3N0CA

Tm0449 mutant crystal grown by hanging drop method
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRAFATVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Diffraction study of protein crystals grown in cryoloops and micromounts.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n0cA00
1O26A 3N0BA 4P5BA 5IOSA 1O25A 1O2BA 1O24A 1KQ4A 5IORA 4KASA 3G4CA 4P5AA 1O28A 4GTDA 4FZBA 4GTEA 4GTLA 5JFEA 5IOTA 2CFAA 4GTBA 1O27A 4GTFA 5IOQA 4KATA 3N0CA 4KARA 4GTCA 1O2AA 1O29A 2CFAB 3AH5A 4GTAA 4GT9A 3G4AA 5CHPA 3N3YA
chains in the Genus database with same CATH superfamily
1TWCK 3I4MK 3GTGA 1B4BA 2JA8K 3CAGA 4OIOA 3FKIC 1IE0A 4LJZA 2WAQD 3PO3K 5C4XC 2WB1D 1EK8A 2D6FC 3H0GA 4O2DA 3CQZA 1L0WA 1XXAA 2YU9C 3GTQK 4A3IC 4A3BC 3A8JA 5CJ9A 4LOWA 3G4AA 3S14C 1TWHC 3HKZL 1PJ5A 4A3LK 2O5JA 4P5BA 5C3EK 4C3JC 3AD9C 3S16K 1BDFA 2NVYK 4KMDA 3H3VL 5C44C 3HOWK 4KDDA 2R7ZA 3L4JA 1PJ6A 5IYCC 3H0GK 3EQLA 1EH1A 2JA7A 1VLOA 2RGRA 1BJTA 5M5XK 5IYBC 3GTKK 5IP7K 4MEXA 4GT9A 3S15C 3M3YC 3Q3QA 2R7ZK 2PMZD 1F9NA 3T01A 5FLMC 3HOYK 1ZBSA 3TFHA 4A3KK 4GTLA 2A68A 1WSVA 3FHZA 1TWGA 3S1QK 1V5VA 4A93C 3GTMC 3GTPC 2JA6A 3GTOA 4OIRA 2R93K 2BE5A 5C4JC 5IYDK 3VA7A 3SZZA 4NOIA 4G7HA 1ZVUA 4C3IK 4G0VA 1TWAC 1Y1VC 1ZYRA 5TJ3A 4YFXA 3K7AC 4Y52K 1I6VA 3QX3A 3S2HK 3GDZA 1PJ7A 4KMHA 1TWGK 1I3QA 2B63K 3S1MK 1BS2A 4BY7C 4BY1C 5JFEA 4YG2A 2JA6K 3GTOK 1USOA 4KARA 1O2FB 4AYBL 3HOXK 1I50A 3M4OK 3FOEA 2R92A 1VJEA 1XPPA 1GE9A 4C45A 2NVXC 4C3HC 1I3QK 3RZOC 3GEIA 4BBRC 5IORA 3MMLB 1TWCA 2E2HC 1O28A 1WCMA 4JK1A 3RZDC 4A3EK 1R9TC 3BUEA 4G0UA 3GTJC 1J6VA 1TWFA 4GTFA 3L4KA 4MEYA 1YNJA 1I50K 2P5MA 2PA8D 3I4NK 2NVTK 2R92K 1WOOA 3GEEA 3HOUC 4KMAA 2JA5C 3LAJA 4X6AK 4GTAA 2Y0SD 4GZYA 3PO2K 3S17C 1B4AA 4LK0A 1O26A 5IOSA 3GTLK 1IS1A 1WCMK 1JOEA 4C2MC 1F7VA 2GSOA 1IW7A 1VH2A 1TWFK 2NVYA 3HOVC 1DCPA 4A3DK 2E2IC 2CFAA 1O27A 2ZFZA 2GSUA 4G7ZA 2YU9A 2VUMC 1ZXOA 1WQFA 3ADAC 3S14K 3WODA 1TWHA 4ILDA 3TFIA 1WQHA 1SFOC 1F7UA 3GTKA 3FKIK 1I6HC 3HOZC 4M1XA 1YX2A 3GTGC 4A3FC 5C4XK 1XZQA 1ZQ1C 1RU0A 1WQGA 1J6XA 2YU9K 1XXCA 4BBSC 3IPJA 2GAGC 4A3IK 4A3BK 1XZQB 2FQTA 3CQZC 1WSRA 4BXXC 3S0XA 4KM9A 1TWHK 4QJVA 4AH6A 4OINA 4C3JK 3GSIA 2R93A 2WAQL 2Y3PA 4A3MC 5C44K 2WB1L 2O5IA 4XLPA 5IYCK 1O24A 4QJVB 4LK1A 2V6TA 2RH6A 4A3JC 1X31C 3S1RC 2R7ZC 5JVOA 4XSXA 2JH3A 2PHCB 3A8IA 1JVIA 1K83C 3GTMA 2B63A 3JSTA 5M5WK 1J98A 4Q5SA 1IL2A 5IYBK 2JA7C 2PPBA 3S15K 3M3YK 4Y7NC 2ZUEA 4A3GC 1TWAA 1Y1VA 4MQ9A 4XCHA 5FLMK 1UV7A 3N0BA 2E2JC 5TMFA 1KQ4A 4A93K 1AB4A 3GTMK 4GTEA 3GTPK 5IOTA 3AQPA 5IP9C 5C4JK 2NVQK 4A3CC 1SMYA 5IOQA 1IQ0A 2PMZL 4KN4A 1HI9A 1TWAK 1Y1VK 3K7AK 4XLNA 1HQMA 2NVXA 3AD7C 1EFWA 3S1NC 2XCOA 4BY7K 4BY1K 1Y1WC 2E2HA 3LAPA 5M5YK 4KAWX 1YCLA 1R9TA 3GTLA 4P9SA 3A8KA 3T00A 3GTJA 2A6HA 3OEPA 4GFQA 3GIRA 4YFNA 3FOFA 1INNA 1WORA 1XZPA 3NUHA 4BKWA 2JA5A 4WJ4A 5EGEA 2NVXK 1ISEA 3S2DC 4C3HK 5HL8A 3RZOK 2ZUFA 4BBRK 2W7VA 4WILA 1JQWA 2E2HK 3RZDK 3AQOA 1R9TK 4ZH4A 3GTJK 1J6WA 3G4CA 4P5AA 1TWCC 3FKIA 4GTDA 2E2IA 1EQRA 3I4MC 4G0WA 4WJ3M 4FM9A 2JA8C 1YNNA 3HKZD 2VUMA 5TMCA 3HOUK 2JA5K 3PO3C 3H3VD 2XCRB 1DD5A 3S17K 2V6SA 2CFAB 2V6UA 2A6EA 4PAAA 4RMFA 4C2MK 2P8TA 3DXJA 3GTQC 3V4GA 1WIHA 3AD8C 3HOVK 5EGHA 4BLBA 1VGXA 2E2IK 2PA8L 4OIQA 4A3LC 5C3EC 4FZBA 3S16C 2NVYC 2VUMK 2Y0SL 3HOWC 3OPFA 3BP3A 4KM8A 3H0GC 1SFOK 4G7OA 1O29A 1I6HK 1DCHA 4DDQA 3HOZK 3GTGK 3N3YA 4A3FK 3GTKC 5IP7C 4KASA 4BBSK 1K83A 1IBAA 3CQZK 4BXXK 5E68A 4GTBA 4QIWD 4KMUA 3HOYC 3GTPA 4A3KC 1XXBA 4KATA 4J3NA 3S1QC 4GTCA 4A3MK 1G51A 2R93C 1VRQC 3BP8C 4BLAA 5IYDC 4A3JK 3S1RK 4KN7A 1O25A 2FQOA 4AYBD 4C3IC 1K83K 3HXAA 4Y52C 2JA7K 3S2HC 3T02A 2B63C 1TWGC 4XSZA 3S1MC 4Y7NK 4KB4A 3TFJA 3GEHA 1WOSA 2JA6C 3N0CA 5M3MK 1EI6A 3GTOC 4A3GK 2NVQC 2E2JK 3AH5A 3LPXA 4LQYA 3SZYA 4QIWL 3HOXC 3M4OC 5FJ8K 5L46A 1Y1WA 1O2BA 1F93A 5IP9K 5D4DA 1I3QC 4A3CK 4LLGA 4PABA 4OIPA 1WOPA 4A3EC 3OREA 1DCOA 1O2AA 1USMA 3TTGA 1I50C 3S1NK 4YFKA 5CHPA 1Y1WK 4KC6A 3I4NC 2NVTC 2R92C 1BGWA 1XZPB 2XCQA 4X6AC 3ERED 2CW0A 2GSNA 3PO2C 3GTLC 1WCMC 5M3FK 3S2DK 4A3DC 2GAHC 1TWFC 4LR2A 2A69A 3GTQA 2EBBA 1C0AA 4KB2A 2KWAA 1SFOA 4Q4ZA
chains in the Genus database with same CATH topology
4C3HC 3N0BA 3GTGA 1B4BA 1KQ4A 5IORA 3MMLB 4KASA 3CAGA 1TWCA 1AB4A 1O28A 1WCMA 4GTEA 1K83A 3BUEA 5IOTA 3AQPA 4G0UA 4GTBA 1EK8A 1TWFA 4GTFA 3L4KA 3GTPA 3H0GA 3CQZA 5IOQA 1XXBA 2P5MA 4KATA 4J3NA 1XXAA 4GTCA 5CJ9A 4KMAA 3LAJA 4GTAA 3G4AA 2NVXA 4BLAA 1B4AA 1O26A 4P5BA 4C3JC 5IOSA 1O25A 1IS1A 2XCOA 4C2MC 4KMDA 2E2HA 4C3IC 4KDDA 3LAPA 2GSOA 4KAWX 2R7ZA 3L4JA 1R9TA 3GTLA 2NVYA 3GTJA 2CFAA 1O27A 3OEPA 4GFQA 1EH1A 2ZFZA 3FOFA 2GSUA 4KB4A 2JA7A 2RGRA 2YU9A 1ZXOA 3N0CA 3NUHA 1WQFA 4BKWA 2JA5A 1BJTA 5EGEA 1ISEA 3AH5A 3LPXA 4GT9A 4LQYA 1GE9A 1TWHA 4ILDA 1WQHA 3GTKA 3AQOA 3Q3QA 1Y1WA 1O2BA 4M1XA 1F9NA 3G4CA 4P5AA 3FKIA 4GTDA 1ZBSA 4GTLA 2E2IA 3FHZA 4G0WA 1TWGA 1WQGA 4FM9A 1XXCA 2VUMA 2JA6A 3GTOA 3OREA 2XCRB 3S0XA 4KM9A 1O2AA 1DD5A 3VA7A 2CFAB 2R93A 1ZVUA 5CHPA 2Y3PA 4KC6A 4G0VA 1BGWA 5TJ3A 3V4GA 1WIHA 2XCQA 1O24A 5EGHA 4BLBA 3ERED 3QX3A 2GSNA 2RH6A 1I3QA 4KMHA 5JVOA 4FZBA 2JH3A 2PHCB 5JFEA 3GTMA 2B63A 3OPFA 4KM8A 4LR2A 4KARA 1I50A 1O29A 4DDQA 3GTQA 3FOEA 2R92A 1TWAA 1Y1VA 3N3YA 2KWAA 4KB2A 1SFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O26 A;  3N0B A;  4P5B A;  5IOS A;  1O25 A;  1O2B A;  1O24 A;  1KQ4 A;  5IOR A;  4KAS A;  3G4C A;  4P5A A;  1O28 A;  4GTD A;  4FZB A;  4GTE A;  4GTL A;  5JFE A;  5IOT A;  2CFA A;  4GTB A;  1O27 A;  4GTF A;  5IOQ A;  4KAT A;  3N0C A;  4KAR A;  4GTC A;  1O2A A;  1O29 A;  2CFA B;  3AH5 A;  4GTA A;  4GT9 A;  3G4A A;  5CHP A;  3N3Y A; 
#chains in the Genus database with same CATH topology
 1TWC K;  3I4M K;  3GTG A;  1B4B A;  2JA8 K;  3CAG A;  4OIO A;  3FKI C;  1IE0 A;  4LJZ A;  2WAQ D;  3PO3 K;  5C4X C;  2WB1 D;  1EK8 A;  2D6F C;  3H0G A;  4O2D A;  3CQZ A;  1L0W A;  1XXA A;  2YU9 C;  3GTQ K;  4A3I C;  4A3B C;  3A8J A;  5CJ9 A;  4LOW A;  3G4A A;  3S14 C;  1TWH C;  3HKZ L;  1PJ5 A;  4A3L K;  2O5J A;  4P5B A;  5C3E K;  4C3J C;  3AD9 C;  3S16 K;  1BDF A;  2NVY K;  4KMD A;  3H3V L;  5C44 C;  3HOW K;  4KDD A;  2R7Z A;  3L4J A;  1PJ6 A;  5IYC C;  3H0G K;  3EQL A;  1EH1 A;  2JA7 A;  1VLO A;  2RGR A;  1BJT A;  5M5X K;  5IYB C;  3GTK K;  5IP7 K;  4MEX A;  4GT9 A;  3S15 C;  3M3Y C;  3Q3Q A;  2R7Z K;  2PMZ D;  1F9N A;  3T01 A;  5FLM C;  3HOY K;  1ZBS A;  3TFH A;  4A3K K;  4GTL A;  2A68 A;  1WSV A;  3FHZ A;  1TWG A;  3S1Q K;  1V5V A;  4A93 C;  3GTM C;  3GTP C;  2JA6 A;  3GTO A;  4OIR A;  2R93 K;  2BE5 A;  5C4J C;  5IYD K;  3VA7 A;  3SZZ A;  4NOI A;  4G7H A;  1ZVU A;  4C3I K;  4G0V A;  1TWA C;  1Y1V C;  1ZYR A;  5TJ3 A;  4YFX A;  3K7A C;  4Y52 K;  1I6V A;  3QX3 A;  3S2H K;  3GDZ A;  1PJ7 A;  4KMH A;  1TWG K;  1I3Q A;  2B63 K;  3S1M K;  1BS2 A;  4BY7 C;  4BY1 C;  5JFE A;  4YG2 A;  2JA6 K;  3GTO K;  1USO A;  4KAR A;  1O2F B;  4AYB L;  3HOX K;  1I50 A;  3M4O K;  3FOE A;  2R92 A;  1VJE A;  1XPP A;  1GE9 A;  4C45 A;  2NVX C;  4C3H C;  1I3Q K;  3RZO C;  3GEI A;  4BBR C;  5IOR A;  3MML B;  1TWC A;  2E2H C;  1O28 A;  1WCM A;  4JK1 A;  3RZD C;  4A3E K;  1R9T C;  3BUE A;  4G0U A;  3GTJ C;  1J6V A;  1TWF A;  4GTF A;  3L4K A;  4MEY A;  1YNJ A;  1I50 K;  2P5M A;  2PA8 D;  3I4N K;  2NVT K;  2R92 K;  1WOO A;  3GEE A;  3HOU C;  4KMA A;  2JA5 C;  3LAJ A;  4X6A K;  4GTA A;  2Y0S D;  4GZY A;  3PO2 K;  3S17 C;  1B4A A;  4LK0 A;  1O26 A;  5IOS A;  3GTL K;  1IS1 A;  1WCM K;  1JOE A;  4C2M C;  1F7V A;  2GSO A;  1IW7 A;  1VH2 A;  1TWF K;  2NVY A;  3HOV C;  1DCP A;  4A3D K;  2E2I C;  2CFA A;  1O27 A;  2ZFZ A;  2GSU A;  4G7Z A;  2YU9 A;  2VUM C;  1ZXO A;  1WQF A;  3ADA C;  3S14 K;  3WOD A;  1TWH A;  4ILD A;  3TFI A;  1WQH A;  1SFO C;  1F7U A;  3GTK A;  3FKI K;  1I6H C;  3HOZ C;  4M1X A;  1YX2 A;  3GTG C;  4A3F C;  5C4X K;  1XZQ A;  1ZQ1 C;  1RU0 A;  1WQG A;  1J6X A;  2YU9 K;  1XXC A;  4BBS C;  3IPJ A;  2GAG C;  4A3I K;  4A3B K;  1XZQ B;  2FQT A;  3CQZ C;  1WSR A;  4BXX C;  3S0X A;  4KM9 A;  1TWH K;  4QJV A;  4AH6 A;  4OIN A;  4C3J K;  3GSI A;  2R93 A;  2WAQ L;  2Y3P A;  4A3M C;  5C44 K;  2WB1 L;  2O5I A;  4XLP A;  5IYC K;  1O24 A;  4QJV B;  4LK1 A;  2V6T A;  2RH6 A;  4A3J C;  1X31 C;  3S1R C;  2R7Z C;  5JVO A;  4XSX A;  2JH3 A;  2PHC B;  3A8I A;  1JVI A;  1K83 C;  3GTM A;  2B63 A;  3JST A;  5M5W K;  1J98 A;  4Q5S A;  1IL2 A;  5IYB K;  2JA7 C;  2PPB A;  3S15 K;  3M3Y K;  4Y7N C;  2ZUE A;  4A3G C;  1TWA A;  1Y1V A;  4MQ9 A;  4XCH A;  5FLM K;  1UV7 A;  3N0B A;  2E2J C;  5TMF A;  1KQ4 A;  4A93 K;  1AB4 A;  3GTM K;  4GTE A;  3GTP K;  5IOT A;  3AQP A;  5IP9 C;  5C4J K;  2NVQ K;  4A3C C;  1SMY A;  5IOQ A;  1IQ0 A;  2PMZ L;  4KN4 A;  1HI9 A;  1TWA K;  1Y1V K;  3K7A K;  4XLN A;  1HQM A;  2NVX A;  3AD7 C;  1EFW A;  3S1N C;  2XCO A;  4BY7 K;  4BY1 K;  1Y1W C;  2E2H A;  3LAP A;  5M5Y K;  4KAW X;  1YCL A;  1R9T A;  3GTL A;  4P9S A;  3A8K A;  3T00 A;  3GTJ A;  2A6H A;  3OEP A;  4GFQ A;  3GIR A;  4YFN A;  3FOF A;  1INN A;  1WOR A;  1XZP A;  3NUH A;  4BKW A;  2JA5 A;  4WJ4 A;  5EGE A;  2NVX K;  1ISE A;  3S2D C;  4C3H K;  5HL8 A;  3RZO K;  2ZUF A;  4BBR K;  2W7V A;  4WIL A;  1JQW A;  2E2H K;  3RZD K;  3AQO A;  1R9T K;  4ZH4 A;  3GTJ K;  1J6W A;  3G4C A;  4P5A A;  1TWC C;  3FKI A;  4GTD A;  2E2I A;  1EQR A;  3I4M C;  4G0W A;  4WJ3 M;  4FM9 A;  2JA8 C;  1YNN A;  3HKZ D;  2VUM A;  5TMC A;  3HOU K;  2JA5 K;  3PO3 C;  3H3V D;  2XCR B;  1DD5 A;  3S17 K;  2V6S A;  2CFA B;  2V6U A;  2A6E A;  4PAA A;  4RMF A;  4C2M K;  2P8T A;  3DXJ A;  3GTQ C;  3V4G A;  1WIH A;  3AD8 C;  3HOV K;  5EGH A;  4BLB A;  1VGX A;  2E2I K;  2PA8 L;  4OIQ A;  4A3L C;  5C3E C;  4FZB A;  3S16 C;  2NVY C;  2VUM K;  2Y0S L;  3HOW C;  3OPF A;  3BP3 A;  4KM8 A;  3H0G C;  1SFO K;  4G7O A;  1O29 A;  1I6H K;  1DCH A;  4DDQ A;  3HOZ K;  3GTG K;  3N3Y A;  4A3F K;  3GTK C;  5IP7 C;  4KAS A;  4BBS K;  1K83 A;  1IBA A;  3CQZ K;  4BXX K;  5E68 A;  4GTB A;  4QIW D;  4KMU A;  3HOY C;  3GTP A;  4A3K C;  1XXB A;  4KAT A;  4J3N A;  3S1Q C;  4GTC A;  4A3M K;  1G51 A;  2R93 C;  1VRQ C;  3BP8 C;  4BLA A;  5IYD C;  4A3J K;  3S1R K;  4KN7 A;  1O25 A;  2FQO A;  4AYB D;  4C3I C;  1K83 K;  3HXA A;  4Y52 C;  2JA7 K;  3S2H C;  3T02 A;  2B63 C;  1TWG C;  4XSZ A;  3S1M C;  4Y7N K;  4KB4 A;  3TFJ A;  3GEH A;  1WOS A;  2JA6 C;  3N0C A;  5M3M K;  1EI6 A;  3GTO C;  4A3G K;  2NVQ C;  2E2J K;  3AH5 A;  3LPX A;  4LQY A;  3SZY A;  4QIW L;  3HOX C;  3M4O C;  5FJ8 K;  5L46 A;  1Y1W A;  1O2B A;  1F93 A;  5IP9 K;  5D4D A;  1I3Q C;  4A3C K;  4LLG A;  4PAB A;  4OIP A;  1WOP A;  4A3E C;  3ORE A;  1DCO A;  1O2A A;  1USM A;  3TTG A;  1I50 C;  3S1N K;  4YFK A;  5CHP A;  1Y1W K;  4KC6 A;  3I4N C;  2NVT C;  2R92 C;  1BGW A;  1XZP B;  2XCQ A;  4X6A C;  3ERE D;  2CW0 A;  2GSN A;  3PO2 C;  3GTL C;  1WCM C;  5M3F K;  3S2D K;  4A3D C;  2GAH C;  1TWF C;  4LR2 A;  2A69 A;  3GTQ A;  2EBB A;  1C0A A;  4KB2 A;  2KWA A;  1SFO A;  4Q4Z A; 
#chains in the Genus database with same CATH homology
 4C3H C;  3N0B A;  3GTG A;  1B4B A;  1KQ4 A;  5IOR A;  3MML B;  4KAS A;  3CAG A;  1TWC A;  1AB4 A;  1O28 A;  1WCM A;  4GTE A;  1K83 A;  3BUE A;  5IOT A;  3AQP A;  4G0U A;  4GTB A;  1EK8 A;  1TWF A;  4GTF A;  3L4K A;  3GTP A;  3H0G A;  3CQZ A;  5IOQ A;  1XXB A;  2P5M A;  4KAT A;  4J3N A;  1XXA A;  4GTC A;  5CJ9 A;  4KMA A;  3LAJ A;  4GTA A;  3G4A A;  2NVX A;  4BLA A;  1B4A A;  1O26 A;  4P5B A;  4C3J C;  5IOS A;  1O25 A;  1IS1 A;  2XCO A;  4C2M C;  4KMD A;  2E2H A;  4C3I C;  4KDD A;  3LAP A;  2GSO A;  4KAW X;  2R7Z A;  3L4J A;  1R9T A;  3GTL A;  2NVY A;  3GTJ A;  2CFA A;  1O27 A;  3OEP A;  4GFQ A;  1EH1 A;  2ZFZ A;  3FOF A;  2GSU A;  4KB4 A;  2JA7 A;  2RGR A;  2YU9 A;  1ZXO A;  3N0C A;  3NUH A;  1WQF A;  4BKW A;  2JA5 A;  1BJT A;  5EGE A;  1ISE A;  3AH5 A;  3LPX A;  4GT9 A;  4LQY A;  1GE9 A;  1TWH A;  4ILD A;  1WQH A;  3GTK A;  3AQO A;  3Q3Q A;  1Y1W A;  1O2B A;  4M1X A;  1F9N A;  3G4C A;  4P5A A;  3FKI A;  4GTD A;  1ZBS A;  4GTL A;  2E2I A;  3FHZ A;  4G0W A;  1TWG A;  1WQG A;  4FM9 A;  1XXC A;  2VUM A;  2JA6 A;  3GTO A;  3ORE A;  2XCR B;  3S0X A;  4KM9 A;  1O2A A;  1DD5 A;  3VA7 A;  2CFA B;  2R93 A;  1ZVU A;  5CHP A;  2Y3P A;  4KC6 A;  4G0V A;  1BGW A;  5TJ3 A;  3V4G A;  1WIH A;  2XCQ A;  1O24 A;  5EGH A;  4BLB A;  3ERE D;  3QX3 A;  2GSN A;  2RH6 A;  1I3Q A;  4KMH A;  5JVO A;  4FZB A;  2JH3 A;  2PHC B;  5JFE A;  3GTM A;  2B63 A;  3OPF A;  4KM8 A;  4LR2 A;  4KAR A;  1I50 A;  1O29 A;  4DDQ A;  3GTQ A;  3FOE A;  2R92 A;  1TWA A;  1Y1V A;  3N3Y A;  2KWA A;  4KB2 A;  1SFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...