3N0CA

Tm0449 mutant crystal grown by hanging drop method
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRAFATVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diffraction study of protein crystals grown in cryoloops and micromounts.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n0cA00
4KATA 1O26A 2CFAA 4FZBA 3N0BA 5IOQA 4GTCA 4GT9A 5JFEA 1O25A 1O27A 4GTFA 1O29A 5IOSA 5IOTA 4KARA 4GTLA 4P5AA 1KQ4A 1O2BA 3N0CA 4GTAA 1O2AA 4P5BA 5IORA 4KASA 3AH5A 3G4CA 1O28A 1O24A 3N3YA 2CFAB 4GTEA 3G4AA 5CHPA 4GTBA 4GTDA
chains in the Genus database with same CATH superfamily
3OEPA 4BLBA 2JA6K 2JA5A 3TFIA 4PABA 5IYDK 2NVQC 1J6VA 2E2IK 5IYCC 3S2DC 3S17K 4A93K 3I4MK 2NVYA 1IE0A 3M4OC 3A8IA 3GTGC 5M5YK 1GE9A 3G4AA 3GEHA 1HQMA 1TWCK 3S1RK 3A8JA 1TWHK 1J6XA 4J3NA 2YU9A 1I3QK 4KMAA 1O27A 2E2HC 3BUEA 1IQ0A 1WOPA 4A3JK 4X6AK 4C3HK 1KQ4A 1JVIA 1JOEA 4A3GC 2GAHC 2JA7K 1WOOA 4OIOA 2E2IC 5C4XK 3A8KA 4G7OA 1DCHA 3GTGK 5FJ8K 2JA6A 4BXXC 2WB1D 4XLNA 4BY7C 1XXAA 3S1QK 4GTDA 4LQYA 1B4AA 3N0BA 3EQLA 1BGWA 4AYBL 3L4JA 1F93A 5C44C 4C3IC 1RU0A 5IOTA 4G7ZA 5C4JC 2PHCB 1SFOC 1BS2A 4X6AC 1XPPA 1K83K 1I6VA 2PPBA 1EQRA 2GAGC 4KASA 1V5VA 2JA7C 3G4CA 3FKIC 2NVTK 2JA5K 3GTOK 2CFAB 4G0UA 4A3CK 3NUHA 3GEEA 4C3HC 1TWFK 2R93A 3WODA 4RMFA 1USMA 4QIWL 4AYBD 5TMFA 1WIHA 3DXJA 5C4XC 1WSVA 1I3QA 4A3EC 5IP7C 4XSZA 4KN7A 4YG2A 4KN4A 1O2BA 4A3IK 1K83C 4A3DC 5M5XK 5IORA 1HI9A 3GTQC 4QJVA 1O28A 2NVYK 2O5IA 3GTOC 2E2HK 5C4JK 4KC6A 3HOXK 4FM9A 3RZOC 2R93C 4GTBA 2ZUFA 2Y0SL 1YNJA 1EH1A 2D6FC 3RZDK 3S2HK 1I50A 1O2FB 1YCLA 2JA8C 3SZZA 1XZPB 4A3CC 3CQZA 1ZYRA 1YNNA 1WQHA 4BXXK 4LK1A 1WQFA 4C45A 4A3IC 4A3DK 3GIRA 4XSXA 5IP7K 3GTGA 3AQPA 1VRQC 4WJ3M 4LOWA 1PJ7A 3M3YC 4LR2A 5TMCA 1XXCA 2JA6C 5FLMC 4FZBA 5IOQA 4G0WA 3HOVC 3LPXA 2E2IA 2JA8K 2RH6A 1ZQ1C 4M1XA 3L4KA 3GTMC 2JA5C 4QJVB 2O5JA 2XCRB 4AH6A 1F7UA 3S2HC 3T02A 1IL2A 3M4OK 2CW0A 1VJEA 2WAQL 4LLGA 4A3EK 2NVXC 2FQTA 2R7ZK 2FQOA 4KM9A 3JSTA 1VGXA 3H3VL 3M3YK 1Y1WA 1TWHC 2R92K 3HOUK 2BE5A 2EBBA 3GTQK 1DCOA 4KMUA 2ZFZA 2NVYC 1C0AA 1ISEA 2PMZL 3RZOK 3S1NK 3HOVK 1R9TA 4A3KC 4KMHA 4A3GK 3RZDC 4A3LK 1UV7A 4YFNA 3H0GA 3GTMK 1JQWA 1O24A 3TFHA 4GTEA 3FOFA 1TWCA 4BY7K 3GTLK 2ZUEA 2PMZD 2GSNA 1O25A 4ILDA 2R7ZC 3GTJA 5D4DA 3S1MK 3GTPK 1F9NA 4C3IK 2V6SA 4GTLA 3I4NC 4KDDA 1XZPA 4Y52K 4Y7NC 4BLAA 1O2AA 4YFKA 3H0GC 3AQOA 5FLMK 2B63C 3FKIK 2P5MA 3HKZD 1WCMA 2VUMA 1TWAK 5CHPA 2GSOA 2PA8L 1TWFC 5L46A 4A3KK 3GTLC 1WCMC 1ZBSA 4A3MK 4MEXA 1EK8A 5IP9C 1EFWA 1TWGC 3S1MC 2NVXK 2NVXA 3MMLB 4P5BA 5EGEA 3HOWK 2R92C 3HOUC 1WORA 1WSRA 3GTPC 1Y1VC 3HOXC 3LAPA 4KATA 3S15K 1YX2A 1INNA 3S1NC 2B63K 5IYBK 1WQGA 3HOYC 4OIPA 1TWAC 5HL8A 2RGRA 1WOSA 3VA7A 1R9TC 3GTKA 4LJZA 3K7AC 3N0CA 5M3FK 2VUMC 1I6HC 5IP9K 1BDFA 5C3EC 1TWGK 4WILA 4Q5SA 5JVOA 1Y1VK 2P8TA 1B4BA 2KWAA 3I4NK 2V6TA 3BP3A 3GTJK 4C2MK 4O2DA 3S16K 3GSIA 4Y7NK 1XXBA 2XCOA 3ERED 2A69A 1TWGA 4QIWD 2Y3PA 3LAJA 3GTMA 3HOZC 1DD5A 3AH5A 3TTGA 1J6WA 3GTLA 3K7AK 4MEYA 4DDQA 1Y1VA 1I6HK 5IYDC 1O26A 3S16C 2Y0SD 2R7ZA 4NOIA 2B63A 4A3BC 3CAGA 4KB4A 3HOWC 3S17C 5IOSA 4MQ9A 3GEIA 4KARA 2E2JK 3PO2K 1BJTA 2V6UA 3HOZK 4BY1C 4A3LC 1I50C 2JH3A 2PA8D 3HOYK 1VH2A 1AB4A 3QX3A 3HKZL 4ZH4A 3FOEA 1TWAA 4BKWA 5EGHA 4BBSC 4GTCA 1L0WA 4A3BK 2GSUA 3TFJA 1O29A 1ZXOA 5M5WK 4A3JC 1PJ5A 1F7VA 4Y52C 3GTJC 4C2MC 4P9SA 3GTPA 4KB2A 3H0GK 3N3YA 2E2JC 3PO2C 1Y1WK 3Q3QA 4YFXA 2A6EA 3CQZC 1WCMK 2E2HA 1SFOA 3ADAC 1XZQA 1I50K 3IPJA 5JFEA 4C3JC 4A3MC 2YU9C 3V4GA 4PAAA 3AD9C 4G7HA 3GTKC 4BBSK 1DCPA 4GTAA 3GTOA 4GZYA 3AD7C 2NVQK 1SMYA 2NVTC 1J98A 5TJ3A 4A93C 1TWHA 1K83A 1IS1A 3S14K 5CJ9A 4XLPA 4KAWX 4OINA 3S15C 2WAQD 2CFAA 2R92A 3PO3K 4GT9A 3HXAA 5IYBC 4BY1K 4GTFA 3FHZA 1R9TK 4A3FC 2A68A 1USOA 4WJ4A 3CQZK 4LK0A 3GTKK 4KM8A 3GDZA 1IW7A 3T00A 2VUMK 2XCQA 3FKIA 4BBRC 1VLOA 2JA7A 1IBAA 5C3EK 3S0XA 1PJ6A 1EI6A 5E68A 5IYCK 1XZQB 2R93K 5M3MK 1TWFA 4XCHA 3OREA 4OIQA 3SZYA 3PO3C 3GTQA 4JK1A 4GFQA 3S14C 4OIRA 3S2DK 3H3VD 3S1QC 3I4MC 4P5AA 4A3FK 1Y1WC 3T01A 1G51A 1X31C 3AD8C 1ZVUA 2WB1L 4G0VA 5C44K 4BBRK 1I3QC 4Q4ZA 4C3JK 2YU9K 4KMDA 2W7VA 3OPFA 1SFOK 2A6HA 1TWCC 3BP8C 3S1RC
chains in the Genus database with same CATH topology
3OEPA 4BLBA 2JA5A 1TWAA 4BKWA 5EGHA 1I50A 1ZBSA 4GTCA 1EK8A 2GSUA 3CQZA 1O29A 1ZXOA 1WQHA 1WQFA 2NVYA 2NVXA 3MMLB 4P5BA 5EGEA 4C2MC 3GTPA 3GTGA 3AQPA 4KB2A 3N3YA 1GE9A 3G4AA 4LR2A 3LAPA 3Q3QA 4KATA 1XXCA 4J3NA 4FZBA 5IOQA 4G0WA 2YU9A 2E2HA 3LPXA 5JFEA 2E2IA 4KMAA 1O27A 1WQGA 2RH6A 4M1XA 4C3JC 3L4KA 3V4GA 3FOEA 3BUEA 2RGRA 3VA7A 3GTKA 1KQ4A 2XCRB 3N0CA 4GTAA 3GTOA 3QX3A 5TJ3A 1TWHA 1K83A 1IS1A 2JA6A 4KM9A 5JVOA 5CJ9A 4KAWX 1Y1WA 1XXAA 4GTDA 1B4BA 2KWAA 1AB4A 4LQYA 2CFAA 1B4AA 1XXBA 3N0BA 2R92A 1BGWA 4GT9A 2XCOA 3ERED 3L4JA 4GTFA 4C3IC 2ZFZA 3FHZA 5IOTA 2PHCB 1ISEA 1TWGA 4KM8A 2Y3PA 3LAJA 1R9TA 3GTMA 4KMHA 2XCQA 4KASA 3FKIA 1DD5A 3AH5A 3G4CA 3H0GA 2JA7A 3S0XA 1O24A 2CFAB 3GTLA 4GTEA 4G0UA 3FOFA 3NUHA 4C3HC 1TWFA 2R93A 1TWCA 4DDQA 1Y1VA 5CHPA 1O26A 1WIHA 3OREA 2R7ZA 1I3QA 2GSNA 2B63A 1O25A 3CAGA 3GTQA 4GFQA 4ILDA 4KB4A 3GTJA 5IOSA 1F9NA 4KARA 4GTLA 4P5AA 4KDDA 1O2BA 1BJTA 4BLAA 1O2AA 1ZVUA 5IORA 4G0VA 3AQOA 1O28A 2P5MA 2JH3A 1WCMA 2VUMA 4KC6A 4KMDA 4FM9A 3OPFA 1SFOA 2GSOA 4GTBA 1EH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KAT A;  1O26 A;  2CFA A;  4FZB A;  3N0B A;  5IOQ A;  4GTC A;  4GT9 A;  5JFE A;  1O25 A;  1O27 A;  4GTF A;  1O29 A;  5IOS A;  5IOT A;  4KAR A;  4GTL A;  4P5A A;  1KQ4 A;  1O2B A;  3N0C A;  4GTA A;  1O2A A;  4P5B A;  5IOR A;  4KAS A;  3AH5 A;  3G4C A;  1O28 A;  1O24 A;  3N3Y A;  2CFA B;  4GTE A;  3G4A A;  5CHP A;  4GTB A;  4GTD A; 
#chains in the Genus database with same CATH topology
 3OEP A;  4BLB A;  2JA6 K;  2JA5 A;  3TFI A;  4PAB A;  5IYD K;  2NVQ C;  1J6V A;  2E2I K;  5IYC C;  3S2D C;  3S17 K;  4A93 K;  3I4M K;  2NVY A;  1IE0 A;  3M4O C;  3A8I A;  3GTG C;  5M5Y K;  1GE9 A;  3G4A A;  3GEH A;  1HQM A;  1TWC K;  3S1R K;  3A8J A;  1TWH K;  1J6X A;  4J3N A;  2YU9 A;  1I3Q K;  4KMA A;  1O27 A;  2E2H C;  3BUE A;  1IQ0 A;  1WOP A;  4A3J K;  4X6A K;  4C3H K;  1KQ4 A;  1JVI A;  1JOE A;  4A3G C;  2GAH C;  2JA7 K;  1WOO A;  4OIO A;  2E2I C;  5C4X K;  3A8K A;  4G7O A;  1DCH A;  3GTG K;  5FJ8 K;  2JA6 A;  4BXX C;  2WB1 D;  4XLN A;  4BY7 C;  1XXA A;  3S1Q K;  4GTD A;  4LQY A;  1B4A A;  3N0B A;  3EQL A;  1BGW A;  4AYB L;  3L4J A;  1F93 A;  5C44 C;  4C3I C;  1RU0 A;  5IOT A;  4G7Z A;  5C4J C;  2PHC B;  1SFO C;  1BS2 A;  4X6A C;  1XPP A;  1K83 K;  1I6V A;  2PPB A;  1EQR A;  2GAG C;  4KAS A;  1V5V A;  2JA7 C;  3G4C A;  3FKI C;  2NVT K;  2JA5 K;  3GTO K;  2CFA B;  4G0U A;  4A3C K;  3NUH A;  3GEE A;  4C3H C;  1TWF K;  2R93 A;  3WOD A;  4RMF A;  1USM A;  4QIW L;  4AYB D;  5TMF A;  1WIH A;  3DXJ A;  5C4X C;  1WSV A;  1I3Q A;  4A3E C;  5IP7 C;  4XSZ A;  4KN7 A;  4YG2 A;  4KN4 A;  1O2B A;  4A3I K;  1K83 C;  4A3D C;  5M5X K;  5IOR A;  1HI9 A;  3GTQ C;  4QJV A;  1O28 A;  2NVY K;  2O5I A;  3GTO C;  2E2H K;  5C4J K;  4KC6 A;  3HOX K;  4FM9 A;  3RZO C;  2R93 C;  4GTB A;  2ZUF A;  2Y0S L;  1YNJ A;  1EH1 A;  2D6F C;  3RZD K;  3S2H K;  1I50 A;  1O2F B;  1YCL A;  2JA8 C;  3SZZ A;  1XZP B;  4A3C C;  3CQZ A;  1ZYR A;  1YNN A;  1WQH A;  4BXX K;  4LK1 A;  1WQF A;  4C45 A;  4A3I C;  4A3D K;  3GIR A;  4XSX A;  5IP7 K;  3GTG A;  3AQP A;  1VRQ C;  4WJ3 M;  4LOW A;  1PJ7 A;  3M3Y C;  4LR2 A;  5TMC A;  1XXC A;  2JA6 C;  5FLM C;  4FZB A;  5IOQ A;  4G0W A;  3HOV C;  3LPX A;  2E2I A;  2JA8 K;  2RH6 A;  1ZQ1 C;  4M1X A;  3L4K A;  3GTM C;  2JA5 C;  4QJV B;  2O5J A;  2XCR B;  4AH6 A;  1F7U A;  3S2H C;  3T02 A;  1IL2 A;  3M4O K;  2CW0 A;  1VJE A;  2WAQ L;  4LLG A;  4A3E K;  2NVX C;  2FQT A;  2R7Z K;  2FQO A;  4KM9 A;  3JST A;  1VGX A;  3H3V L;  3M3Y K;  1Y1W A;  1TWH C;  2R92 K;  3HOU K;  2BE5 A;  2EBB A;  3GTQ K;  1DCO A;  4KMU A;  2ZFZ A;  2NVY C;  1C0A A;  1ISE A;  2PMZ L;  3RZO K;  3S1N K;  3HOV K;  1R9T A;  4A3K C;  4KMH A;  4A3G K;  3RZD C;  4A3L K;  1UV7 A;  4YFN A;  3H0G A;  3GTM K;  1JQW A;  1O24 A;  3TFH A;  4GTE A;  3FOF A;  1TWC A;  4BY7 K;  3GTL K;  2ZUE A;  2PMZ D;  2GSN A;  1O25 A;  4ILD A;  2R7Z C;  3GTJ A;  5D4D A;  3S1M K;  3GTP K;  1F9N A;  4C3I K;  2V6S A;  4GTL A;  3I4N C;  4KDD A;  1XZP A;  4Y52 K;  4Y7N C;  4BLA A;  1O2A A;  4YFK A;  3H0G C;  3AQO A;  5FLM K;  2B63 C;  3FKI K;  2P5M A;  3HKZ D;  1WCM A;  2VUM A;  1TWA K;  5CHP A;  2GSO A;  2PA8 L;  1TWF C;  5L46 A;  4A3K K;  3GTL C;  1WCM C;  1ZBS A;  4A3M K;  4MEX A;  1EK8 A;  5IP9 C;  1EFW A;  1TWG C;  3S1M C;  2NVX K;  2NVX A;  3MML B;  4P5B A;  5EGE A;  3HOW K;  2R92 C;  3HOU C;  1WOR A;  1WSR A;  3GTP C;  1Y1V C;  3HOX C;  3LAP A;  4KAT A;  3S15 K;  1YX2 A;  1INN A;  3S1N C;  2B63 K;  5IYB K;  1WQG A;  3HOY C;  4OIP A;  1TWA C;  5HL8 A;  2RGR A;  1WOS A;  3VA7 A;  1R9T C;  3GTK A;  4LJZ A;  3K7A C;  3N0C A;  5M3F K;  2VUM C;  1I6H C;  5IP9 K;  1BDF A;  5C3E C;  1TWG K;  4WIL A;  4Q5S A;  5JVO A;  1Y1V K;  2P8T A;  1B4B A;  2KWA A;  3I4N K;  2V6T A;  3BP3 A;  3GTJ K;  4C2M K;  4O2D A;  3S16 K;  3GSI A;  4Y7N K;  1XXB A;  2XCO A;  3ERE D;  2A69 A;  1TWG A;  4QIW D;  2Y3P A;  3LAJ A;  3GTM A;  3HOZ C;  1DD5 A;  3AH5 A;  3TTG A;  1J6W A;  3GTL A;  3K7A K;  4MEY A;  4DDQ A;  1Y1V A;  1I6H K;  5IYD C;  1O26 A;  3S16 C;  2Y0S D;  2R7Z A;  4NOI A;  2B63 A;  4A3B C;  3CAG A;  4KB4 A;  3HOW C;  3S17 C;  5IOS A;  4MQ9 A;  3GEI A;  4KAR A;  2E2J K;  3PO2 K;  1BJT A;  2V6U A;  3HOZ K;  4BY1 C;  4A3L C;  1I50 C;  2JH3 A;  2PA8 D;  3HOY K;  1VH2 A;  1AB4 A;  3QX3 A;  3HKZ L;  4ZH4 A;  3FOE A;  1TWA A;  4BKW A;  5EGH A;  4BBS C;  4GTC A;  1L0W A;  4A3B K;  2GSU A;  3TFJ A;  1O29 A;  1ZXO A;  5M5W K;  4A3J C;  1PJ5 A;  1F7V A;  4Y52 C;  3GTJ C;  4C2M C;  4P9S A;  3GTP A;  4KB2 A;  3H0G K;  3N3Y A;  2E2J C;  3PO2 C;  1Y1W K;  3Q3Q A;  4YFX A;  2A6E A;  3CQZ C;  1WCM K;  2E2H A;  1SFO A;  3ADA C;  1XZQ A;  1I50 K;  3IPJ A;  5JFE A;  4C3J C;  4A3M C;  2YU9 C;  3V4G A;  4PAA A;  3AD9 C;  4G7H A;  3GTK C;  4BBS K;  1DCP A;  4GTA A;  3GTO A;  4GZY A;  3AD7 C;  2NVQ K;  1SMY A;  2NVT C;  1J98 A;  5TJ3 A;  4A93 C;  1TWH A;  1K83 A;  1IS1 A;  3S14 K;  5CJ9 A;  4XLP A;  4KAW X;  4OIN A;  3S15 C;  2WAQ D;  2CFA A;  2R92 A;  3PO3 K;  4GT9 A;  3HXA A;  5IYB C;  4BY1 K;  4GTF A;  3FHZ A;  1R9T K;  4A3F C;  2A68 A;  1USO A;  4WJ4 A;  3CQZ K;  4LK0 A;  3GTK K;  4KM8 A;  3GDZ A;  1IW7 A;  3T00 A;  2VUM K;  2XCQ A;  3FKI A;  4BBR C;  1VLO A;  2JA7 A;  1IBA A;  5C3E K;  3S0X A;  1PJ6 A;  1EI6 A;  5E68 A;  5IYC K;  1XZQ B;  2R93 K;  5M3M K;  1TWF A;  4XCH A;  3ORE A;  4OIQ A;  3SZY A;  3PO3 C;  3GTQ A;  4JK1 A;  4GFQ A;  3S14 C;  4OIR A;  3S2D K;  3H3V D;  3S1Q C;  3I4M C;  4P5A A;  4A3F K;  1Y1W C;  3T01 A;  1G51 A;  1X31 C;  3AD8 C;  1ZVU A;  2WB1 L;  4G0V A;  5C44 K;  4BBR K;  1I3Q C;  4Q4Z A;  4C3J K;  2YU9 K;  4KMD A;  2W7V A;  3OPF A;  1SFO K;  2A6H A;  1TWC C;  3BP8 C;  3S1R C; 
#chains in the Genus database with same CATH homology
 3OEP A;  4BLB A;  2JA5 A;  1TWA A;  4BKW A;  5EGH A;  1I50 A;  1ZBS A;  4GTC A;  1EK8 A;  2GSU A;  3CQZ A;  1O29 A;  1ZXO A;  1WQH A;  1WQF A;  2NVY A;  2NVX A;  3MML B;  4P5B A;  5EGE A;  4C2M C;  3GTP A;  3GTG A;  3AQP A;  4KB2 A;  3N3Y A;  1GE9 A;  3G4A A;  4LR2 A;  3LAP A;  3Q3Q A;  4KAT A;  1XXC A;  4J3N A;  4FZB A;  5IOQ A;  4G0W A;  2YU9 A;  2E2H A;  3LPX A;  5JFE A;  2E2I A;  4KMA A;  1O27 A;  1WQG A;  2RH6 A;  4M1X A;  4C3J C;  3L4K A;  3V4G A;  3FOE A;  3BUE A;  2RGR A;  3VA7 A;  3GTK A;  1KQ4 A;  2XCR B;  3N0C A;  4GTA A;  3GTO A;  3QX3 A;  5TJ3 A;  1TWH A;  1K83 A;  1IS1 A;  2JA6 A;  4KM9 A;  5JVO A;  5CJ9 A;  4KAW X;  1Y1W A;  1XXA A;  4GTD A;  1B4B A;  2KWA A;  1AB4 A;  4LQY A;  2CFA A;  1B4A A;  1XXB A;  3N0B A;  2R92 A;  1BGW A;  4GT9 A;  2XCO A;  3ERE D;  3L4J A;  4GTF A;  4C3I C;  2ZFZ A;  3FHZ A;  5IOT A;  2PHC B;  1ISE A;  1TWG A;  4KM8 A;  2Y3P A;  3LAJ A;  1R9T A;  3GTM A;  4KMH A;  2XCQ A;  4KAS A;  3FKI A;  1DD5 A;  3AH5 A;  3G4C A;  3H0G A;  2JA7 A;  3S0X A;  1O24 A;  2CFA B;  3GTL A;  4GTE A;  4G0U A;  3FOF A;  3NUH A;  4C3H C;  1TWF A;  2R93 A;  1TWC A;  4DDQ A;  1Y1V A;  5CHP A;  1O26 A;  1WIH A;  3ORE A;  2R7Z A;  1I3Q A;  2GSN A;  2B63 A;  1O25 A;  3CAG A;  3GTQ A;  4GFQ A;  4ILD A;  4KB4 A;  3GTJ A;  5IOS A;  1F9N A;  4KAR A;  4GTL A;  4P5A A;  4KDD A;  1O2B A;  1BJT A;  4BLA A;  1O2A A;  1ZVU A;  5IOR A;  4G0V A;  3AQO A;  1O28 A;  2P5M A;  2JH3 A;  1WCM A;  2VUM A;  4KC6 A;  4KMD A;  4FM9 A;  3OPF A;  1SFO A;  2GSO A;  4GTB A;  1EH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...