3N0CA

Tm0449 mutant crystal grown by hanging drop method
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRAFATVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Diffraction study of protein crystals grown in cryoloops and micromounts.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 76
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n0cA00
4FZBA 5JFEA 4KASA 1O24A 1O26A 3G4AA 4GTBA 5IORA 3N3YA 5IOQA 3G4CA 5IOTA 1O2AA 4GTEA 1KQ4A 4KATA 4P5BA 1O28A 4GTAA 1O25A 4KARA 4GT9A 4P5AA 1O27A 5CHPA 4GTLA 3N0CA 1O2BA 1O29A 4GTCA 4GTFA 2CFAA 2CFAB 5IOSA 4GTDA 3AH5A 3N0BA
chains in the Genus database with same CATH superfamily
4OIOA 3H0GC 1Y1VA 3GTOK 3GTMC 3M4OC 4G7HA 4KM8A 4A3IC 4A3EK 5HL8A 4GTBA 2P5MA 4ILDA 4Y7NK 3GEEA 5D4DA 5IOTA 5IYBC 4KM9A 2XCRB 4BXXC 1EQRA 5L46A 4P5BA 1IQ0A 3CQZK 3RZDC 2JH3A 1XZPA 3GDZA 3GEIA 1G51A 1I6VA 2ZUEA 4A3LC 2V6SA 2Y0SL 3GTMK 2XCQA 4J3NA 4OIPA 1XZQB 2E2HA 2A6EA 4O2DA 2E2IC 3HOXC 1PJ7A 4KMDA 5IYBK 1IBAA 5IOQA 3L4JA 3CQZA 4YFNA 3RZDK 3S0XA 4LK0A 4A3CC 4A3LK 1TWFC 1ZQ1C 3GTPA 5IP9C 2RGRA 5TJ3A 4GTCA 1EK8A 3S1RK 2E2IK 2PA8L 1GE9A 4KN7A 2WB1L 1WOOA 4XLPA 1J6VA 5TMCA 3PO2C 1L0WA 3FOEA 1I3QC 1ISEA 5M3FK 2NVXC 4OINA 4A3CK 1F93A 5C3EC 2JA7C 1O28A 4MEYA 3OEPA 4AH6A 4DDQA 5IP9K 1EH1A 5CHPA 1SFOK 4WJ3M 3S17C 3N0CA 1R9TC 4C3HC 3AQPA 4C3IC 4KB2A 4MQ9A 5JFEA 1JVIA 4G0VA 1WCMC 3T01A 3S14C 3S1QC 1AB4A 2GSUA 4KC6A 4G7OA 3JSTA 4KN4A 1VGXA 2Y0SD 4OIQA 3LAJA 1BGWA 1WOSA 4A3BC 4Y52C 3HKZL 1YNNA 2JA7K 3H3VD 5M3MK 1SFOA 4G7ZA 3S17K 4BLAA 4KARA 3S2HC 1R9TK 4C3HK 3K7AC 3HOYC 5EGEA 3BUEA 4GTFA 3VA7A 1WCMK 2CFAA 2CW0A 3S14K 3S1QK 4GTDA 3Q3QA 2R7ZA 4BY1K 3GTKC 4A93C 4FM9A 1O26A 4A3BK 2JA7A 4Y52K 4XSZA 1J98A 1I50C 3I4MC 3S2HK 1R9TA 3SZZA 3K7AK 3HOYK 4LJZA 5E68A 3S15C 4LR2A 4GTLA 1JQWA 2A69A 1PJ5A 1TWAC 1WQHA 3GEHA 1O29A 4JK1A 4YG2A 3GTKK 4A93K 4A3KC 1EFWA 3AD9C 1HQMA 3WODA 5FLMC 3SZYA 4A3MC 1I50K 4BBRC 3GTGK 3I4MK 1V5VA 4BY7C 1VJEA 4LK1A 1ZXOA 2R92K 1TWGA 4BLBA 1WSRA 1BDFA 1TWAK 2NVYK 3HKZD 5FJ8K 4P9SA 4BBSC 4KMHA 2YU9C 4A3KK 4LOWA 4QIWD 3H0GK 2CFAB 3GTOA 3M4OK 4A3IK 4A3MK 3BP3A 1I50A 2JA5C 3GTGA 4BBRK 2V6UA 3H3VL 3QX3A 1XPPA 4BY7K 4BKWA 2R92A 1DCPA 1B4BA 4BXXK 3A8IA 2GAGC 4NOIA 1TWAA 4Q5SA 2GSNA 2NVYA 2O5JA 3HOZC 3NUHA 4BBSK 2YU9K 4A3GC 3FOFA 2A68A 2VUMC 3H0GA 1F9NA 3GTMA 4KB4A 3S16C 3HOWC 2JA5K 1O25A 4A3JC 3AD8C 3HOXK 4M1XA 2FQTA 2JA8C 1ZYRA 3LAPA 3PO3C 5IYCC 1TWCC 1EI6A 3TFIA 3HOZK 2KWAA 4A3GK 3M3YC 1TWFK 2VUMK 4C45A 1TWHC 3HOWK 2A6HA 2Y3PA 2JA5A 2PHCB 1WSVA 2E2IA 4A3JK 4LQYA 3AH5A 4FZBA 3GTJC 1WOPA 3PO2K 5IYCK 1TWCK 1I3QK 1YNJA 1WIHA 3M3YK 3TFJA 2NVXK 1TWFA 1YCLA 1O2AA 3A8JA 5C3EK 2B63C 1Y1WC 3V4GA 1XXCA 4Q4ZA 3FKIC 4QIWL 1O27A 1INNA 5M5WK 3L4KA 4C3IK 3OREA 1DCHA 4YFXA 5M5YK 1I6HC 4KAWX 3GTJK 2D6FC 5CJ9A 2R93C 1I3QA 2NVXA 1RU0A 1WQFA 2B63K 1SMYA 1Y1WK 3I4NC 1IE0A 3GTLC 1K83C 1VH2A 3GTJA 1F7UA 1WCMA 1IL2A 5IYDC 3T02A 2R93K 4PAAA 5C44C 4RMFA 2V6TA 3ERED 4GT9A 1BS2A 3HOUC 1Y1WA 3T00A 4YFKA 2E2HC 4LLGA 5JVOA 4KATA 3GTLK 1K83K 1C0AA 4GTAA 3GIRA 3S15K 1DD5A 4P5AA 2NVTC 3CQZC 1F7VA 4PABA 3GTKA 3MMLB 2GSOA 3HOUK 1VLOA 5FLMK 3GTPC 1X31C 2E2HK 1BJTA 3GTLA 1K83A 3TTGA 3AQOA 4QJVA 1PJ6A 3DXJA 1IW7A 4A3DC 2NVTK 1VRQC 2ZUFA 4KMUA 3IPJA 2PMZD 1XXBA 3EQLA 3GTPK 3AD7C 5IOSA 1J6XA 3S1RC 1YX2A 3TFHA 2E2JC 5M5XK 4A3DK 3G4CA 4C2MC 3S1NC 4GTEA 4ZH4A 4XLNA 2YU9A 1KQ4A 2EBBA 2WAQD 4MEXA 3RZOC 2O5IA 4GZYA 2XCOA 3S16K 3BP8C 1SFOC 3GTQC 1WORA 3HXAA 2GAHC 3N0BA 1IS1A 2FQOA 2E2JK 4KMAA 4KDDA 2JA8K 1DCOA 1JOEA 2PPBA 4C2MK 4A3FC 3S1NK 3PO3K 2ZFZA 3N3YA 5TMFA 2R7ZC 1J6WA 3RZOK 2VUMA 4QJVB 4AYBL 1TWHK 5C4JC 3LPXA 4WJ4A 3OPFA 4X6AC 1XZPB 3S1MC 3GTQK 1O2BA 2JA6C 4OIRA 1O2FB 3S2DC 1TWCA 4A3FK 3G4AA 4BY1C 3GSIA 2R7ZK 2BE5A 4G0WA 1TWHA 2W7VA 4XSXA 5IORA 2NVQC 5EGHA 1ZBSA 4G0UA 1Y1VC 5C4JK 4X6AK 4XCHA 3S1MK 3FKIK 2PMZL 3GTQA 1XXAA 4GFQA 2JA6K 5IP7C 2RH6A 1I6HK 1TWGC 1USOA 3HOVC 3S2DK 2P8TA 1WQGA 1XZQA 4KASA 1O24A 4C3JC 5C4XC 2B63A 4WILA 3A8KA 3ADAC 3CAGA 2NVQK 2PA8D 1USMA 1Y1VK 3GTOC 3I4NK 2WAQL 2WB1D 3FKIA 4A3EC 3GTGC 1UV7A 4Y7NC 2JA6A 5IP7K 2R92C 1TWGK 1B4AA 1HI9A 3HOVK 2R93A 1ZVUA 5IYDK 4AYBD 2NVYC 5C44K 3FHZA 4C3JK 5C4XK
chains in the Genus database with same CATH topology
3Q3QA 4FZBA 2R7ZA 1Y1VA 4FM9A 4KM8A 1O26A 2JA7A 4GTBA 1WIHA 2P5MA 4ILDA 1TWFA 3G4CA 5IOTA 4C2MC 1O2AA 4GTEA 4KM9A 2XCRB 2YU9A 1R9TA 1KQ4A 4P5BA 3V4GA 1XXCA 2JH3A 1O27A 2XCOA 4LR2A 4GTLA 3L4KA 3OREA 1WQHA 1O29A 4KAWX 2XCQA 3N0BA 5CJ9A 1IS1A 4J3NA 1I3QA 2E2HA 4KMAA 4KDDA 2NVXA 1WQFA 4KMDA 2ZFZA 3N3YA 5IOQA 3L4JA 3CQZA 2VUMA 1ZXOA 3S0XA 1TWGA 4BLBA 3LPXA 3OPFA 3GTJA 1WCMA 4KMHA 3GTPA 1O2BA 2RGRA 5TJ3A 4GTCA 1EK8A 2CFAB 3GTOA 3ERED 4GT9A 1GE9A 1TWCA 1I50A 3GTGA 3G4AA 1Y1WA 3QX3A 4BKWA 4G0WA 2R92A 1TWHA 5IORA 3FOEA 1B4BA 5EGHA 1ISEA 1ZBSA 5JVOA 4G0UA 1TWAA 2GSNA 2NVYA 4KATA 3NUHA 1O28A 4GTAA 3GTQA 3OEPA 1DD5A 1XXAA 3FOFA 4GFQA 4DDQA 1EH1A 4P5AA 5CHPA 3H0GA 3GTKA 2RH6A 1F9NA 3GTMA 3MMLB 3N0CA 4KB4A 4C3HC 3AQPA 2GSOA 4C3IC 4KB2A 1O25A 5JFEA 1WQGA 4KASA 4G0VA 1O24A 4C3JC 2B63A 4M1XA 1AB4A 2GSUA 4KC6A 3CAGA 1BJTA 3LAJA 1BGWA 3GTLA 3LAPA 3FKIA 1K83A 3AQOA 2KWAA 2JA6A 1SFOA 4BLAA 4KARA 2Y3PA 1B4AA 2R93A 2JA5A 1ZVUA 2PHCB 2E2IA 5EGEA 3BUEA 3FHZA 1XXBA 4LQYA 4GTFA 3VA7A 2CFAA 5IOSA 4GTDA 3AH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZB A;  5JFE A;  4KAS A;  1O24 A;  1O26 A;  3G4A A;  4GTB A;  5IOR A;  3N3Y A;  5IOQ A;  3G4C A;  5IOT A;  1O2A A;  4GTE A;  1KQ4 A;  4KAT A;  4P5B A;  1O28 A;  4GTA A;  1O25 A;  4KAR A;  4GT9 A;  4P5A A;  1O27 A;  5CHP A;  4GTL A;  3N0C A;  1O2B A;  1O29 A;  4GTC A;  4GTF A;  2CFA A;  2CFA B;  5IOS A;  4GTD A;  3AH5 A;  3N0B A; 
#chains in the Genus database with same CATH topology
 4OIO A;  3H0G C;  1Y1V A;  3GTO K;  3GTM C;  3M4O C;  4G7H A;  4KM8 A;  4A3I C;  4A3E K;  5HL8 A;  4GTB A;  2P5M A;  4ILD A;  4Y7N K;  3GEE A;  5D4D A;  5IOT A;  5IYB C;  4KM9 A;  2XCR B;  4BXX C;  1EQR A;  5L46 A;  4P5B A;  1IQ0 A;  3CQZ K;  3RZD C;  2JH3 A;  1XZP A;  3GDZ A;  3GEI A;  1G51 A;  1I6V A;  2ZUE A;  4A3L C;  2V6S A;  2Y0S L;  3GTM K;  2XCQ A;  4J3N A;  4OIP A;  1XZQ B;  2E2H A;  2A6E A;  4O2D A;  2E2I C;  3HOX C;  1PJ7 A;  4KMD A;  5IYB K;  1IBA A;  5IOQ A;  3L4J A;  3CQZ A;  4YFN A;  3RZD K;  3S0X A;  4LK0 A;  4A3C C;  4A3L K;  1TWF C;  1ZQ1 C;  3GTP A;  5IP9 C;  2RGR A;  5TJ3 A;  4GTC A;  1EK8 A;  3S1R K;  2E2I K;  2PA8 L;  1GE9 A;  4KN7 A;  2WB1 L;  1WOO A;  4XLP A;  1J6V A;  5TMC A;  3PO2 C;  1L0W A;  3FOE A;  1I3Q C;  1ISE A;  5M3F K;  2NVX C;  4OIN A;  4A3C K;  1F93 A;  5C3E C;  2JA7 C;  1O28 A;  4MEY A;  3OEP A;  4AH6 A;  4DDQ A;  5IP9 K;  1EH1 A;  5CHP A;  1SFO K;  4WJ3 M;  3S17 C;  3N0C A;  1R9T C;  4C3H C;  3AQP A;  4C3I C;  4KB2 A;  4MQ9 A;  5JFE A;  1JVI A;  4G0V A;  1WCM C;  3T01 A;  3S14 C;  3S1Q C;  1AB4 A;  2GSU A;  4KC6 A;  4G7O A;  3JST A;  4KN4 A;  1VGX A;  2Y0S D;  4OIQ A;  3LAJ A;  1BGW A;  1WOS A;  4A3B C;  4Y52 C;  3HKZ L;  1YNN A;  2JA7 K;  3H3V D;  5M3M K;  1SFO A;  4G7Z A;  3S17 K;  4BLA A;  4KAR A;  3S2H C;  1R9T K;  4C3H K;  3K7A C;  3HOY C;  5EGE A;  3BUE A;  4GTF A;  3VA7 A;  1WCM K;  2CFA A;  2CW0 A;  3S14 K;  3S1Q K;  4GTD A;  3Q3Q A;  2R7Z A;  4BY1 K;  3GTK C;  4A93 C;  4FM9 A;  1O26 A;  4A3B K;  2JA7 A;  4Y52 K;  4XSZ A;  1J98 A;  1I50 C;  3I4M C;  3S2H K;  1R9T A;  3SZZ A;  3K7A K;  3HOY K;  4LJZ A;  5E68 A;  3S15 C;  4LR2 A;  4GTL A;  1JQW A;  2A69 A;  1PJ5 A;  1TWA C;  1WQH A;  3GEH A;  1O29 A;  4JK1 A;  4YG2 A;  3GTK K;  4A93 K;  4A3K C;  1EFW A;  3AD9 C;  1HQM A;  3WOD A;  5FLM C;  3SZY A;  4A3M C;  1I50 K;  4BBR C;  3GTG K;  3I4M K;  1V5V A;  4BY7 C;  1VJE A;  4LK1 A;  1ZXO A;  2R92 K;  1TWG A;  4BLB A;  1WSR A;  1BDF A;  1TWA K;  2NVY K;  3HKZ D;  5FJ8 K;  4P9S A;  4BBS C;  4KMH A;  2YU9 C;  4A3K K;  4LOW A;  4QIW D;  3H0G K;  2CFA B;  3GTO A;  3M4O K;  4A3I K;  4A3M K;  3BP3 A;  1I50 A;  2JA5 C;  3GTG A;  4BBR K;  2V6U A;  3H3V L;  3QX3 A;  1XPP A;  4BY7 K;  4BKW A;  2R92 A;  1DCP A;  1B4B A;  4BXX K;  3A8I A;  2GAG C;  4NOI A;  1TWA A;  4Q5S A;  2GSN A;  2NVY A;  2O5J A;  3HOZ C;  3NUH A;  4BBS K;  2YU9 K;  4A3G C;  3FOF A;  2A68 A;  2VUM C;  3H0G A;  1F9N A;  3GTM A;  4KB4 A;  3S16 C;  3HOW C;  2JA5 K;  1O25 A;  4A3J C;  3AD8 C;  3HOX K;  4M1X A;  2FQT A;  2JA8 C;  1ZYR A;  3LAP A;  3PO3 C;  5IYC C;  1TWC C;  1EI6 A;  3TFI A;  3HOZ K;  2KWA A;  4A3G K;  3M3Y C;  1TWF K;  2VUM K;  4C45 A;  1TWH C;  3HOW K;  2A6H A;  2Y3P A;  2JA5 A;  2PHC B;  1WSV A;  2E2I A;  4A3J K;  4LQY A;  3AH5 A;  4FZB A;  3GTJ C;  1WOP A;  3PO2 K;  5IYC K;  1TWC K;  1I3Q K;  1YNJ A;  1WIH A;  3M3Y K;  3TFJ A;  2NVX K;  1TWF A;  1YCL A;  1O2A A;  3A8J A;  5C3E K;  2B63 C;  1Y1W C;  3V4G A;  1XXC A;  4Q4Z A;  3FKI C;  4QIW L;  1O27 A;  1INN A;  5M5W K;  3L4K A;  4C3I K;  3ORE A;  1DCH A;  4YFX A;  5M5Y K;  1I6H C;  4KAW X;  3GTJ K;  2D6F C;  5CJ9 A;  2R93 C;  1I3Q A;  2NVX A;  1RU0 A;  1WQF A;  2B63 K;  1SMY A;  1Y1W K;  3I4N C;  1IE0 A;  3GTL C;  1K83 C;  1VH2 A;  3GTJ A;  1F7U A;  1WCM A;  1IL2 A;  5IYD C;  3T02 A;  2R93 K;  4PAA A;  5C44 C;  4RMF A;  2V6T A;  3ERE D;  4GT9 A;  1BS2 A;  3HOU C;  1Y1W A;  3T00 A;  4YFK A;  2E2H C;  4LLG A;  5JVO A;  4KAT A;  3GTL K;  1K83 K;  1C0A A;  4GTA A;  3GIR A;  3S15 K;  1DD5 A;  4P5A A;  2NVT C;  3CQZ C;  1F7V A;  4PAB A;  3GTK A;  3MML B;  2GSO A;  3HOU K;  1VLO A;  5FLM K;  3GTP C;  1X31 C;  2E2H K;  1BJT A;  3GTL A;  1K83 A;  3TTG A;  3AQO A;  4QJV A;  1PJ6 A;  3DXJ A;  1IW7 A;  4A3D C;  2NVT K;  1VRQ C;  2ZUF A;  4KMU A;  3IPJ A;  2PMZ D;  1XXB A;  3EQL A;  3GTP K;  3AD7 C;  5IOS A;  1J6X A;  3S1R C;  1YX2 A;  3TFH A;  2E2J C;  5M5X K;  4A3D K;  3G4C A;  4C2M C;  3S1N C;  4GTE A;  4ZH4 A;  4XLN A;  2YU9 A;  1KQ4 A;  2EBB A;  2WAQ D;  4MEX A;  3RZO C;  2O5I A;  4GZY A;  2XCO A;  3S16 K;  3BP8 C;  1SFO C;  3GTQ C;  1WOR A;  3HXA A;  2GAH C;  3N0B A;  1IS1 A;  2FQO A;  2E2J K;  4KMA A;  4KDD A;  2JA8 K;  1DCO A;  1JOE A;  2PPB A;  4C2M K;  4A3F C;  3S1N K;  3PO3 K;  2ZFZ A;  3N3Y A;  5TMF A;  2R7Z C;  1J6W A;  3RZO K;  2VUM A;  4QJV B;  4AYB L;  1TWH K;  5C4J C;  3LPX A;  4WJ4 A;  3OPF A;  4X6A C;  1XZP B;  3S1M C;  3GTQ K;  1O2B A;  2JA6 C;  4OIR A;  1O2F B;  3S2D C;  1TWC A;  4A3F K;  3G4A A;  4BY1 C;  3GSI A;  2R7Z K;  2BE5 A;  4G0W A;  1TWH A;  2W7V A;  4XSX A;  5IOR A;  2NVQ C;  5EGH A;  1ZBS A;  4G0U A;  1Y1V C;  5C4J K;  4X6A K;  4XCH A;  3S1M K;  3FKI K;  2PMZ L;  3GTQ A;  1XXA A;  4GFQ A;  2JA6 K;  5IP7 C;  2RH6 A;  1I6H K;  1TWG C;  1USO A;  3HOV C;  3S2D K;  2P8T A;  1WQG A;  1XZQ A;  4KAS A;  1O24 A;  4C3J C;  5C4X C;  2B63 A;  4WIL A;  3A8K A;  3ADA C;  3CAG A;  2NVQ K;  2PA8 D;  1USM A;  1Y1V K;  3GTO C;  3I4N K;  2WAQ L;  2WB1 D;  3FKI A;  4A3E C;  3GTG C;  1UV7 A;  4Y7N C;  2JA6 A;  5IP7 K;  2R92 C;  1TWG K;  1B4A A;  1HI9 A;  3HOV K;  2R93 A;  1ZVU A;  5IYD K;  4AYB D;  2NVY C;  5C44 K;  3FHZ A;  4C3J K;  5C4X K; 
#chains in the Genus database with same CATH homology
 3Q3Q A;  4FZB A;  2R7Z A;  1Y1V A;  4FM9 A;  4KM8 A;  1O26 A;  2JA7 A;  4GTB A;  1WIH A;  2P5M A;  4ILD A;  1TWF A;  3G4C A;  5IOT A;  4C2M C;  1O2A A;  4GTE A;  4KM9 A;  2XCR B;  2YU9 A;  1R9T A;  1KQ4 A;  4P5B A;  3V4G A;  1XXC A;  2JH3 A;  1O27 A;  2XCO A;  4LR2 A;  4GTL A;  3L4K A;  3ORE A;  1WQH A;  1O29 A;  4KAW X;  2XCQ A;  3N0B A;  5CJ9 A;  1IS1 A;  4J3N A;  1I3Q A;  2E2H A;  4KMA A;  4KDD A;  2NVX A;  1WQF A;  4KMD A;  2ZFZ A;  3N3Y A;  5IOQ A;  3L4J A;  3CQZ A;  2VUM A;  1ZXO A;  3S0X A;  1TWG A;  4BLB A;  3LPX A;  3OPF A;  3GTJ A;  1WCM A;  4KMH A;  3GTP A;  1O2B A;  2RGR A;  5TJ3 A;  4GTC A;  1EK8 A;  2CFA B;  3GTO A;  3ERE D;  4GT9 A;  1GE9 A;  1TWC A;  1I50 A;  3GTG A;  3G4A A;  1Y1W A;  3QX3 A;  4BKW A;  4G0W A;  2R92 A;  1TWH A;  5IOR A;  3FOE A;  1B4B A;  5EGH A;  1ISE A;  1ZBS A;  5JVO A;  4G0U A;  1TWA A;  2GSN A;  2NVY A;  4KAT A;  3NUH A;  1O28 A;  4GTA A;  3GTQ A;  3OEP A;  1DD5 A;  1XXA A;  3FOF A;  4GFQ A;  4DDQ A;  1EH1 A;  4P5A A;  5CHP A;  3H0G A;  3GTK A;  2RH6 A;  1F9N A;  3GTM A;  3MML B;  3N0C A;  4KB4 A;  4C3H C;  3AQP A;  2GSO A;  4C3I C;  4KB2 A;  1O25 A;  5JFE A;  1WQG A;  4KAS A;  4G0V A;  1O24 A;  4C3J C;  2B63 A;  4M1X A;  1AB4 A;  2GSU A;  4KC6 A;  3CAG A;  1BJT A;  3LAJ A;  1BGW A;  3GTL A;  3LAP A;  3FKI A;  1K83 A;  3AQO A;  2KWA A;  2JA6 A;  1SFO A;  4BLA A;  4KAR A;  2Y3P A;  1B4A A;  2R93 A;  2JA5 A;  1ZVU A;  2PHC B;  2E2I A;  5EGE A;  3BUE A;  3FHZ A;  1XXB A;  4LQY A;  4GTF A;  3VA7 A;  2CFA A;  5IOS A;  4GTD A;  3AH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...