1ZBSA

Crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
MILIGDSGSTKTDWCIAKEGKSLGRFQTSGINPFQQDRNEIDTALRSEVLPAIGQKASSIRAVYFYGAGCTPAKAPMLNEALDSMLPHCDRIEVAGDMLGAARALCGDSEGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQMPEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSFDDFLVRNVLRYNRPDLPLHFIGSVAFHYREVLSSVIKKRGLTLGSVLQSPMEGLIQYHHNNHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PG1100
total genus 82
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zbsA03
4PL7A 4A62A 3D2EB 2YJFA 4A61A 3D7EO 5B8HA 3H1VX 4CZEA 3CHWA 5BRFA 3WXJA 4BGAA 4CBXA 4BC4A 2EWSA 5EX5A 1ZC6A 4O5FA 5AQRA 4RWTA 3VEWA 2P9PB 1HLUA 5AQOA 3U4LA 2CH5A 2E88A 3WUHA 4QS7A 3A5MC 1GLDG 4B9QA 1BA0A 1ESVA 4CZIA 1KAZA 2A42A 4NB4A 3KVGA 2ASOA 2GUPA 2VYPA 3CIPA 3D2EA 1U2VA 5AZIB 2QWLA 5BR9A 3ZETA 3H3OB 4GNIA 4DQ8A 5F1XA 1P8ZA 3R9PA 2P9KA 2J4RA 3R6MA 4BRLA 2P9PA 3CJBA 1X9JA 3TPQA 4WQ5C 4H03B 1BUPA 1GLEG 4FWKA 4B1ZA 4BC2A 4BR7A 2D0PA 4XH5A 2GEMA 3RSEA 3O1WA 3CJ1A 3FZFA 2HF3A 3EN9A 3VEXA 1U2VB 2E1ZA 2P9UA 2KHOA 1DEJA 4MLHA 3J8AA 5AQKA 3QFUA 2A5XA 3QB0A 1HPMA 2GWKA 4BRIA 3LDQA 5LJVA 4HTLA 2ZWHA 2YJEA 1RFQA 1V4TA 4H5RA 3O08A 3MN9A 1D4XA 3A5LC 3B8AX 1SAZA 3L6QA 3QICA 2QWNA 1NGDA 5AQGA 2I7PA 1BG3A 3H1QA 4BR0A 1NWKA 3I8BA 1BO5O 4NO7A 4A2BA 3M1FA 3QBXA 1MDUB 3G25A 1E4GT 1BWFO 2A40A 2E2NA 2QW9A 5AQNA 5KQDA 2QWRA 4ISGA 4H0OA 3D2FA 5KPTA 1ATRA 3CQYA 3DJCA 3W0LA 3S41A 1HKGA 1Y64A 2ASPA 4IJAA 2A3ZA 2I7NA 3VPZA 2YHWA 4BG9A 3QDKA 4BRMA 2QM1A 3MK6A 3U9DA 4YDUC 3WXKA 2NRHA 1YXQA 3GBTA 5BN8A 1LOTB 4BQLA 1DKGD 4IZ9A 4FL9A 5AQWA 3QFPA 1KXPA 2WUSA 4H0XB 5JLFA 5BREA 3A0IX 4JD2A 4J8FA 2CGJA 4IXCA 4QS8A 3SLCA 1KAYA 2GELA 1NGAA 2NZTA 2FF6A 2QWOA 4L3QA 3ATUA 5AQSA 3HSCA 3ZX2A 3A8YA 3L4IA 3WEEA 4FWLA 2A6AA 2BTFA 4DB3A 1GLBG 4H0YB 1NGHA 1GLFO 2A41A 3DXMA 2YI1A 2HF4A 5AFUA 2AA4A 4B1WB 1J6ZA 4BRAA 3IMXA 1V4SA 1ZXOA 2PBDA 4K25A 1JCFA 3M6GA 1NGEA 3DXKA 5AQFA 4B1YB 3VF4A 5BRDA 5BPMA 1LCUA 3L0QA 4BRNA 3GOIA 1TYQA 2IIRA 3VEYA 1QZ5A 1E4FT 1QZ6A 2VCPA 1CZAN 3H3NO 4I6MB 3R8EA 1T44A 2E1YA 3FZKA 3VGLA 4Z94A 1YVNA 2OANA 3VESA 1XC3A 3SMPA 4KBOA 4FPAA 4H5VA 3UKRB 3ENHA 5AQYA 1QHAA 4CZLA 4GY2B 2HOEA 3MCPA 2DPNA 3P4IA 2IVNA 4BVOA 3QBWA 3A5NC 3HZ6A 4H0TB 1ZBSA 1NGIA 3ZETB 3DXKB 4DCHA 5AR0A 4BVPA 4CBUA 4CZKA 4E1JA 1H1VA 2V7YA 5AFUH 5AQPA 5AQZA 1G99A 4C23A 1GLCG 2V7ZA 3EKUA 5EOYA 2P9SB 3VETA 2GTDA 3KZBA 5KPZA 1R59O 2F9WA 1ATNA 2W40A 3DWLA 3HBTA 3O80A 1IG8A 4FOIA 4B1UB 2IVPA 2E8AA 4CZJA 2CH6A 1T6DA 4PL8A 5KPRA 2HMPA 4A2AA 4RCHA 4CJ7A 4CZGA 3C7NA 3UKUB 3H45C 2P9NB 4XH4A 1HKBA 3GL1A 2IVOA 4H5NA 1GLJO 3O4WA 3ATVA 4IO8A 5F2RA 4FWOA 4I6MA 4BRCA 5CE3A 1WUAA 4BC5A 2E2PA 3IFRA 2FSKA 1KAXA 3UKRA 2BUPA 4FSVA 2E2QA 1BU6O 4BROA 3OHRA 4CD3A 5ADXH 1TUYA 3BF3A 3C0BA 3CQXA 3FE1A 2P9LA 3JS6A 1C0GA 3VEZA 2QWQA 4CD1A 4JNEA 5JICA 3D2FB 4ISEA 3LM9A 1X3NA 3WXLA 4FOEA 3BUZB 2W41A 4O8KA 2D4WA 2ZF5O 3FZMA 3AY9A 4FWRA 5ADXA 3LDPA 5AQHA 4BRFA 3VEOA 1HX1A 3UE5A 5JLHA 2ZGZA 2E2OA 4BC3A 4H0PA 1NGJA 2QXLA 4K41A 3ID8A 4H5WA 1NLVA 1QQOA 1EQYA 4H0VB 4M63C 2FLOA 5AZIA 3LDLA 4FWSA 4IWVA 4QS9A 3ZX3A 4BREA 3UB5A 1YUWA 2ZGYA 4BQZA 5BPNA 3IUCA 2V51B 5AQLA 5FPEA 2QWPA 5AZJB 1T6CA 2F9TA 4YDUA 3O5BA 4MO4A 5JMVA 1Q18A 4EAHD 4B1VA 4FWMA 3CI5A 5I9EB 4FWNA 5LY3A 2ITMA 1JCGA 2YHXA 4XEIA 5AQUA 3SK3A 3VENA 4AM6A 3WXIA 1NGFA 4H5TA 4EHTA 2D1KA 4Y0WA 5BN9A 3VF2A 5EY4A 1C0FA 1Z6RA 3ULEA 3MN6A 1YAGA 3U8XA 4CZHA 5AQQA 1NMDA 4IJNA 4CBWA 2GWJA 1Z05A 2FSNA 2YCHA 4LC9B 5BRHA 1MWMA 4WQ5A 1QQNA 3CJAA 3LDNA 5AQXA 1SQKA 1BA1A 2Q2RA 1IJJA 4JN4A 1WOQA 3EL2A 4M7YA 4RTFD 5LJWA 2QWMA 5AQMA 4CI6A 3H6EA 2D0OA 2ASMA 1GLAG 3AAQA 3MN7A 3CJ7A 4PKHA 4BRGA 4WQ4A 3WQTA 3BF1A 1X3MA 3VEVA 3ZEUA 1NGCA 2AP1A 2FSJA 2Q36A 5AQJA 5AQVA 2UYTA 5FPMA 2P9KB 1OKJA 3A5OC 4BR4A 3EKSA 4BR5A 1TUUA 4FWQA 3F9MA 2NLXA 1U6ZA 3HTVA 3VF6A 1JCEA 3C7NB 3SJHA 3UKUA 3VOVA 1MWKA 3SMSA 3WEEB 1SZ2A 4JHDA 1XUPO 4BRKA 1MA9B 1RDWX 5EXWA 3BP8A 5AQIA 4K43A 4DHYA 3DXMB 4CZMA 3TU5A 2P9IA 4BR2A 2PAVA 4EFHA 4M7XA 3HM8A 2FXUA 3FFKB 4BR9A 3ENOA 4BRQA 1GLLO 1NBWA 1HJOA 4AM7A 5F0XA 3O1BA 4PKIA 1BDGA 3EZWA 1K8KB 1TYQB 4K42A 5EVZA 3CETA 3U9ZA 2P9LB 3FGUA 1DGKN 1S3XA 5TKYA 1S22A 1HKCA 3HI0A 4BRPA 5BPLA 3ZEUB 2Q97A 3CJ9A 3CERA 4BG8A 4HWIA 4WQ4C 3O8MA 1BOTO 1RGIA 3GDQA 3AAPA 3AARA 2P9IB 4FWPA 3FZHA 3JXUA 3WT0A 3LL3A 4EHUA 4JAXA 4PKGA 4XH1A 2VWBA 4BRHA 5ELZA 4B1XB 4BGBA 2Q0UA 3MDQA 3VGKA 3MMVA 1XQSC 1ATSA 1NGBA 2CGLA 2H3GX 3EO3A 4FO0A 3WQUA 2E20A 3GG4A 4CZFA 3QMLA 3VERA 3LDOA 2YHYA 3I33A 5AQTA 3CJCA 4JHDB 4MO5A 5AZJA 3FZLA 4ISFA 3H46O 3VGMA 4EIAA 2V52B 1HUXA 4BRDA 3ZX0A 4FPBA 4JD2B 2P9SA 3LM2A 2CGKA 3MN5A 3O6WA 4WYBA 5E84A 3W3DA 4F9OA 5FPDA 3GE1A 1K8KA 1QQMA 3KHYA 1NM1A 3FLCO 3M3ZA 3IDHA 2Q31A 2Q1NA 2P9NA 5KQ8A 5FPNA 3RSEB 3ULEB 5E26A 2FF3B 1NGGA 4MLEA 2Q0RA 3BEXA 3FR0A 3DAWA 2P9UB
chains in the Genus database with same CATH superfamily
5J1EA 4PL7A 5C0YA 2ZQBA 3HK2A 3S16K 2BANA 4FZXC 2O8DB 3CQZA 5C42A 3CHWA 5BRFA 4CBXA 2XO7A 4GKJK 1IS1A 1RT5A 1ZC6A 4O5FA 3OYFA 1QTMA 1JL1A 2QKBA 3OREA 4BLAA 1VQKN 4KATA 1WSFA 1HR0K 3N3YA 3CCJN 5CHPA 4ZH4A 4R5PA 1L3VA 4HVJA 3GTKC 1GLDG 4AH6A 4DV7K 2R93K 1KAZA 4NB4A 1A5WA 4WFAL 4YNQA 4KARA 1BL3A 4O44A 3V9WA 1VLOA 2Y1JA 5F1XA 3V1QA 3TANA 3R9PA 2P9KA 4A3KK 4KTQA 3OYJA 4FZBA 4FJ5A 4MDAA 1EKEA 1X9JA 5GAGP 3ZSZA 4FLYA 3M8SA 1XNRK 2BE2A 5M1QA 4J3NA 2B5JA 5FLMC 4BC2A 4C8LA 4ID5A 4B3TK 2NVTK 3VQBA 1XZQA 4J2DA 2XY5A 1ZBLA 1U2VB 1VSMA 4KFBA 1NMNA 4DU3A 3AQPA 4JI0K 3OPFA 1KTQA 1I39A 1CXUA 4Q5SA 3LALA 4YOUA 3O9RA 3ZSRA 5FJ8K 5AJ3K 3KLGA 3BGRA 3QEXA 3BP8C 4H5RA 1NU0A 1VSHA 3B6OA 2UXBK 1RT3A 2GSUA 1BG3A 3MEEA 2D0CA 4BR0A 2NVYK 3H3VD 3LAKA 4OPAA 4NO7A 1HQUA 1IH7A 3M1FA 3G25A 4A3DC 3CC4N 4DTSA 4CEOA 2A40A 2E2NA 2FC0A 1T05A 5C2DA 1OVYA 1GOAA 3THWB 2QWRA 3AA4A 4ISGA 4YFUA 3CAGA 2ZUFA 1B9FA 1LWEA 3LP3A 3CQYA 4Z4FA 2HHTA 1HKGA 1KQ4A 2QKKA 4G7ZA 1Q8IA 2YNGA 3QEIA 1F93A 3GTPK 2A3ZA 1NOZA 4JLHA 3AVMA 2ATQA 4BRMA 4CJ4A 1KRPA 4GTBA 2JA5K 1J54A 3U9DA 1SL2A 4FXDA 4XSZA 3S17K 1WBDA 3WXKA 2NRHA 3ZLJA 1XZQB 3RZDC 1X9WA 4A3BC 1DKGD 4IZ9A 4FL9A 1VRTA 4YFNA 3ZCMA 3S0XA 4EZ9A 4QJVA 4H0XB 3M4OC 5JLFA 4IG3A 3A0IX 3HJFA 4LFBK 4A3JK 2CGJA 3T69A 1G51A 1R9TK 1NGAA 2FF6A 4KHYA 1C0UA 1QSLA 1WQGA 4DU1A 4YFXA 4A3GK 1SKRA 3OJSA 1YJ9N 3NF8A 2HMIA 3P83D 1GLBG 3CYMA 4CJ3A 4B3SK 1NGHA 1BI4B 1IKWA 1K83A 4FJJA 5AFUA 4X6AK 1HPZA 3MXMA 4BRAA 4QIWL 3FOFA 3IMXA 1JCFA 3M6GA 2NVTC 5BRDA 4KN4A 1TKZA 5D3GA 3EZ5A 4DQQA 4C3JK 3HOZK 3TTDA 3H3NO 3K5LA 2VCPA 1CZAN 4I6MB 1SFOK 4KHWA 3AQOA 3GEHA 4OIPA 4IO9L 1KD1O 2OTLN 4Z94A 4IKFA 2A6EA 2OANA 3C6AA 3VESA 4LFCK 2KZMA 2RGRA 4H5VA 1BGWA 4E7IA 2XY8A 1EWRA 1N32K 1TWGK 3G4AA 2IVNA 4JK7A 1FKPA 4QJVB 4E7JA 5C44K 3S2HC 1T3VA 5K14A 4AH9A 3HL8A 4DFMA 3GTQA 3GDZA 4CZKA 2JA6C 4O0IA 4KREA 2RF2A 4GFQA 1ITGA 3AD8C 1VHXA 4M45A 2FBXA 5AQZA 2OYQA 4OIRA 1VQLN 3GTJK 1TWCC 1GLCG 3OYMA 4DSIA 3DOLA 4KH4A 1O2AA 2P9SB 3VETA 1N33K 5HL8A 3LP1A 1R59O 2W40A 1ATNA 3O80A 4FK4A 4M1XA 4ILGB 4CZJA 2CH6A 1BS2A 4KMHA 1X31C 1WOOA 5JVGL 2HMPA 1PJ7A 4HHTA 1HNZK 4XH4A 4JI3K 3O4WA 4Q5VA 2E2HC 5C4JK 4FWOA 2PHCB 3HXAA 4BRCA 1WLJA 2F8TA 3RMBA 3IFRA 2O5IA 4GV6A 2Y0SD 1KAXA 4XLNA 1WORA 3ULDA 1O2BA 2E2QA 2YHBA 4BROA 3OHRA 1UV7A 4KB2A 1JLEA 3FE1A 2O8FA 4KAWX 2P9LA 2VUMC 3JS6A 4M3YA 5KGXA 3S1RC 1WCMC 3AV9A 4R79A 3T1YK 3LM9A 1WNSA 3TTCA 2NVXA 4BACA 1WOPA 3VN5A 3TTFA 4DTUA 3LDPA 4QOZB 4JS5A 3L2RA 1ZYQA 3T02A 3CXCM 4GVMA 4C8KA 1NGJA 1WOSA 4KASA 1B92A 4CFAA 1EQYA 4M63C 5AZIA 4YOWA 3L2VA 1I50K 1WSRA 4FWSA 5HP1A 4KHSA 4BREA 3CCUN 1TWFK 3RR8A 1UOCA 2V51B 5DMRA 5AQLA 3I56N 1LAVA 3SZYA 4NCAA 2JWLA 4A3CC 1XHZA 4A3FC 3HP6A 3THXA 1ASVA 4N47A 3SV4A 2ZM6K 2ITMA 1TK8A 2PMZL 5AQUA 5L46A 1RTDA 3SK3A 4FZYA 5IORA 5HRRA 2YNHA 3CCVN 4LFAK 3WXIA 1NGFA 1K8AO 4EHTA 1D5AA 1XXCA 2NVQC 1JVIA 4JV5K 4DR7K 3NF7A 1C0FA 1Z6RA 2YKNA 3O9SA 4CHQA 4B9NA 4A3MC 4OVLA 1R9TC 1VQPN 4E1MA 1NG9A 4FYDA 4LC9B 5BRHA 1KFDA 4A59A 2XRIA 2VG5A 3DMJA 3CJAA 3CPEA 3LDNA 3TAMA 4CJKA 3KWGA 4CGHA 1IJJA 2VGNA 4JN4A 5KTQA 3O3GA 2PFUA 3VQQA 5AQMA 1TKTA 5IYBK 3H6EA 2D0OA 3N0BA 3IKMA 3AVGA 5GIOA 2BGGA 4DMNA 4OKKA 4CEFA 5KRTA 4C3IC 3IRXA 4HTUA 3O3HA 5C12A 1X3MA 3VEVA 3ZEUA 3NDKA 4KI6A 2CW0A 2AP1A 4W5RA 4WJ4A 4Q0BA 3GEIA 3AD9C 1BIUA 1Q82O 3CF5L 2A6HA 4FM0A 1YNJA 4BR4A 3R3LA 1LAWA 4BR5A 1TUUA 1VK0A 3F9MA 1Z26A 2NLXA 1U6ZA 4CW7B 4A3MK 1Y1VA 2Y0SL 3T3FA 1W97L 4KM8A 4JHDA 4BRKA 1MA9B 1RILA 3PO5A 1EI6A 5IOQA 4DHYA 1U45A 3VQ5A 2GUIA 1UA0A 3NE6A 3OYAA 4CEAA 1WN7A 4RW9A 3ZSWA 3HM8A 4BDPA 2FXUA 1IW7A 4BR9A 2FBVA 3ENOA 1GLLO 3QINA 2QXFA 1NBWA 1HJOA 3EZWA 3GTKK 1WBBA 3HYFA 4FJMA 2YV0X 4BBSC 2HHUA 3OEPA 1S22A 3I4MC 3HI0A 4GV9A 4I9LA 3WNGA 3GTOK 4KMUA 4KMDA 4LF5K 4BG8A 4HWIA 4DUYK 3S1QK 4DFPA 1JJ2M 3A8JA 5IYDC 4CEEA 3P1GA 4BXXC 3O9QA 3PUFA 1VSFA 3WT0A 3ZSOA 1O24A 4E7KA 5ELZA 1JLBA 3OW2M 1TL1A 3VQ4A 4DSJA 1HMVA 3VGKA 4CE9A 5EU7A 1I6VA 1XQSC 1SS6A 3PO3K 3EY1A 5IYCC 3KKRA 1NGBA 2CGLA 4FO0A 2E20A 3GG4A 3QMLA 4MEXA 4A3KC 4ID1A 5AQTA 3I33A 2OPRA 4I9QA 5FRMA 5AZJA 2KKZA 3AA3A 4ISFA 3AO3A 3ID6A 3DRSA 4NYNA 4YOYA 2V52B 1RDAA 2NVXK 1U49A 4DS5A 4BRDA 5FROA 4CHPA 1LWCA 1UAXA 3SJJA 4JD2B 1NJYA 4ILHA 1OH8A 2HSTA 3AVHA 2XY6A 3DLGA 1I3QC 4CJQA 3W3DA 4CF2A 5FPDA 3MWTA 1WAJA 5IYDK 5CHIA 4WJ3M 2CFAB 4CHZA 5IYCK 5KQ8A 3RSEB 1FW6A 4M3RA 4E3SA 3ULEB 1DCOA 4ILJA 2JA7A 2FF3B 4A5AA 4KTZA 3A8KA 2Q0RA 3TR8A 4M42A 5H1SQ 4A62A 1EXQA 5B8HA 1YF5L 3H1VX 3WXJA 4ILDA 3C65A 3AVLA 5KRSA 1O13A 5AQRA 5AQOA 1IKXA 1O29A 2E88A 1KLNA 3JSTA 4FCYA 3I4NK 2A1RA 3WUHA 2HBKA 1VQ4N 1ZBHA 3CQZC 3A5MC 1BA0A 1ESVA 4CHYA 4O2DA 4FJKA 3G10A 1IO2A 2A42A 4F4KA 3KVGA 1UWBA 2KW4A 2D6FC 3D2EA 5AZIB 2P8TA 4YHHK 4LR2A 2QWLA 3OS2A 4Z4EA 3H3OB 2F4VK 3CM5A 3M4OK 4DQ8A 4N56A 2ZD1A 3S9HA 3HPGA 2J4RA 1FJGK 4BRLA 3SQ2A 4WE1A 4WQ5C 4M3TA 4F3OA 1YJWN 1BHLA 1TWGA 4K8XA 2YX6A 3OYNA 2JA8C 4BR7A 3DLKA 3SPYA 4XH5A 3CJ1A 3KK1A 3FZFA 3BY5A 3VEXA 4KHQA 3ADAC 4CJEA 4U67L 2P9UA 4O5BA 4AYBL 3VA3A 4KN7A 1DEJA 3Q7CA 3GIRA 2GX9A 3KD5E 3FKIK 5M3MK 4BRIA 4CJTA 2HW3A 3KTQA 2YJEA 4FLUA 1RFQA 1K83K 2E2IC 3MN9A 4IDKA 3HOYK 3QICA 3L6QA 4YFKA 2QWNA 3N4QA 4CJLA 1RBUA 3MECA 3OYLA 4IOCL 3QBXA 3HT3A 1E4GT 5HRNA 2UUBK 3RRGA 1JKHA 1SL0A 3QNNA 3O9TA 4RG8A 5E41A 5C4XC 1C6VA 4G9ZA 4H0OA 3D2FA 4C8MA 4CHNA 1TK0A 4JRQA 2JA5C 3W0LA 1S6PA 3S41A 1TVRA 4IEIA 3EYZA 1HYSA 2QI2A 4IJAA 3VPZA 3S14K 1YTUA 2IS3A 4E1NA 4KI4A 2QM1A 2HNYA 4DLEA 1O28A 2P9UB 1WSJA 4FLTA 5BN8A 4IFYA 3KJVA 4CJPA 1I50C 4FJHA 1KXPA 4DV2K 5FRNA 4ZHRA 4YG2A 3GTPC 4QS8A 3PV8A 3CQ8A 4CJRA 2RKIA 2WB1L 4OJRA 1YVUA 3ZSYA 1RCHA 3L4IA 3TAFA 3I4NC 1U4BA 3FHZA 3PX0A 2HHVA 1GLFO 2A41A 3DXMA 3SZ2A 3TFHA 2ETJA 2HF4A 3Q7BA 4B1WB 4LK1A 3QEVA 2G8UA 1V4SA 4CFDA 4AHTA 2PBDA 2FQTA 2JH3A 1XMQK 3L4QA 3K0SA 3NHGA 1IBAA 4C3HC 4B3OA 1LCUA 3L0QA 4FK0A 4BRNA 2R7ZC 1DTQA 3SCXA 3GOIA 2IIRA 5D4DA 1QZ6A 3K7AC 2XCRB 4FJ7A 1T44A 3DRPA 3FZKA 1WCMK 4DLGA 2G8WA 1XC3A 3ENHA 2DPNA 4JKBA 3CCQN 3QBWA 4C8OA 3HZ6A 4H0TB 3CG7A 2E2JC 1CZ9A 4CGDA 4CGIA 1TWHC 4RW7A 4HCCA 4LF6K 1H1VA 1EK8A 3IS9A 3TARA 1NK8A 1B4BA 4LQYA 4FJ9A 1NOYA 4KB0A 4CF8A 3SUNA 4OGCA 4KHUA 5EOYA 2R93A 2NUBA 3KZBA 3T1HK 1SL1A 2F9WA 3HBTA 4DTJA 3DWLA 3DLLL 4KC6A 2WONA 4KH5A 4CHOA 4G0UA 2V6UA 3NCIA 1X1PA 2E8AA 5T7BA 5CJ9A 3SYZA 1JLFA 4IFEA 3HOWC 4PL8A 5KPRA 3LAMA 4CJ7A 4RCHA 3C7NA 2P9NB 1TGOA 1WIHA 1HKBA 1D9FA 2KLAA 2EBBA 2VG6A 1D8YA 4KTWA 4H5NA 3OBYA 5F2RA 4HUGA 4I2PA 4I6MA 1HNVA 2HVHA 1VQ8N 4YOTA 3QNOA 2R92C 3GTQC 1QHTA 2IDOA 4WFNL 1DCHA 4W5NA 5EGHA 1VSIA 1S5JA 1L5UA 1R0AA 1TUYA 1NJXA 4I7FA 1S9GA 1HQEA 3A2FA 2QWQA 4FM2A 1SFOC 4JNEA 3M5RA 5C3EC 5JICA 3E1YA 2R7YA 2FBTA 3PSFA 3ZSVA 3L4KA 4NCBA 4O8KA 2D4WA 5ADXA 1J98A 4JS4A 5LMNK 1HX1A 3CCMN 3UE5A 2E2OA 4BC3A 1OH6A 4Z4CA 2QXLA 4K41A 1JLQA 2XHBA 3SUOA 2GAHC 1RDDA 1K6YA 3LDLA 4QAGA 3UB5A 3KKSA 2ZGYA 4BQZA 1B4AA 3IUCA 3HOUK 3M3YC 2KFZA 5FPEA 2QWPA 1VJEA 1BCMA 3PO2C 4B9LA 3L2WA 3H08A 4P5BA 1QSSA 4EAHD 3C94A 4B1VA 5LY3A 3OYHA 3NF9A 2IOCA 1JCGA 5J2PA 1ASWA 1BQNA 4A3BK 1YTAA 3VENA 2X78A 1NK0A 2G8FA 4H5TA 1TL3A 3K57A 4PY5A 4CESA 1RBRA 4Z0UA 3MAQA 3RTVA 3MN6A 1YAGA 3U8XA 1Q86O 4CZHA 2PA8D 3G4CA 4E7HA 3CC7N 4CBWA 1NK9A 1Z05A 1MU2A 2WOMA 5M1FA 2O8DA 5GAHP 4X62K 4A3IC 1QQNA 3MCAB 5AQXA 1EQRA 5M1OA 4CCHA 3LP2A 3ZT0A 3MEGA 3GSIA 4A5BA 1HNWK 3ZT4A 2UXCK 3AO4A 1GLAG 4CF0A 2PZSA 3PIPL 4JK9A 3AD7C 3BF1A 3M8PA 2B63A 3F2KA 4O8UA 4DQPA 5HLFA 2FSJA 3GTMA 3S3MA 3UIQA 5GAEP 3T1AA 3HOVC 3S3OA 5AQVA 4FJGA 2O8CB 1BQMA 2UYTA 2B63K 2HB5A 5HRPA 3ZT1A 3TSUA 2B4JA 3I0SA 2P9KB 3VMFB 3RWUA 3A5OC 4DWIA 3HOVK 4LD0A 1E3MA 4G7HA 1VQ5N 3EKSA 5GINA 3E01A 4FWQA 4B8AB 3S14C 4DR2K 4DG1A 1JCEA 1BDFA 3SJHA 3P31A 1MWKA 4IBNA 1J5EK 5IP9K 3QIPA 1VAZA 3BP8A 4DV5K 5CYQA 2Q3SA 1O26A 3DXMB 4FLWA 4CZMA 3GTLC 5IT9O 3LAPA 3TU5A 2P9IA 2HBJA 3C6TA 3MX5A 3O4NA 1SUQA 4CK2A 3KK3A 4FJLA 4FVUA 4GTEA 4Z4HA 2UU9K 2HHSA 3RR7A 3FFKB 1WQFA 4BRQA 1KVBA 3AH5A 5F0XA 1RU0A 2E2HA 4PKIA 2YHAA 2FQOA 3JAMO 3HO1A 3SAFA 3VA0A 4CJSA 3U9ZA 3CQZK 3RZOK 3RVCA 2JA7C 3FGUA 4X65K 2UXDK 4LSLA 4BRPA 5BPLA 3ZEUB 5C4JC 3CJ9A 3ENBA 2HHHK 3U3GA 4JKGA 3O8MA 1BOTO 3GDQA 5J2NA 4GMJB 1TWAA 3VQPA 5TKWA 5I42A 4DF8A 3ZT3A 3FZHA 3L2UA 1GOBA 4JI8K 3E9LA 4JAXA 5KI6A 1ISEA 2VWBA 4KAZA 5IOTA 4B1XB 1OVQA 4BGBA 3DI6A 3E66A 4DTRA 4DQIA 2ZUEA 1L3TA 4OPHA 1W7AA 3LAJA 1HNXK 2GV9A 3ZT2A 4FLVA 1ATSA 3VQEA 1S72N 3EO3A 3VA7A 4CZFA 3VQ6A 3QLHA 3LDOA 1NKEA 5M1PA 4JHDB 1YCLA 2HHQA 3FZLA 1QE1A 3V6DA 3CCSN 3HOWK 4EIAA 2DTUA 3KK2A 4LF9K 3THXB 3SBTA 2D5RA 3SPZA 3MN5A 4CIGA 4DR1K 2YU9K 2NVXC 2A1SA 4WYBA 5E84A 4BBRK 2PYLA 1VQNN 2P1JA 2WB1D 3KK7A 1N36K 3KHYA 1YX2A 3G4SN 5GADP 2UUAK 2Q1NA 4GT9A 2P9NA 3CCRN 4C1NK 5FPNA 1PJ6A 4A3EK 1TWAK 5E26A 3L4JA 4FJIA 3E9PA 1NGGA 4MLEA 2YNIA 5MLCQ 3BEXA 1SKSA 2XCOA 2QTDA 2AJQA 5HOOA 3CPWM 2YNFA 4G0WA 4CZEA 3RMCA 1V5VA 3G6EN 2W7VA 3M8RA 4BC4A 1RDUA 4CFBA 2E2HK 4JK8A 4GTFA 4RWTA 3VEWA 2P9PB 1HLUA 3U4LA 3KLHA 4QCLA 2Z1HA 2RHKA 1ZVUA 4QS7A 5M5YK 4U7BA 4NLCA 3A8IA 3S15K 1RNHA 4CK3A 1HJRA 1U2VA 3CM6A 3HM9A 4A3JC 1X9SA 5BR9A 3ZETA 3DXJA 4B3MK 4KHNA 4GNIA 4B8CA 4LJZA 1P8ZA 3PLAA 4DKWA 2E4LA 1EWQA 4AQYK 4H03B 4EP5A 4DSFA 1EO1A 1BUPA 4KPYA 3S2HK 1C1CA 1VSDA 2D0PA 2GEMA 3RSEA 5M1KA 1T03A 4WFBL 2HF3A 2V6TA 2VWKA 4DU4A 1WCMA 4JKDA 2E1ZA 1C0AA 1BISA 3J8AA 1WAFA 2P5GA 5AQKA 1NK7A 3RZDK 3DOKA 4Z4GA 3OVNA 4RW8A 3TAGA 3HOZC 1WSHA 4HTLA 2ZWHA 2PMZD 4LSNA 5M5WK 4A3DK 2R7ZK 3G0ZA 2VG7A 1NNEA 4M3UA 3S2DC 4W5TA 3O08A 4H8KA 1U47A 1D4XA 4ZTJA 1AB4A 2Z1IA 5AQGA 1J6WA 3K9JA 4WF9L 3NVMA 1TV6A 3BZCA 3I8BA 1I94K 4BY1C 3G71N 4A2BA 4JI7K 1MDUB 4HUEA 1BWFO 1ZQ1C 3FKIC 3HVTA 4GKKK 5KQDA 3CFPA 5I3UA 4Y7NK 2VQFK 4G0VA 1N8RO 1WQHA 2EX3A 3TAPA 1ZBIA 3DJCA 3CCEN 1W9HA 3Q3QA 2ASPA 4K8ZA 2I7NA 4QIWD 1RDBA 2YHWA 3QDKA 3HPHA 3QIOA 4FLXA 3MK6A 4IOAL 4YDUC 3LANA 2KFNA 3QO9A 1YXQA 4C45A 1O27A 3K2PA 4BQLA 3S17C 2NNWA 5AQWA 1XZPB 1Y97A 3U3YA 1J6VA 4OIOA 3BDPA 4FW1A 5BREA 2D0BA 4J8FA 1Y1WK 4C3IK 4IXCA 3B6PA 3SLCA 4FJ8A 3I0RA 2NZTA 2QWOA 4L3QA 3P5JA 3J7YP 3D45A 2UUCK 4IOXA 3ZX2A 2ZJQL 3WEEA 4FWLA 1F21A 2A6AA 3MEDA 1OH5A 2BTFA 1XI1A 2JLEA 1M1KO 4CJ5A 2YI1A 1LW2A 3PSIA 3S15C 4JKHA 1XPPA 3MMLB 1QSYA 1WB9A 3HKZL 3AA5X 2GAGC 5M1NA 1S9EA 1ZXOA 3FKIA 4P5AA 3DXKA 3VQAA 3VF4A 4CF9A 5HBMA 5BPMA 4DR4K 3GTGC 4JYAK 2R92A 1NK5A 4O55A 4MQ3A 4Y1DA 4W5QA 5SWMA 1RT2A 2QEXN 4KBOA 4FPAA 2EHGA 3UKRB 3ZSQA 1QHAA 4CZLA 4GY2B 1CXQA 3D6RA 4DF4A 1I6HC 2PY5A 4BVOA 3K5NA 2GSNA 4F2RA 1RTHA 3J7ZO 1ZBSA 5M3FK 3BZKA 4DSLA 4KB4A 4CBUA 4E1JA 3NBPA 2V7YA 4CEDA 5C24A 2NRRA 4CEBA 5AFUH 5AQPA 1TWFC 4DTOA 3K58A 4C23A 1VQ7N 1PJ5A 4NYFA 3CFOA 3EKUA 2GTDA 4OLAA 2VUMK 2YU9C 5KPZA 2OPPA 3O4QA 1TWCA 4FOIA 4B1UB 4E0DA 3NH1A 4A3LC 1DCPA 3V9SA 1T6DA 5EGEA 4CZGA 1S1WA 3UKUB 1VQMN 3LP0A 4GTCA 5CR4A 3HP9A 3IPJA 2A69A 1GLJO 3SBGA 4CJVA 3ATVA 4IO8A 3AGRA 5CYMA 1IKYA 4CFCA 1USOA 4DV6K 1YITN 2JA6K 1KSPA 4PQUA 2HHXA 1WUAA 4BC5A 4LK0A 2DFEA 2JA7K 1ZBUA 4B9VA 3AVKA 3S16C 3K59A 1YHQN 4LY7A 3VQDA 1TWHA 3UKRA 1DLOA 2BUPA 3SQ4A 1I3QK 4AF1A 2ZFZA 1BU6O 3K5MA 4CD3A 1ASUA 2OA8A 2IAJA 3TABA 4FLZA 3VQCA 3K9KA 3D2FB 4M3XA 2O4GA 4FZZA 4K0KK 4C2MC 4FOEA 4BY7K 2W41A 2Z1GA 2ZF5O 3J7AP 3AY9A 2QA4N 4GTLA 1YI2N 1EETA 3JYTA 4BRFA 5IP7C 3VEOA 2E2IA 2WAQL 5JLHA 2ZGZA 1Q81O 4B9SA 4H0PA 3ID8A 1NLVA 4JI6K 4H0VB 2FLOA 5TMFA 4QS9A 4BDZA 1REVA 3ZX3A 5A2QO 1YUWA 4A3GC 3OA9A 4J2BA 3MXJA 1T6CA 3KIOA 2F9TA 5AZJB 3QERA 1X9MA 3O5BA 3QETA 4MO4A 1XMOK 4CJWA 4G1QA 4KV8A 4AHCA 1Q18A 3T19A 3N4PA 4B3RK 5DK5A 4ZTFA 3HKZD 3OY9A 4FWNA 4ELUA 5IYBC 2XY7A 4OIQA 4DUZK 3DLRA 2YHXA 4XEIA 3OYDA 3S1QC 4CJFA 3TFJA 4AM6A 3GTLK 3F5TA 4UY8O 4OO1J 4BBSK 2D1KA 5BN9A 1RBVA 3THYA 3GTGK 3VF2A 5EY4A 5IP9C 2KQ2A 3ULEA 3H3VL 3LDSA 3P39A 4AHRA 3AVAA 4IJNA 2GWJA 1NKBA 3J81O 2RE2A 2OZSA 3ISNC 4NXMK 3PY8A 1L0WA 3NGYA 5TJ3A 4WQ5A 1VH2A 3SQ0A 1W0HA 4HCBA 1JLGA 4LH5A 1WOQA 3EL2A 4M7YA 4RTFD 5LJWA 3VQ9A 3L2QA 2QWMA 4MEYA 2Z1JA 3SAHA 1WSEA 2ASMA 3AAQA 3MN7A 4WQ4A 1SKWA 2F8SA 4GTDA 5JS1A 4N5SA 2Q36A 2F96A 5AQJA 1HYZA 1FKOA 3FOEA 4XSXA 4OLBA 1S1XA 3V4GA 2KWAA 2HBMA 1A5XA 2Y3PA 3THYB 4JI5K 4AHSA 3VF6A 1Q9YA 1VQ9N 1WSVA 3C7NB 4RW6A 3WEEB 3V81A 1JLAA 4WILA 4CJUA 1XUPO 1EH1A 1RDWX 4BE0A 4XIUA 2NRTA 4B9MA 3PX6A 1T8EA 1JOEA 4BR2A 2PAVA 5J2MA 3S1MC 2F7TA 4EFHA 2HNZA 5IP7K 2O8BB 1RT4A 1KVAA 4JEPA 2BH1A 2OPSA 3H0GK 3S1NC 3O1BA 3HRGA 1BDGA 3T01A 3KWIA 3MWPA 1TYQB 4K42A 4MFBA 3GTLA 1D9DA 3THVA 2P9LB 1INNA 1DGKN 1S3XA 5TKYA 1NJIO 3GEEA 5C3EK 1K9MO 3ZYYX 4PHTX 3OYEA 2Q97A 4B9UA 1S1TA 2NRXA 1DT9A 4WQ4C 2P9IB 1OH7A 4FWPA 3JXUA 4EHUA 3LL3A 3NAEA 4PKGA 3NUHA 1J9AA 4KDDA 4O4GA 1JXBA 1CZBA 3AO2A 3TSPA 4E7LA 4A3CK 5FLMK 1ZBFA 1GOCA 1ILYA 3MMVA 3QX3A 4Y52C 3EE8A 4DFJA 3KLIA 3NGIA 2D0AA 3WQUA 2P5OA 4A93C 4EZ6A 3O9UA 3CMEN 1KCFA 2W6KA 2HVIA 4A57A 2OPQA 3ERED 1TAQA 1K73O 3AVFA 3V9UA 1HUXA 4A3LK 4GVEA 1O2FB 4FPBA 2ZJRL 2E2JK 1YIJN 2E6MA 4JKFA 4BE2A 4N76A 1RTJA 3IAYA 2JGUA 4BXXK 4KO0A 1QQMA 1U48A 1NM1A 4G7OA 3FLCO 3M3ZA 2I5JA 3IDHA 2Q31A 5LMUK 4X64K 1KFSA 5FDLA 3PO3C 1N6QA 4H4OA 4CIEA 1TWHK 3LZIA 4GW6A 3VQ8A 3GTOA 4FW2A 1BIZA 3DAWA 2JA6A 1TKDA 1C0TA 3D2EB 3I55N 3BP3A 2YJFA 4A61A 3D7EO 3CMAN 4LLGA 3TI0A 3SUQA 3GTKA 4BGAA 4XCHA 2EWSA 5EX5A 5GIPA 3H0GA 3C6UA 4LF7K 3ZSXA 2CH5A 3TAEA 4KRFA 4OINA 3SZZA 4CVNE 2WBNA 4HUFA 1P90A 4C3HK 1O1WA 3OYGA 4B9QA 2VUMA 4CZIA 4FK2A 3VTHA 1N5YA 4PA1A 1SV5A 2DFHA 5DM6L 2ASOA 2GUPA 2VYPA 3CIPA 3GTJA 4X6AC 5M5XK 2E6LA 1I3AA 4CIFA 1Y1WC 3TTGA 4F8RA 1Y1VK 2GSOA 1JQWA 1LWFA 2V6SA 2BDPA 1SMYA 4CERA 4CEQA 3R6MA 3OS1A 4Q4ZA 3VTIA 4A93K 2P9PA 3T7ZA 1JLCA 3CJBA 3TPQA 4DV1K 4FWKA 1GLEG 3I4MK 1C1BA 4B1ZA 1XC9A 4RW4A 2ZJPL 4OKEA 3RZOC 2RN2A 3O1WA 3EN9A 1I6HK 5HL7L 2W42A 4E19A 1KC8O 4JKAA 2KHOA 4E89A 1CLQA 4MLHA 1IQ0A 2B63C 3S1MK 3QFUA 2A5XA 3QB0A 1HPMA 3THWA 3GTMC 1NKCA 1YJNN 3LPUA 2GWKA 3LDQA 5LJVA 3NH0A 3AO5A 4B08A 1UA1A 4X66K 4YOXA 1V4TA 1VQ6N 1W2BM 1KQSM 4M3ZA 4AHVA 2ITGA 3C6HA 3A5LC 3B8AX 1SAZA 5C15A 4JK1A 1NGDA 2I7PA 3H1QA 1IBMK 4V19S 1VSJA 4YORA 1NWKA 2PYJA 1BO5O 3DLEA 5C4XK 2OTJN 2BE5A 2QW9A 4JKGB 5AQNA 3OBWA 4NCGA 3VQ7A 1B9DA 1R9TA 4DSEA 5LL6Z 4JI2K 3GTGA 1U04A 1S1UA 5KPTA 1Y1WA 1ATRA 3L8BA 1XHXA 1QVFM 1Y64A 4YOVA 4JRPA 1O25A 4BG9A 2WAQD 2JA8K 5C10A 2RH6A 3HOSA 4F2SA 5E68A 2JA5A 3GBTA 1LOTB 1JL2A 1F7UA 1BCOA 2JWKA 4NLBA 3R1XA 3GTPA 4DR5K 2P51A 3QFPA 1VSKA 3K5OA 2WUSA 5JFEA 3DM2A 3LWLA 4ELTA 1T7PA 4JD2A 1FK9A 1TWFA 1IE0A 5CZ1A 4A3FK 1I50A 1QQCA 3DLHA 3T00A 1KAYA 2GELA 3LPXA 3AVJA 4LOWA 2VGMA 2WTUA 3ATUA 5AQSA 3HSCA 3FFIA 1K83C 2E2IK 3HOUC 3A8YA 4PABA 4RMFA 1IBKK 2CFAA 3WXMB 3OYKA 4LF8K 3RMAA 1TKXA 4WCEL 5HRSA 2NVYA 2W6LA 3NVKA 1C0MA 4DB3A 2O4IA 4KMAA 4H0YB 2O8BA 4BWMA 5BR8K 3N0CA 1RT6A 2DFFA 2AA4A 2WFBA 3IG1A 1J6ZA 3TAQA 4DV3K 3V1RA 4CK1A 3HOYC 1DD5A 4K25A 4KM9A 1G15A 1NGEA 3L3UA 5AQFA 4B1YB 3PX4A 4C2MK 4BKWA 1TYQA 3VEYA 1QZ5A 1E4FT 3TSQA 4DTPA 2Y1IA 3R8EA 5CZ2A 2E1YA 5IWAK 3MXIA 1EX4A 3S3NA 1I3QA 2OZMA 3M3YK 3VGLA 1Z25A 5SZTA 1XXBA 1YVNA 2HNDA 1N34K 3DYAA 3TWHA 3V9XA 3SMPA 1Q7YO 3ALYA 4DV4K 5AQYA 3O3FA 4C8NA 2HOEA 3MCPA 3U6FA 1TK5A 1XZPA 3P4IA 4DTNA 4N41A 3A5NC 4M3WA 1KLMA 4Y1CA 3NMUA 2O8FB 3NGZA 3CCLN 1NGIA 3PO2K 4JKCA 3ZETB 3DXKB 4DCHA 5AR0A 3V1OA 4BVPA 4BY7C 1KVCA 4F3TA 4NOIA 2VWJA 1TWCK 2GBZA 2B6AA 1G99A 1WSIA 3AO1A 2V7ZA 4DV0K 1Y1VC 3HXMA 3F73A 4KB1A 1RTIA 1IG8A 4J2AA 2IVPA 2R93C 5FLXO 4Z4IA 4DR6K 3GTQK 3MX2A 4A2AA 1TWGC 4J2EA 4LH4A 1EFWA 3H45C 2O8EB 4FVMA 3BUEA 4B9TA 3GL1A 2IVOA 3KLEA 3GTOC 3WNEA 2OCEA 4OX9K 5CE3A 2E2PA 4C3JC 1BJTA 3HOXK 2FSKA 2LSNA 1SFOA 3QESA 1IBLK 1EP4A 1RT1A 4FSVA 2DY4A 2R92K 3H0GC 4I2QA 5ADXH 3BF3A 3C0BA 3CQXA 1C0GA 3VEZA 4CD1A 2FBYA 4DSKA 1A5VA 3OYCA 3GTJC 4ISEA 1X3NA 4BE1A 3WXLA 3BUZB 3LZJA 3FZMA 4FWRA 4NXNK 1VQON 5JVHL 5AQHA 5C44C 3DRRA 4FM9A 4GZYA 3AVNA 4UQGA 1DTTA 4H5WA 1J5OA 1QQOA 5JS2A 1NJZA 2X74A 3NFAA 3JSMA 1IV0A 4IWVA 4OPKA 4H4MA 1YT3A 1VSLA 5BPNA 3HSTB 1YNNA 1RDCA 1IKVA 4ELVA 4YDUA 2KTQA 3SNNA 1GE9A 2IGIA 5JMVA 3HOTA 4AYBD 4KH6A 3EEQA 4GV3A 4FWMA 3CI5A 1VGXA 5I9EB 4PUOA 1VRQC 5HROA 2ZE2A 3LPTA 5J2QA 4DQRA 2QK9A 3K7AK 4TSXA 3D0PA 4Y0WA 3AA2A 4OKJA 4A3IK 3CC2N 4ICLA 3PO4A 4DDQA 1FXXA 1Q9XA 3S1NK 5AQQA 1NMDA 3QEWA 2FSNA 4FJNA 3WNHA 3CD6N 2YCHA 1VSEA 1MWMA 4JI1K 2O8CA 5C25A 3E9OA 4FM1A 2RPIA 4IFVA 4AILC 2NVQK 1TAUA 3EQLA 1SQKA 1BA1A 2Q2RA 4KHPK 3SV3A 2R7ZA 4O0JA 4BWJA 1BGXT 1M90O 4CI6A 5TMCA 1NJWA 4IEEA 2HBLA 3HVRA 3NF6A 3CJ7A 4PKHA 1LW0A 4XLPA 4BRGA 2YKMA 3WQTA 1F7VA 4FJXA 4DR3K 1NGCA 3WNFA 1L3SA 1HQMA 2G8IA 1J53A 3V9ZA 2X6SA 3GTMK 4CGGA 4Y7NC 3SQ1A 5FPMA 3C95A 4EP4A 1OKJA 3HPOA 3DLBA 2G8KA 3ITHA 4DTMA 1LV5A 4CGFA 2O5JA 2PA8L 1S1VA 3F9KA 5JVOA 3HTVA 3SI6A 1NK6A 3UKUA 3VOVA 2P5MA 3SMSA 5C2FA 3SUPA 1SZ2A 4CGJA 3S2DK 2NRVA 3OJUA 5EXWA 5AQIA 3WODA 1BI4A 4YY3K 4K43A 2E5LK 3M8QA 5CY4A 3OYBA 4CF1A 1L3UA 1S6QA 4BY1K 4JKEA 2NVYC 4M7XA 4PAAA 4AHUA 2X6NA 1VRUA 4AM7A 3AVBA 3NH2A 5DM7L 1NK4A 3PIOL 1K8KB 4IDHA 5EVZA 3CETA 4P9SA 2WC9A 1RBTA 1XWLA 1WSGA 3SAGA 1TWAC 4MQ9A 3LWMA 1HKCA 1XXAA 4PWDA 4DQSA 2NRWA 3CERA 3OYIA 1JXEA 1RGIA 3AAPA 3AARA 3EE9A 1ZYRA 4MDBA 3QEPA 3ASMA 4XH1A 3HOXC 1IL2A 4BRHA 4IG0A 4DTXA 2Q0UA 1RT7A 3MDQA 3KLFA 4M41A 3RRHA 4GTAA 1IG9A 3J80O 4CECA 2YU9A 3I8DA 2H3GX 3OS0A 1F9NA 1HI9A 5KGWA 3RMDA 3VERA 2YHYA 4OPJA 4BDYA 4DS4A 3CJCA 2PPBA 4MO5A 2XCQA 2A68A 3OTOK 2G8HA 1HNIA 3H46O 3VGMA 1C1AA 3KD1E 4LF4K 4JI4K 2IC3A 3ZX0A 2P9SA 3LM2A 4KKOA 3V4IA 2CGKA 1HRHA 3TFIA 3O6WA 1HYVA 1USMA 4BLBA 1QS4A 3CFRA 4F9OA 4DFKA 4BY9C 3GE1A 4CEZA 1K8KA 5IOSA 4L8RB 2KZZA 3AVIA 1RBSA 4A3EC 2G8VA 3S1RK 3L3VA 4W5OA 3P38A 4C1NI 2O8EA 4Y52K 2NRZA 2HHWA 1XNQK 3AVCA 3AGKA 2VQEK 1QVGM 4BBRC 3FR0A 4OGEA 1J6XA
chains in the Genus database with same CATH topology
4PL7A 5C0YA 4A62A 5HOOA 3D2EB 3I55N 3CPWM 2YJFA 4A61A 3D7EO 3CMAN 5B8HA 3CQZA 1YF5L 3H1VX 4CZEA 4G0WA 3CHWA 5BRFA 3WXJA 4BGAA 4CBXA 4ILDA 3G6EN 3GTKA 3C65A 1IS1A 4BC4A 1RDUA 2EWSA 1O13A 5EX5A 1ZC6A 4JK8A 4O5FA 5GIPA 3H0GA 4GTFA 5AQRA 4RWTA 3VEWA 2P9PB 1HLUA 5AQOA 3U4LA 1O29A 2CH5A 2E88A 3OREA 4BLAA 1VQKN 4KATA 2RHKA 3N3YA 2WBNA 3CCJN 3WUHA 2HBKA 1VQ4N 1P90A 1ZVUA 4QS7A 5CHPA 3A5MC 1GLDG 4B9QA 4U7BA 1BA0A 1ESVA 2VUMA 4CZIA 4NLCA 1KAZA 3VTHA 2A42A 4NB4A 3KVGA 4WFAL 4KARA 5DM6L 2ASOA 2GUPA 2VYPA 3CIPA 3GTJA 3D2EA 1U2VA 5AZIB 4LR2A 2QWLA 5BR9A 3ZETA 3H3OB 2GSOA 4GNIA 4DQ8A 5F1XA 1P8ZA 3R9PA 3PLAA 2P9KA 4DKWA 2J4RA 3R6MA 3VTIA 4BRLA 4FZBA 2P9PA 3T7ZA 4MDAA 3CJBA 1X9JA 3TPQA 5GAGP 4WQ5C 4H03B 1EO1A 1BUPA 1GLEG 4FWKA 1YJWN 1TWGA 2E2HA 5M1QA 2YX6A 4B1ZA 4J3NA 4BC2A 2ZJPL 4BR7A 2D0PA 4XH5A 2GEMA 3RSEA 3O1WA 3CJ1A 5M1KA 3FZFA 4WFBL 2HF3A 3EN9A 3VEXA 5HL7L 1WCMA 1KC8O 4JKDA 1U2VB 2E1ZA 2P9UA 4U67L 4JKAA 2KHOA 1DEJA 3Q7CA 4MLHA 3J8AA 2GX9A 5AQKA 3AQPA 3OPFA 3QFUA 2A5XA 3QB0A 1HPMA 4YOUA 1YJNN 2GWKA 4BRIA 3LDQA 3O9RA 4HTLA 5LJVA 2ZWHA 2YJEA 4YOXA 1RFQA 1V4TA 4H5RA 1W2BM 1KQSM 3O08A 3MN9A 1VQ6N 3C6HA 1D4XA 3A5LC 3B8AX 1SAZA 3L6QA 3QICA 2QWNA 1NGDA 3N4QA 5C15A 1AB4A 5AQGA 2I7PA 2GSUA 1BG3A 3H1QA 4BR0A 4YORA 3K9JA 4WF9L 3NVMA 1NWKA 3I8BA 4OPAA 1BO5O 4NO7A 3G71N 4A2BA 3M1FA 3QBXA 4IOCL 1MDUB 3G25A 3CC4N 1E4GT 2OTJN 1BWFO 2A40A 2E2NA 2QW9A 4JKGB 5AQNA 3OBWA 5KQDA 3O9TA 5C2DA 1OVYA 4G9ZA 1R9TA 2QWRA 3CAGA 4ISGA 4G0VA 3GTGA 4H0OA 1N8RO 3D2FA 1WQHA 5KPTA 1Y1WA 1ATRA 3CQYA 3DJCA 3W0LA 1QVFM 3S41A 1HKGA 3CCEN 1KQ4A 4IEIA 3Q3QA 1Y64A 2ASPA 2QI2A 4YOVA 4IJAA 2A3ZA 2I7NA 3VPZA 1O25A 2YHWA 4BG9A 3QDKA 4BRMA 2QM1A 4GTBA 5C10A 2RH6A 3MK6A 4IOAL 3U9DA 3HOSA 1O28A 4YDUC 2JA5A 3WXKA 2NRHA 1YXQA 3GBTA 5BN8A 1O27A 1LOTB 4BQLA 1DKGD 4IZ9A 2JWKA 4FL9A 2NNWA 4NLBA 3R1XA 5AQWA 3GTPA 3QFPA 3S0XA 1KXPA 2WUSA 5JFEA 4H0XB 5JLFA 5BREA 3A0IX 4JD2A 4J8FA 1TWFA 2CGJA 4IXCA 3T69A 1I50A 4QS8A 1XXAA 3SLCA 1KAYA 2GELA 3LPXA 1NGAA 2NZTA 2FF6A 2QWOA 4L3QA 2VGMA 3ATUA 5AQSA 3HSCA 1WQGA 4IOXA 3ZX2A 3A8YA 2ZJQL 3L4IA 2CFAA 3WXMB 4WCEL 3WEEA 2NVYA 4FWLA 2A6AA 3NVKA 3FHZA 2BTFA 1YJ9N 4DB3A 1GLBG 1M1KO 4H0YB 4KMAA 1NGHA 1GLFO 2A41A 3DXMA 2YI1A 3N0CA 1K83A 2HF4A 3Q7BA 5AFUA 2AA4A 2WFBA 4JKHA 4B1WB 1J6ZA 3MMLB 4BRAA 3FOFA 3IMXA 1V4SA 5M1NA 1ZXOA 2PBDA 4K25A 1JCFA 3M6GA 3L4QA 1DD5A 2JH3A 1NGEA 3FKIA 4KM9A 3DXKA 5AQFA 4B1YB 3VF4A 5BRDA 4P5AA 5BPMA 1LCUA 3L0QA 4C3HC 4BRNA 4BKWA 2R92A 3GOIA 1TYQA 2IIRA 3VEYA 3TTDA 1QZ5A 1E4FT 1QZ6A 2VCPA 1CZAN 3H3NO 4I6MB 3R8EA 1T44A 2E1YA 3FZKA 3AQOA 1I3QA 2XCRB 4IO9L 3VGLA 1KD1O 2OTLN 4Z94A 1YVNA 1XXBA 2OANA 3C6AA 3VESA 2QEXN 1XC3A 2RGRA 3SMPA 4KBOA 4FPAA 4H5VA 1Q7YO 1BGWA 3UKRB 3ENHA 5AQYA 1QHAA 4CZLA 4GY2B 3D6RA 2HOEA 3MCPA 3G4AA 2DPNA 4JKBA 3P4IA 2IVNA 4JK7A 4BVOA 3CCQN 3QBWA 3A5NC 2GSNA 3NMUA 3HZ6A 1T3VA 4H0TB 1ZBSA 3J7ZO 3CCLN 1NGIA 4JKCA 3ZETB 3DXKB 4DCHA 5AR0A 4BVPA 4CBUA 4CZKA 4E1JA 4KB4A 1H1VA 3GTQA 2V7YA 1EK8A 2NRRA 1B4BA 4LQYA 5AFUH 5AQPA 4GFQA 5AQZA 1G99A 1VQLN 4C23A 1VQ7N 1GLCG 2V7ZA 4KH4A 3EKUA 5EOYA 1O2AA 2P9SB 2R93A 3VETA 2GTDA 3KZBA 5KPZA 1R59O 2F9WA 1ATNA 2W40A 3DWLA 3HBTA 3O80A 3DLLL 1TWCA 4KH5A 1IG8A 4M1XA 4FOIA 4B1UB 4G0UA 2IVPA 2E8AA 4ILGB 4CZJA 2CH6A 4KMHA 5CJ9A 1T6DA 4IFEA 5EGEA 4PL8A 3MX2A 2HMPA 4A2AA 4RCHA 4CJ7A 4CZGA 5KPRA 5JVGL 3C7NA 3UKUB 1VQMN 3H45C 2P9NB 4XH4A 3BUEA 1WIHA 1HKBA 4GTCA 2KLAA 3GL1A 2IVOA 5CR4A 4H5NA 1GLJO 3O4WA 3OBYA 3ATVA 4IO8A 3SBGA 5F2RA 3AGRA 4FWOA 2PHCB 1YITN 4I6MA 4BRCA 5CE3A 1WUAA 4BC5A 2E2PA 4C3JC 1VQ8N 4YOTA 1BJTA 3IFRA 4GV6A 1YHQN 2FSKA 1TWHA 1KAXA 3UKRA 2BUPA 1SFOA 1O2BA 4AF1A 4FSVA 4WFNL 5EGHA 2E2QA 2ZFZA 1BU6O 4BROA 3OHRA 4CD3A 5ADXH 4KB2A 1TUYA 3BF3A 3C0BA 3CQXA 3FE1A 4KAWX 2P9LA 3JS6A 1C0GA 3K9KA 3VEZA 2QWQA 4CD1A 4JNEA 3M5RA 4R79A 5JICA 3D2FB 3E1YA 3LM9A 4ISEA 4C2MC 1X3NA 3TTCA 3WXLA 4FOEA 3BUZB 2W41A 3L4KA 2NVXA 4O8KA 2D4WA 2ZF5O 3FZMA 3AY9A 4FWRA 5ADXA 3TTFA 2QA4N 4GTLA 3LDPA 1YI2N 1VQON 5JVHL 5AQHA 4BRFA 3VEOA 4FM9A 1HX1A 3CCMN 2E2IA 3UE5A 5JLHA 2ZGZA 2E2OA 4BC3A 3CXCM 1Q81O 4H0PA 1NGJA 2QXLA 4K41A 3ID8A 4H5WA 4KASA 1NLVA 1QQOA 1EQYA 4H0VB 4M63C 2FLOA 5AZIA 4YOWA 3LDLA 4FWSA 4IWVA 4QS9A 3ZX3A 4BREA 3UB5A 1YUWA 3CCUN 3OA9A 2ZGYA 4BQZA 5BPNA 3IUCA 1B4AA 2V51B 5AQLA 3I56N 5FPEA 2QWPA 2JWLA 5AZJB 1T6CA 2F9TA 4YDUA 1GE9A 3O5BA 4MO4A 5JMVA 3HOTA 4KH6A 1Q18A 4P5BA 4EAHD 3N4PA 4B1VA 4GV3A 4FWMA 3CI5A 5I9EB 4FWNA 5LY3A 2ITMA 1JCGA 2YHXA 4XEIA 5AQUA 3SK3A 5IORA 3VENA 4AM6A 3CCVN 3WXIA 1NGFA 1K8AO 3F5TA 4H5TA 4UY8O 4OO1J 4EHTA 2D1KA 4Y0WA 5BN9A 1XXCA 3CC2N 3VF2A 5EY4A 4DDQA 1C0FA 1Z6RA 3ULEA 3MN6A 1YAGA 3U8XA 3O9SA 3P39A 4CZHA 1Q86O 3G4CA 5AQQA 1VQPN 3CC7N 1NMDA 4IJNA 4CBWA 2GWJA 1Z05A 2FSNA 2RE2A 5M1FA 3CD6N 2YCHA 4LC9B 5BRHA 4A59A 5GAHP 1MWMA 3E9OA 5TJ3A 4WQ5A 1QQNA 3CJAA 3MCAB 3CPEA 3LDNA 5AQXA 1SQKA 1BA1A 2Q2RA 3KWGA 1IJJA 2VGNA 4JN4A 5M1OA 1WOQA 3EL2A 4M7YA 4RTFD 2R7ZA 2PFUA 5LJWA 4A5BA 2QWMA 5AQMA 3SAHA 1M90O 4CI6A 4IEEA 3H6EA 2HBLA 2D0OA 3N0BA 2ASMA 3IKMA 1GLAG 3AAQA 3MN7A 3CJ7A 4PKHA 5GIOA 3PIPL 4BRGA 4JK9A 4WQ4A 4C3IC 3WQTA 4GTDA 3BF1A 2B63A 5C12A 1X3MA 3VEVA 3F2KA 4O8UA 1NGCA 3ZEUA 2AP1A 2FSJA 3GTMA 5GAEP 2Q36A 5AQJA 5AQVA 3FOEA 2UYTA 5FPMA 3TSUA 2P9KB 3VMFB 1Q82O 3CF5L 1OKJA 3A5OC 3V4GA 2KWAA 1VQ5N 2HBMA 4BR4A 5H1SQ 2Y3PA 3EKSA 3R3LA 5GINA 4BR5A 1TUUA 4FWQA 3F9MA 2NLXA 1U6ZA 5JVOA 3HTVA 3VF6A 1VQ9N 1JCEA 1Y1VA 3C7NB 3SJHA 3UKUA 3P31A 3VOVA 1MWKA 3SMSA 3WEEB 2P5MA 4KM8A 1W97L 5C2FA 1SZ2A 4JHDA 1EH1A 1XUPO 4BRKA 1MA9B 1RDWX 2NRVA 1VAZA 2NRTA 3BP8A 5AQIA 5EXWA 4K43A 1O26A 5IOQA 4DHYA 3DXMB 4CZMA 3LAPA 3TU5A 2P9IA 2HBJA 3MX5A 2PAVA 4BR2A 4FVUA 2F7TA 4JKEA 4GTEA 4EFHA 4M7XA 3HM8A 3GTOA 2FXUA 3FFKB 4BR9A 1WQFA 3ENOA 4BRQA 1GLLO 3AH5A 1NBWA 1HJOA 2BH1A 4JEPA 4AM7A 5F0XA 3O1BA 3HRGA 1BDGA 3EZWA 4PKIA 3KWIA 5DM7L 1K8KB 3MWPA 1TYQB 4K42A 4IDHA 5EVZA 3PIOL 3GTLA 3CETA 3SAFA 3U9ZA 2P9LB 2WC9A 3RVCA 3FGUA 1DGKN 1S3XA 3SAGA 3OEPA 5TKYA 1S22A 1NJIO 1HKCA 3HI0A 4BRPA 1K9MO 4GV9A 3ZYYX 2NRWA 4PHTX 3ZEUB 5BPLA 2Q97A 3CJ9A 4KC6A 3CERA 4KMDA 2NRXA 3ENBA 1DT9A 4HWIA 4JKGA 4WQ4C 3O8MA 1BOTO 1RGIA 3GDQA 1JJ2M 3AAPA 3AARA 1TWAA 2P9IB 3EE9A 3TSQA 4MDBA 5TKWA 4FWPA 3O9QA 3FZHA 3JXUA 4BG8A 3WT0A 3LL3A 4EHUA 3E9LA 4JAXA 4PKGA 3NUHA 1O24A 1ISEA 4XH1A 2VWBA 5IOTA 4BRHA 5ELZA 4B1XB 3E66A 3TSPA 4BGBA 4KDDA 3OW2M 2Q0UA 3MDQA 4OPHA 4GTAA 3VGKA 1ILYA 3MMVA 3LAJA 3QX3A 1XQSC 1SS6A 3EE8A 1ATSA 2YU9A 1NGBA 2CGLA 1S72N 2H3GX 3EO3A 3VA7A 4FO0A 3WQUA 1F9NA 2E20A 3GG4A 4CZFA 3QMLA 3VERA 3LDOA 3O9UA 3CMEN 2YHYA 3I33A 5AQTA 5M1PA 4A57A 3CJCA 4JHDB 3ERED 4MO5A 5AZJA 2KKZA 2XCQA 3FZLA 1K73O 2QTDA 4ISFA 3ID6A 4YOYA 3CCSN 3H46O 3VGMA 4EIAA 2V52B 1HUXA 4GVEA 4BRDA 3SBTA 3ZX0A 4FPBA 4JD2B 2P9SA 3LM2A 2ZJRL 1YIJN 2CGKA 3MN5A 4ILHA 2HSTA 4JKFA 3O6WA 4WYBA 4BLBA 5E84A 1VQNN 3W3DA 3KK7A 4F9OA 5FPDA 3MWTA 3GE1A 4BY9C 1K8KA 5IOSA 1QQMA 3KHYA 1NM1A 3G4SN 5GADP 3FLCO 3M3ZA 3IDHA 5CHIA 2Q31A 2CFAB 2Q1NA 4GT9A 2P9NA 3P38A 4C1NI 3CCRN 4C1NK 5KQ8A 5FPNA 3RSEB 2NRZA 3ULEB 5E26A 3L4JA 3AGKA 4ILJA 2FF3B 4A5AA 3E9PA 1QVGM 1NGGA 4MLEA 2JA7A 2Q0RA 5MLCQ 3BEXA 2XCOA 3FR0A 3DAWA 2P9UB 2JA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PL7 A;  4A62 A;  3D2E B;  2YJF A;  4A61 A;  3D7E O;  5B8H A;  3H1V X;  4CZE A;  3CHW A;  5BRF A;  3WXJ A;  4BGA A;  4CBX A;  4BC4 A;  2EWS A;  5EX5 A;  1ZC6 A;  4O5F A;  5AQR A;  4RWT A;  3VEW A;  2P9P B;  1HLU A;  5AQO A;  3U4L A;  2CH5 A;  2E88 A;  3WUH A;  4QS7 A;  3A5M C;  1GLD G;  4B9Q A;  1BA0 A;  1ESV A;  4CZI A;  1KAZ A;  2A42 A;  4NB4 A;  3KVG A;  2ASO A;  2GUP A;  2VYP A;  3CIP A;  3D2E A;  1U2V A;  5AZI B;  2QWL A;  5BR9 A;  3ZET A;  3H3O B;  4GNI A;  4DQ8 A;  5F1X A;  1P8Z A;  3R9P A;  2P9K A;  2J4R A;  3R6M A;  4BRL A;  2P9P A;  3CJB A;  1X9J A;  3TPQ A;  4WQ5 C;  4H03 B;  1BUP A;  1GLE G;  4FWK A;  4B1Z A;  4BC2 A;  4BR7 A;  2D0P A;  4XH5 A;  2GEM A;  3RSE A;  3O1W A;  3CJ1 A;  3FZF A;  2HF3 A;  3EN9 A;  3VEX A;  1U2V B;  2E1Z A;  2P9U A;  2KHO A;  1DEJ A;  4MLH A;  3J8A A;  5AQK A;  3QFU A;  2A5X A;  3QB0 A;  1HPM A;  2GWK A;  4BRI A;  3LDQ A;  5LJV A;  4HTL A;  2ZWH A;  2YJE A;  1RFQ A;  1V4T A;  4H5R A;  3O08 A;  3MN9 A;  1D4X A;  3A5L C;  3B8A X;  1SAZ A;  3L6Q A;  3QIC A;  2QWN A;  1NGD A;  5AQG A;  2I7P A;  1BG3 A;  3H1Q A;  4BR0 A;  1NWK A;  3I8B A;  1BO5 O;  4NO7 A;  4A2B A;  3M1F A;  3QBX A;  1MDU B;  3G25 A;  1E4G T;  1BWF O;  2A40 A;  2E2N A;  2QW9 A;  5AQN A;  5KQD A;  2QWR A;  4ISG A;  4H0O A;  3D2F A;  5KPT A;  1ATR A;  3CQY A;  3DJC A;  3W0L A;  3S41 A;  1HKG A;  1Y64 A;  2ASP A;  4IJA A;  2A3Z A;  2I7N A;  3VPZ A;  2YHW A;  4BG9 A;  3QDK A;  4BRM A;  2QM1 A;  3MK6 A;  3U9D A;  4YDU C;  3WXK A;  2NRH A;  1YXQ A;  3GBT A;  5BN8 A;  1LOT B;  4BQL A;  1DKG D;  4IZ9 A;  4FL9 A;  5AQW A;  3QFP A;  1KXP A;  2WUS A;  4H0X B;  5JLF A;  5BRE A;  3A0I X;  4JD2 A;  4J8F A;  2CGJ A;  4IXC A;  4QS8 A;  3SLC A;  1KAY A;  2GEL A;  1NGA A;  2NZT A;  2FF6 A;  2QWO A;  4L3Q A;  3ATU A;  5AQS A;  3HSC A;  3ZX2 A;  3A8Y A;  3L4I A;  3WEE A;  4FWL A;  2A6A A;  2BTF A;  4DB3 A;  1GLB G;  4H0Y B;  1NGH A;  1GLF O;  2A41 A;  3DXM A;  2YI1 A;  2HF4 A;  5AFU A;  2AA4 A;  4B1W B;  1J6Z A;  4BRA A;  3IMX A;  1V4S A;  1ZXO A;  2PBD A;  4K25 A;  1JCF A;  3M6G A;  1NGE A;  3DXK A;  5AQF A;  4B1Y B;  3VF4 A;  5BRD A;  5BPM A;  1LCU A;  3L0Q A;  4BRN A;  3GOI A;  1TYQ A;  2IIR A;  3VEY A;  1QZ5 A;  1E4F T;  1QZ6 A;  2VCP A;  1CZA N;  3H3N O;  4I6M B;  3R8E A;  1T44 A;  2E1Y A;  3FZK A;  3VGL A;  4Z94 A;  1YVN A;  2OAN A;  3VES A;  1XC3 A;  3SMP A;  4KBO A;  4FPA A;  4H5V A;  3UKR B;  3ENH A;  5AQY A;  1QHA A;  4CZL A;  4GY2 B;  2HOE A;  3MCP A;  2DPN A;  3P4I A;  2IVN A;  4BVO A;  3QBW A;  3A5N C;  3HZ6 A;  4H0T B;  1ZBS A;  1NGI A;  3ZET B;  3DXK B;  4DCH A;  5AR0 A;  4BVP A;  4CBU A;  4CZK A;  4E1J A;  1H1V A;  2V7Y A;  5AFU H;  5AQP A;  5AQZ A;  1G99 A;  4C23 A;  1GLC G;  2V7Z A;  3EKU A;  5EOY A;  2P9S B;  3VET A;  2GTD A;  3KZB A;  5KPZ A;  1R59 O;  2F9W A;  1ATN A;  2W40 A;  3DWL A;  3HBT A;  3O80 A;  1IG8 A;  4FOI A;  4B1U B;  2IVP A;  2E8A A;  4CZJ A;  2CH6 A;  1T6D A;  4PL8 A;  5KPR A;  2HMP A;  4A2A A;  4RCH A;  4CJ7 A;  4CZG A;  3C7N A;  3UKU B;  3H45 C;  2P9N B;  4XH4 A;  1HKB A;  3GL1 A;  2IVO A;  4H5N A;  1GLJ O;  3O4W A;  3ATV A;  4IO8 A;  5F2R A;  4FWO A;  4I6M A;  4BRC A;  5CE3 A;  1WUA A;  4BC5 A;  2E2P A;  3IFR A;  2FSK A;  1KAX A;  3UKR A;  2BUP A;  4FSV A;  2E2Q A;  1BU6 O;  4BRO A;  3OHR A;  4CD3 A;  5ADX H;  1TUY A;  3BF3 A;  3C0B A;  3CQX A;  3FE1 A;  2P9L A;  3JS6 A;  1C0G A;  3VEZ A;  2QWQ A;  4CD1 A;  4JNE A;  5JIC A;  3D2F B;  4ISE A;  3LM9 A;  1X3N A;  3WXL A;  4FOE A;  3BUZ B;  2W41 A;  4O8K A;  2D4W A;  2ZF5 O;  3FZM A;  3AY9 A;  4FWR A;  5ADX A;  3LDP A;  5AQH A;  4BRF A;  3VEO A;  1HX1 A;  3UE5 A;  5JLH A;  2ZGZ A;  2E2O A;  4BC3 A;  4H0P A;  1NGJ A;  2QXL A;  4K41 A;  3ID8 A;  4H5W A;  1NLV A;  1QQO A;  1EQY A;  4H0V B;  4M63 C;  2FLO A;  5AZI A;  3LDL A;  4FWS A;  4IWV A;  4QS9 A;  3ZX3 A;  4BRE A;  3UB5 A;  1YUW A;  2ZGY A;  4BQZ A;  5BPN A;  3IUC A;  2V51 B;  5AQL A;  5FPE A;  2QWP A;  5AZJ B;  1T6C A;  2F9T A;  4YDU A;  3O5B A;  4MO4 A;  5JMV A;  1Q18 A;  4EAH D;  4B1V A;  4FWM A;  3CI5 A;  5I9E B;  4FWN A;  5LY3 A;  2ITM A;  1JCG A;  2YHX A;  4XEI A;  5AQU A;  3SK3 A;  3VEN A;  4AM6 A;  3WXI A;  1NGF A;  4H5T A;  4EHT A;  2D1K A;  4Y0W A;  5BN9 A;  3VF2 A;  5EY4 A;  1C0F A;  1Z6R A;  3ULE A;  3MN6 A;  1YAG A;  3U8X A;  4CZH A;  5AQQ A;  1NMD A;  4IJN A;  4CBW A;  2GWJ A;  1Z05 A;  2FSN A;  2YCH A;  4LC9 B;  5BRH A;  1MWM A;  4WQ5 A;  1QQN A;  3CJA A;  3LDN A;  5AQX A;  1SQK A;  1BA1 A;  2Q2R A;  1IJJ A;  4JN4 A;  1WOQ A;  3EL2 A;  4M7Y A;  4RTF D;  5LJW A;  2QWM A;  5AQM A;  4CI6 A;  3H6E A;  2D0O A;  2ASM A;  1GLA G;  3AAQ A;  3MN7 A;  3CJ7 A;  4PKH A;  4BRG A;  4WQ4 A;  3WQT A;  3BF1 A;  1X3M A;  3VEV A;  3ZEU A;  1NGC A;  2AP1 A;  2FSJ A;  2Q36 A;  5AQJ A;  5AQV A;  2UYT A;  5FPM A;  2P9K B;  1OKJ A;  3A5O C;  4BR4 A;  3EKS A;  4BR5 A;  1TUU A;  4FWQ A;  3F9M A;  2NLX A;  1U6Z A;  3HTV A;  3VF6 A;  1JCE A;  3C7N B;  3SJH A;  3UKU A;  3VOV A;  1MWK A;  3SMS A;  3WEE B;  1SZ2 A;  4JHD A;  1XUP O;  4BRK A;  1MA9 B;  1RDW X;  5EXW A;  3BP8 A;  5AQI A;  4K43 A;  4DHY A;  3DXM B;  4CZM A;  3TU5 A;  2P9I A;  4BR2 A;  2PAV A;  4EFH A;  4M7X A;  3HM8 A;  2FXU A;  3FFK B;  4BR9 A;  3ENO A;  4BRQ A;  1GLL O;  1NBW A;  1HJO A;  4AM7 A;  5F0X A;  3O1B A;  4PKI A;  1BDG A;  3EZW A;  1K8K B;  1TYQ B;  4K42 A;  5EVZ A;  3CET A;  3U9Z A;  2P9L B;  3FGU A;  1DGK N;  1S3X A;  5TKY A;  1S22 A;  1HKC A;  3HI0 A;  4BRP A;  5BPL A;  3ZEU B;  2Q97 A;  3CJ9 A;  3CER A;  4BG8 A;  4HWI A;  4WQ4 C;  3O8M A;  1BOT O;  1RGI A;  3GDQ A;  3AAP A;  3AAR A;  2P9I B;  4FWP A;  3FZH A;  3JXU A;  3WT0 A;  3LL3 A;  4EHU A;  4JAX A;  4PKG A;  4XH1 A;  2VWB A;  4BRH A;  5ELZ A;  4B1X B;  4BGB A;  2Q0U A;  3MDQ A;  3VGK A;  3MMV A;  1XQS C;  1ATS A;  1NGB A;  2CGL A;  2H3G X;  3EO3 A;  4FO0 A;  3WQU A;  2E20 A;  3GG4 A;  4CZF A;  3QML A;  3VER A;  3LDO A;  2YHY A;  3I33 A;  5AQT A;  3CJC A;  4JHD B;  4MO5 A;  5AZJ A;  3FZL A;  4ISF A;  3H46 O;  3VGM A;  4EIA A;  2V52 B;  1HUX A;  4BRD A;  3ZX0 A;  4FPB A;  4JD2 B;  2P9S A;  3LM2 A;  2CGK A;  3MN5 A;  3O6W A;  4WYB A;  5E84 A;  3W3D A;  4F9O A;  5FPD A;  3GE1 A;  1K8K A;  1QQM A;  3KHY A;  1NM1 A;  3FLC O;  3M3Z A;  3IDH A;  2Q31 A;  2Q1N A;  2P9N A;  5KQ8 A;  5FPN A;  3RSE B;  3ULE B;  5E26 A;  2FF3 B;  1NGG A;  4MLE A;  2Q0R A;  3BEX A;  3FR0 A;  3DAW A;  2P9U B; 
#chains in the Genus database with same CATH topology
 5J1E A;  4PL7 A;  5C0Y A;  2ZQB A;  3HK2 A;  3S16 K;  2BAN A;  4FZX C;  2O8D B;  3CQZ A;  5C42 A;  3CHW A;  5BRF A;  4CBX A;  2XO7 A;  4GKJ K;  1IS1 A;  1RT5 A;  1ZC6 A;  4O5F A;  3OYF A;  1QTM A;  1JL1 A;  2QKB A;  3ORE A;  4BLA A;  1VQK N;  4KAT A;  1WSF A;  1HR0 K;  3N3Y A;  3CCJ N;  5CHP A;  4ZH4 A;  4R5P A;  1L3V A;  4HVJ A;  3GTK C;  1GLD G;  4AH6 A;  4DV7 K;  2R93 K;  1KAZ A;  4NB4 A;  1A5W A;  4WFA L;  4YNQ A;  4KAR A;  1BL3 A;  4O44 A;  3V9W A;  1VLO A;  2Y1J A;  5F1X A;  3V1Q A;  3TAN A;  3R9P A;  2P9K A;  4A3K K;  4KTQ A;  3OYJ A;  4FZB A;  4FJ5 A;  4MDA A;  1EKE A;  1X9J A;  5GAG P;  3ZSZ A;  4FLY A;  3M8S A;  1XNR K;  2BE2 A;  5M1Q A;  4J3N A;  2B5J A;  5FLM C;  4BC2 A;  4C8L A;  4ID5 A;  4B3T K;  2NVT K;  3VQB A;  1XZQ A;  4J2D A;  2XY5 A;  1ZBL A;  1U2V B;  1VSM A;  4KFB A;  1NMN A;  4DU3 A;  3AQP A;  4JI0 K;  3OPF A;  1KTQ A;  1I39 A;  1CXU A;  4Q5S A;  3LAL A;  4YOU A;  3O9R A;  3ZSR A;  5FJ8 K;  5AJ3 K;  3KLG A;  3BGR A;  3QEX A;  3BP8 C;  4H5R A;  1NU0 A;  1VSH A;  3B6O A;  2UXB K;  1RT3 A;  2GSU A;  1BG3 A;  3MEE A;  2D0C A;  4BR0 A;  2NVY K;  3H3V D;  3LAK A;  4OPA A;  4NO7 A;  1HQU A;  1IH7 A;  3M1F A;  3G25 A;  4A3D C;  3CC4 N;  4DTS A;  4CEO A;  2A40 A;  2E2N A;  2FC0 A;  1T05 A;  5C2D A;  1OVY A;  1GOA A;  3THW B;  2QWR A;  3AA4 A;  4ISG A;  4YFU A;  3CAG A;  2ZUF A;  1B9F A;  1LWE A;  3LP3 A;  3CQY A;  4Z4F A;  2HHT A;  1HKG A;  1KQ4 A;  2QKK A;  4G7Z A;  1Q8I A;  2YNG A;  3QEI A;  1F93 A;  3GTP K;  2A3Z A;  1NOZ A;  4JLH A;  3AVM A;  2ATQ A;  4BRM A;  4CJ4 A;  1KRP A;  4GTB A;  2JA5 K;  1J54 A;  3U9D A;  1SL2 A;  4FXD A;  4XSZ A;  3S17 K;  1WBD A;  3WXK A;  2NRH A;  3ZLJ A;  1XZQ B;  3RZD C;  1X9W A;  4A3B C;  1DKG D;  4IZ9 A;  4FL9 A;  1VRT A;  4YFN A;  3ZCM A;  3S0X A;  4EZ9 A;  4QJV A;  4H0X B;  3M4O C;  5JLF A;  4IG3 A;  3A0I X;  3HJF A;  4LFB K;  4A3J K;  2CGJ A;  3T69 A;  1G51 A;  1R9T K;  1NGA A;  2FF6 A;  4KHY A;  1C0U A;  1QSL A;  1WQG A;  4DU1 A;  4YFX A;  4A3G K;  1SKR A;  3OJS A;  1YJ9 N;  3NF8 A;  2HMI A;  3P83 D;  1GLB G;  3CYM A;  4CJ3 A;  4B3S K;  1NGH A;  1BI4 B;  1IKW A;  1K83 A;  4FJJ A;  5AFU A;  4X6A K;  1HPZ A;  3MXM A;  4BRA A;  4QIW L;  3FOF A;  3IMX A;  1JCF A;  3M6G A;  2NVT C;  5BRD A;  4KN4 A;  1TKZ A;  5D3G A;  3EZ5 A;  4DQQ A;  4C3J K;  3HOZ K;  3TTD A;  3H3N O;  3K5L A;  2VCP A;  1CZA N;  4I6M B;  1SFO K;  4KHW A;  3AQO A;  3GEH A;  4OIP A;  4IO9 L;  1KD1 O;  2OTL N;  4Z94 A;  4IKF A;  2A6E A;  2OAN A;  3C6A A;  3VES A;  4LFC K;  2KZM A;  2RGR A;  4H5V A;  1BGW A;  4E7I A;  2XY8 A;  1EWR A;  1N32 K;  1TWG K;  3G4A A;  2IVN A;  4JK7 A;  1FKP A;  4QJV B;  4E7J A;  5C44 K;  3S2H C;  1T3V A;  5K14 A;  4AH9 A;  3HL8 A;  4DFM A;  3GTQ A;  3GDZ A;  4CZK A;  2JA6 C;  4O0I A;  4KRE A;  2RF2 A;  4GFQ A;  1ITG A;  3AD8 C;  1VHX A;  4M45 A;  2FBX A;  5AQZ A;  2OYQ A;  4OIR A;  1VQL N;  3GTJ K;  1TWC C;  1GLC G;  3OYM A;  4DSI A;  3DOL A;  4KH4 A;  1O2A A;  2P9S B;  3VET A;  1N33 K;  5HL8 A;  3LP1 A;  1R59 O;  2W40 A;  1ATN A;  3O80 A;  4FK4 A;  4M1X A;  4ILG B;  4CZJ A;  2CH6 A;  1BS2 A;  4KMH A;  1X31 C;  1WOO A;  5JVG L;  2HMP A;  1PJ7 A;  4HHT A;  1HNZ K;  4XH4 A;  4JI3 K;  3O4W A;  4Q5V A;  2E2H C;  5C4J K;  4FWO A;  2PHC B;  3HXA A;  4BRC A;  1WLJ A;  2F8T A;  3RMB A;  3IFR A;  2O5I A;  4GV6 A;  2Y0S D;  1KAX A;  4XLN A;  1WOR A;  3ULD A;  1O2B A;  2E2Q A;  2YHB A;  4BRO A;  3OHR A;  1UV7 A;  4KB2 A;  1JLE A;  3FE1 A;  2O8F A;  4KAW X;  2P9L A;  2VUM C;  3JS6 A;  4M3Y A;  5KGX A;  3S1R C;  1WCM C;  3AV9 A;  4R79 A;  3T1Y K;  3LM9 A;  1WNS A;  3TTC A;  2NVX A;  4BAC A;  1WOP A;  3VN5 A;  3TTF A;  4DTU A;  3LDP A;  4QOZ B;  4JS5 A;  3L2R A;  1ZYQ A;  3T02 A;  3CXC M;  4GVM A;  4C8K A;  1NGJ A;  1WOS A;  4KAS A;  1B92 A;  4CFA A;  1EQY A;  4M63 C;  5AZI A;  4YOW A;  3L2V A;  1I50 K;  1WSR A;  4FWS A;  5HP1 A;  4KHS A;  4BRE A;  3CCU N;  1TWF K;  3RR8 A;  1UOC A;  2V51 B;  5DMR A;  5AQL A;  3I56 N;  1LAV A;  3SZY A;  4NCA A;  2JWL A;  4A3C C;  1XHZ A;  4A3F C;  3HP6 A;  3THX A;  1ASV A;  4N47 A;  3SV4 A;  2ZM6 K;  2ITM A;  1TK8 A;  2PMZ L;  5AQU A;  5L46 A;  1RTD A;  3SK3 A;  4FZY A;  5IOR A;  5HRR A;  2YNH A;  3CCV N;  4LFA K;  3WXI A;  1NGF A;  1K8A O;  4EHT A;  1D5A A;  1XXC A;  2NVQ C;  1JVI A;  4JV5 K;  4DR7 K;  3NF7 A;  1C0F A;  1Z6R A;  2YKN A;  3O9S A;  4CHQ A;  4B9N A;  4A3M C;  4OVL A;  1R9T C;  1VQP N;  4E1M A;  1NG9 A;  4FYD A;  4LC9 B;  5BRH A;  1KFD A;  4A59 A;  2XRI A;  2VG5 A;  3DMJ A;  3CJA A;  3CPE A;  3LDN A;  3TAM A;  4CJK A;  3KWG A;  4CGH A;  1IJJ A;  2VGN A;  4JN4 A;  5KTQ A;  3O3G A;  2PFU A;  3VQQ A;  5AQM A;  1TKT A;  5IYB K;  3H6E A;  2D0O A;  3N0B A;  3IKM A;  3AVG A;  5GIO A;  2BGG A;  4DMN A;  4OKK A;  4CEF A;  5KRT A;  4C3I C;  3IRX A;  4HTU A;  3O3H A;  5C12 A;  1X3M A;  3VEV A;  3ZEU A;  3NDK A;  4KI6 A;  2CW0 A;  2AP1 A;  4W5R A;  4WJ4 A;  4Q0B A;  3GEI A;  3AD9 C;  1BIU A;  1Q82 O;  3CF5 L;  2A6H A;  4FM0 A;  1YNJ A;  4BR4 A;  3R3L A;  1LAW A;  4BR5 A;  1TUU A;  1VK0 A;  3F9M A;  1Z26 A;  2NLX A;  1U6Z A;  4CW7 B;  4A3M K;  1Y1V A;  2Y0S L;  3T3F A;  1W97 L;  4KM8 A;  4JHD A;  4BRK A;  1MA9 B;  1RIL A;  3PO5 A;  1EI6 A;  5IOQ A;  4DHY A;  1U45 A;  3VQ5 A;  2GUI A;  1UA0 A;  3NE6 A;  3OYA A;  4CEA A;  1WN7 A;  4RW9 A;  3ZSW A;  3HM8 A;  4BDP A;  2FXU A;  1IW7 A;  4BR9 A;  2FBV A;  3ENO A;  1GLL O;  3QIN A;  2QXF A;  1NBW A;  1HJO A;  3EZW A;  3GTK K;  1WBB A;  3HYF A;  4FJM A;  2YV0 X;  4BBS C;  2HHU A;  3OEP A;  1S22 A;  3I4M C;  3HI0 A;  4GV9 A;  4I9L A;  3WNG A;  3GTO K;  4KMU A;  4KMD A;  4LF5 K;  4BG8 A;  4HWI A;  4DUY K;  3S1Q K;  4DFP A;  1JJ2 M;  3A8J A;  5IYD C;  4CEE A;  3P1G A;  4BXX C;  3O9Q A;  3PUF A;  1VSF A;  3WT0 A;  3ZSO A;  1O24 A;  4E7K A;  5ELZ A;  1JLB A;  3OW2 M;  1TL1 A;  3VQ4 A;  4DSJ A;  1HMV A;  3VGK A;  4CE9 A;  5EU7 A;  1I6V A;  1XQS C;  1SS6 A;  3PO3 K;  3EY1 A;  5IYC C;  3KKR A;  1NGB A;  2CGL A;  4FO0 A;  2E20 A;  3GG4 A;  3QML A;  4MEX A;  4A3K C;  4ID1 A;  5AQT A;  3I33 A;  2OPR A;  4I9Q A;  5FRM A;  5AZJ A;  2KKZ A;  3AA3 A;  4ISF A;  3AO3 A;  3ID6 A;  3DRS A;  4NYN A;  4YOY A;  2V52 B;  1RDA A;  2NVX K;  1U49 A;  4DS5 A;  4BRD A;  5FRO A;  4CHP A;  1LWC A;  1UAX A;  3SJJ A;  4JD2 B;  1NJY A;  4ILH A;  1OH8 A;  2HST A;  3AVH A;  2XY6 A;  3DLG A;  1I3Q C;  4CJQ A;  3W3D A;  4CF2 A;  5FPD A;  3MWT A;  1WAJ A;  5IYD K;  5CHI A;  4WJ3 M;  2CFA B;  4CHZ A;  5IYC K;  5KQ8 A;  3RSE B;  1FW6 A;  4M3R A;  4E3S A;  3ULE B;  1DCO A;  4ILJ A;  2JA7 A;  2FF3 B;  4A5A A;  4KTZ A;  3A8K A;  2Q0R A;  3TR8 A;  4M42 A;  5H1S Q;  4A62 A;  1EXQ A;  5B8H A;  1YF5 L;  3H1V X;  3WXJ A;  4ILD A;  3C65 A;  3AVL A;  5KRS A;  1O13 A;  5AQR A;  5AQO A;  1IKX A;  1O29 A;  2E88 A;  1KLN A;  3JST A;  4FCY A;  3I4N K;  2A1R A;  3WUH A;  2HBK A;  1VQ4 N;  1ZBH A;  3CQZ C;  3A5M C;  1BA0 A;  1ESV A;  4CHY A;  4O2D A;  4FJK A;  3G10 A;  1IO2 A;  2A42 A;  4F4K A;  3KVG A;  1UWB A;  2KW4 A;  2D6F C;  3D2E A;  5AZI B;  2P8T A;  4YHH K;  4LR2 A;  2QWL A;  3OS2 A;  4Z4E A;  3H3O B;  2F4V K;  3CM5 A;  3M4O K;  4DQ8 A;  4N56 A;  2ZD1 A;  3S9H A;  3HPG A;  2J4R A;  1FJG K;  4BRL A;  3SQ2 A;  4WE1 A;  4WQ5 C;  4M3T A;  4F3O A;  1YJW N;  1BHL A;  1TWG A;  4K8X A;  2YX6 A;  3OYN A;  2JA8 C;  4BR7 A;  3DLK A;  3SPY A;  4XH5 A;  3CJ1 A;  3KK1 A;  3FZF A;  3BY5 A;  3VEX A;  4KHQ A;  3ADA C;  4CJE A;  4U67 L;  2P9U A;  4O5B A;  4AYB L;  3VA3 A;  4KN7 A;  1DEJ A;  3Q7C A;  3GIR A;  2GX9 A;  3KD5 E;  3FKI K;  5M3M K;  4BRI A;  4CJT A;  2HW3 A;  3KTQ A;  2YJE A;  4FLU A;  1RFQ A;  1K83 K;  2E2I C;  3MN9 A;  4IDK A;  3HOY K;  3QIC A;  3L6Q A;  4YFK A;  2QWN A;  3N4Q A;  4CJL A;  1RBU A;  3MEC A;  3OYL A;  4IOC L;  3QBX A;  3HT3 A;  1E4G T;  5HRN A;  2UUB K;  3RRG A;  1JKH A;  1SL0 A;  3QNN A;  3O9T A;  4RG8 A;  5E41 A;  5C4X C;  1C6V A;  4G9Z A;  4H0O A;  3D2F A;  4C8M A;  4CHN A;  1TK0 A;  4JRQ A;  2JA5 C;  3W0L A;  1S6P A;  3S41 A;  1TVR A;  4IEI A;  3EYZ A;  1HYS A;  2QI2 A;  4IJA A;  3VPZ A;  3S14 K;  1YTU A;  2IS3 A;  4E1N A;  4KI4 A;  2QM1 A;  2HNY A;  4DLE A;  1O28 A;  2P9U B;  1WSJ A;  4FLT A;  5BN8 A;  4IFY A;  3KJV A;  4CJP A;  1I50 C;  4FJH A;  1KXP A;  4DV2 K;  5FRN A;  4ZHR A;  4YG2 A;  3GTP C;  4QS8 A;  3PV8 A;  3CQ8 A;  4CJR A;  2RKI A;  2WB1 L;  4OJR A;  1YVU A;  3ZSY A;  1RCH A;  3L4I A;  3TAF A;  3I4N C;  1U4B A;  3FHZ A;  3PX0 A;  2HHV A;  1GLF O;  2A41 A;  3DXM A;  3SZ2 A;  3TFH A;  2ETJ A;  2HF4 A;  3Q7B A;  4B1W B;  4LK1 A;  3QEV A;  2G8U A;  1V4S A;  4CFD A;  4AHT A;  2PBD A;  2FQT A;  2JH3 A;  1XMQ K;  3L4Q A;  3K0S A;  3NHG A;  1IBA A;  4C3H C;  4B3O A;  1LCU A;  3L0Q A;  4FK0 A;  4BRN A;  2R7Z C;  1DTQ A;  3SCX A;  3GOI A;  2IIR A;  5D4D A;  1QZ6 A;  3K7A C;  2XCR B;  4FJ7 A;  1T44 A;  3DRP A;  3FZK A;  1WCM K;  4DLG A;  2G8W A;  1XC3 A;  3ENH A;  2DPN A;  4JKB A;  3CCQ N;  3QBW A;  4C8O A;  3HZ6 A;  4H0T B;  3CG7 A;  2E2J C;  1CZ9 A;  4CGD A;  4CGI A;  1TWH C;  4RW7 A;  4HCC A;  4LF6 K;  1H1V A;  1EK8 A;  3IS9 A;  3TAR A;  1NK8 A;  1B4B A;  4LQY A;  4FJ9 A;  1NOY A;  4KB0 A;  4CF8 A;  3SUN A;  4OGC A;  4KHU A;  5EOY A;  2R93 A;  2NUB A;  3KZB A;  3T1H K;  1SL1 A;  2F9W A;  3HBT A;  4DTJ A;  3DWL A;  3DLL L;  4KC6 A;  2WON A;  4KH5 A;  4CHO A;  4G0U A;  2V6U A;  3NCI A;  1X1P A;  2E8A A;  5T7B A;  5CJ9 A;  3SYZ A;  1JLF A;  4IFE A;  3HOW C;  4PL8 A;  5KPR A;  3LAM A;  4CJ7 A;  4RCH A;  3C7N A;  2P9N B;  1TGO A;  1WIH A;  1HKB A;  1D9F A;  2KLA A;  2EBB A;  2VG6 A;  1D8Y A;  4KTW A;  4H5N A;  3OBY A;  5F2R A;  4HUG A;  4I2P A;  4I6M A;  1HNV A;  2HVH A;  1VQ8 N;  4YOT A;  3QNO A;  2R92 C;  3GTQ C;  1QHT A;  2IDO A;  4WFN L;  1DCH A;  4W5N A;  5EGH A;  1VSI A;  1S5J A;  1L5U A;  1R0A A;  1TUY A;  1NJX A;  4I7F A;  1S9G A;  1HQE A;  3A2F A;  2QWQ A;  4FM2 A;  1SFO C;  4JNE A;  3M5R A;  5C3E C;  5JIC A;  3E1Y A;  2R7Y A;  2FBT A;  3PSF A;  3ZSV A;  3L4K A;  4NCB A;  4O8K A;  2D4W A;  5ADX A;  1J98 A;  4JS4 A;  5LMN K;  1HX1 A;  3CCM N;  3UE5 A;  2E2O A;  4BC3 A;  1OH6 A;  4Z4C A;  2QXL A;  4K41 A;  1JLQ A;  2XHB A;  3SUO A;  2GAH C;  1RDD A;  1K6Y A;  3LDL A;  4QAG A;  3UB5 A;  3KKS A;  2ZGY A;  4BQZ A;  1B4A A;  3IUC A;  3HOU K;  3M3Y C;  2KFZ A;  5FPE A;  2QWP A;  1VJE A;  1BCM A;  3PO2 C;  4B9L A;  3L2W A;  3H08 A;  4P5B A;  1QSS A;  4EAH D;  3C94 A;  4B1V A;  5LY3 A;  3OYH A;  3NF9 A;  2IOC A;  1JCG A;  5J2P A;  1ASW A;  1BQN A;  4A3B K;  1YTA A;  3VEN A;  2X78 A;  1NK0 A;  2G8F A;  4H5T A;  1TL3 A;  3K57 A;  4PY5 A;  4CES A;  1RBR A;  4Z0U A;  3MAQ A;  3RTV A;  3MN6 A;  1YAG A;  3U8X A;  1Q86 O;  4CZH A;  2PA8 D;  3G4C A;  4E7H A;  3CC7 N;  4CBW A;  1NK9 A;  1Z05 A;  1MU2 A;  2WOM A;  5M1F A;  2O8D A;  5GAH P;  4X62 K;  4A3I C;  1QQN A;  3MCA B;  5AQX A;  1EQR A;  5M1O A;  4CCH A;  3LP2 A;  3ZT0 A;  3MEG A;  3GSI A;  4A5B A;  1HNW K;  3ZT4 A;  2UXC K;  3AO4 A;  1GLA G;  4CF0 A;  2PZS A;  3PIP L;  4JK9 A;  3AD7 C;  3BF1 A;  3M8P A;  2B63 A;  3F2K A;  4O8U A;  4DQP A;  5HLF A;  2FSJ A;  3GTM A;  3S3M A;  3UIQ A;  5GAE P;  3T1A A;  3HOV C;  3S3O A;  5AQV A;  4FJG A;  2O8C B;  1BQM A;  2UYT A;  2B63 K;  2HB5 A;  5HRP A;  3ZT1 A;  3TSU A;  2B4J A;  3I0S A;  2P9K B;  3VMF B;  3RWU A;  3A5O C;  4DWI A;  3HOV K;  4LD0 A;  1E3M A;  4G7H A;  1VQ5 N;  3EKS A;  5GIN A;  3E01 A;  4FWQ A;  4B8A B;  3S14 C;  4DR2 K;  4DG1 A;  1JCE A;  1BDF A;  3SJH A;  3P31 A;  1MWK A;  4IBN A;  1J5E K;  5IP9 K;  3QIP A;  1VAZ A;  3BP8 A;  4DV5 K;  5CYQ A;  2Q3S A;  1O26 A;  3DXM B;  4FLW A;  4CZM A;  3GTL C;  5IT9 O;  3LAP A;  3TU5 A;  2P9I A;  2HBJ A;  3C6T A;  3MX5 A;  3O4N A;  1SUQ A;  4CK2 A;  3KK3 A;  4FJL A;  4FVU A;  4GTE A;  4Z4H A;  2UU9 K;  2HHS A;  3RR7 A;  3FFK B;  1WQF A;  4BRQ A;  1KVB A;  3AH5 A;  5F0X A;  1RU0 A;  2E2H A;  4PKI A;  2YHA A;  2FQO A;  3JAM O;  3HO1 A;  3SAF A;  3VA0 A;  4CJS A;  3U9Z A;  3CQZ K;  3RZO K;  3RVC A;  2JA7 C;  3FGU A;  4X65 K;  2UXD K;  4LSL A;  4BRP A;  5BPL A;  3ZEU B;  5C4J C;  3CJ9 A;  3ENB A;  2HHH K;  3U3G A;  4JKG A;  3O8M A;  1BOT O;  3GDQ A;  5J2N A;  4GMJ B;  1TWA A;  3VQP A;  5TKW A;  5I42 A;  4DF8 A;  3ZT3 A;  3FZH A;  3L2U A;  1GOB A;  4JI8 K;  3E9L A;  4JAX A;  5KI6 A;  1ISE A;  2VWB A;  4KAZ A;  5IOT A;  4B1X B;  1OVQ A;  4BGB A;  3DI6 A;  3E66 A;  4DTR A;  4DQI A;  2ZUE A;  1L3T A;  4OPH A;  1W7A A;  3LAJ A;  1HNX K;  2GV9 A;  3ZT2 A;  4FLV A;  1ATS A;  3VQE A;  1S72 N;  3EO3 A;  3VA7 A;  4CZF A;  3VQ6 A;  3QLH A;  3LDO A;  1NKE A;  5M1P A;  4JHD B;  1YCL A;  2HHQ A;  3FZL A;  1QE1 A;  3V6D A;  3CCS N;  3HOW K;  4EIA A;  2DTU A;  3KK2 A;  4LF9 K;  3THX B;  3SBT A;  2D5R A;  3SPZ A;  3MN5 A;  4CIG A;  4DR1 K;  2YU9 K;  2NVX C;  2A1S A;  4WYB A;  5E84 A;  4BBR K;  2PYL A;  1VQN N;  2P1J A;  2WB1 D;  3KK7 A;  1N36 K;  3KHY A;  1YX2 A;  3G4S N;  5GAD P;  2UUA K;  2Q1N A;  4GT9 A;  2P9N A;  3CCR N;  4C1N K;  5FPN A;  1PJ6 A;  4A3E K;  1TWA K;  5E26 A;  3L4J A;  4FJI A;  3E9P A;  1NGG A;  4MLE A;  2YNI A;  5MLC Q;  3BEX A;  1SKS A;  2XCO A;  2QTD A;  2AJQ A;  5HOO A;  3CPW M;  2YNF A;  4G0W A;  4CZE A;  3RMC A;  1V5V A;  3G6E N;  2W7V A;  3M8R A;  4BC4 A;  1RDU A;  4CFB A;  2E2H K;  4JK8 A;  4GTF A;  4RWT A;  3VEW A;  2P9P B;  1HLU A;  3U4L A;  3KLH A;  4QCL A;  2Z1H A;  2RHK A;  1ZVU A;  4QS7 A;  5M5Y K;  4U7B A;  4NLC A;  3A8I A;  3S15 K;  1RNH A;  4CK3 A;  1HJR A;  1U2V A;  3CM6 A;  3HM9 A;  4A3J C;  1X9S A;  5BR9 A;  3ZET A;  3DXJ A;  4B3M K;  4KHN A;  4GNI A;  4B8C A;  4LJZ A;  1P8Z A;  3PLA A;  4DKW A;  2E4L A;  1EWQ A;  4AQY K;  4H03 B;  4EP5 A;  4DSF A;  1EO1 A;  1BUP A;  4KPY A;  3S2H K;  1C1C A;  1VSD A;  2D0P A;  2GEM A;  3RSE A;  5M1K A;  1T03 A;  4WFB L;  2HF3 A;  2V6T A;  2VWK A;  4DU4 A;  1WCM A;  4JKD A;  2E1Z A;  1C0A A;  1BIS A;  3J8A A;  1WAF A;  2P5G A;  5AQK A;  1NK7 A;  3RZD K;  3DOK A;  4Z4G A;  3OVN A;  4RW8 A;  3TAG A;  3HOZ C;  1WSH A;  4HTL A;  2ZWH A;  2PMZ D;  4LSN A;  5M5W K;  4A3D K;  2R7Z K;  3G0Z A;  2VG7 A;  1NNE A;  4M3U A;  3S2D C;  4W5T A;  3O08 A;  4H8K A;  1U47 A;  1D4X A;  4ZTJ A;  1AB4 A;  2Z1I A;  5AQG A;  1J6W A;  3K9J A;  4WF9 L;  3NVM A;  1TV6 A;  3BZC A;  3I8B A;  1I94 K;  4BY1 C;  3G71 N;  4A2B A;  4JI7 K;  1MDU B;  4HUE A;  1BWF O;  1ZQ1 C;  3FKI C;  3HVT A;  4GKK K;  5KQD A;  3CFP A;  5I3U A;  4Y7N K;  2VQF K;  4G0V A;  1N8R O;  1WQH A;  2EX3 A;  3TAP A;  1ZBI A;  3DJC A;  3CCE N;  1W9H A;  3Q3Q A;  2ASP A;  4K8Z A;  2I7N A;  4QIW D;  1RDB A;  2YHW A;  3QDK A;  3HPH A;  3QIO A;  4FLX A;  3MK6 A;  4IOA L;  4YDU C;  3LAN A;  2KFN A;  3QO9 A;  1YXQ A;  4C45 A;  1O27 A;  3K2P A;  4BQL A;  3S17 C;  2NNW A;  5AQW A;  1XZP B;  1Y97 A;  3U3Y A;  1J6V A;  4OIO A;  3BDP A;  4FW1 A;  5BRE A;  2D0B A;  4J8F A;  1Y1W K;  4C3I K;  4IXC A;  3B6P A;  3SLC A;  4FJ8 A;  3I0R A;  2NZT A;  2QWO A;  4L3Q A;  3P5J A;  3J7Y P;  3D45 A;  2UUC K;  4IOX A;  3ZX2 A;  2ZJQ L;  3WEE A;  4FWL A;  1F21 A;  2A6A A;  3MED A;  1OH5 A;  2BTF A;  1XI1 A;  2JLE A;  1M1K O;  4CJ5 A;  2YI1 A;  1LW2 A;  3PSI A;  3S15 C;  4JKH A;  1XPP A;  3MML B;  1QSY A;  1WB9 A;  3HKZ L;  3AA5 X;  2GAG C;  5M1N A;  1S9E A;  1ZXO A;  3FKI A;  4P5A A;  3DXK A;  3VQA A;  3VF4 A;  4CF9 A;  5HBM A;  5BPM A;  4DR4 K;  3GTG C;  4JYA K;  2R92 A;  1NK5 A;  4O55 A;  4MQ3 A;  4Y1D A;  4W5Q A;  5SWM A;  1RT2 A;  2QEX N;  4KBO A;  4FPA A;  2EHG A;  3UKR B;  3ZSQ A;  1QHA A;  4CZL A;  4GY2 B;  1CXQ A;  3D6R A;  4DF4 A;  1I6H C;  2PY5 A;  4BVO A;  3K5N A;  2GSN A;  4F2R A;  1RTH A;  3J7Z O;  1ZBS A;  5M3F K;  3BZK A;  4DSL A;  4KB4 A;  4CBU A;  4E1J A;  3NBP A;  2V7Y A;  4CED A;  5C24 A;  2NRR A;  4CEB A;  5AFU H;  5AQP A;  1TWF C;  4DTO A;  3K58 A;  4C23 A;  1VQ7 N;  1PJ5 A;  4NYF A;  3CFO A;  3EKU A;  2GTD A;  4OLA A;  2VUM K;  2YU9 C;  5KPZ A;  2OPP A;  3O4Q A;  1TWC A;  4FOI A;  4B1U B;  4E0D A;  3NH1 A;  4A3L C;  1DCP A;  3V9S A;  1T6D A;  5EGE A;  4CZG A;  1S1W A;  3UKU B;  1VQM N;  3LP0 A;  4GTC A;  5CR4 A;  3HP9 A;  3IPJ A;  2A69 A;  1GLJ O;  3SBG A;  4CJV A;  3ATV A;  4IO8 A;  3AGR A;  5CYM A;  1IKY A;  4CFC A;  1USO A;  4DV6 K;  1YIT N;  2JA6 K;  1KSP A;  4PQU A;  2HHX A;  1WUA A;  4BC5 A;  4LK0 A;  2DFE A;  2JA7 K;  1ZBU A;  4B9V A;  3AVK A;  3S16 C;  3K59 A;  1YHQ N;  4LY7 A;  3VQD A;  1TWH A;  3UKR A;  1DLO A;  2BUP A;  3SQ4 A;  1I3Q K;  4AF1 A;  2ZFZ A;  1BU6 O;  3K5M A;  4CD3 A;  1ASU A;  2OA8 A;  2IAJ A;  3TAB A;  4FLZ A;  3VQC A;  3K9K A;  3D2F B;  4M3X A;  2O4G A;  4FZZ A;  4K0K K;  4C2M C;  4FOE A;  4BY7 K;  2W41 A;  2Z1G A;  2ZF5 O;  3J7A P;  3AY9 A;  2QA4 N;  4GTL A;  1YI2 N;  1EET A;  3JYT A;  4BRF A;  5IP7 C;  3VEO A;  2E2I A;  2WAQ L;  5JLH A;  2ZGZ A;  1Q81 O;  4B9S A;  4H0P A;  3ID8 A;  1NLV A;  4JI6 K;  4H0V B;  2FLO A;  5TMF A;  4QS9 A;  4BDZ A;  1REV A;  3ZX3 A;  5A2Q O;  1YUW A;  4A3G C;  3OA9 A;  4J2B A;  3MXJ A;  1T6C A;  3KIO A;  2F9T A;  5AZJ B;  3QER A;  1X9M A;  3O5B A;  3QET A;  4MO4 A;  1XMO K;  4CJW A;  4G1Q A;  4KV8 A;  4AHC A;  1Q18 A;  3T19 A;  3N4P A;  4B3R K;  5DK5 A;  4ZTF A;  3HKZ D;  3OY9 A;  4FWN A;  4ELU A;  5IYB C;  2XY7 A;  4OIQ A;  4DUZ K;  3DLR A;  2YHX A;  4XEI A;  3OYD A;  3S1Q C;  4CJF A;  3TFJ A;  4AM6 A;  3GTL K;  3F5T A;  4UY8 O;  4OO1 J;  4BBS K;  2D1K A;  5BN9 A;  1RBV A;  3THY A;  3GTG K;  3VF2 A;  5EY4 A;  5IP9 C;  2KQ2 A;  3ULE A;  3H3V L;  3LDS A;  3P39 A;  4AHR A;  3AVA A;  4IJN A;  2GWJ A;  1NKB A;  3J81 O;  2RE2 A;  2OZS A;  3ISN C;  4NXM K;  3PY8 A;  1L0W A;  3NGY A;  5TJ3 A;  4WQ5 A;  1VH2 A;  3SQ0 A;  1W0H A;  4HCB A;  1JLG A;  4LH5 A;  1WOQ A;  3EL2 A;  4M7Y A;  4RTF D;  5LJW A;  3VQ9 A;  3L2Q A;  2QWM A;  4MEY A;  2Z1J A;  3SAH A;  1WSE A;  2ASM A;  3AAQ A;  3MN7 A;  4WQ4 A;  1SKW A;  2F8S A;  4GTD A;  5JS1 A;  4N5S A;  2Q36 A;  2F96 A;  5AQJ A;  1HYZ A;  1FKO A;  3FOE A;  4XSX A;  4OLB A;  1S1X A;  3V4G A;  2KWA A;  2HBM A;  1A5X A;  2Y3P A;  3THY B;  4JI5 K;  4AHS A;  3VF6 A;  1Q9Y A;  1VQ9 N;  1WSV A;  3C7N B;  4RW6 A;  3WEE B;  3V81 A;  1JLA A;  4WIL A;  4CJU A;  1XUP O;  1EH1 A;  1RDW X;  4BE0 A;  4XIU A;  2NRT A;  4B9M A;  3PX6 A;  1T8E A;  1JOE A;  4BR2 A;  2PAV A;  5J2M A;  3S1M C;  2F7T A;  4EFH A;  2HNZ A;  5IP7 K;  2O8B B;  1RT4 A;  1KVA A;  4JEP A;  2BH1 A;  2OPS A;  3H0G K;  3S1N C;  3O1B A;  3HRG A;  1BDG A;  3T01 A;  3KWI A;  3MWP A;  1TYQ B;  4K42 A;  4MFB A;  3GTL A;  1D9D A;  3THV A;  2P9L B;  1INN A;  1DGK N;  1S3X A;  5TKY A;  1NJI O;  3GEE A;  5C3E K;  1K9M O;  3ZYY X;  4PHT X;  3OYE A;  2Q97 A;  4B9U A;  1S1T A;  2NRX A;  1DT9 A;  4WQ4 C;  2P9I B;  1OH7 A;  4FWP A;  3JXU A;  4EHU A;  3LL3 A;  3NAE A;  4PKG A;  3NUH A;  1J9A A;  4KDD A;  4O4G A;  1JXB A;  1CZB A;  3AO2 A;  3TSP A;  4E7L A;  4A3C K;  5FLM K;  1ZBF A;  1GOC A;  1ILY A;  3MMV A;  3QX3 A;  4Y52 C;  3EE8 A;  4DFJ A;  3KLI A;  3NGI A;  2D0A A;  3WQU A;  2P5O A;  4A93 C;  4EZ6 A;  3O9U A;  3CME N;  1KCF A;  2W6K A;  2HVI A;  4A57 A;  2OPQ A;  3ERE D;  1TAQ A;  1K73 O;  3AVF A;  3V9U A;  1HUX A;  4A3L K;  4GVE A;  1O2F B;  4FPB A;  2ZJR L;  2E2J K;  1YIJ N;  2E6M A;  4JKF A;  4BE2 A;  4N76 A;  1RTJ A;  3IAY A;  2JGU A;  4BXX K;  4KO0 A;  1QQM A;  1U48 A;  1NM1 A;  4G7O A;  3FLC O;  3M3Z A;  2I5J A;  3IDH A;  2Q31 A;  5LMU K;  4X64 K;  1KFS A;  5FDL A;  3PO3 C;  1N6Q A;  4H4O A;  4CIE A;  1TWH K;  3LZI A;  4GW6 A;  3VQ8 A;  3GTO A;  4FW2 A;  1BIZ A;  3DAW A;  2JA6 A;  1TKD A;  1C0T A;  3D2E B;  3I55 N;  3BP3 A;  2YJF A;  4A61 A;  3D7E O;  3CMA N;  4LLG A;  3TI0 A;  3SUQ A;  3GTK A;  4BGA A;  4XCH A;  2EWS A;  5EX5 A;  5GIP A;  3H0G A;  3C6U A;  4LF7 K;  3ZSX A;  2CH5 A;  3TAE A;  4KRF A;  4OIN A;  3SZZ A;  4CVN E;  2WBN A;  4HUF A;  1P90 A;  4C3H K;  1O1W A;  3OYG A;  4B9Q A;  2VUM A;  4CZI A;  4FK2 A;  3VTH A;  1N5Y A;  4PA1 A;  1SV5 A;  2DFH A;  5DM6 L;  2ASO A;  2GUP A;  2VYP A;  3CIP A;  3GTJ A;  4X6A C;  5M5X K;  2E6L A;  1I3A A;  4CIF A;  1Y1W C;  3TTG A;  4F8R A;  1Y1V K;  2GSO A;  1JQW A;  1LWF A;  2V6S A;  2BDP A;  1SMY A;  4CER A;  4CEQ A;  3R6M A;  3OS1 A;  4Q4Z A;  3VTI A;  4A93 K;  2P9P A;  3T7Z A;  1JLC A;  3CJB A;  3TPQ A;  4DV1 K;  4FWK A;  1GLE G;  3I4M K;  1C1B A;  4B1Z A;  1XC9 A;  4RW4 A;  2ZJP L;  4OKE A;  3RZO C;  2RN2 A;  3O1W A;  3EN9 A;  1I6H K;  5HL7 L;  2W42 A;  4E19 A;  1KC8 O;  4JKA A;  2KHO A;  4E89 A;  1CLQ A;  4MLH A;  1IQ0 A;  2B63 C;  3S1M K;  3QFU A;  2A5X A;  3QB0 A;  1HPM A;  3THW A;  3GTM C;  1NKC A;  1YJN N;  3LPU A;  2GWK A;  3LDQ A;  5LJV A;  3NH0 A;  3AO5 A;  4B08 A;  1UA1 A;  4X66 K;  4YOX A;  1V4T A;  1VQ6 N;  1W2B M;  1KQS M;  4M3Z A;  4AHV A;  2ITG A;  3C6H A;  3A5L C;  3B8A X;  1SAZ A;  5C15 A;  4JK1 A;  1NGD A;  2I7P A;  3H1Q A;  1IBM K;  4V19 S;  1VSJ A;  4YOR A;  1NWK A;  2PYJ A;  1BO5 O;  3DLE A;  5C4X K;  2OTJ N;  2BE5 A;  2QW9 A;  4JKG B;  5AQN A;  3OBW A;  4NCG A;  3VQ7 A;  1B9D A;  1R9T A;  4DSE A;  5LL6 Z;  4JI2 K;  3GTG A;  1U04 A;  1S1U A;  5KPT A;  1Y1W A;  1ATR A;  3L8B A;  1XHX A;  1QVF M;  1Y64 A;  4YOV A;  4JRP A;  1O25 A;  4BG9 A;  2WAQ D;  2JA8 K;  5C10 A;  2RH6 A;  3HOS A;  4F2S A;  5E68 A;  2JA5 A;  3GBT A;  1LOT B;  1JL2 A;  1F7U A;  1BCO A;  2JWK A;  4NLB A;  3R1X A;  3GTP A;  4DR5 K;  2P51 A;  3QFP A;  1VSK A;  3K5O A;  2WUS A;  5JFE A;  3DM2 A;  3LWL A;  4ELT A;  1T7P A;  4JD2 A;  1FK9 A;  1TWF A;  1IE0 A;  5CZ1 A;  4A3F K;  1I50 A;  1QQC A;  3DLH A;  3T00 A;  1KAY A;  2GEL A;  3LPX A;  3AVJ A;  4LOW A;  2VGM A;  2WTU A;  3ATU A;  5AQS A;  3HSC A;  3FFI A;  1K83 C;  2E2I K;  3HOU C;  3A8Y A;  4PAB A;  4RMF A;  1IBK K;  2CFA A;  3WXM B;  3OYK A;  4LF8 K;  3RMA A;  1TKX A;  4WCE L;  5HRS A;  2NVY A;  2W6L A;  3NVK A;  1C0M A;  4DB3 A;  2O4I A;  4KMA A;  4H0Y B;  2O8B A;  4BWM A;  5BR8 K;  3N0C A;  1RT6 A;  2DFF A;  2AA4 A;  2WFB A;  3IG1 A;  1J6Z A;  3TAQ A;  4DV3 K;  3V1R A;  4CK1 A;  3HOY C;  1DD5 A;  4K25 A;  4KM9 A;  1G15 A;  1NGE A;  3L3U A;  5AQF A;  4B1Y B;  3PX4 A;  4C2M K;  4BKW A;  1TYQ A;  3VEY A;  1QZ5 A;  1E4F T;  3TSQ A;  4DTP A;  2Y1I A;  3R8E A;  5CZ2 A;  2E1Y A;  5IWA K;  3MXI A;  1EX4 A;  3S3N A;  1I3Q A;  2OZM A;  3M3Y K;  3VGL A;  1Z25 A;  5SZT A;  1XXB A;  1YVN A;  2HND A;  1N34 K;  3DYA A;  3TWH A;  3V9X A;  3SMP A;  1Q7Y O;  3ALY A;  4DV4 K;  5AQY A;  3O3F A;  4C8N A;  2HOE A;  3MCP A;  3U6F A;  1TK5 A;  1XZP A;  3P4I A;  4DTN A;  4N41 A;  3A5N C;  4M3W A;  1KLM A;  4Y1C A;  3NMU A;  2O8F B;  3NGZ A;  3CCL N;  1NGI A;  3PO2 K;  4JKC A;  3ZET B;  3DXK B;  4DCH A;  5AR0 A;  3V1O A;  4BVP A;  4BY7 C;  1KVC A;  4F3T A;  4NOI A;  2VWJ A;  1TWC K;  2GBZ A;  2B6A A;  1G99 A;  1WSI A;  3AO1 A;  2V7Z A;  4DV0 K;  1Y1V C;  3HXM A;  3F73 A;  4KB1 A;  1RTI A;  1IG8 A;  4J2A A;  2IVP A;  2R93 C;  5FLX O;  4Z4I A;  4DR6 K;  3GTQ K;  3MX2 A;  4A2A A;  1TWG C;  4J2E A;  4LH4 A;  1EFW A;  3H45 C;  2O8E B;  4FVM A;  3BUE A;  4B9T A;  3GL1 A;  2IVO A;  3KLE A;  3GTO C;  3WNE A;  2OCE A;  4OX9 K;  5CE3 A;  2E2P A;  4C3J C;  1BJT A;  3HOX K;  2FSK A;  2LSN A;  1SFO A;  3QES A;  1IBL K;  1EP4 A;  1RT1 A;  4FSV A;  2DY4 A;  2R92 K;  3H0G C;  4I2Q A;  5ADX H;  3BF3 A;  3C0B A;  3CQX A;  1C0G A;  3VEZ A;  4CD1 A;  2FBY A;  4DSK A;  1A5V A;  3OYC A;  3GTJ C;  4ISE A;  1X3N A;  4BE1 A;  3WXL A;  3BUZ B;  3LZJ A;  3FZM A;  4FWR A;  4NXN K;  1VQO N;  5JVH L;  5AQH A;  5C44 C;  3DRR A;  4FM9 A;  4GZY A;  3AVN A;  4UQG A;  1DTT A;  4H5W A;  1J5O A;  1QQO A;  5JS2 A;  1NJZ A;  2X74 A;  3NFA A;  3JSM A;  1IV0 A;  4IWV A;  4OPK A;  4H4M A;  1YT3 A;  1VSL A;  5BPN A;  3HST B;  1YNN A;  1RDC A;  1IKV A;  4ELV A;  4YDU A;  2KTQ A;  3SNN A;  1GE9 A;  2IGI A;  5JMV A;  3HOT A;  4AYB D;  4KH6 A;  3EEQ A;  4GV3 A;  4FWM A;  3CI5 A;  1VGX A;  5I9E B;  4PUO A;  1VRQ C;  5HRO A;  2ZE2 A;  3LPT A;  5J2Q A;  4DQR A;  2QK9 A;  3K7A K;  4TSX A;  3D0P A;  4Y0W A;  3AA2 A;  4OKJ A;  4A3I K;  3CC2 N;  4ICL A;  3PO4 A;  4DDQ A;  1FXX A;  1Q9X A;  3S1N K;  5AQQ A;  1NMD A;  3QEW A;  2FSN A;  4FJN A;  3WNH A;  3CD6 N;  2YCH A;  1VSE A;  1MWM A;  4JI1 K;  2O8C A;  5C25 A;  3E9O A;  4FM1 A;  2RPI A;  4IFV A;  4AIL C;  2NVQ K;  1TAU A;  3EQL A;  1SQK A;  1BA1 A;  2Q2R A;  4KHP K;  3SV3 A;  2R7Z A;  4O0J A;  4BWJ A;  1BGX T;  1M90 O;  4CI6 A;  5TMC A;  1NJW A;  4IEE A;  2HBL A;  3HVR A;  3NF6 A;  3CJ7 A;  4PKH A;  1LW0 A;  4XLP A;  4BRG A;  2YKM A;  3WQT A;  1F7V A;  4FJX A;  4DR3 K;  1NGC A;  3WNF A;  1L3S A;  1HQM A;  2G8I A;  1J53 A;  3V9Z A;  2X6S A;  3GTM K;  4CGG A;  4Y7N C;  3SQ1 A;  5FPM A;  3C95 A;  4EP4 A;  1OKJ A;  3HPO A;  3DLB A;  2G8K A;  3ITH A;  4DTM A;  1LV5 A;  4CGF A;  2O5J A;  2PA8 L;  1S1V A;  3F9K A;  5JVO A;  3HTV A;  3SI6 A;  1NK6 A;  3UKU A;  3VOV A;  2P5M A;  3SMS A;  5C2F A;  3SUP A;  1SZ2 A;  4CGJ A;  3S2D K;  2NRV A;  3OJU A;  5EXW A;  5AQI A;  3WOD A;  1BI4 A;  4YY3 K;  4K43 A;  2E5L K;  3M8Q A;  5CY4 A;  3OYB A;  4CF1 A;  1L3U A;  1S6Q A;  4BY1 K;  4JKE A;  2NVY C;  4M7X A;  4PAA A;  4AHU A;  2X6N A;  1VRU A;  4AM7 A;  3AVB A;  3NH2 A;  5DM7 L;  1NK4 A;  3PIO L;  1K8K B;  4IDH A;  5EVZ A;  3CET A;  4P9S A;  2WC9 A;  1RBT A;  1XWL A;  1WSG A;  3SAG A;  1TWA C;  4MQ9 A;  3LWM A;  1HKC A;  1XXA A;  4PWD A;  4DQS A;  2NRW A;  3CER A;  3OYI A;  1JXE A;  1RGI A;  3AAP A;  3AAR A;  3EE9 A;  1ZYR A;  4MDB A;  3QEP A;  3ASM A;  4XH1 A;  3HOX C;  1IL2 A;  4BRH A;  4IG0 A;  4DTX A;  2Q0U A;  1RT7 A;  3MDQ A;  3KLF A;  4M41 A;  3RRH A;  4GTA A;  1IG9 A;  3J80 O;  4CEC A;  2YU9 A;  3I8D A;  2H3G X;  3OS0 A;  1F9N A;  1HI9 A;  5KGW A;  3RMD A;  3VER A;  2YHY A;  4OPJ A;  4BDY A;  4DS4 A;  3CJC A;  2PPB A;  4MO5 A;  2XCQ A;  2A68 A;  3OTO K;  2G8H A;  1HNI A;  3H46 O;  3VGM A;  1C1A A;  3KD1 E;  4LF4 K;  4JI4 K;  2IC3 A;  3ZX0 A;  2P9S A;  3LM2 A;  4KKO A;  3V4I A;  2CGK A;  1HRH A;  3TFI A;  3O6W A;  1HYV A;  1USM A;  4BLB A;  1QS4 A;  3CFR A;  4F9O A;  4DFK A;  4BY9 C;  3GE1 A;  4CEZ A;  1K8K A;  5IOS A;  4L8R B;  2KZZ A;  3AVI A;  1RBS A;  4A3E C;  2G8V A;  3S1R K;  3L3V A;  4W5O A;  3P38 A;  4C1N I;  2O8E A;  4Y52 K;  2NRZ A;  2HHW A;  1XNQ K;  3AVC A;  3AGK A;  2VQE K;  1QVG M;  4BBR C;  3FR0 A;  4OGE A;  1J6X A; 
#chains in the Genus database with same CATH homology
 4PL7 A;  5C0Y A;  4A62 A;  5HOO A;  3D2E B;  3I55 N;  3CPW M;  2YJF A;  4A61 A;  3D7E O;  3CMA N;  5B8H A;  3CQZ A;  1YF5 L;  3H1V X;  4CZE A;  4G0W A;  3CHW A;  5BRF A;  3WXJ A;  4BGA A;  4CBX A;  4ILD A;  3G6E N;  3GTK A;  3C65 A;  1IS1 A;  4BC4 A;  1RDU A;  2EWS A;  1O13 A;  5EX5 A;  1ZC6 A;  4JK8 A;  4O5F A;  5GIP A;  3H0G A;  4GTF A;  5AQR A;  4RWT A;  3VEW A;  2P9P B;  1HLU A;  5AQO A;  3U4L A;  1O29 A;  2CH5 A;  2E88 A;  3ORE A;  4BLA A;  1VQK N;  4KAT A;  2RHK A;  3N3Y A;  2WBN A;  3CCJ N;  3WUH A;  2HBK A;  1VQ4 N;  1P90 A;  1ZVU A;  4QS7 A;  5CHP A;  3A5M C;  1GLD G;  4B9Q A;  4U7B A;  1BA0 A;  1ESV A;  2VUM A;  4CZI A;  4NLC A;  1KAZ A;  3VTH A;  2A42 A;  4NB4 A;  3KVG A;  4WFA L;  4KAR A;  5DM6 L;  2ASO A;  2GUP A;  2VYP A;  3CIP A;  3GTJ A;  3D2E A;  1U2V A;  5AZI B;  4LR2 A;  2QWL A;  5BR9 A;  3ZET A;  3H3O B;  2GSO A;  4GNI A;  4DQ8 A;  5F1X A;  1P8Z A;  3R9P A;  3PLA A;  2P9K A;  4DKW A;  2J4R A;  3R6M A;  3VTI A;  4BRL A;  4FZB A;  2P9P A;  3T7Z A;  4MDA A;  3CJB A;  1X9J A;  3TPQ A;  5GAG P;  4WQ5 C;  4H03 B;  1EO1 A;  1BUP A;  1GLE G;  4FWK A;  1YJW N;  1TWG A;  2E2H A;  5M1Q A;  2YX6 A;  4B1Z A;  4J3N A;  4BC2 A;  2ZJP L;  4BR7 A;  2D0P A;  4XH5 A;  2GEM A;  3RSE A;  3O1W A;  3CJ1 A;  5M1K A;  3FZF A;  4WFB L;  2HF3 A;  3EN9 A;  3VEX A;  5HL7 L;  1WCM A;  1KC8 O;  4JKD A;  1U2V B;  2E1Z A;  2P9U A;  4U67 L;  4JKA A;  2KHO A;  1DEJ A;  3Q7C A;  4MLH A;  3J8A A;  2GX9 A;  5AQK A;  3AQP A;  3OPF A;  3QFU A;  2A5X A;  3QB0 A;  1HPM A;  4YOU A;  1YJN N;  2GWK A;  4BRI A;  3LDQ A;  3O9R A;  4HTL A;  5LJV A;  2ZWH A;  2YJE A;  4YOX A;  1RFQ A;  1V4T A;  4H5R A;  1W2B M;  1KQS M;  3O08 A;  3MN9 A;  1VQ6 N;  3C6H A;  1D4X A;  3A5L C;  3B8A X;  1SAZ A;  3L6Q A;  3QIC A;  2QWN A;  1NGD A;  3N4Q A;  5C15 A;  1AB4 A;  5AQG A;  2I7P A;  2GSU A;  1BG3 A;  3H1Q A;  4BR0 A;  4YOR A;  3K9J A;  4WF9 L;  3NVM A;  1NWK A;  3I8B A;  4OPA A;  1BO5 O;  4NO7 A;  3G71 N;  4A2B A;  3M1F A;  3QBX A;  4IOC L;  1MDU B;  3G25 A;  3CC4 N;  1E4G T;  2OTJ N;  1BWF O;  2A40 A;  2E2N A;  2QW9 A;  4JKG B;  5AQN A;  3OBW A;  5KQD A;  3O9T A;  5C2D A;  1OVY A;  4G9Z A;  1R9T A;  2QWR A;  3CAG A;  4ISG A;  4G0V A;  3GTG A;  4H0O A;  1N8R O;  3D2F A;  1WQH A;  5KPT A;  1Y1W A;  1ATR A;  3CQY A;  3DJC A;  3W0L A;  1QVF M;  3S41 A;  1HKG A;  3CCE N;  1KQ4 A;  4IEI A;  3Q3Q A;  1Y64 A;  2ASP A;  2QI2 A;  4YOV A;  4IJA A;  2A3Z A;  2I7N A;  3VPZ A;  1O25 A;  2YHW A;  4BG9 A;  3QDK A;  4BRM A;  2QM1 A;  4GTB A;  5C10 A;  2RH6 A;  3MK6 A;  4IOA L;  3U9D A;  3HOS A;  1O28 A;  4YDU C;  2JA5 A;  3WXK A;  2NRH A;  1YXQ A;  3GBT A;  5BN8 A;  1O27 A;  1LOT B;  4BQL A;  1DKG D;  4IZ9 A;  2JWK A;  4FL9 A;  2NNW A;  4NLB A;  3R1X A;  5AQW A;  3GTP A;  3QFP A;  3S0X A;  1KXP A;  2WUS A;  5JFE A;  4H0X B;  5JLF A;  5BRE A;  3A0I X;  4JD2 A;  4J8F A;  1TWF A;  2CGJ A;  4IXC A;  3T69 A;  1I50 A;  4QS8 A;  1XXA A;  3SLC A;  1KAY A;  2GEL A;  3LPX A;  1NGA A;  2NZT A;  2FF6 A;  2QWO A;  4L3Q A;  2VGM A;  3ATU A;  5AQS A;  3HSC A;  1WQG A;  4IOX A;  3ZX2 A;  3A8Y A;  2ZJQ L;  3L4I A;  2CFA A;  3WXM B;  4WCE L;  3WEE A;  2NVY A;  4FWL A;  2A6A A;  3NVK A;  3FHZ A;  2BTF A;  1YJ9 N;  4DB3 A;  1GLB G;  1M1K O;  4H0Y B;  4KMA A;  1NGH A;  1GLF O;  2A41 A;  3DXM A;  2YI1 A;  3N0C A;  1K83 A;  2HF4 A;  3Q7B A;  5AFU A;  2AA4 A;  2WFB A;  4JKH A;  4B1W B;  1J6Z A;  3MML B;  4BRA A;  3FOF A;  3IMX A;  1V4S A;  5M1N A;  1ZXO A;  2PBD A;  4K25 A;  1JCF A;  3M6G A;  3L4Q A;  1DD5 A;  2JH3 A;  1NGE A;  3FKI A;  4KM9 A;  3DXK A;  5AQF A;  4B1Y B;  3VF4 A;  5BRD A;  4P5A A;  5BPM A;  1LCU A;  3L0Q A;  4C3H C;  4BRN A;  4BKW A;  2R92 A;  3GOI A;  1TYQ A;  2IIR A;  3VEY A;  3TTD A;  1QZ5 A;  1E4F T;  1QZ6 A;  2VCP A;  1CZA N;  3H3N O;  4I6M B;  3R8E A;  1T44 A;  2E1Y A;  3FZK A;  3AQO A;  1I3Q A;  2XCR B;  4IO9 L;  3VGL A;  1KD1 O;  2OTL N;  4Z94 A;  1YVN A;  1XXB A;  2OAN A;  3C6A A;  3VES A;  2QEX N;  1XC3 A;  2RGR A;  3SMP A;  4KBO A;  4FPA A;  4H5V A;  1Q7Y O;  1BGW A;  3UKR B;  3ENH A;  5AQY A;  1QHA A;  4CZL A;  4GY2 B;  3D6R A;  2HOE A;  3MCP A;  3G4A A;  2DPN A;  4JKB A;  3P4I A;  2IVN A;  4JK7 A;  4BVO A;  3CCQ N;  3QBW A;  3A5N C;  2GSN A;  3NMU A;  3HZ6 A;  1T3V A;  4H0T B;  1ZBS A;  3J7Z O;  3CCL N;  1NGI A;  4JKC A;  3ZET B;  3DXK B;  4DCH A;  5AR0 A;  4BVP A;  4CBU A;  4CZK A;  4E1J A;  4KB4 A;  1H1V A;  3GTQ A;  2V7Y A;  1EK8 A;  2NRR A;  1B4B A;  4LQY A;  5AFU H;  5AQP A;  4GFQ A;  5AQZ A;  1G99 A;  1VQL N;  4C23 A;  1VQ7 N;  1GLC G;  2V7Z A;  4KH4 A;  3EKU A;  5EOY A;  1O2A A;  2P9S B;  2R93 A;  3VET A;  2GTD A;  3KZB A;  5KPZ A;  1R59 O;  2F9W A;  1ATN A;  2W40 A;  3DWL A;  3HBT A;  3O80 A;  3DLL L;  1TWC A;  4KH5 A;  1IG8 A;  4M1X A;  4FOI A;  4B1U B;  4G0U A;  2IVP A;  2E8A A;  4ILG B;  4CZJ A;  2CH6 A;  4KMH A;  5CJ9 A;  1T6D A;  4IFE A;  5EGE A;  4PL8 A;  3MX2 A;  2HMP A;  4A2A A;  4RCH A;  4CJ7 A;  4CZG A;  5KPR A;  5JVG L;  3C7N A;  3UKU B;  1VQM N;  3H45 C;  2P9N B;  4XH4 A;  3BUE A;  1WIH A;  1HKB A;  4GTC A;  2KLA A;  3GL1 A;  2IVO A;  5CR4 A;  4H5N A;  1GLJ O;  3O4W A;  3OBY A;  3ATV A;  4IO8 A;  3SBG A;  5F2R A;  3AGR A;  4FWO A;  2PHC B;  1YIT N;  4I6M A;  4BRC A;  5CE3 A;  1WUA A;  4BC5 A;  2E2P A;  4C3J C;  1VQ8 N;  4YOT A;  1BJT A;  3IFR A;  4GV6 A;  1YHQ N;  2FSK A;  1TWH A;  1KAX A;  3UKR A;  2BUP A;  1SFO A;  1O2B A;  4AF1 A;  4FSV A;  4WFN L;  5EGH A;  2E2Q A;  2ZFZ A;  1BU6 O;  4BRO A;  3OHR A;  4CD3 A;  5ADX H;  4KB2 A;  1TUY A;  3BF3 A;  3C0B A;  3CQX A;  3FE1 A;  4KAW X;  2P9L A;  3JS6 A;  1C0G A;  3K9K A;  3VEZ A;  2QWQ A;  4CD1 A;  4JNE A;  3M5R A;  4R79 A;  5JIC A;  3D2F B;  3E1Y A;  3LM9 A;  4ISE A;  4C2M C;  1X3N A;  3TTC A;  3WXL A;  4FOE A;  3BUZ B;  2W41 A;  3L4K A;  2NVX A;  4O8K A;  2D4W A;  2ZF5 O;  3FZM A;  3AY9 A;  4FWR A;  5ADX A;  3TTF A;  2QA4 N;  4GTL A;  3LDP A;  1YI2 N;  1VQO N;  5JVH L;  5AQH A;  4BRF A;  3VEO A;  4FM9 A;  1HX1 A;  3CCM N;  2E2I A;  3UE5 A;  5JLH A;  2ZGZ A;  2E2O A;  4BC3 A;  3CXC M;  1Q81 O;  4H0P A;  1NGJ A;  2QXL A;  4K41 A;  3ID8 A;  4H5W A;  4KAS A;  1NLV A;  1QQO A;  1EQY A;  4H0V B;  4M63 C;  2FLO A;  5AZI A;  4YOW A;  3LDL A;  4FWS A;  4IWV A;  4QS9 A;  3ZX3 A;  4BRE A;  3UB5 A;  1YUW A;  3CCU N;  3OA9 A;  2ZGY A;  4BQZ A;  5BPN A;  3IUC A;  1B4A A;  2V51 B;  5AQL A;  3I56 N;  5FPE A;  2QWP A;  2JWL A;  5AZJ B;  1T6C A;  2F9T A;  4YDU A;  1GE9 A;  3O5B A;  4MO4 A;  5JMV A;  3HOT A;  4KH6 A;  1Q18 A;  4P5B A;  4EAH D;  3N4P A;  4B1V A;  4GV3 A;  4FWM A;  3CI5 A;  5I9E B;  4FWN A;  5LY3 A;  2ITM A;  1JCG A;  2YHX A;  4XEI A;  5AQU A;  3SK3 A;  5IOR A;  3VEN A;  4AM6 A;  3CCV N;  3WXI A;  1NGF A;  1K8A O;  3F5T A;  4H5T A;  4UY8 O;  4OO1 J;  4EHT A;  2D1K A;  4Y0W A;  5BN9 A;  1XXC A;  3CC2 N;  3VF2 A;  5EY4 A;  4DDQ A;  1C0F A;  1Z6R A;  3ULE A;  3MN6 A;  1YAG A;  3U8X A;  3O9S A;  3P39 A;  4CZH A;  1Q86 O;  3G4C A;  5AQQ A;  1VQP N;  3CC7 N;  1NMD A;  4IJN A;  4CBW A;  2GWJ A;  1Z05 A;  2FSN A;  2RE2 A;  5M1F A;  3CD6 N;  2YCH A;  4LC9 B;  5BRH A;  4A59 A;  5GAH P;  1MWM A;  3E9O A;  5TJ3 A;  4WQ5 A;  1QQN A;  3CJA A;  3MCA B;  3CPE A;  3LDN A;  5AQX A;  1SQK A;  1BA1 A;  2Q2R A;  3KWG A;  1IJJ A;  2VGN A;  4JN4 A;  5M1O A;  1WOQ A;  3EL2 A;  4M7Y A;  4RTF D;  2R7Z A;  2PFU A;  5LJW A;  4A5B A;  2QWM A;  5AQM A;  3SAH A;  1M90 O;  4CI6 A;  4IEE A;  3H6E A;  2HBL A;  2D0O A;  3N0B A;  2ASM A;  3IKM A;  1GLA G;  3AAQ A;  3MN7 A;  3CJ7 A;  4PKH A;  5GIO A;  3PIP L;  4BRG A;  4JK9 A;  4WQ4 A;  4C3I C;  3WQT A;  4GTD A;  3BF1 A;  2B63 A;  5C12 A;  1X3M A;  3VEV A;  3F2K A;  4O8U A;  1NGC A;  3ZEU A;  2AP1 A;  2FSJ A;  3GTM A;  5GAE P;  2Q36 A;  5AQJ A;  5AQV A;  3FOE A;  2UYT A;  5FPM A;  3TSU A;  2P9K B;  3VMF B;  1Q82 O;  3CF5 L;  1OKJ A;  3A5O C;  3V4G A;  2KWA A;  1VQ5 N;  2HBM A;  4BR4 A;  5H1S Q;  2Y3P A;  3EKS A;  3R3L A;  5GIN A;  4BR5 A;  1TUU A;  4FWQ A;  3F9M A;  2NLX A;  1U6Z A;  5JVO A;  3HTV A;  3VF6 A;  1VQ9 N;  1JCE A;  1Y1V A;  3C7N B;  3SJH A;  3UKU A;  3P31 A;  3VOV A;  1MWK A;  3SMS A;  3WEE B;  2P5M A;  4KM8 A;  1W97 L;  5C2F A;  1SZ2 A;  4JHD A;  1EH1 A;  1XUP O;  4BRK A;  1MA9 B;  1RDW X;  2NRV A;  1VAZ A;  2NRT A;  3BP8 A;  5AQI A;  5EXW A;  4K43 A;  1O26 A;  5IOQ A;  4DHY A;  3DXM B;  4CZM A;  3LAP A;  3TU5 A;  2P9I A;  2HBJ A;  3MX5 A;  2PAV A;  4BR2 A;  4FVU A;  2F7T A;  4JKE A;  4GTE A;  4EFH A;  4M7X A;  3HM8 A;  3GTO A;  2FXU A;  3FFK B;  4BR9 A;  1WQF A;  3ENO A;  4BRQ A;  1GLL O;  3AH5 A;  1NBW A;  1HJO A;  2BH1 A;  4JEP A;  4AM7 A;  5F0X A;  3O1B A;  3HRG A;  1BDG A;  3EZW A;  4PKI A;  3KWI A;  5DM7 L;  1K8K B;  3MWP A;  1TYQ B;  4K42 A;  4IDH A;  5EVZ A;  3PIO L;  3GTL A;  3CET A;  3SAF A;  3U9Z A;  2P9L B;  2WC9 A;  3RVC A;  3FGU A;  1DGK N;  1S3X A;  3SAG A;  3OEP A;  5TKY A;  1S22 A;  1NJI O;  1HKC A;  3HI0 A;  4BRP A;  1K9M O;  4GV9 A;  3ZYY X;  2NRW A;  4PHT X;  3ZEU B;  5BPL A;  2Q97 A;  3CJ9 A;  4KC6 A;  3CER A;  4KMD A;  2NRX A;  3ENB A;  1DT9 A;  4HWI A;  4JKG A;  4WQ4 C;  3O8M A;  1BOT O;  1RGI A;  3GDQ A;  1JJ2 M;  3AAP A;  3AAR A;  1TWA A;  2P9I B;  3EE9 A;  3TSQ A;  4MDB A;  5TKW A;  4FWP A;  3O9Q A;  3FZH A;  3JXU A;  4BG8 A;  3WT0 A;  3LL3 A;  4EHU A;  3E9L A;  4JAX A;  4PKG A;  3NUH A;  1O24 A;  1ISE A;  4XH1 A;  2VWB A;  5IOT A;  4BRH A;  5ELZ A;  4B1X B;  3E66 A;  3TSP A;  4BGB A;  4KDD A;  3OW2 M;  2Q0U A;  3MDQ A;  4OPH A;  4GTA A;  3VGK A;  1ILY A;  3MMV A;  3LAJ A;  3QX3 A;  1XQS C;  1SS6 A;  3EE8 A;  1ATS A;  2YU9 A;  1NGB A;  2CGL A;  1S72 N;  2H3G X;  3EO3 A;  3VA7 A;  4FO0 A;  3WQU A;  1F9N A;  2E20 A;  3GG4 A;  4CZF A;  3QML A;  3VER A;  3LDO A;  3O9U A;  3CME N;  2YHY A;  3I33 A;  5AQT A;  5M1P A;  4A57 A;  3CJC A;  4JHD B;  3ERE D;  4MO5 A;  5AZJ A;  2KKZ A;  2XCQ A;  3FZL A;  1K73 O;  2QTD A;  4ISF A;  3ID6 A;  4YOY A;  3CCS N;  3H46 O;  3VGM A;  4EIA A;  2V52 B;  1HUX A;  4GVE A;  4BRD A;  3SBT A;  3ZX0 A;  4FPB A;  4JD2 B;  2P9S A;  3LM2 A;  2ZJR L;  1YIJ N;  2CGK A;  3MN5 A;  4ILH A;  2HST A;  4JKF A;  3O6W A;  4WYB A;  4BLB A;  5E84 A;  1VQN N;  3W3D A;  3KK7 A;  4F9O A;  5FPD A;  3MWT A;  3GE1 A;  4BY9 C;  1K8K A;  5IOS A;  1QQM A;  3KHY A;  1NM1 A;  3G4S N;  5GAD P;  3FLC O;  3M3Z A;  3IDH A;  5CHI A;  2Q31 A;  2CFA B;  2Q1N A;  4GT9 A;  2P9N A;  3P38 A;  4C1N I;  3CCR N;  4C1N K;  5KQ8 A;  5FPN A;  3RSE B;  2NRZ A;  3ULE B;  5E26 A;  3L4J A;  3AGK A;  4ILJ A;  2FF3 B;  4A5A A;  3E9P A;  1QVG M;  1NGG A;  4MLE A;  2JA7 A;  2Q0R A;  5MLC Q;  3BEX A;  2XCO A;  3FR0 A;  3DAW A;  2P9U B;  2JA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...