G A;  1U8S A;  3E3X A;  2HQG A;  3EMT A;  2Y0B B;  1AB4 A;  1SH2 A;  1FX4 A;  3OHB A;  4ES1 A;  3FQK A;  2A3J A;  1V3Z A;  3QFH A;  4W90 B;  1X9M A;  1YBT A;  4A3E K;  2D9P A;  4G3I A;  1I5O B;  3NOG A;  3VZI A;  2IMW P;  1DTQ A;  4A8O A;  2PN6 A;  5G0R B;  3SDE B;  1Q7L B;  5HK4 A;  3HHL A;  4D3G A;  2ZH3 A;  2JA6 K;  2KFY A;  1FRH A;  4Q8F A;  2DT9 A;  1R3N A;  1QJH A;  2YKQ A;  1O26 A;  2V2Q A;  2AEJ A;  3OL9 A;  4Z2X A;  2CDQ A;  2XSJ A;  2P8I A;  1J5O B;  3TAM A;  4WU2 A;  2KU7 A;  3OLB A;  1CJT A;  4LFB J;  2D9O A;  1APS A;  2XLJ A;  4RBU A;  2GHV C;  3G71 S;  2CPJ A;  4DCP B;  1KEK A;  2FLP A;  1G7C B;  1HNZ F;  5LMN J;  3UDV A;  4RNH A;  4EBD A;  3PKY A;  2FHK A;  1ROF A;  1WHW A;  2M0G B;  3N6N A;  4DX6 A;  1CC8 A;  2HFO A;  2W2O P;  3OJU A;  1M5V C;  1B3T A;  4C3H C;  1EFW A;  2NPF A;  4HHH A;  1HW8 A;  5A0Y B;  3MM6 A;  1JLB A;  1Y1W C;  5J2P A;  5JUM A;  3S15 C;  4TU7 A;  5EX3 A;  3RRK A;  2CQD A;  5LSR A;  2Z57 B;  4KFB A;  3FSY A;  4F36 A;  5KFT A;  2ZJP Q;  3CVK A;  3PX4 A;  4FYW B;  4WPA A;  5SUH A;  5D4D A;  3DN9 A;  5LSL A;  4MQ9 A;  3UDE A;  1TFY A;  4Z7C A;  5B7W A;  2R92 A;  3FRZ A;  4DL2 A;  2PEB A;  4QYR A;  4OYO A;  5CHP A;  2FHO B;  1NHU A;  2ROG A;  3CD6 S;  2CG8 A;  3ENV A;  2N3L A;  3JYT B;  4O4G B;  4R25 A;  4MKY A;  4DLG A;  4RW8 A;  4XDC A;  4FXD A;  1UKU A;  3MF5 A;  1OS5 A;  1WSR A;  2KT3 A;  1N5Q A;  1HYS A;  1SIZ A;  4I69 A;  2E2I C;  2IFX A;  3POT A;  5KG5 A;  4OI6 A;  4X64 J;  2GJI A;  3CCT A;  5EGY A;  2HVI A;  1TWG C;  5HQL A;  1RAC B;  2YY3 A;  2PGC A;  5CJ9 A;  2CQH A;  1RI7 A;  3PW7 A;  3GFX A;  4KGK A;  3M9M B;  4G1Q A;  4HTJ A;  3T41 A;  2DIT A;  3V4I A;  3D7S B;  3TZY A;  3LTO A;  1LNQ A;  1BQM B;  2WW8 A;  2XZW A;  4C98 A;  1WTB A;  4NMX A;  3MUM P;  3G87 A;  4ZN1 A;  2UXD F;  2ATC B;  2I2Y A;  3JST A;  4ED2 A;  2XWY A;  4GTL A;  4CO1 A;  2RSQ A;  2BQU A;  1C0U B;  5A8R B;  1G4C A;  2BEF A;  3EVO A;  3K5O A;  5B0G A;  5IP7 K;  1HI9 A;  1NME B;  2XHW A;  2NPI A;  4K4T A;  1LWE A;  1DAR A;  4ECY A;  1D9F A;  2J9E A;  3GTQ C;  2HMI A;  2W7P A;  1I50 K;  2UXC J;  4KKO A;  1FRI A;  2UUT A;  1UVJ A;  1Y4Z B;  1AT1 B;  1RTD B;  4USV A;  5EGH A;  4C0O C;  2IYG A;  2OEJ A;  5CHC B;  4LFA F;  2ZHO A;  1Y3K A;  4OHW A;  4WIL A;  1S6Q A;  4A8X A;  1X60 A;  3RB0 A;  2DTJ A;  4DZ6 A;  4HDH A;  2P5M A;  3MEE B;  2ZOG A;  3BDP A;  3GTJ K;  3S14 C;  4C8Y A;  4ZHR A;  3H0G C;  2LVW A;  4J3N A;  4C3J C;  1EQ0 A;  3NNA A;  2MGZ B;  1VQ6 S;  5FLX Y;  3R1H A;  1MW7 A;  1S1T A;  4WP3 A;  3KHG A;  2G0I A;  2MKJ A;  1SXL A;  2KRR A;  1OYD A;  1SKU B;  1OMS A;  2GAH C;  3VGU A;  2J7U A;  5D3G A;  3PFE A;  1EIY B;  4FF3 A;  3DYA B;  1ZAX A;  2XLK A;  5BYR A;  1CUL A;  1U26 A;  4ZPA A;  2HBY B;  2W9C A;  2CZ4 A;  2FVS A;  4OX7 A;  4CDI A;  1AFI A;  3MR3 A;  1TL3 A;  2EC0 A;  5DJB A;  5TMF A;  1VBX A;  3D28 A;  4L73 A;  5T41 A;  2IHR 1;  4MIB A;  4JI3 F;  4CO4 A;  1RB0 A;  3D1O A;  3IXQ A;  1HBN B;  2GIR A;  1WWH A;  4QPX A;  4Q4Z A;  5DG9 A;  1Y1V A;  3W63 A;  3ONQ A;  3CIZ A;  4NCA A;  1H72 C;  1JLE B;  1JLA A;  4LR7 A;  2GA7 A;  1QSY A;  4N47 A;  3BGO P;  3KDN A;  3QLH A;  1SKW A;  2JL9 A;  2R2S A;  1ZBS A;  2HHW A;  4RO0 A;  4J9P A;  3M30 B;  3CC7 S;  2HHS A;  4NLP A;  1IR0 A;  2E5G A;  4JI4 J;  1RAJ A;  3T1Y J;  3ISZ A;  1JIH A;  4AYB D;  1D9A A;  1XJW B;  1Q7Y T;  2X3D A;  4JUZ A;  5C4J K;  4MK9 A;  4V19 J;  4UTG A;  5C42 B;  4HDG A;  2KM8 B;  3EVM A;  1WCM K;  5EUH A;  2ROE A;  3TEG A;  3FSX A;  1IJF B;  2O66 A;  5J1P A;  3DNC A;  4A3F C;  1WJ9 A;  1DAX A;  3HLU A;  3OBI A;  1WSV A;  3OFF A;  1HBO B;  1RT3 A;  3HOY C;  4LIW A;  3ZZO A;  4KHM A;  4A3L K;  4UQG A;  1F7V A;  4I56 A;  1GAO A;  2NUU G;  1I3Q C;  2OLW A;  4GTB A;  1RAG B;  2JLF A;  4QOT A;  3T6J A;  2RUG A;  5D15 A;  3SV3 A;  1M5H A;  1F6T A;  2OAU A;  4U67 Q;  1RTZ A;  3I87 A;  2IM3 A;  2BOP A;  4RUC A;  1YBU A;  2VPW B;  3S16 K;  1LWF B;  2VU5 A;  3M8S A;  2KZM A;  2BMB A;  1CJV B;  4B3M F;  2IMO A;  4ZLN A;  4YOE A;  4YB6 A;  4KBI A;  3DRP B;  3FKI K;  3H42 A;  2Y1R I;  2V8D A;  3LGH A;  1NHV A;  4DR7 J;  5CYM B;  2XCP A;  5G4D A;  3AQO A;  2G2Y A;  4O4R A;  2CQC A;  3KMS A;  4J9O A;  2CPI A;  4Q43 A;  1S6U A;  1FA0 A;  1CS4 B;  1FDA A;  4C3M A;  2QL7 B;  3QJP A;  1U1O A;  3HOU C;  2VOO A;  3LAM A;  2R42 A;  4B9M A;  1ZM9 A;  2YKN B;  3EIC A;  3O1L A;  4HVZ A;  3QYY A;  3MMJ A;  2FZC B;  3ADA C;  1RHR B;  1Y5L B;  4ZVE A;  4DV7 F;  2IA6 A;  4GO7 X;  2B9X A;  3EPI A;  3TEH B;  1QD1 A;  3C66 A;  1I6H C;  4LLG A;  5GAH U;  5F8I A;  4FZV A;  1FTC A;  2G1H A;  5KFW A;  1DTT A;  2VUM A;  4H4K C;  1RAF B;  4H4O B;  1ZTT A;  3RAX A;  1TAQ A;  2JFD A;  4WE1 B;  1RKJ A;  3EZU A;  4PXD A;  2ZUE A;  4ZVP B;  2V94 A;  1RT6 B;  2QA2 A;  5EWE A;  1XMQ J;  4F0M A;  4KGV B;  1W2I A;  4KTQ A;  1KOH A;  2DHH A;  1BLU A;  1V3R A;  3UR0 A;  5IXU A;  5ETP A;  5FLX U;  4LF5 J;  4K5S A;  1H2U X;  3IBC B;  4ZCL A;  2YKA A;  1QAX A;  4I2P A;  2RF2 A;  1NAQ A;  4H4M A;  2HEK A;  2VAS A;  2QL5 B;  1U1R A;  1V9O A;  3S2D K;  4RW7 A;  3ENW A;  4OYI A;  5HVH A;  2D74 B;  4CQ1 A;  3T00 A;  4B3O A;  2FZG B;  3IC1 A;  4DUZ J;  2QT7 A;  4H54 A;  3NL0 A;  5IC6 B;  2A68 A;  1T9W A;  4DN0 A;  2HVH A;  3PJ9 A;  4X66 F;  1YRT A;  3WOD A;  2ATL A;  1GMU A;  3CD5 A;  4YDD B;  3C2P A;  2XI2 A;  2UVU A;  3SIP B;  2HHH J;  2DH7 A;  2VBY A;  2G0C A;  2C3O A;  2CDR B;  2AGQ A;  2AT1 B;  1SJ3 P;  1TWF C;  1FKA F;  1B64 A;  3KXD A;  1BGX T;  2P9C A;  1T9V A;  4DWI A;  2BKP A;  1X5T A;  2GHP A;  4B3T F;  2GNK A;  1S1X B;  3IA0 A;  2GGP A;  3C46 A;  2QJ3 A;  3RJM B;  1F5A A;  9RUB A;  4OYW A;  4DQR A;  1YJU A;  1HPZ B;  3B6B A;  1YCL A;  5KFD A;  2NVY K;  3ZZR A;  3G8T A;  1X4B A;  1RWX B;  3Q8V A;  2MPU A;  4Y6I A;  4UF4 A;  2AYM A;  2V4R A;  1REV B;  1H74 A;  3FOE A;  1BQN B;  2V4J B;  1JLQ B;  4OIN A;  3J7A N;  3SYZ A;  1X9S A;  3IWN C;  1LW2 A;  3BKU A;  3C19 A;  3CD7 A;  1K73 T;  5KG4 A;  2BYC A;  2RQK A;  2MYF A;  4NRT A;  4F25 A;  1XNR F;  2C2E A;  1S9F A;  1D8Y A;  4F4Y A;  3DOK B;  4ECW A;  4LRB A;  4LJM A;  5ITH A;  2H48 B;  1WHV A;  4GVB B;  2W01 A;  2E2H K;  4XK8 C;  1VJE A;  4AQY J;  3VWS A;  3TA2 A;  1MU2 A;  4EEY A;  3GCX P;  5HP1 B;  2ALZ A;  3JSY A;  3MED B;  4WP8 A;  1XN9 A;  4Y0F A;  1S1W B;  1KLM B;  3TOQ A;  1N5S A;  4LRF A;  1SL1 A;  2X1A A;  5LL6 d;  4ZIW A;  4JI2 F;  1YBA A;  4W4M A;  3IS9 B;  1WQF A;  4UY8 5;  1RTJ A;  2SXL A;  5E2Q A;  3IGN A;  2BOA A;  2JZ5 A;  1UVM A;  2LXF A;  4CT8 A;  2Z8Q A;  2FJW A;  3HOZ C;  1R8H A;  2RKI A;  4OX6 A;  2ILZ A;  1J5E F;  4WU3 A;  4P71 A;  1AZS B;  3DHW C;  3R7B B;  4Y2M A;  4KO0 B;  4LBI A;  4GMK A;  1B7Y B;  1ZTW A;  3K7A K;  2IM2 A;  2PMH A;  4LFC F;  5AXL A;  3LAN A;  4Q8E A;  2AEM A;  4ELT A;  5KG6 A;  1I6V A;  1S0M A;  1ZPW X;  1YNN A;  3BPD A;  1Z4U A;  3EZO A;  4X65 F;  5AE3 A;  3G4C A;  3MDF A;  3MAA B;  3QPI A;  3TUI C;  3GJS B;  3DGP A;  2OFH X;  5I42 B;  4GTA A;  3CMA S;  2NLW A;  3OR1 A;  1B0V A;  3N0B A;  3HHN B;  3V6D A;  2R7Z K;  4IR9 A;  2NVT C;  2C1E B;  4ELU A;  4QJV B;  4OJ3 A;  1Y1W A;  2F7V A;  4KHP F;  3EQL A;  1WC0 A;  4C4W A;  1C1C A;  3GTL C;  4PAA A;  2AQ4 A;  3O44 A;  3HKW A;  4X6A C;  4DV0 F;  1PIL A;  4JV1 A;  1A7G E;  3PO2 C;  3M1V A;  4ECU A;  4NLX A;  3QZ7 A;  1FVS A;  5K9F A;  1TK0 A;  3UQS A;  1R0C B;  4RX6 A;  3DLK B;  2VFS A;  3UE2 A;  5IT9 Y;  5I3U A;  1J27 A;  1TVR A;  3TX0 A;  2VPZ B;  4TVA B;  3KK2 A;  1HR0 J;  1M0S A;  2OKQ A;  1EH1 A;  3NG8 A;  1T3N A;  2W8L A;  1WG1 A;  2V67 A;  3KYL A;  1UWA A;  2O1P A;  3Q8S B;  4CO0 A;  4ECV A;  3K2Y A;  4A3J K;  5IOL A;  1HMV A;  5M2P A;  3S1Q K;  3P4U B;  3S7R A;  1N4L A;  1DQA A;  2PEH A;  1V3S A;  3DHX A;  1S9G B;  2DR7 A;  2V34 A;  5I4M A;  2DKO B;  4ZKA A;  3PW0 A;  1IWA A;  1S0O A;  3QT7 A;  1U1Q A;  1RP5 A;  3GTP C;  3H5X A;  1S99 A;  2HRU A;  4K2J A;  4YHH F;  3BGR A;  3N01 A;  2YU9 A;  3T5K A;  3W2W A;  2BJ3 A;  3OVS A;  4IG3 B;  4QIW D;  4C2M A;  2V2K A;  2IBK A;  2XEX A;  1N36 J;  5HAO A;  4RNN A;  2QA1 A;  1Y7P A;  4UY8 T;  1IM6 A;  5E33 A;  3U1L A;  4DS4 A;  4QU6 A;  1XXB A;  4DX7 A;  2ZNZ A;  4GKJ F;  1YJN S;  2F40 A;  1RT4 B;  4OX9 F;  4ED4 A;  3CW2 C;  3QNW B;  1SH3 A;  2H9Z A;  4YY3 F;  4P74 A;  1BC6 A;  2BJE A;  4DV4 F;  2VG5 B;  5A8W A;  1HBU B;  3GIK A;  5HO4 A;  5F8G A;  1VCT A;  3CED A;  3KLV A;  1TTH B;  1IKW B;  2C2R A;  4JI0 J;  4Q45 A;  1FD8 A;  4I1T A;  2GZO A;  2DBB A;  4M5L A;  4IRD A;  3MFI A;  1KN6 A;  4A4J A;  1HFE L;  1JLC B;  3OR2 A;  4K4S A;  3GDZ A;  4FN5 A;  2FTR A;  4I2Q B;  1RWU A;  2XMT A;  2W25 A;  1NZA A;  5T7L B;  1IM4 A;  4DUY J;  4QQB A;  1INN A;  2ZH9 A;  4ANC A;  4J9V A;  2ZD1 A;  3K5N A;  2MY8 A;  4G1I A;  5FLM C;  2YPZ A;  3W8P A;  5KG1 A;  4C3L A;  4O3R A;  1UFK A;  1HBM A;  2VG7 B;  3GTO A;  4C3I K;  2ZM6 F;  2D69 A;  3S1M K;  1GXT A;  2UUA F;  1J6W A;  4CLW A;  5IYC K;  4IRK A;  2HHT A;  3GFZ A;  1QAI A;  2J0S D;  1M5S A;  2M2B A;  1S6O A;  1R9T C;  3DRS B;  2DD8 S;  2D1C A;  4LF7 F;  3IP0 A;  1ZM3 A;  3I9Z A;  2J8A A;  1NK8 A;  4LOW A;  4FS1 A;  1PKU A;  3ILL A;  1JKH B;  4I64 A;  1T9U A;  3UCZ P;  5LJ5 Y;  1CQM A;  2AHO B;  2CQG A;  2LXU A;  1T3O A;  1U6B A;  2HNZ A;  3MM5 A;  1SQG A;  1F0X A;  3ULH A;  4QW8 A;  2I1R A;  1C0T A;  3D6T B;  1EP4 A;  1FFW B;  2HVD A;  1VHI A;  3W62 A;  5DZ7 A;  1GH8 A;  3AXK A;  4DPW A;  3MR5 A;  3C16 A;  1WC5 A;  1SPB P;  3K7R A;  4XDD A;  2BE2 B;  4X84 A;  3FKB A;  3IO1 A;  2V9W A;  5IOR A;  1SKS A;  2C2D A;  4M8L A;  5LJ3 Y;  1OSD A;  2XO7 A;  3I0R A;  4NLD A;  4P6Q A;  1SC3 B;  2EEY A;  2DGQ A;  5DDP C;  4DL6 A;  4I6Y A;  4PYD A;  3TVZ A;  5KFY A;  4A3D K;  4FPR A;  3S2H K;  3MR6 A;  3A3N B;  4PUO B;  4NOH A;  4TLR A;  3U1M A;  1DQ9 A;  4B3R F;  5IT9 U;  3I4H X;  3IPJ A;  3PR5 B;  4RWW A;  3R6G B;  2FY8 A;  3PDN A;  2XB2 D;  1TWC K;  5L1K A;  1QUV A;  1N52 B;  3QMQ A;  5ETS A;  3E8O A;  2U1A A;  3ZZZ A;  5IS2 A;  1X4G A;  3HO1 A;  4LQY A;  4OJG A;  2DY1 A;  5CZV A;  2M7S A;  5HLF B;  2FDN A;  3J81 j;  4OLO A;  1T9Y A;  3CDU A;  1U48 A;  4HAC B;  3OVB A;  4WFB Q;  1N34 J;  2OI2 A;  2BVZ A;  4A8S A;  2VG6 A;  3MEG B;  3MWB A;  4LSZ B;  4YR0 A;  1RGV A;  4MKV A;  1QTM A;  4K4X A;  4AE5 A;  1B0T A;  4F4W A;  4LF9 J;  4WZM A;  4EZ9 A;  1PJ6 A;  1FKP B;  3G82 A;  2AD9 A;  1C4A A;  3KNG A;  1TUW A;  1QE1 A;  4JI5 J;  4BLG A;  4KN7 A;  4BY7 K;  2P9G A;  1UA0 A;  4C8Z A;  4KMA A;  3WHI A;  4B9N A;  3S1R C;  2EPI A;  1B4A A;  2ROP A;  5JVO A;  2HQI A;  1S48 A;  2CJK A;  3FCW A;  1JOE A;  1FK9 B;  5DDQ C;  4OX8 A;  1Z2Z A;  2ERR A;  2HWI A;  1KVI A;  4LMZ A;  1XER A;  2GMH A;  1T8E A;  2WB1 D;  2V69 A;  1R0A B;  3HVT B;  2YH1 A;  2VBZ A;  2WRM A;  4M1K A;  3W60 A;  2NVX K;  3O3L A;  2LCW A;  1LW0 B;  2E9T A;  2IBO A;  1RU1 A;  1ZYR A;  1NPP A;  3EUN A;  1XR7 A;  3RW6 A;  4EO6 A;  4ZLJ A;  1U49 A;  3MM7 A;  4ZP8 A;  3EYZ A;  2JX2 A;  1RCO B;  4LF1 A;  2CQ3 A;  1UL3 A;  4PXC A;  2KL8 A;  3EDQ B;  1TMJ A;  1WOO A;  4FYX B;  1KVK A;  3CQZ K;  1FER A;  4ELV A;  1VOM A;  5CCM A;  2W2P P;  1Z1Z A;  4NI2 A;  2CZV C;  3R9L A;  1G51 A;  3T1H F;  2DRB A;  2N7Y A;  4OYZ A;  2VFR A;  3U02 A;  2KT2 A;  3KJV B;  1T94 A;  4R8U A;  3KLF A;  5F0U A;  2GMJ A;  1VBZ A;  4DV1 F;  4KMD A;  1XC9 A;  3MPV A;  4XPC A;  2H3E B;  3UVJ B;  2Z2Z A;  3J81 U;  4PXB A;  2RDI A;  3FEY B;  1Q5Y A;  5A8K A;  4DSK A;  2A69 A;  4RL1 A;  5H9E J;  3MM8 A;  3D5M A;  3M2U B;  1L0W A;  3JTP A;  4F26 A;  2PC6 A;  3RTV A;  2ZIT A;  1IBM J;  3M6U A;  2E5H A;  2KM8 C;  3DM2 B;  3C15 A;  3BJY A;  4X62 J;  3IRW P;  3HX9 A;  2GSO A;  2DNR A;  2FPH X;  2KYZ A;  1EI6 A;  3GPA A;  5CA5 A;  4J90 A;  3X3U A;  4JI8 J;  2W2N P;  3M2V A;  3D67 A;  1X0P A;  4OZL A;  4BLB A;  5ETO A;  3CUN A;  3VAJ A;  1NK4 A;  3NS5 A;  2QTW A;  2GQQ A;  3R1L A;  3JSM B;  2CW0 A;  1AXQ A;  4ZLP A;  3GIJ A;  3GP9 A;  3BSC A;  8AT1 B;  1UZH A;  2Y1J A;  4M5D A;  3HCX A;  4FBU A;  4CWB A;  5KFG A;  2LEA A;  4W92 B;  1TWA C;  3W66 A;  1C0A A;  3ZTS A;  3HFV A;  1S6P A;  5HVG A;  4A46 A;  3PRB A;  2OEM A;  1VQ9 S;  1NUE A;  1UPM B;  2P6S A;  1EKS A;  4FBT A;  3MD3 A;  2EFP A;  3J80 Y;  3M3Y C;  3R5C A;  4IDK A;  1FWL A;  5F8M A;  3PEJ A;  4TY9 A;  4Y52 K;  2JA6 A;  6AT1 B;  3OXF A;  3KK1 A;  5D0E A;  1XEZ A;  1RSC A;  2HLU A;  3GMG A;  3I82 A;  4UQT A;  2RD5 C;  2J0Q D;  1FXL A;  1MML A;  4JI6 F;  1VRT B;  1VQL S;  1HKA A;  2VKR A;  3PEH A;  3L9Z A;  4OHV A;  1XZP B;  1Q5V A;  4NZ6 A;  3WC0 A;  2C42 A;  3N9U C;  4YS2 A;  4DR6 J;  5HVF A;  1XR6 A;  4DR5 F;  4N8O A;  1E6V B;  4BC7 A;  3PW2 A;  3I5B A;  3V4G A;  4PG5 A;  3DI6 A;  3ZTQ A;  2IVF B;  3MM9 A;  1VC5 A;  2GQC A;  1G6B A;  4K2X A;  3GON A;  4NA3 A;  2WOM B;  2MLX A;  3TP2 A;  4I67 A;  5JVH Q;  3CJQ A;  3H2L A;  3TZX A;  3AH5 A;  3R5A A;  3KG1 A;  5MLC V;  3LPE A;  1IR2 A;  3SSR A;  3DLE A;  2HAF A;  1ZZN A;  5KFR A;  1AA1 B;  1L5U A;  4CNZ A;  4OI3 A;  4DF8 A;  4QWC A;  4WWS A;  1HNV A;  3RU0 A;  3H5U A;  4EWT A;  4O3Q A;  3KLE A;  4IOA Q;  2FVR A;  1VK3 A;  3LP2 B;  4FYD A;  4K4W A;  1EKR A;  3DCA A;  1Q86 T;  4A3I C;  2H1Y A;  5GAG U;  2BUN A;  4J9R A;  5DQG A;  3KTQ A;  3OUY B;  4PR6 A;  4ZN3 A;  2Q66 A;  5F41 A;  2HAI A;  2AJ0 A;  2PI4 A;  3S0X A;  1K44 A;  3QIP B;  2R7Q A;  2LQ8 A;  2UUB F;  4LQ3 A;  4LSL A;  2B63 C;  4OI0 A;  5EDW A;  3JAM Y;  2E7V A;  1S76 D;  2CQ1 A;  1C1B B;  4YQW A;  3FHZ A;  4Q5V A;  2K06 A;  1EB0 A;  1OSC A;  1FX2 A;  2CVI A;  4QCL A;  1S4F A;  2DRA A;  4PG8 A;  2L9N A;  3T5L A;  1P27 B;  1L3T A;  5DM6 Q;  1L3S A;  3C14 B;  2I6W A;  4BHQ A;  2H5J B;  2C3Y A;  5H1S V;  4DCJ B;  1S1U A;  2NXC A;  3BV8 A;  4KAI A;  5TMC A;  3BM7 A;  5KFV A;  5IT4 A;  5L38 A;  1HD0 A;  5J1N A;  3D9B A;  3D66 A;  4LQ9 A;  2V68 A;  3P5T L;  5K5M A;  3K5M A;  1UVL A;  2YNG A;  2UZA A;  3HDS A;  5K8O A;  5HRO B;  4WFX A;  3MPY A;  1R8C A;  1G1X A;  1BWV A;  1U1K A;  3MML B;  3B4D A;  1NZ8 A;  2PFD A;  3VF0 B;  3T6B A;  3AD7 C;  2EXU A;  1WKJ A;  4AFF A;  4FDF A;  4WK1 A;  1VQY A;  2F8H A;  2W24 A;  2N4D A;  3JXO A;  4BBR K;  1K83 K;  5IFM A;  4KY3 A;  1N6Q A;  4EUV A;  5K8N A;  1I50 A;  1S9E B;  1KRP A;  2RRA A;  3MPU B;  3NS6 A;  2DB1 A;  2G1D A;  3TUZ C;  3CJ5 A;  4NYO A;  4NXM F;  4O23 A;  1FJG J;  2OSR A;  4Q0B B;  4L6V 3;  1X4E A;  3Q24 A;  2IA0 A;  4F4A A;  3TJA A;  5IOQ A;  1KS2 A;  2RDJ A;  2BJ9 A;  1JJ4 A;  2VQF J;  1ICE B;  4RW9 B;  1RU0 A;  2E5J A;  4PPZ A;  3OL7 A;  3GTJ A;  4A8W A;  4LF8 F;  2D3Z A;  3BH7 B;  3GTK K;  4DR3 F;  1YZ7 A;  4ZVT B;  2MKY A;  3NWG A;  5G0R A;  3SDE A;  5F9N A;  2COL A;  3DOL B;  1RDR A;  3GG0 A;  5IQQ A;  1CSJ A;  2LQ5 A;  4PWD B;  3QFW A;  2ZZM A;  1XK8 A;  2FJA B;  2YX1 A;  4OHX A;  1YHQ S;  3R8Y A;  1T05 B;  3V6H A;  3AXM A;  1VQS A;  2EFG A;  2N7C A;  1NK6 A;  5CAA A;  1F3F A;  4JI7 F;  1YJ7 A;  1N8R T;  4CIO A;  1J5O A;  1X4F A;  2DNO A;  4ANE A;  2ZE2 B;  5HL7 Q;  4OZN A;  3IRX B;  4XIU A;  3G96 A;  2HZC A;  5H9F K;  2VHG A;  5I3P A;  3ZZU A;  2ZC3 A;  2RS2 A;  4OZ2 A;  3BQ0 A;  4A93 C;  4FVC A;  2J6T A;  3P45 B;  4FP9 A;  3HD2 A;  1FFG B;  5IC4 B;  4CNY A;  2EVZ A;  1LK5 A;  1U0S A;  2QRR A;  3I55 S;  5JXS A;  2VA3 A;  4KT0 C;  3NMA A;  2XUL A;  5BJR A;  2DY9 A;  3D6F B;  2XM3 A;  1HNZ J;  3Q8U A;  3FGV A;  4RW4 A;  1IUJ A;  3H7H B;  4K4V A;  1FNX H;  1HQM A;  4M5M A;  1GXU A;  1W26 A;  4EMD A;  1RWM B;  4YUD A;  3ET6 A;  2QN6 B;  1VQK S;  4ED5 A;  5B0B A;  1RHU B;  4YDX A;  2P5V A;  1N54 B;  1TV6 A;  3GTM K;  3GYX B;  2BAB A;  5IV3 A;  3A8J A;  4QWE A;  2FY1 A;  1Q8I A;  2E2J C;  4Q2L A;  1DFD A;  4ZVU B;  4UUX A;  2YPY A;  3IG1 B;  4DJB A;  3TI0 A;  1O29 A;  1RWK B;  1MWY A;  1DTQ B;  3ENA A;  2ZH4 A;  4WZQ A;  1WCM A;  2VH7 A;  5KFQ A;  3R5B A;  4O4G A;  3N5B A;  3CJ2 A;  1WUU A;  1FE4 A;  3HHL B;  8ATC B;  3S17 C;  4KE5 A;  4KR0 B;  2DH9 A;  3GIL A;  4A3G C;  1L3V A;  1IE0 A;  1PIE A;  3JAM U;  1WC3 A;  2HW3 A;  2NSC A;  2W8K A;  1ITP A;  2XSJ B;  1RCX B;  3GJQ B;  3TAM B;  1MRO A;  3VQT A;  4ZP6 A;  4TYB A;  1CJT B;  3Q8Y A;  2RAQ A;  1UV7 A;  2W7O A;  2H5E A;  2HHP A;  3KG0 A;  3MOZ A;  3FFI A;  5D8H B;  4WYL A;  1UJ6 A;  5HBM A;  2KWA A;  2XYH B;  1U1L A;  2ZUA A;  1Q95 G;  1FXR A;  2VON A;  1VLY A;  3FCV A;  4N8N A;  4UOH A;  3FKI A;  1ZBT A;  2UU9 J;  3HT3 A;  4K4Z A;  2J6S A;  4GTD A;  2DRD A;  2V9K A;  1JLB B;  2YWG A;  2UXD J;  1IBK F;  4C3H K;  1T0T V;  4KFB B;  2DHX A;  4RUB A;  2JH3 A;  4HR2 A;  1OQ6 A;  2GS8 A;  3R7N B;  1NK7 A;  2AV5 A;  2Q43 A;  4XSZ A;  1Y1W K;  3MI7 X;  3S15 K;  2F9D A;  1DJ0 A;  4DFJ A;  4G0W A;  2NS1 B;  1WF2 A;  1RYR A;  1NSP A;  4ENO A;  1RXO B;  4OLP A;  3NP5 A;  1RTD A;  3V5R A;  4QPT A;  1HNX F;  3NCP A;  1RLC L;  1Y0H A;  4WF9 Q;  3NGS A;  3GTG C;  3ZO7 A;  2ZH8 A;  4FYY B;  4RW8 B;  3D2W A;  2R3V A;  2IJN A;  1A6L A;  1OY8 A;  4M63 A;  4WKY A;  5CYQ A;  2MB0 B;  4LFA J;  2J8S A;  1HYS B;  4CLL A;  5C3E C;  5HN0 A;  4E98 A;  3G86 A;  2LQJ A;  3ZC4 A;  4U8Y A;  2VIC A;  3POT B;  5KFA A;  2MGZ A;  2HVE A;  5ETK A;  3CTR A;  2YNI B;  2E2I K;  1L3U A;  3Q0A A;  4F2S A;  2Z2Y B;  5KFI A;  4G1Q B;  2AJ2 A;  2RRN A;  3V4I B;  2M5Y A;  1UZD A;  4L3K A;  1PSD A;  4CZC A;  2P2C B;  5KT7 A;  1TZ0 A;  2YU9 K;  4MAK A;  1Y3J A;  1UJ5 A;  3GLJ A;  4FF2 A;  1Y11 A;  4C2M K;  1T03 A;  3C3L A;  4ECX A;  5FII A;  4ZP7 A;  2K2P A;  2HNY B;  1GE9 A;  1NB2 A;  4LF4 F;  2DNZ A;  3GZ7 A;  4FYV B;  4C8M A;  2HMI B;  2M9K A;  4K7Q A;  4JI3 J;  1JLE A;  4KKO B;  2RH6 A;  4KAR A;  2KH9 A;  1TKT A;  3HOX C;  5CD4 A;  2FQT A;  4O3N A;  4U7U K;  4P72 A;  4F02 A;  4DR4 F;  3GTQ K;  1BUX A;  1RT5 A;  2ZH2 A;  4CCH A;  3CO9 A;  2BQ3 A;  1EZZ B;  2JSX A;  4OZ3 A;  2NZ4 A;  2ZKU A;  3VGS A;  1RWP B;  1VRU A;  2IM0 A;  2GIQ A;  3KG4 A;  4NLU A;  2I8E A;  5SZT A;  3VTI A;  3IR6 B;  2NVY A;  4ZHR B;  7FDR A;  4OHZ A;  2ZKT A;  1KFS A;  1NSA A;  5KFS A;  2ZH1 A;  1S1T B;  5GAE U;  4DSL A;  1DRZ A;  2GFF A;  4R0J A;  1HWK A;  2Y8Y A;  2DHS A;  1W2B R;  5HMZ A;  3H0G K;  5LMU F;  4C3J K;  3HPO A;  2E1R A;  1OPZ A;  3PW5 A;  1EAR A;  4K5R A;  3KLH A;  3DXJ A;  4KMU A;  1CJU B;  5D3G B;  4AL7 A;  3BRE A;  4ZS6 A;  2YNF A;  1E6Y B;  3S16 C;  5KTQ A;  5J2M A;  1CUL B;  2VC0 A;  4PXE A;  5JFE A;  3M8P B;  2JA5 C;  2W9C B;  2KFZ A;  3WDO A;  3NNC A;  1YGY A;  1TL3 B;  1PC5 A;  5CYJ A;  3PHT A;  1G2E A;  5RUB A;  2IJR A;  4PWU A;  3K58 A;  1HWJ A;  3U1N A;  4USU A;  3PO3 C;  3GYG A;  4ZP9 A;  2E7X A;  1S10 A;  3NGT A;  5CYM A;  3OL6 A;  1BY9 A;  1SKR A;  4NYZ A;  4B3M J;  2ZBQ A;  2J76 E;  1KKH A;  1J2V A;  4ZPB A;  3VZH A;  3QLH B;  2ZDP A;  4IRC A;  1WOP A;  1TU0 B;  3E51 A;  3HXM A;  3AOB A;  1D8Z A;  4J7C A;  6FD1 A;  3CCQ S;  2MZT A;  3CD0 A;  5DET A;  2OFG X;  2MZR A;  2MQM A;  3M32 A;  2L08 A;  3CJT A;  2UV8 A;  5IYD C;  2MZS A;  3GTY X;  4CO3 A;  1Y5N B;  2R7Z A;  3TAN A;  2KZZ A;  1FT8 A;  4DV7 J;  4MYT A;  4HTI A;  4X4V A;  1RT3 B;  1HWL A;  4X4O A;  3CGI A;  3N0V A;  4WE1 A;  2HS4 A;  4FNI A;  2MHE A;  4A3F K;  2IY5 B;  1GT8 A;  5GMD A;  2IRU A;  1UFL A;  1CVJ A;  3RBE A;  4LR8 A;  4U9R A;  3HOY K;  2HFS A;  3CE8 A;  1I3Q K;  1SV5 A;  1IQT A;  1F9H A;  3NCQ A;  1I51 B;  2J7W A;  5M5Y K;  2JLG A;  2R2R A;  4ZIT A;  4QR0 A;  5CQG A;  3UDL A;  3KJF B;  5J2N A;  4I0W A;  1F5B A;  2MJN A;  3SFG A;  4KPY A;  1QVF R;  1NCL A;  3JQM A;  4MYU A;  2QE5 A;  1IS1 A;  3FZB A;  1HNI A;  2MZJ A;  2OO4 A;  5C24 B;  3MCM A;  3PIO Q;  4PRF A;  2FC8 A;  5C2C A;  4UOC A;  3MR2 A;  2ZVI A;  2VC1 A;  2KJV A;  4M5J A;  3A4T A;  4OYA A;  2G9O A;  3NAI A;  1FNM A;  2OEK A;  3MTJ A;  4LBP A;  4A3C C;  2HQC A;  3HOU K;  1D9D A;  1GTH A;  2MMY A;  1FJE B;  1IBC B;  2A18 A;  4DX8 H;  3AOC A;  3V6J A;  4XCH A;  2ZBI A;  3SSQ A;  4A8K A;  3D6M B;  4CLF A;  1DTT B;  4NZ0 A;  3HSZ A;  4B3T J;  2ILY A;  3RB3 A;  4G0V A;  1I6H K;  3HOW C;  3LP0 A;  4B08 A;  3SXL A;  1REV A;  3IWL A;  4PG7 A;  5KFL A;  2ABY A;  1LWX A;  1UVK A;  4KGM A;  3QWU A;  1FKO A;  5ETV A;  4Y34 A;  4A8F A;  3O8W A;  3DDI A;  3RR8 A;  2E2H C;  3CJ0 A;  2H65 B;  2EFQ A;  2NVQ C;  1HQU A;  2HKE A;  2YX4 A;  4I2P B;  2RF2 B;  3PNI A;  3VGV A;  4H4M B;  1UTA A;  2VJU A;  4QYZ J;  2CPX A;  1IKY A;  3MMC B;  1XNR J;  4RW7 B;  2JOQ A;  2AYG A;  4IYQ A;  2RQC A;  4WJB A;  3EZ5 A;  3W65 A;  2D3U A;  2WSF C;  3DU6 A;  5HL8 A;  1S1W A;  4GFQ A;  2HS3 A;  3L7U A;  3PG9 A;  3IS9 A;  1S5Z A;  2W4D A;  5BR8 F;  2O5J A;  3HK2 A;  1SFO C;  2B56 A;  4LRA A;  4JI2 J;  3KHL A;  2R93 C;  3OW2 R;  2DPJ A;  5L1I A;  3TZW A;  4KO0 A;  2KVI A;  4EYI B;  2H4Y B;  1V6H A;  4DL5 A;  3CMQ A;  3Q22 A;  1H73 A;  4G7H A;  4YG2 A;  3CSK A;  3AD8 C;  4A8Y A;  3A3O B;  1J5E J;  1TWF K;  3MMA B;  3TTG A;  2E1A A;  4EGL A;  5DDR C;  1RAB B;  2XLI A;  5L46 A;  2AZ3 A;  1H7W A;  3I0S A;  4LFC J;  2ADC A;  1ZAW A;  1N5Y B;  2CYY A;  2JNJ A;  2QFI A;  3N4W A;  4RBT A;  1KR4 A;  1YDL A;  1VS3 A;  1BE4 A;  2R7W A;  1WDD A;  3TUP A;  2IDE A;  1K8A T;  4X65 J;  2NXE A;  4YFU A;  4I4B A;  4QZV B;  1LW2 B;  5FDL A;  1BHN A;  5ETR A;  5E5N A;  4E2F B;  2LKZ A;  2YNH A;  4TXS A;  2VPX B;  3RZD C;  4L75 A;  4K59 A;  3GG1 A;  3BR8 A;  2DJW A;  4OMF G;  3FBC A;  2DGV A;  3FUY A;  1Q16 B;  2ACY A;  2QSW A;  1U2F A;  2QLF B;  1WI6 A;  4KHP J;  2F5G A;  1BS2 A;  4AL6 A;  3RZO C;  1SMY A;  2AX1 A;  4GC7 A;  4Y7N C;  3WX4 A;  2Y1L B;  4NAS A;  4PG6 A;  2HGN A;  2EFN A;  1MU2 B;  5B0A A;  1SI9 A;  4DV0 J;  5IYB C;  3KHH A;  1JJH A;  3LPX A;  3DLK A;  4ZPD A;  3MPW A;  4Y2I A;  4B9L A;  2IRX A;  3UCU P;  5C5J A;  1DLO A;  1JLG A;  1OPI A;  4F50 A;  3LPY A;  1RTJ B;  2EBG A;  2VZ9 A;  4HHU A;  4DPO A;  3BYR A;  3NBP A;  4RU2 A;  5GMK a;  4C0H A;  2FIU A;  1TWC A;  1S9G A;  2A10 A;  2V2Z A;  2RKI B;  4NLS A;  4OIP A;  2AYE A;  4P2S A;  3H3V L;  1UEK A;  1O6X A;  2FVP A;  2EC2 A;  2JA7 C;  3Q8Q B;  2BZ2 A;  4DU8 A;  1WG5 A;  2FGC A;  2RT3 A;  1DUR A;  3HOZ K;  2R7U A;  1YJV A;  4MIW A;  1F2G A;  2VFU A;  5KFU A;  1JLF B;  2RB7 A;  3FJ2 A;  4G7O A;  1YTY A;  2MJU A;  3DGP B;  4ECR A;  4IH5 A;  3BF4 A;  3OR1 B;  5ETT A;  2HWT A;  5ETM A;  3L09 A;  3VQS A;  3WBZ A;  3V6D B;  5F8J A;  2YVS A;  2GQ2 A;  3LWL A;  2HYI B;  4LRE A;  4L72 B;  3A8E A;  1FHT A;  1KBR A;  1RJJ A;  5A6P A;  2LP4 A;  3B4M A;  2XQC A;  2E5I A;  4GKJ J;  1C1C B;  4OX9 J;  2NVT K;  4YY3 J;  2W4P A;  1V5I B;  4DV4 J;  4N56 A;  2R8I A;  2QG9 B;  3M1V B;  4MT1 A;  3W2V B;  1NPR A;  3UW1 A;  3GU0 A;  3GTL K;  1HR0 F;  2MEW A;  2FQO A;  1FEH A;  1F7U A;  4X6A K;  1O2A A;  4XAK A;  3D0I E;  3PO2 K;  2OPR A;  5I3U B;  4RNF A;  2Y0S L;  2NVX A;  4WTY A;  5C2G A;  3BB5 A;  2HK2 A;  1ZH5 A;  3KK3 B;  2ZFZ A;  5T7L A;  2L9D A;  1XZQ A;  1YWX A;  3RRG A;  3N3Y A;  2C3U A;  2K1R A;  1NXI A;  4IR1 A;  4BXX C;  3H90 A;  2A6M A;  2LDI A;  4OFZ A;  3FBB A;  2JJ4 D;  5DZ6 A;  4ED7 A;  3GEE A;  3M4O C;  4FNH A;  3B8H A;  3CQZ A;  2W7V A;  2PFF B;  3C8Y A;  2DHA A;  3BBB A;  3EM1 A;  3BGR B;  3W2W B;  3BP8 C;  4NLR A;  5KAK A;  3Q8R B;  2DNG A;  3BBC A;  1F60 B;  4B9T A;  1TKZ A;  4ED1 A;  2VBW A;  3GTP K;  3CJ3 A;  2UUA J;  4OV6 A;  3GR1 A;  2DGW A;  3JTN A;  2ZHB A;  2ZWP A;  5K8M A;  1WTF A;  2DHG A;  2MQQ A;  3ILJ A;  4Z7Y A;  3R5D A;  2J9D E;  1N32 F;  4LF7 J;  4ILR A;  5AXN A;  1M90 T;  4C8N A;  1UEU A;  3I9V 9;  1H98 A;  2XMJ A;  5F8H A;  2DR6 A;  2QA4 S;  3L4J A;  5A8W B;  1R0B G;  4PAB A;  5MAO A;  2KG1 A;  1FRM A;  3CT9 A;  1F9E B;  2YKM B;  1URR A;  1FTR A;  4C0B A;  4X4P A;  1TAU A;  1QDU B;  4AT1 B;  1G3O A;  2VB6 A;  3E01 A;  2BE2 A;  1Q82 T;  3HHL C;  3RUB L;  3OR2 B;  4BWJ A;  1O8B A;  1RHJ B;  2YXL A;  2WZ1 A;  1D1U A;  1SJ4 P;  4AD6 A;  1EHW A;  3H4D A;  1NJW A;  1LOU A;  4KB2 A;  2RDD A;  2KT5 A;  1PAU B;  3NGD A;  4X4R A;  3FEX B;  4E8U A;  2KB2 A;  3S2H C;  2HFV A;  1HLW A;  3SZY A;  4N7T A;  4CH1 A;  3CPW R;  4K0K J;  2CQ0 A;  4Z37 A;  2UUC F;  4JI1 F;  2Y3Y A;  5KT3 A;  2ZD1 B;  4ZPV R;  2RGR A;  2H5I B;  3HVA A;  4NLT A;  3QJJ A;  3EGV A;  3SZZ A;  1HBM B;  1VMB A;  1WD6 A;  1IL2 A;  3OFH A;  1NU4 A;  4RBV A;  2CKW A;  5FLM K;  1KQK A;  2O5I A;  4ZCI A;  4CLP A;  2PII A;  2NYH A;  4WTO B;  4B3R J;  5C4X K;  3S1N C;  1ZXO A;  4J9M A;  3J7Y U;  1RT1 B;  1ZAV A;  4HAC A;  1I94 F;  5K8P A;  3RGI A;  4F04 B;  2QX0 A;  3KUE A;  1R9T K;  1LK7 A;  5AE1 A;  1FDN A;  2Z2L A;  3EGZ A;  2R92 C;  1UFW A;  5TJ3 A;  2PMW A;  1FWK A;  4NYP A;  1CEZ A;  2HNZ B;  3MM5 B;  2R7X A;  1FKP A;  3L4K A;  1C0T B;  1EP4 B;  2OPQ B;  1XMO F;  2KVQ E;  4OYX A;  3BEG B;  1N5V A;  3C16 B;  3F73 A;  4J5O A;  2BE9 B;  1GEH A;  1T02 A;  4UZB A;  5CH7 B;  2BW7 A;  5DDO C;  3M05 A;  2RQM A;  2IVY A;  2HHU A;  4NL5 A;  2GVZ A;  4O3P A;  3I0R B;  3GFY A;  3OSP A;  3K5L A;  4CTA A;  4RW6 B;  3CCV S;  3PTW A;  2POK A;  3PX6 A;  2KN4 A;  2HG4 A;  3GIR A;  2KHC A;  3MFH A;  3O5T B;  3H5Y A;  3U7J A;  3CCS S;  2E5L J;  1WI8 A;  5HQ8 A;  1KON A;  1LEO A;  1Q78 A;  2V50 A;  3KKF A;  3BQ1 A;  4WII A;  3D54 A;  3NEK A;  2DK2 A;  1MWQ A;  3LW5 C;  3D0G E;  1HA1 A;  1OIA A;  2HGM A;  5AJ3 F;  2LYV A;  2L9W A;  4ER8 A;  2HFN A;  1MN9 A;  4ETZ A;  4K4Y A;  2OPP B;  4B17 A;  3C6U B;  1NDK A;  1N88 A;  2ZFH A;  1FO1 A;  1PYO B;  1KHW A;  5BYQ A;  1H2V Z;  2UXB F;  3JTO A;  4WFN Q;  2WVF A;  5JMN A;  3ITH A;  3N6M A;  2QMU B;  3R3T A;  2WVE A;  2XCQ A;  3RBX A;  1PYS B;  3T1H J;  5DGA A;  4FKX A;  1BJT A;  1HWU A;  1O0P A;  3G82 B;  2KXN B;  5D4P A;  1WG4 A;  1QE1 B;  4FPI A;  4DV1 J;  4BKW A;  1S1V A;  3BGL A;  3ZZY A;  2RHQ B;  2MLZ A;  3QAU A;  4Y2K A;  1XTZ A;  4IFV B;  3TYT A;  3P49 B;  4N76 A;  2B4U A;  1DD5 A;  2NQP A;  2AU0 A;  1NDP A;  5HAT A;  2RVJ A;  3HVW A;  3M2R A;  4JP8 A;  3US5 A;  4X4U A;  3OVA A;  3DM2 A;  3LO3 A;  2V5H G;  3BKF A;  5K14 A;  3V81 A;  1N0U A;  4C3K A;  1K83 A;  3S1R K;  2PPB A;  1Y00 A;  3VCD A;  1TL1 A;  4KGZ B;  3DLJ A;  3TAQ A;  1RAO A;  2XWX A;  3HSJ A;  2RJZ A;  5M2R A;  2R7V A;  1TL7 A;  1R8B A;  3LWM A;  1CJK A;  4D3H A;  4N77 A;  1WHY A;  4DV6 F;  2BQR A;  2FLO A;  4JYA F;  3GV8 B;  2IAJ A;  1U0H A;  1X4A A;  2KDO A;  2JVO A;  4O2D A;  3GTK A;  3M7V A;  1S12 A;  5KFP A;  1GXL A;  4NI2 B;  1TQL A;  3BDE A;  3UD5 A;  3CJ4 A;  3OFG A;  4F4X A;  2FVQ A;  1U45 A;  2A6O A;  4OHY A;  2NYI A;  2DR9 A;  1Y1V C;  2LFV A;  4R8U B;  3KLF B;  1SCJ B;  1WF0 A;  2XCA A;  5D4N A;  1M5K C;  2K7K A;  1YI2 S;  2DH8 A;  1SUQ A;  3L3C A;  5LT5 A;  3GWC A;  3BO2 A;  1NJY A;  2AMC B;  3THT A;  2XCR B;  1H3D A;  1VBY A;  2D7S A;  1E6V A;  1KQ4 A;  4JI6 J;  2XCO A;  3DFE A;  3MM8 B;  4AND A;  3WC2 A;  3O2I A;  3EXC X;  1LWC A;  3RB6 A;  3T5J A;  1TWH C;  3FSI A;  4DR5 J;  2GVD A;  4X4T A;  1FD2 A;  2VFV A;  3G4S S;  1NKE A;  4IQX A;  2WOM A;  2KHD A;  2XY5 A;  3OXL A;  2L3M A;  3IAM 9;  5HSP A;  2J0W A;  3MCO A;  1S97 A;  4TYA A;  4DDQ A;  3UN3 A;  5HJY A;  4BDP A;  2GW8 A;  1YRX A;  3FBE A;  3TFH A;  4GT9 A;  3CCR S;  3DU5 A;  3HZG A;  2D3O 1;  4C7Q A;  3QAE A;  2ASL A;  3IWX A;  3GTM A;  3HFZ B;  1F9F A;  2P9E A;  4MJK A;  4DHV A;  5EHH A;  2ZVS A;  3EVW A;  3PJW A;  4M5D B;  1H6K X;  3T5H A;  1HI8 A;  2GML A;  2XS2 A;  3H98 A;  2FJV A;  2MKC A;  1S6P B;  1UP1 A;  4USM A;  2KRB A;  2VQE F;  3OUY A;  3W61 A;  4J9L A; 
#chains in the Genus database with same CATH homology
 3A8J A;  1WSV A;  5L46 A;  1PJ5 A;  4P9S A;  4PAB A;  3GSI A;  1WOP A;  1XZP A;  2GAG C;  1PJ7 A;  3GIR A;  1WOR A;  2GAH C;  1WOO A;  1XZP B;  3GEE A;  1VLO A;  3TFH A;  1VRQ C;  1WOS A;  3TFJ A;  1PJ6 A;  3A8I A;  3GEI A;  3ADA C;  3GEH A;  1WSR A;  1X31 C;  3AD8 C;  1V5V A;  1XZQ A;  3TFI A;  3AD7 C;  3A8K A;  1XZQ B;  1YX2 A;  4PAA A;  3TTG A;  3AD9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...