1ZBSA

Crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
MILIGDSGSTKTDWCIAKEGKSLGRFQTSGINPFQQDRNEIDTALRSEVLPAIGQKASSIRAVYFYGAGCTPAKAPMLNEALDSMLPHCDRIEVAGDMLGAARALCGDSEGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQMPEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSFDDFLVRNVLRYNRPDLPLHFIGSVAFHYREVLSSVIKKRGLTLGSVLQSPMEGLIQYHHNNHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PG1100
publication title Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18
rcsb
source organism Porphyromonas gingivalis
total genus 82
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zbsA03
3VERA 3D2FA 1BDGA 5CE3A 4A62A 1MWKA 1ATNA 3A5NC 2Q1NA 4O8KA 4FPAA 1X9JA 2FF6A 3FE1A 1YVNA 2IVNA 5AQLA 4HWIA 1ZC6A 5KQDA 2VYPA 3WXKA 4B9QA 2P9PA 4JHDA 3WEEA 4WQ4C 4FOEA 4C23A 4A61A 3EN9A 4GY2B 2ASMA 3G25A 1RDWX 2A5XA 4JN4A 2A3ZA 1NGGA 4KBOA 1ESVA 5LY3A 1SAZA 3JS6A 4CBUA 4CBXA 1IJJA 2GWJA 5EXWA 2E2OA 4EFHA 3O80A 5FPMA 4HTLA 2GELA 4B1UB 3I33A 4L3QA 4B1ZA 2QWLA 4I6MB 4XH1A 3GDQA 2QWRA 4FWPA 4WQ5C 3ATUA 4H0YB 2HF4A 4K43A 2V7YA 1GLAG 5AQYA 3SJHA 4AM6A 2P9NA 4PKGA 3CJ9A 2P9IA 1NGHA 3U4LA 3MDQA 2E8AA 3WXLA 4BC4A 1C0GA 4EIAA 3FFKB 3U9DA 2ZGYA 3FGUA 3QMLA 1MA9B 4CJ7A 2V52B 1NM1A 1U2VA 4EHTA 4RCHA 3R9PA 1NGEA 3CJBA 3RSEB 4MO5A 1NLVA 4NB4A 4O5FA 3IDHA 4BRAA 4IWVA 1NGFA 3A8YA 2QW9A 3ZX0A 4B1WB 4B1XB 1KAYA 5AQTA 3AAPA 1NMDA 3A5MC 3L4IA 3BF3A 5E84A 2Q31A 2FF3B 3H1VX 3HM8A 4BVPA 3TU5A 3AY9A 3ZEUB 1HPMA 3ID8A 2E1ZA 1NGCA 5JLFA 1R59O 1P8ZA 3DXMB 3RSEA 1HLUA 1TUUA 4MLHA 1LOTB 3VEWA 4CZIA 1LCUA 4BR7A 1MWMA 3WQTA 2PAVA 4BRLA 2P9KB 3C7NB 1HUXA 5F0XA 3MN7A 3EKSA 4FWOA 3ENOA 4IJAA 5JMVA 3C0BA 3SMSA 4CZFA 3ZEUA 1SQKA 2BTFA 2DPNA 3CETA 3ZX3A 3SMPA 5FPEA 4LC9B 4FWKA 2YHWA 5BR9A 3MMVA 3BUZB 4H0VB 3M1FA 2NLXA 4BRDA 3VENA 4BGBA 3M3ZA 2P9UB 3LDLA 1TYQB 2F9WA 1QQOA 3WQUA 2QXLA 3KVGA 4BQLA 5AQNA 3FZHA 3D2FB 4YDUC 1JCFA 1Z05A 4QS9A 5KPTA 2Q97A 3C7NA 2CGLA 1BOTO 3VF4A 1T6DA 3CJAA 4QS8A 3A5OC 2W41A 4BR9A 3LDQA 4A2BA 4H0PA 3GE1A 4JHDB 3WEEB 1HKCA 3EL2A 2P9UA 5BREA 3SK3A 1S22A 4H5NA 4CZEA 5KPZA 2UYTA 1ATSA 3VESA 4CZJA 1TUYA 4PKIA 1DKGD 3L6QA 3FZFA 1GLJO 3IMXA 3GG4A 3AAQA 4H0XB 5AQQA 3KHYA 5LJWA 5KPRA 4XEIA 4BRCA 4BG8A 2V51B 2E2PA 3U9ZA 3EKUA 5E26A 2P9NB 1YXQA 3A5LC 2P9IB 3IUCA 4H5RA 2CH5A 4F9OA 2D1KA 1NGBA 2EWSA 5AZIA 3CQXA 4BRFA 5BRFA 2FLOA 1QZ6A 3DWLA 4H5TA 4CD1A 1U2VB 3D2EA 3QBXA 3W3DA 3MN5A 3MCPA 4B1VA 4E1JA 1ZBSA 5FPDA 1GLEG 2HOEA 3CQYA 1G99A 5BN9A 2Q0UA 1DGKN 3WXJA 4BRNA 1NWKA 3QBWA 2D0PA 3DXKB 2ZGZA 3WUHA 3EZWA 4FO0A 4RTFD 3CJ7A 1GLCG 3O4WA 5F1XA 1Y64A 5EY4A 1T44A 2ZF5O 2E2QA 4FPBA 2E1YA 3HTVA 3ZETB 3VEVA 2AP1A 4BG9A 5AQWA 4IJNA 4BR0A 3DXKA 2CGJA 5JLHA 3VGKA 3FR0A 3SLCA 3UE5A 2KHOA 3LM2A 4BC5A 2W40A 4PL8A 1GLFO 3L0QA 4M63C 1BUPA 1BWFO 3CJCA 3QDKA 3ZETA 4XH5A 4B1YB 4BREA 1S3XA 1BA1A 1RFQA 2A6AA 3M6GA 4CZMA 4CZGA 3HSCA 1EQYA 1NGAA 3VEZA 3VGLA 3O08A 3QICA 2ASPA 2CH6A 3H3NO 4FWQA 2H3GX 1BG3A 3O1BA 3W0LA 3KZBA 4A2AA 2IVPA 4BRKA 2YJEA 4Y0WA 1HX1A 3U8XA 2QWPA 3GBTA 3CERA 4JD2B 5AQSA 3CHWA 5EVZA 3O6WA 3VOVA 3HBTA 2QM1A 3EO3A 4FWSA 3H6EA 2HF3A 2ITMA 5AFUA 2IIRA 1XC3A 5ELZA 2D0OA 5AQJA 1X3MA 1KAZA 2I7NA 4FL9A 3WXIA 5AZJA 3HI0A 1IG8A 4JNEA 2I7PA 5TKYA 4JD2A 2F9TA 4H5VA 1C0FA 3CI5A 2V7ZA 4XH4A 4M7XA 4DCHA 1BO5O 3A0IX 5AZIB 5BN8A 2VWBA 4FWMA 1NGIA 4FWNA 5BRDA 4H0TB 3D2EB 4M7YA 4QS7A 5B8HA 3FLCO 3VEYA 3TPQA 1MDUB 2VCPA 5AQRA 2YCHA 2GTDA 5AQHA 5BPMA 5AFUH 4CD3A 5AQZA 3VGMA 3F9MA 2Q2RA 3S41A 4WQ5A 1OKJA 3BEXA 3DJCA 2P9LB 5KQ8A 3FZMA 1DEJA 4JAXA 4NO7A 1KAXA 2BUPA 4MLEA 3BP8A 4PKHA 1XQSC 4CZLA 4WYBA 2D4WA 2E2NA 1YAGA 2E88A 5I9EB 4IO8A 1X3NA 1HJOA 4BC2A 3AARA 1QHAA 3LM9A 3MN9A 3VF6A 1KXPA 1E4GT 5AQFA 1D4XA 4BC3A 3CIPA 4CZKA 1QZ5A 3QFPA 2YHXA 4MO4A 3UKUB 5AQKA 1T6CA 3D7EO 2P9LA 3LDNA 5EOYA 5JICA 1RGIA 3VF2A 3FZLA 3WT0A 2WUSA 1BU6O 4CZHA 2A42A 4BRQA 1XUPO 1J6ZA 1GLBG 4H0OA 2OANA 5AQMA 2CGKA 5AQOA 4J8FA 4BR2A 1Q18A 3LDPA 2NZTA 3ATVA 3VPZA 2HMPA 2ASOA 4DB3A 4DHYA 1YUWA 1JCGA 1HKGA 3UKUA 1SZ2A 1GLDG 5F2RA 2P9SB 1QQMA 4BROA 2IVOA 2YI1A 5AQVA 5AR0A 1NGJA 5BRHA 4IZ9A 4BGAA 1H1VA 2FSNA 3H45C 2J4RA 4I6MA 4BRHA 3GL1A 2YJFA 2E20A 3FZKA 1V4SA 3R6MA 4BR5A 3MK6A 1QQNA 3UKRB 1K8KB 2A41A 2GEMA 1GLLO 3I8BA 3VETA 2GWKA 3DAWA 3HZ6A 4GNIA 3MN6A 5BPLA 3H3OB 4FOIA 2P9SA 1HKBA 2PBDA 4EAHD 2FSJA 3LL3A 3O5BA 3H1QA 3R8EA 3LDOA 4H5WA 3VEOA 3J8AA 5BPNA 1WOQA 2NRHA 4BRIA 4Z94A 3UB5A 4FWLA 4YDUA 5ADXA 5FPNA 3JXUA 3QFUA 1U6ZA 3UKRA 1K8KA 5AZJB 4K41A 2Q36A 3ULEB 3CJ1A 3GOIA 4ISEA 3QB0A 4ISGA 1ATRA 4FSVA 1E4FT 2Q0RA 5LJVA 5AQPA 2QWOA 1CZAN 4DQ8A 4EHUA 1V4TA 3B8AX 4BRMA 1WUAA 4K42A 4AM7A 3DXMA 4BRGA 2A40A 2QWNA 2YHYA 1Z6RA 3H46O 4H03B 5AQUA 4RWTA 2QWQA 5AQIA 5AQGA 3ULEA 3O1WA 5ADXH 4CI6A 4BVOA 2FSKA 2P9KA 3BF1A 3P4IA 4WQ4A 4ISFA 4FWRA 2ZWHA 3IFRA 4BQZA 3ENHA 2GUPA 5EX5A 4BR4A 4K25A 1BA0A 1NBWA 2AA4A 2QWMA 4CBWA 5AQXA 2P9PB 1JCEA 1ZXOA 2FXUA 3OHRA 3VEXA 3ZX2A 4IXCA 4PL7A 4BRPA 1TYQA 3O8MA 1NGDA
chains in the Genus database with same CATH superfamily
4IFVA 3VERA 1BDGA 3G6EN 3O3GA 3PO3C 1WNSA 4IFYA 1YF5L 1QSLA 1YVUA 3T1YK 1HYSA 1YVNA 4DTNA 5TMFA 2IVNA 4KO0A 4LK1A 5FJ8K 1N33K 3WNHA 4FVMA 5M1PA 1RDCA 3WEEA 3J81O 2KZZA 3G25A 3HPHA 1RDWX 2A68A 3E9OA 2YHAA 3BP3A 1DTTA 2UUCK 4CE9A 4YOVA 2WTUA 3OA9A 2GSNA 4DR1K 3O80A 4BDZA 2V6SA 4HTLA 4CEDA 4Y7NK 2O8BB 3I4MK 3U3GA 3VA7A 3KK1A 2VUMK 3CCSN 4W5QA 1EP4A 1VQ8N 2B63K 1XXAA 1TKXA 4PABA 2BANA 2P9IA 4CJKA 3M8SA 3VQ9A 2E8AA 1I3AA 1O29A 2OPRA 3FFKB 3HSTB 1Q81O 4OIPA 1K83K 3QMLA 3KKSA 2ZQBA 1VSMA 4DF8A 3S17C 4MO5A 1NLVA 1VQ4N 4BRAA 3KD5E 5GAGP 3V9WA 1K73O 4OKJA 3I55N 2Y3PA 4BY1K 3CQ8A 2QW9A 3ZX0A 3QEWA 4ELUA 1TWCC 2G8FA 2NRTA 1WOPA 3EYZA 2HSTA 1Y1WK 1VQ7N 3AAPA 2OYQA 4IEIA 3AQOA 1RBUA 3AVGA 2R7YA 3PSFA 3AY9A 2HHVA 2KZMA 4DTUA 5JLFA 3KK3A 1P8ZA 2F8TA 3RMAA 3TI0A 5IYCK 3BGRA 3KIOA 2HHHK 3NMUA 1KLNA 4MLHA 3AVKA 1LCUA 5IP9K 3AGRA 3WQTA 3RZDK 3SAGA 1FJGK 1B9DA 4KB4A 3C7NB 1HUXA 3M8PA 3MN7A 4BXXK 4IJAA 4N47A 3PIPL 3SMSA 4YFXA 4DLGA 1WSIA 3L2VA 4FWKA 3SYZA 4W5OA 3GTJC 5BR9A 2P1JA 1J5OA 4C8NA 4RW7A 4BGBA 4KH4A 3QO9A 3R1XA 4JKDA 3LDLA 4Y1DA 2D0CA 3MEGA 2JA7A 4BQLA 4B3TK 1FW6A 3GTLA 1Z05A 1KSPA 4JKCA 2CGLA 4A5BA 4M42A 5CY4A 3AD7C 3CJAA 5GIPA 2R92K 1K8AO 3A5OC 4M3XA 4BR9A 3LDQA 3HOVK 3JYTA 2GV9A 1KVAA 3TTDA 5GAEP 3DLBA 3WEEB 4C1NI 3CC2N 5TJ3A 1VJEA 3I4NK 3EL2A 2NNWA 4DSKA 2P9UA 4A3JC 4GV3A 3F73A 4NYFA 1NKCA 4LSNA 5KI6A 2JA6C 4YG2A 4CF1A 3ULDA 3AO3A 4RW9A 3VQQA 2WFBA 1ATSA 1B9FA 3DYAA 3SPZA 1S1VA 4I2QA 4PKIA 4KMHA 3TTGA 1BQMA 2P8TA 3OTOK 3KHYA 3PLAA 2HHQA 1VK0A 1U04A 1JVIA 5EGEA 2V51B 1YJ9N 1CXUA 1CXQA 3K58A 4CEFA 3EKUA 5E26A 4M3RA 3A5LC 1YXQA 3HO1A 1Q9YA 2P9IB 1SKSA 1VQKN 4FJHA 2D1KA 4NCAA 3HKZD 1NGBA 4YNQA 2R93K 3TAFA 3SNNA 1QZ6A 3DWLA 1F93A 5A2QO 4OLAA 1O1WA 4BE0A 4DSFA 1JKHA 3QBXA 5C25A 3W3DA 2HHWA 3EEQA 1WOSA 1ZBIA 1SMYA 1C1CA 4FLZA 4CHOA 3L8BA 3NF8A 1G99A 3E9PA 1KQSM 1TWGA 3WXJA 3V9ZA 4KM9A 1HJRA 4BRNA 4CGDA 1BDFA 3WUHA 1HNXK 3C6TA 4A3DC 4GTFA 1W0HA 4DSEA 1SUQA 5F1XA 3S3OA 3VMFB 4DV0K 1A5WA 1C0TA 4IOCL 2ZD1A 3T02A 4CEOA 4FPBA 4HCCA 3CM5A 2AP1A 3CD6N 4GV9A 4BG9A 5AQWA 2KQ2A 4IJNA 4FLYA 4BR0A 1T3VA 3AVIA 2X78A 2CGJA 3UE5A 3CPWM 4BY7C 3OJUA 1WAFA 3TABA 4E3SA 4DR6K 3VN5A 5M1QA 4WE1A 5KRTA 3L0QA 3LANA 1BI4A 4BACA 2E2HA 1S1UA 4JKBA 1TWHA 5K14A 1S3XA 3HOZC 3H0GA 2NVXA 4KREA 1NGAA 1WSFA 3I8DA 3WNEA 1D9DA 3HOTA 1YTAA 3S1MC 3VGLA 2D5RA 2HVHA 1I50K 3QERA 4MEYA 3QICA 1NJYA 2PZSA 2KKZA 5M1OA 2UXCK 1IV0A 4A3CK 2RE2A 4GTAA 2IVPA 3OVNA 4C3IK 4J2EA 3GTGK 3LZIA 4DU1A 5GIOA 3DLEA 4YOXA 1L5UA 4GTLA 1CZBA 4XIUA 2RPIA 2HNDA 4LY7A 3U8XA 2QWPA 4BE1A 3CERA 3NAEA 3VOVA 3S1RK 3HBTA 4KB2A 2B6AA 4FWSA 1VQPN 5CHPA 1X3MA 2I7NA 1RCHA 3L2QA 4NCGA 2NRWA 3M8RA 5AZJA 2NVXK 1IG8A 2HB5A 2IGIA 4FCYA 3KKRA 4E1MA 4ZHRA 3DLHA 2F9TA 4H5VA 3K7AK 1C0FA 1DCOA 1X1PA 3GTPK 4GVMA 2CFAB 4FWMA 3NFAA 4FWNA 5BRDA 3T3FA 2QTDA 1VLOA 4X65K 3OBYA 4H0TB 4QS7A 3S1NK 1XI1A 3HOUC 3AO1A 1TKDA 3NF6A 1F21A 1FKOA 4N41A 2YCHA 4XLPA 5AQHA 1D8YA 5IOQA 4E7IA 4QIWD 5AFUH 4CGGA 3S41A 4CF8A 4HCBA 4WQ5A 4CEBA 1ASUA 3DJCA 3FZMA 1KAXA 3AO2A 2PA8D 3G4CA 1IBLK 1JL1A 1XQSC 4CZLA 4CESA 4IO8A 1HJOA 3U6FA 3S9HA 1QHAA 1U48A 3SZ2A 1R9TC 1HYZA 5M1NA 3Q7CA 4F4KA 3ZSVA 1D4XA 4LF7K 3CIPA 3QFPA 2LSNA 1D9FA 1NK6A 4JS4A 1VSDA 1NU0A 2ZE2A 3LDNA 4KASA 5EOYA 1BIUA 3DRRA 3ITHA 3OS0A 3FZLA 3WT0A 1BU6O 4BRQA 4LOWA 4H0OA 4XLNA 5GAHP 1RT3A 3JAMO 4BR2A 4Q0BA 2NZTA 4CIGA 2ZUFA 3ATVA 5C3EC 3M5RA 2HMPA 2ASOA 3VPZA 4DTOA 4DV5K 1BGWA 1YUWA 3UKUA 4H4MA 1GLDG 4IOXA 2P9SB 3RRGA 1XNQK 5HBMA 3SI6A 3QEPA 2YI1A 5J2NA 3LP2A 5AR0A 3VQ5A 1BIZA 2E2IC 2VWJA 3VA3A 3PV8A 1VRUA 3H45C 1HNIA 4I6MA 1XMQK 4LF6K 1N32K 3TSQA 4YORA 3CQZC 4JK7A 2YJFA 1J6WA 3FZKA 3R6MA 3V9UA 4EP4A 4M3UA 1RTDA 3C65A 5EU7A 5FLMK 2GWKA 3HZ6A 3L2WA 3MN6A 4FOIA 3QNOA 4FZBA 4B08A 4DV1K 2PBDA 1HQEA 3EE8A 4Y1CA 5HOOA 2A6HA 2JA5C 3ZT2A 4W5RA 4KAZA 4I9QA 4A3MC 4CGJA 5BPNA 1WOQA 2OPQA 4BRIA 4FJ8A 3I56N 1BGXT 4YDUA 1KTQA 3O9TA 5ADXA 4A3KK 5FPNA 3RVCA 5HROA 1U6ZA 4KAWX 5AZJB 4NXNK 4C2MC 5KRSA 4FK4A 1GOBA 4DSIA 3QB0A 4ISGA 1ATRA 4FSVA 1X31C 3M4OK 3THXA 2W7VA 4MQ3A 5AQPA 1ZVUA 3E66A 4OGEA 3U3YA 2EX3A 4AM7A 4KHYA 3F2KA 2QWNA 4ICLA 2HHTA 2QWQA 5AQIA 3ASMA 3RMCA 4BBSK 4X6AC 1VSEA 4C3JC 2NRRA 3PO5A 4BLAA 1TAQA 3O1WA 4KFBA 5JVHL 2FSKA 3NF7A 3CCMN 1WSHA 4G9ZA 4ISFA 4FWRA 4BQZA 3LWLA 3PX4A 2O4IA 4C3HK 4B9TA 4K25A 3T7ZA 1BA0A 3GTKK 3SAFA 1VRQC 1Q8IA 2QWMA 4CBWA 3BDPA 4CF2A 4CHYA 1T7PA 1I3QK 3VEXA 3OYIA 3S3MA 4L8RB 1TYQA 3HJFA 1NK7A 3D2FA 5DMRA 5CE3A 1MWKA 5IP7K 1ATNA 4C8OA 2RKIA 4JI4K 4O8KA 1VHXA 5HL7L 3HOYK 4A59A 4JV5K 2XCQA 3S2HC 4DV3K 1INNA 4KN4A 3CCEN 4JHDA 2XO7A 3HOXC 4FOEA 2O4GA 4OPJA 4BBRK 4A61A 3OYGA 2A5XA 4AHTA 4JN4A 4Z0UA 5LY3A 3TFJA 4A3GC 5AJ3K 1IJJA 1WORA 4AH9A 1I6HC 4Y52C 4RW6A 1RT4A 4EFHA 3TANA 1HNWK 4DQRA 4X64K 2E6MA 2AJQA 3CCJN 3VQ8A 3MCAB 3ADAC 1QQCA 3E01A 4I6MB 4FJ9A 1I6VA 3GDQA 2QWRA 1VQON 4C1NK 4XSXA 3SUPA 4H0YB 4A3BK 4V19S 1GLAG 4BKWA 3SJHA 3CJ9A 1NGHA 3HM9A 1RT6A 3KLFA 4AYBL 1U4BA 3WXLA 1SFOK 3QLHA 4NLBA 5C44K 3U9DA 1MA9B 1NM1A 3WNGA 3NBPA 4EHTA 3R9PA 1NGEA 3CJBA 2W6KA 1XNRK 1NK8A 2VGNA 3NGZA 1S9GA 2PPBA 4IWVA 1MU2A 3OYBA 4FW1A 4CJ4A 1JLGA 1KAYA 3VQPA 3S1QC 4A3IK 4YOUA 1NMDA 5C15A 4W5NA 5E84A 2FF3B 3H1VX 3FKIA 4A3EK 1DD5A 4AILC 1NGCA 1C6VA 2Y1JA 3IAYA 3G4AA 3PY8A 1ZYQA 1N34K 2HW3A 2GAGC 2ATQA 3NH2A 3N3YA 2E2JC 4EP5A 4DU3A 4LFCK 3PX6A 4LFAK 3DRSA 1O27A 2OPPA 4PA1A 4FWOA 4CGHA 4Z4HA 1RILA 3C0BA 1IBKK 3ZX3A 2NVYC 3SMPA 5FPEA 3QNNA 4LC9B 4CEZA 2YHWA 3SJJA 4KMAA 3J7ZO 4H0VB 3O9RA 2NLXA 4B8AB 3O3HA 4BRDA 3J80O 1W2BM 3DOLA 3KTQA 2OTJN 3GTOK 5J2MA 3M3ZA 4KM8A 3P83D 2OCEA 1TYQB 2F9WA 4UQGA 4A3LK 2QXLA 3KVGA 3JSMA 3FZHA 3D2FB 5E41A 3C7NA 2V6UA 4ILJA 1BOTO 4FYDA 1T6DA 4OO1J 3VTIA 4A2BA 4O5BA 4JHDB 1VQ6N 1HKCA 1BISA 1WAJA 3AD8C 2VUMA 3GTQK 1LW2A 1S22A 4HHTA 3ID6A 4H5NA 3A8KA 4CCHA 4G0VA 4DTMA 5HRNA 1U47A 4FK2A 2B63A 2JA8K 2BE5A 1Q7YO 4RG8A 4O4GA 3OYFA 3FOFA 2XRIA 3FZFA 5T7BA 3QEIA 4WFAL 3OW2M 3P5JA 3GG4A 4HUGA 3AAQA 4H0XB 5AQQA 5LJWA 4FLVA 4AH6A 1K83A 4CFCA 3S2DK 2E2PA 1W9HA 3SPYA 1X9SA 2YU9K 1NJZA 1WSEA 3NGYA 3DLKA 3GEHA 5M3FK 1N8RO 1Y1WA 3QINA 2G8HA 5CJ9A 4B9LA 5L46A 1QS4A 4CJRA 3I4MC 1TWFK 4WJ4A 5AZIA 3CQXA 1WCMK 2VUMC 2BH1A 2OPSA 4DSLA 3VQCA 3K0SA 5HLFA 1NK9A 4ID1A 4OLBA 3VQBA 3MCPA 1ZBSA 3C6UA 4H8KA 4DR7K 4KHUA 5BN9A 2Q0UA 1DGKN 1G51A 2F8SA 3AGKA 3BUEA 3EZWA 4FO0A 4RTFD 3CJ7A 1RBTA 3NVMA 2E4LA 3CMEN 1Y64A 5EY4A 1XZPB 4BY1C 3LP3A 3CM6A 3P39A 4RW4A 4YOTA 3OPFA 1HQUA 4LF5K 3VEVA 3GEEA 1JXEA 4OGCA 3LALA 2Q3SA 4CF0A 2O5JA 1YX2A 4LQYA 1HRHA 4JS5A 1N36K 5IYCC 1QHTA 2W40A 4CJWA 4PL8A 1QVGM 4M63C 1BL3A 5C10A 3NGIA 4DWIA 5IP9C 2R92A 4K0KK 3QDKA 2B4JA 3S17K 4E7KA 2NVQC 2X6NA 1L3TA 3CCLN 1BA1A 5JS2A 3L2RA 1ZYRA 1LWEA 1K6YA 4JK8A 4CZGA 1TWCK 2WB1D 1YJWN 1S1XA 3JSTA 3VEZA 3MX5A 2QA4N 5TKWA 2ITGA 3O08A 1O2AA 2ASPA 4Z4CA 2CH6A 1KRPA 3TAEA 4FWQA 4ELVA 4FM2A 3L4KA 1TKTA 3NH0A 4BDPA 4U7BA 3NF9A 1TWAK 2P5MA 1D5AA 3MECA 2O8CB 2PMZL 1HX1A 2EBBA 1C0UA 4A93K 1VQNN 4IG0A 5M5YK 3ZSYA 4P5AA 1QE1A 3QX3A 3CHWA 3I0RA 4DR5K 1ITGA 3ZSZA 3O6WA 2HHXA 2YNIA 2KFNA 4OKKA 4CHQA 5SZTA 3SUNA 5C4JK 3K57A 2R93A 2HF3A 4M41A 3CYMA 2IIRA 2D0OA 5AQJA 3NH1A 3MXIA 4A3FC 5D4DA 5C24A 4FL9A 3GTJK 3IPJA 3B6OA 1ZBUA 3R3LA 5IOSA 4KTQA 3AVJA 1JLEA 3L3VA 3S15K 4C8KA 3HP9A 3S14C 4CGFA 1SL1A 2JWKA 3H3VD 2V7ZA 2GX9A 1VQ5N 4GTEA 1BO5O 2HBMA 5AZIB 3DLLL 2VWBA 1NGIA 2JA7C 4JI7K 1VRTA 3GTLC 3M3YC 1TKZA 2WAQL 3T01A 2DFFA 4QIWL 2WBNA 3TPQA 2Y0SD 4BLBA 4KI4A 3TWHA 1UV7A 5BPMA 3OYLA 1JLQA 4G7OA 4YY3K 4A3JK 3SZZA 4WCEL 5FRMA 5KQ8A 4FJJA 3GTMK 3V1QA 2JA6K 4I7FA 1KVCA 1N6QA 2CFAA 1QTMA 3BP8A 4DTRA 4G1QA 1EXQA 2D4WA 1A5VA 4BC2A 3MEEA 3VF6A 3DLRA 3C95A 1HR0K 1NG9A 4LK0A 1KXPA 3EY1A 1E4GT 4J3NA 4KV8A 3M8QA 4LF9K 1TVRA 4MO4A 2D6FC 4DTSA 1O13A 2VQEK 1NK5A 4KHPK 3MXMA 2RGRA 1FKPA 1VSHA 2HBLA 3TSUA 2WUSA 4CFBA 1I50A 4YFKA 4JI1K 1XUPO 2OZSA 2QKBA 2OANA 5CR4A 5AQMA 1WN7A 4J8FA 2PYJA 1SS6A 3Q7BA 3ALYA 3TR8A 4DLEA 3N4QA 1U45A 2OTLN 3GTGA 1JCGA 1HKGA 1BQNA 1SZ2A 4B9NA 4BROA 4ZH4A 1J9AA 1QQMA 2IVOA 3G0ZA 1QSSA 3D0PA 4E7LA 1GOAA 2YNFA 4BGAA 2J4RA 3RR8A 1TWGC 4BRHA 4BWMA 1F7VA 3GL1A 2BGGA 1LWFA 5BR8K 3LP0A 1WB9A 1V4SA 1QSYA 1WSGA 3UKRB 4CJQA 1K8KB 2A41A 2GEMA 3DAWA 5BPLA 3OYAA 1I50C 2P9SA 5KGWA 4U67L 4KHQA 3H1QA 3R8EA 3QETA 5CZ2A 3J8AA 4A3CC 2NRHA 3GIRA 3UB5A 3A8IA 3DXJA 2KWAA 3GTPA 4BY7K 1PJ7A 4FW2A 4OPKA 2KFZA 1KFSA 1RTIA 4K41A 3ULEB 4OKEA 1NK0A 2RH6A 3KWIA 3GOIA 4ISEA 4CEQA 3HVRA 2JGUA 3S1RC 5IYBC 2E2HC 3K5NA 4MDBA 3TFIA 3HOZK 1SKWA 1TWHC 3VTHA 1WUAA 4K42A 2X6SA 2A69A 3H0GC 4G7HA 2NVXC 3H46O 2O8FB 5AQUA 3K5MA 1ILYA 2R7ZA 4RW8A 5ADXH 3K7AC 2GSUA 4KI6A 2ZWHA 3ENHA 4BR4A 1OH7A 4LFBK 3S1NC 4X66K 1G15A 5FROA 3PO2C 1J53A 2PY5A 1EK8A 1BHLA 4FLWA 2NRXA 2P9PB 4Z4EA 1Y97A 4DV4K 3ZX2A 4IXCA 4BRPA 3AD9C 4DS5A 2IC3A 4A62A 2PFUA 4BY9C 3A5NC 5FLXO 2Z1GA 1KD1O 2FF6A 5CHIA 3AA5X 2NVTC 3HT3A 1YT3A 4UY8O 4HWIA 1ZC6A 2R7ZK 3AO4A 1JLBA 3HPGA 4C23A 1P90A 4GY2B 4M3WA 1JLAA 2ASMA 2IAJA 1KLMA 2NUBA 1RT7A 3HOUK 3KK2A 3K59A 1SAZA 3KLHA 4CBUA 1NK4A 1WBBA 3ENBA 4RMFA 5EXWA 2OA8A 4MFBA 5FPMA 4E0DA 2OZMA 1EI6A 4B1ZA 2QWLA 4JK9A 4FJXA 4WQ5C 5M1KA 3ATUA 4IO9L 4K43A 3ZT3A 2V7YA 2DTUA 1R9TK 4PKGA 3IKMA 3LAJA 4CK1A 3PIOL 3ISNC 4KH5A 1C0GA 4PWDA 1IS1A 4EIAA 2ZGYA 4CK3A 3FGUA 2YNHA 1NOZA 2V52B 3RSEB 4FM9A 3IDHA 2ZM6K 4DTPA 1VQMN 1FK9A 1ASVA 3UIQA 1NGFA 4DTJA 3A8YA 4ELTA 4B1XB 1S1TA 3L4IA 3BF3A 2Q31A 5H1SQ 5IT9O 1IG9A 3HM8A 4DU4A 2D0BA 3V1OA 4A3KC 3KLIA 3ZEUB 3O9UA 4E19A 5HRRA 5CYQA 1Y1VA 2WONA 5DM7L 1R59O 1NKEA 4B3MK 2G8VA 1O2FB 1WOOA 3RWUA 2Z1HA 2E2IK 3AH5A 3GTKA 5SWMA 1LOTB 1YJNN 4CZIA 3CQZK 3M4OC 1RU0A 2PYLA 1I3QA 1MWMA 4WFBL 2PAVA 2IOCA 1X9WA 1T05A 3L4QA 4E89A 3EKSA 1USOA 4CZFA 4OX9K 1SQKA 2BTFA 4I9LA 2DPNA 4HVJA 4H4OA 3CCRN 2JA5K 3EQLA 1RNHA 3SUOA 3MMVA 3BUZB 1FXXA 3M1FA 1EWRA 4CHPA 3OREA 4WJ3M 3VENA 3LPTA 3RMDA 5J2PA 4FJMA 4FVUA 1QQOA 3WQUA 4O44A 5AQNA 2YKMA 4FXDA 4YDUC 1JCFA 4C3HC 2Q97A 3TARA 3GTKC 1Y1VK 2ZJPL 4Q4ZA 3VF4A 3ZYYX 3T1AA 2W41A 5C42A 1C1BA 3CC4N 3CXCM 4YHHK 2ZFZA 2E6LA 5BREA 3SK3A 2RN2A 1J98A 1EFWA 4F3OA 1C0MA 2CW0A 4X6AK 2I5JA 3MEDA 1T8EA 4CZEA 3CCQN 3VQ6A 1TGOA 5HP1A 4CZJA 1TUYA 1SFOA 2YKNA 1DKGD 4JI3K 1GLJO 3VQEA 4CJSA 1J6VA 3O3FA 4EZ6A 4BG8A 4M3ZA 1F9NA 3AVBA 2B5JA 1EO1A 1SL0A 3ZT1A 4DUYK 4GTBA 1O2BA 3HVTA 1WSRA 5J2QA 4ILHA 3IG1A 4CJUA 4H5RA 2CH5A 4F9OA 3SQ2A 4G0UA 2EWSA 2HHSA 4KTZA 4DV6K 4K8ZA 4BRFA 3PO4A 4H5TA 3CCVN 2G8UA 4N56A 3P31A 2NRZA 4FZYA 3SUQA 4CECA 1NJIO 1GLEG 3QEXA 4F2RA 4MDAA 1B4AA 2D0PA 1IH7A 3DXKB 1IKVA 2ZGZA 3N0CA 1PJ5A 5IORA 4CIFA 1ASWA 3DM2A 3L2UA 1YNJA 3O4WA 1I6HK 2XCOA 3QEVA 2ZF5O 2QK9A 4DR3K 1HNZK 3K9KA 3THVA 2VQFK 4CJFA 5GADP 2E2QA 4A3IC 3L3UA 4DS4A 1A5XA 2E1YA 3ZSRA 3LAPA 3ZETB 3GTOA 1YHQN 1EKEA 4FZXC 4A3EC 3MWPA 4XCHA 3RZOC 4FJGA 1LWCA 5JLHA 3VGKA 4B9MA 3SLCA 2KHOA 4WFNL 4LJZA 2GSOA 1XZPA 3OYHA 3SCXA 4KKOA 3L4JA 3GSIA 4NYNA 4LH5A 4N5SA 3WNFA 3NUHA 1SKRA 5JVGL 3M6GA 5I42A 3GTQA 3S16K 3S1QK 5JS1A 4FZZA 3CC7N 1J54A 3AV9A 2XHBA 3V1RA 4Z4IA 3Q3QA 3H3NO 2P51A 3MWTA 4AHCA 3HOWC 1B92A 4MEXA 3W0LA 3FKIC 4A2AA 4M3TA 2UXDK 4Y0WA 3T1HK 4KB1A 3V4GA 3QIPA 3NE6A 4DF4A 2YU9A 1REVA 2HMIA 4JD2B 3K5OA 4CJPA 2VG6A 5AQSA 4DFPA 1KQ4A 1BJTA 4OIRA 4AHRA 3EO3A 1Q82O 2NRVA 1BCOA 4KB0A 1TWFA 1XC3A 5ELZA 1L3SA 1WCMA 3GTQC 5IYDK 2NVYK 1KAZA 1GOCA 3AVFA 3OYMA 3WXIA 3ZSXA 2O8CA 4QJVB 5M3MK 1LAWA 2JA8C 1XZQA 1HQMA 2QKKA 4JNEA 5TKYA 4KATA 3CF5L 2F4VK 1JLCA 3CI5A 4XH4A 4M7XA 4CERA 3A0IX 4CIEA 3QESA 5CZ1A 5C4XK 1RDUA 2G8WA 5B8HA 1RBRA 3FLCO 3VQDA 1CLQA 2A6EA 1MDUB 2VCPA 5AQRA 2GTDA 1Z26A 2YHBA 2YX6A 4KN7A 4QCLA 1N5YA 4P5BA 5EGHA 3O9QA 4FM1A 4F2SA 3TFHA 3HKZL 3B6PA 4CD3A 5AQZA 3F9MA 2Q2RA 3K9JA 1TWFC 1WCMC 1OKJA 2P9LB 1S1WA 4JAXA 4Y7NC 2BUPA 4MLEA 3PO3K 2E2NA 1OVQA 5I9EB 1X3NA 3TTFA 2B63C 1W97L 3AARA 3KLGA 3LM9A 3MN9A 1K9MO 4LF4K 4IOAL 4A57A 3PSIA 3LPXA 3KWGA 1XC9A 4OIQA 3BZKA 1OH5A 5C2FA 4LLGA 2P5GA 4E7JA 2YHXA 1HI9A 1K83C 4FM0A 1WSJA 5AQKA 1T6CA 1BS2A 1RDAA 4X62K 3OYKA 4MQ9A 5JICA 1TWCA 4WILA 3KJVA 5LL6Z 4JI8K 3VF2A 4FJNA 3K5LA 2A42A 2VG5A 3O4QA 1C0AA 1VSKA 4J2AA 1TK5A 1Y1WC 3LPUA 1ZBFA 1OH6A 2CGKA 4GTCA 5AQOA 3VQAA 1Q18A 3LDPA 4IG3A 4JI5K 3ZT4A 4DHYA 4DB3A 1EQRA 3ZSWA 1TWAA 5F2RA 1X9MA 5AQVA 2A1SA 4GVEA 4AYBD 5BRHA 3MX2A 4WF9L 2WOMA 4IEEA 3T69A 1ZBHA 4HTUA 1IL2A 4NOIA 3RZDC 2KTQA 2JH3A 1QQNA 3S3NA 1KCFA 3FOEA 1GLLO 3I8BA 3VETA 1Q9XA 4BXXC 3GTJA 5HRPA 5M5XK 1HKBA 3O5BA 5I3UA 4R5PA 2JLEA 5FDLA 3LDOA 4H5WA 3N4PA 1IBMK 2Y1IA 4Z94A 4P9SA 3F9KA 4CHNA 1TWAC 2G8KA 1YITN 4KMDA 3AVHA 1VSLA 3JXUA 3QFUA 3CCUN 4B3OA 1XXCA 3UKRA 4A93C 1NMNA 1K8KA 1C1AA 5LMUK 3CFPA 1XZQB 1RTHA 5DM6L 4FJLA 2G8IA 4CJVA 2NVQK 5C4JC 5LJVA 3RR7A 2R92C 1JOEA 3MAQA 3HOVC 1CZAN 3OBWA 2W42A 2O8DB 4EHUA 3H08A 4FJIA 3GTMA 3OYNA 3I4NC 1F7UA 2JA6A 3DXMA 2W6LA 3LAMA 3HK2A 3C94A 4RWTA 4H03B 4BE2A 5AQGA 3SAHA 2HBKA 3S15C 3DI6A 3ULEA 4CI6A 1JQWA 3MMLB 4AF1A 1M1KO 4BVOA 4DTXA 4J2DA 4DDQA 4JKAA 2P9KA 4AQYK 2IS3A 4WQ4A 4LF8K 4DR4K 3IFRA 1M90O 4AHUA 2GUPA 5EX5A 1HYVA 3TTCA 3BY5A 1JXBA 2KLAA 1LAVA 1GE9A 5AQXA 1Q86O 2O8FA 4FLUA 1ZXOA 4CW7B 1JJ2M 4ZTJA 4CGIA 4PL7A 4PQUA 3O8MA 4FLTA 1IKYA 4LH4A 3OEPA 4A3FK 3DMJA 3GTMC 4OJRA 2R93C 3HXMA 1TAUA 3J7AP 4LD0A 5GINA 2DFHA 2PA8L 1CZ9A 2Q1NA 4FPAA 1X9JA 2DY4A 3RTVA 3FE1A 1XMOK 3S14K 5AQLA 4JYAK 2XY7A 5KQDA 3NDKA 3ZSQA 3I0SA 3RMBA 2VYPA 3WXKA 4B9QA 2P9PA 4WQ4C 3IS9A 3EN9A 4NCBA 2HVIA 3AA4A 1O26A 2JA7K 1I39A 3O4NA 3GTLK 3M3YK 2A3ZA 1NJXA 4GZYA 1NGGA 2FQTA 3V81A 4KBOA 1ESVA 3SV4A 3JS6A 1WSVA 4KRFA 4CBXA 2GWJA 1RT1A 4DQIA 2E2OA 4B9UA 1IE0A 1I94K 2GELA 4Z4FA 4B1UB 4DQPA 3I33A 4L3QA 3F5TA 4M45A 4C8MA 4XH1A 4E1NA 4FWPA 4CJ3A 1IBAA 3PUFA 3SBTA 1IKXA 2HF4A 4CJLA 1HNVA 4QAGA 1E3MA 5AQYA 3DOKA 4AM6A 2P9NA 4DG1A 3BP8C 1WBDA 3HOSA 4DSJA 1UA0A 3HRGA 3U4LA 3MDQA 3ZT0A 3HL8A 4BC4A 3T00A 3O9SA 4JI2K 2ETJA 2FBXA 3OYDA 4FJ7A 4CJ7A 4DQQA 1U2VA 4A3DK 4RCHA 2XY5A 1AB4A 4O0JA 4O5FA 4NB4A 1USMA 4C8LA 3V9SA 1PJ6A 4OIOA 1UOCA 4B1WB 1S6QA 4E7HA 2RF2A 2GBZA 3AVMA 4EZ9A 5AQTA 3NVKA 4I2PA 4ZTFA 3A5MC 2HNZA 3CMAN 1TV6A 5J1EA 3CPEA 4BVPA 3AQPA 3TU5A 1RBVA 5KGXA 1HPMA 1XHZA 3ID8A 2E1ZA 3OS2A 3LP1A 1NNEA 3DXMB 3RSEA 4C3IC 3GTGC 3KLEA 1HLUA 3QIOA 1TUUA 4AHVA 1TWGK 3SQ1A 1XHXA 3G10A 4KH6A 3VEWA 4PAAA 4BR7A 2FQOA 3THWA 3ZLJA 1RDBA 4BDYA 4FJ5A 4BRLA 2P9KB 5F0XA 4N76A 5JMVA 3ENOA 1KC8O 3ZEUA 4M3YA 3CETA 4JKGA 1O24A 1JLFA 3S1MK 2EHGA 2FBTA 4OVLA 1IKWA 1YI2N 4B9SA 2P9UB 4YOWA 1JL2A 3VQ7A 2P5OA 4FLXA 5C2DA 4QS9A 5KPTA 3IRXA 3GTPC 2PMZD 4KHNA 1DLOA 4O55A 3SZYA 1NKBA 5JFEA 2FBVA 4NLCA 5IYBK 1O25A 3SV3A 2E2HK 4QS8A 1NOYA 1TWHK 2HBJA 3GDZA 1IO2A 2VGMA 3AVLA 4H0PA 3GE1A 2Z1JA 4IDHA 4CVNE 2A1RA 3H0GK 1SV5A 1RT2A 3VA0A 1L3UA 5E68A 1R9TA 5KPZA 2UYTA 3VESA 4W5TA 2R7ZC 3RRHA 4HUEA 3L6QA 1EX4A 1KVBA 3IMXA 5KPRA 1IQ0A 4XEIA 4BRCA 3HP6A 1S6PA 3KD1E 3HXAA 3PO2K 3U9ZA 2WAQD 2P9NB 4OPHA 4YOYA 3CFRA 3IUCA 4GTDA 3CFOA 4DQSA 4FJKA 4Z4GA 2Z1IA 3J7YP 4CK2A 2IDOA 1TL1A 3THYA 5BRFA 2FLOA 4CD1A 1U2VB 1VH2A 3D2EA 2NVTK 4GV6A 3MN5A 3OYCA 4B1VA 4E1JA 3VQ4A 4JKFA 4GKJK 5FPDA 2E2IA 2HOEA 3CQYA 3OJSA 1DT9A 3TSPA 3V6DA 1DCPA 5MLCQ 3CQZA 3OYJA 1NWKA 3QBWA 1HPZA 2JWLA 5C0YA 1GLCG 3CAGA 1RT5A 1TK0A 1T44A 5KTQA 3TAQA 1BI4B 4YFUA 5FLMC 2JA5A 3LZJA 3HTVA 3OYEA 4CEEA 3V4IA 1TL3A 3THWB 3T19A 1EETA 3DXKA 3AVAA 5JVOA 5C3EK 3AVCA 1KFDA 3FR0A 4CHZA 2GUIA 1WQGA 1YTUA 3LM2A 4BC5A 4DV2K 4XSZA 2KW4A 4JKGB 1SL2A 1GLFO 3EZ5A 3ZCMA 4O8UA 4GW6A 1BUPA 1BWFO 4LSLA 2QEXN 4IDKA 3OS1A 3CJCA 4ID5A 3ZETA 1XPPA 1R0AA 4XH5A 1ZQ1C 4B1YB 4BREA 1RFQA 1S5JA 2A6AA 4R79A 4GT9A 3FFIA 4CFDA 4CZMA 4Q5VA 3HSCA 1EQYA 2ZJRL 3AA3A 3CG7A 2VG7A 3NCIA 5IWAK 3FHZA 3OY9A 4DR2K 4BBSC 3EE9A 3G4SN 4DFJA 2H3GX 1BG3A 4A3MK 3O1BA 3KZBA 4BRKA 3ERED 2YJEA 1J5EK 1RBSA 1V5VA 3K2PA 1LW0A 1Y1VC 4G7ZA 3DRPA 2GAHC 4Q5SA 1U49A 2F96A 3GBTA 4C2MK 2FC0A 2ZJQL 1OVYA 5EVZA 1T03A 3A8JA 2QM1A 2O8EA 1I3QC 3H6EA 2ITMA 3ZSOA 5AFUA 4DFMA 2XY6A 2BE2A 3SBGA 2D0AA 3DLGA 5IP7C 3HI0A 4JI6K 4B3RK 1IW7A 4C3JK 5LMNK 2I7PA 3HOYC 4JD2A 1RTJA 4DCHA 5BN8A 4KMUA 3THYB 4BBRC 4G0WA 4DKWA 2QI2A 3AA2A 3D2EB 1Z25A 4M7YA 5CYMA 4ILDA 4JK1A 3VEYA 2F7TA 3PX0A 5TMCA 4JLHA 4TSXA 4QJVA 2FBYA 3MXJA 5IOTA 3E9LA 3VGMA 4CJEA 2UXBK 2DFEA 2BDPA 3BEXA 2XCRB 4CJ5A 1DEJA 4NO7A 2UU9K 3LAKA 4AHSA 4PKHA 5FRNA 1VSJA 4WYBA 4A3BC 2E88A 4O2DA 1YAGA 1DCHA 4DUZK 4B9VA 1L0WA 4A5AA 3V9XA 4HUFA 1WQHA 3S2HK 4F8RA 1WLJA 4B8CA 2E5LK 4C45A 1SFOC 5AQFA 4BC3A 2HHUA 3HOXK 4CJTA 5C44C 4CZKA 1QZ5A 2QXFA 2ZUEA 3UKUB 3D7EO 4OPAA 2P9LA 4IKFA 1EWQA 1RGIA 4A3GK 3N0BA 2O5IA 4Y52K 1QVFM 1ZBLA 4CZHA 4JRPA 1J6ZA 1GLBG 3WXMB 1XXBA 3C6HA 2XY8A 5M1FA 1B4BA 1EH1A 3G71N 5DK5A 3SQ4A 1NGJA 1W7AA 4KC6A 4IZ9A 1H1VA 2FSNA 3S0XA 2O8BA 1HMVA 1S9EA 1RDDA 4KHSA 4O0IA 1UAXA 1VSFA 2UUAK 1WQFA 2E20A 4GFQA 4BR5A 1YNNA 3MK6A 4GKKK 4KPYA 2WB1L 3S16C 2NVYA 4GNIA 1L3VA 3H3OB 4PUOA 4EAHD 1S72N 2FSJA 3LL3A 4CEAA 3THXB 3A2FA 1TK8A 1WIHA 1VQ9N 2YNGA 4IFEA 3VEOA 1YIJN 2UUBK 3RZOK 4DMNA 4KDDA 4JKEA 1ISEA 4PHTX 2O8EB 3GTOC 3LDSA 4F3TA 1BCMA 4FWLA 1VQLN 1LV5A 4K8XA 4GMJB 3KK7A 3LWMA 5C12A 2HNYA 4A3LC 1J6XA 5M5WK 5D3GA 4B3SK 3E1YA 4DV7K 4PY5A 2Q36A 4FK0A 4CF9A 3CJ1A 4KTWA 2WC9A 1E4FT 1O28A 2E2JK 4OINA 2PHCB 1UWBA 1OH8A 2Q0RA 2QWOA 4DFKA 4KHWA 4DQ8A 3BZCA 1V4TA 1VGXA 5IYDC 3B8AX 1XWLA 4BRMA 4JI0K 4BRGA 2A40A 3SQ0A 3NHGA 4JEPA 4NXMK 2YHYA 1Z6RA 3AO5A 5HL8A 3C6AA 1YCLA 4J2BA 3HOWK 2YV0X 3D6RA 3FKIK 3H3VL 3D45A 3P4IA 3BF1A 2RHKA 1UA1A 3HYFA 5HRSA 1DTQA 2VWKA 4ILGB 2V6TA 5C4XC 3GEIA 4QOZB 2O8DA 3AVNA 1VSIA 4LR2A 4JKHA 1NBWA 2AA4A 3HPOA 3S2DC 2Y0SL 4JRQA 1NJWA 4IBNA 2YU9C 1VAZA 3P38A 1JCEA 4CFAA 2FXUA 3TAGA 3P1GA 3OHRA 3WODA 3TAPA 4M1XA 4YFNA 4BWJA 4KARA 3TAMA 2X74A 1NGDA
chains in the Genus database with same CATH topology
3VERA 3D2FA 1BDGA 3G6EN 5CE3A 4A62A 1MWKA 5GINA 2PFUA 1ATNA 4BY9C 3A5NC 1YF5L 2Q1NA 4O8KA 4FPAA 1KD1O 1X9JA 2FF6A 3FE1A 5HL7L 1YVNA 4A59A 5CHIA 2IVNA 5AQLA 4UY8O 2XCQA 4HWIA 1ZC6A 5KQDA 5M1PA 2VYPA 3WXKA 4B9QA 2P9PA 4JHDA 3CCEN 3WEEA 4WQ4C 4FOEA 4C23A 1P90A 3EN9A 4GY2B 2ASMA 4A61A 3G25A 1O26A 1RDWX 2A5XA 4JN4A 3E9OA 2A3ZA 1NGGA 4KBOA 1ESVA 4YOVA 5LY3A 1SAZA 3OA9A 2GSNA 3JS6A 4CBUA 3ENBA 1IJJA 2GWJA 4CBXA 5EXWA 2E2OA 4EFHA 3O80A 5FPMA 4HTLA 2GELA 4B1UB 3I33A 3CCJN 3MCAB 4L3QA 4B1ZA 3F5TA 3BUEA 2QWLA 4I6MB 4JK9A 4XH1A 3VA7A 3GDQA 2QWRA 4FWPA 4C1NK 1VQON 4WQ5C 3SBTA 5M1KA 3ATUA 4H0YB 3CCSN 2HF4A 4K43A 4IO9L 2V7YA 1VQ8N 1GLAG 5AQYA 3SJHA 4BKWA 4AM6A 1XXAA 2P9NA 4PKGA 3CJ9A 2P9IA 3IKMA 3LAJA 3HOSA 1NGHA 3PIOL 3HRGA 3U4LA 3MDQA 2E8AA 4KH5A 3WXLA 4BC4A 4NLBA 1C0GA 1O29A 3O9SA 1IS1A 4EIAA 3FFKB 3U9DA 1Q81O 2ZGYA 3FGUA 3QMLA 1MA9B 4CJ7A 2V52B 1NM1A 1U2VA 4EHTA 4RCHA 3R9PA 1NGEA 3CJBA 1AB4A 3RSEB 4MO5A 1NLVA 4NB4A 4O5FA 1VQ4N 3IDHA 4FM9A 2VGNA 4BRAA 1VQMN 5GAGP 4IWVA 1NGFA 1K73O 3I55N 2Y3PA 3A8YA 2QW9A 3ZX0A 4B1WB 2NRTA 4B1XB 2HSTA 1KAYA 5AQTA 3NVKA 1VQ7N 3AAPA 4YOUA 4IEIA 1NMDA 3A5MC 3L4IA 5C15A 3BF3A 5E84A 2Q31A 3CMAN 5H1SQ 3AQOA 2FF3B 3H1VX 3HM8A 3CPEA 3FKIA 4BVPA 3AQPA 3TU5A 3AY9A 3ZEUB 3O9UA 1DD5A 1HPMA 3ID8A 2E1ZA 1NGCA 1Y1VA 5JLFA 5DM7L 1R59O 1P8ZA 3DXMB 3RSEA 4C3IC 3G4AA 1HLUA 3AH5A 3GTKA 1TUUA 3NMUA 4MLHA 1LOTB 4KH6A 3VEWA 4CZIA 1YJNN 1LCUA 4BR7A 3N3YA 1I3QA 1MWMA 3AGRA 3WQTA 4WFBL 2PAVA 3SAGA 3L4QA 2P9KB 3C7NB 1HUXA 4BRLA 5F0XA 3MN7A 1O27A 4KB4A 3EKSA 4FWOA 3ENOA 4IJAA 5JMVA 3PIPL 3C0BA 3SMSA 4CZFA 1KC8O 3ZEUA 1SQKA 2BTFA 2DPNA 3CETA 3ZX3A 3CCRN 4JKGA 3SMPA 5FPEA 4LC9B 1O24A 4FWKA 2YHWA 4KMAA 3J7ZO 5BR9A 3MMVA 3BUZB 4H0VB 3M1FA 3O9RA 3OREA 2NLXA 2OTJN 1W2BM 4BRDA 1YI2N 3VENA 4BGBA 4KH4A 4FVUA 3M3ZA 2P9UB 3R1XA 4YOWA 4KM8A 4JKDA 3LDLA 1TYQB 2F9WA 1QQOA 3WQUA 2QXLA 3KVGA 4BQLA 5AQNA 5C2DA 2JA7A 3FZHA 3D2FB 4YDUC 1JCFA 1Z05A 4QS9A 5KPTA 4C3HC 2Q97A 3C7NA 3GTLA 4ILJA 5JFEA 4JKCA 2ZJPL 2CGLA 4NLCA 1BOTO 3VF4A 4A5BA 1O25A 1T6DA 3CJAA 3ZYYX 4QS8A 5GIPA 1K8AO 3A5OC 4OO1J 2W41A 3VTIA 2HBJA 3LDQA 4BR9A 3CC4N 3TTDA 2VGMA 4H0PA 4A2BA 5GAEP 3GE1A 4JHDB 4IDHA 3WEEB 4C1NI 3CXCM 3CC2N 1HKCA 1VQ6N 3EL2A 2NNWA 2ZFZA 5TJ3A 2P9UA 5BREA 4GV3A 3SK3A 2VUMA 1S22A 3ID6A 4H5NA 4G0VA 2B63A 1R9TA 4CZEA 5KPZA 3CCQN 2UYTA 1ATSA 2WFBA 3VESA 4CZJA 1Q7YO 1TUYA 4KMHA 4PKIA 1SFOA 1DKGD 3L6QA 3FOFA 3FZFA 1GLJO 3IMXA 4WFAL 3OW2M 3GG4A 3AAQA 4H0XB 5AQQA 3KHYA 5LJWA 3PLAA 5KPRA 1K83A 5EGEA 4XEIA 4BRCA 4BG8A 1F9NA 2V51B 2E2PA 1YJ9N 1EO1A 3U9ZA 3EKUA 5E26A 4GTBA 2P9NB 1YXQA 3A5LC 4OPHA 1O2BA 2P9IB 4ILHA 4YOYA 4GTDA 3IUCA 4H5RA 1VQKN 2CH5A 4F9OA 1N8RO 2D1KA 1Y1WA 4G0UA 1NGBA 5CJ9A 2EWSA 5AZIA 3CQXA 4BRFA 2BH1A 5BRFA 2FLOA 1QZ6A 3DWLA 4H5TA 3CCVN 4CD1A 1U2VB 3D2EA 3P31A 3QBXA 4GV6A 3W3DA 3MN5A 2NRZA 3MCPA 4B1VA 4E1JA 1ZBSA 4JKFA 5FPDA 1NJIO 2E2IA 1GLEG 2HOEA 3CQYA 1G99A 3E9PA 5BN9A 1DT9A 2Q0UA 1DGKN 3TSPA 1KQSM 1TWGA 5MLCQ 3WXJA 3CQZA 4KM9A 4MDAA 3AGKA 1NWKA 3QBWA 4BRNA 2D0PA 1B4AA 3DXKB 2JWLA 5C0YA 2ZGZA 3WUHA 3EZWA 4FO0A 4RTFD 3CJ7A 3N0CA 5IORA 1GLCG 4GTFA 3O4WA 3NVMA 3CAGA 5F1XA 3CMEN 1Y64A 5EY4A 3VMFB 2XCOA 1T44A 2ZF5O 4IOCL 3K9KA 3P39A 4YOTA 3OPFA 2JA5A 5GADP 2E2QA 4FPBA 2E1YA 3HTVA 3LAPA 3ZETB 3VEVA 1YHQN 3GTOA 2AP1A 3CD6N 4GV9A 3MWPA 4BG9A 5AQWA 4IJNA 4BR0A 1T3VA 3DXKA 5JVOA 2CGJA 5JLHA 3VGKA 4LQYA 3FR0A 3SLCA 3UE5A 3CPWM 1WQGA 2KHOA 3LM2A 4BC5A 4WFNL 2GSOA 2W40A 5M1QA 4JKGB 4PL8A 1GLFO 1QVGM 3L0QA 3L4JA 4O8UA 4M63C 1BUPA 1BWFO 2E2HA 5C10A 2QEXN 2R92A 4JKBA 1TWHA 3CJCA 3QDKA 3ZETA 4XH5A 3NUHA 4B1YB 4BREA 5JVGL 1S3XA 1BA1A 1RFQA 2A6AA 4R79A 3M6GA 3CCLN 4GT9A 3H0GA 4JK8A 4CZMA 4CZGA 3HSCA 3GTQA 2NVXA 1EQYA 1YJWN 1NGAA 2ZJRL 3HOTA 3VEZA 3MX5A 2QA4N 3VGLA 3CC7N 5TKWA 3O08A 3QICA 1O2AA 2ASPA 3Q3QA 3FHZA 2CH6A 3H3NO 4FWQA 3EE9A 2KKZA 3G4SN 2H3GX 3MWTA 5M1OA 1BG3A 3L4KA 3O1BA 3W0LA 2RE2A 3KZBA 4A2AA 4GTAA 2IVPA 4BRKA 4U7BA 3ERED 2P5MA 2YJEA 4Y0WA 5GIOA 4YOXA 3V4GA 4GTLA 1HX1A 2YU9A 1VQNN 3U8XA 2QWPA 3GBTA 3CERA 4JD2B 4P5AA 3QX3A 5AQSA 3CHWA 2ZJQL 1OVYA 3O6WA 5EVZA 3VOVA 1BJTA 1KQ4A 3HBTA 4KB2A 2QM1A 3EO3A 4FWSA 1Q82O 2NRVA 2R93A 3H6EA 2HF3A 2ITMA 1VQPN 1TWFA 5AFUA 2IIRA 1XC3A 5ELZA 1WCMA 2D0OA 5AQJA 5CHPA 1X3MA 1KAZA 2I7NA 3SBGA 2NRWA 4FL9A 3WXIA 5AZJA 3HI0A 3R3LA 1IG8A 5IOSA 4JNEA 2I7PA 5TKYA 4KATA 4JD2A 3CF5L 2F9TA 4H5VA 2JWKA 1C0FA 3CI5A 2V7ZA 4XH4A 4M7XA 2GX9A 1VQ5N 4DCHA 1BO5O 2HBMA 3A0IX 5AZIB 2VWBA 4FWMA 1NGIA 4FWNA 5BN8A 5BRDA 3DLLL 2QTDA 4G0WA 1RDUA 4DKWA 3OBYA 2QI2A 4H0TB 3D2EB 4M7YA 4QS7A 5B8HA 3FLCO 4ILDA 4BLBA 3VEYA 2F7TA 2WBNA 3TPQA 2CFAB 1MDUB 2VCPA 5AQRA 2YCHA 2GTDA 5AQHA 2YX6A 5IOQA 4P5BA 5BPMA 5EGHA 3O9QA 5AFUH 5IOTA 3E9LA 5AQZA 3VGMA 3F9MA 2Q2RA 3K9JA 4CD3A 3S41A 4WCEL 4WQ5A 1OKJA 3BEXA 3DJCA 2P9LB 5KQ8A 2XCRB 3FZMA 1DEJA 4JAXA 4NO7A 1KAXA 3G4CA 2BUPA 2CFAA 4MLEA 3BP8A 4PKHA 1XQSC 4CZLA 4WYBA 2D4WA 2E2NA 1YAGA 2E88A 5I9EB 4IO8A 1X3NA 3TTFA 1HJOA 1W97L 3AARA 4BC2A 1QHAA 4A5AA 1WQHA 3LM9A 3MN9A 3VF6A 1K9MO 5M1NA 4A57A 4IOAL 3LPXA 3Q7CA 3KWGA 1KXPA 1E4GT 5AQFA 1D4XA 4BC3A 5C2FA 4J3NA 3CIPA 4CZKA 1QZ5A 3QFPA 2YHXA 4MO4A 3UKUB 5AQKA 1T6CA 3D7EO 4OPAA 2P9LA 1O13A 3LDNA 4KASA 5EOYA 5JICA 1TWCA 1RGIA 3N0BA 2RGRA 2HBLA 3FZLA 3TSUA 3VF2A 2WUSA 3WT0A 1QVFM 1BU6O 4CZHA 2A42A 4BRQA 1I50A 1XUPO 1J6ZA 1GLBG 4H0OA 2OANA 5CR4A 5AQMA 3WXMB 5GAHP 2CGKA 4GTCA 5AQOA 4J8FA 4BR2A 1Q18A 1XXBA 3LDPA 2NZTA 1SS6A 3C6HA 3Q7BA 3ATVA 2OTLN 3M5RA 2HMPA 2ASOA 3N4QA 3VPZA 4DB3A 4DHYA 5M1FA 1BGWA 1TWAA 1YUWA 3GTGA 1JCGA 1HKGA 3UKUA 1SZ2A 1GLDG 4IOXA 2P9SB 1QQMA 5F2RA 4BROA 2IVOA 1B4BA 1EH1A 3G71N 2YI1A 5AQVA 4GVEA 1NGJA 5AR0A 5BRHA 4KC6A 3MX2A 4IZ9A 4WF9L 4BGAA 1H1VA 2FSNA 3S0XA 3H45C 2J4RA 4I6MA 4BRHA 3GL1A 4IEEA 3TSQA 4YORA 3T69A 4JK7A 2YJFA 1WQFA 2E20A 3FZKA 1V4SA 3R6MA 4BR5A 3MK6A 4GFQA 2JH3A 1QQNA 3UKRB 3C65A 1K8KB 2A41A 3FOEA 2GEMA 1GLLO 3I8BA 3VETA 2GWKA 3DAWA 3HZ6A 4GNIA 2NVYA 3MN6A 3GTJA 5BPLA 3H3OB 4FOIA 4FZBA 2P9SA 1HKBA 2PBDA 4EAHD 3EE8A 4U67L 5HOOA 1S72N 2FSJA 3LL3A 3O5BA 1WIHA 3H1QA 3R8EA 3LDOA 4H5WA 3N4PA 4IFEA 3VEOA 1YIJN 1VQ9N 3J8AA 4KDDA 4JKEA 1ISEA 5BPNA 1WOQA 2NRHA 4BRIA 4PHTX 4Z94A 3I56N 3UB5A 1VQLN 4FWLA 4YDUA 3O9TA 5ADXA 3KK7A 2KWAA 3GTPA 5C12A 5FPNA 1YITN 4KMDA 3JXUA 3QFUA 3CCUN 1XXCA 3RVCA 1U6ZA 3UKRA 3E1YA 1K8KA 5AZJB 4KAWX 4K41A 2Q36A 3ULEB 2RH6A 4C2MC 3CJ1A 3KWIA 3GOIA 4ISEA 3QB0A 4ISGA 1ATRA 4FSVA 5DM6L 2WC9A 1E4FT 1O28A 4MDBA 2PHCB 2Q0RA 5LJVA 5AQPA 2QWOA 1CZAN 3OBWA 3VTHA 4DQ8A 1ZVUA 4EHUA 1V4TA 3B8AX 3E66A 1WUAA 4K42A 4BRMA 3GTMA 2JA6A 4AM7A 3DXMA 4BRGA 2A40A 3F2KA 2QWNA 4JEPA 2YHYA 1Z6RA 3H46O 4H03B 5AQUA 4RWTA 1ILYA 2QWQA 5AQIA 5AQGA 3C6AA 3SAHA 2R7ZA 2HBKA 4C3JC 2NRRA 4BLAA 3ULEA 3O1WA 5ADXH 3D6RA 5JVHL 4GTEA 4CI6A 3MMLB 4AF1A 1M1KO 4BVOA 2FSKA 4DDQA 2GSUA 4JKAA 2P9KA 3BF1A 3P4IA 2RHKA 3CCMN 4WQ4A 4G9ZA 4ISFA 4FWRA 2ZWHA 3IFRA 4ILGB 4BQZA 1M90O 3ENHA 2GUPA 5EX5A 4BR4A 3TTCA 4LR2A 4K25A 4JKHA 1BA0A 1NBWA 2KLAA 3T7ZA 3SAFA 2AA4A 1GE9A 2QWMA 4CBWA 1EK8A 5AQXA 2NRXA 1VAZA 2P9PB 1JCEA 1ZXOA 2FXUA 3P38A 1Q86O 3OHRA 3VEXA 3ZX2A 1JJ2M 4M1XA 4IXCA 4PL7A 4KARA 4BRPA 1TYQA 3O8MA 1NGDA 3OEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VER A;  3D2F A;  1BDG A;  5CE3 A;  4A62 A;  1MWK A;  1ATN A;  3A5N C;  2Q1N A;  4O8K A;  4FPA A;  1X9J A;  2FF6 A;  3FE1 A;  1YVN A;  2IVN A;  5AQL A;  4HWI A;  1ZC6 A;  5KQD A;  2VYP A;  3WXK A;  4B9Q A;  2P9P A;  4JHD A;  3WEE A;  4WQ4 C;  4FOE A;  4C23 A;  4A61 A;  3EN9 A;  4GY2 B;  2ASM A;  3G25 A;  1RDW X;  2A5X A;  4JN4 A;  2A3Z A;  1NGG A;  4KBO A;  1ESV A;  5LY3 A;  1SAZ A;  3JS6 A;  4CBU A;  4CBX A;  1IJJ A;  2GWJ A;  5EXW A;  2E2O A;  4EFH A;  3O80 A;  5FPM A;  4HTL A;  2GEL A;  4B1U B;  3I33 A;  4L3Q A;  4B1Z A;  2QWL A;  4I6M B;  4XH1 A;  3GDQ A;  2QWR A;  4FWP A;  4WQ5 C;  3ATU A;  4H0Y B;  2HF4 A;  4K43 A;  2V7Y A;  1GLA G;  5AQY A;  3SJH A;  4AM6 A;  2P9N A;  4PKG A;  3CJ9 A;  2P9I A;  1NGH A;  3U4L A;  3MDQ A;  2E8A A;  3WXL A;  4BC4 A;  1C0G A;  4EIA A;  3FFK B;  3U9D A;  2ZGY A;  3FGU A;  3QML A;  1MA9 B;  4CJ7 A;  2V52 B;  1NM1 A;  1U2V A;  4EHT A;  4RCH A;  3R9P A;  1NGE A;  3CJB A;  3RSE B;  4MO5 A;  1NLV A;  4NB4 A;  4O5F A;  3IDH A;  4BRA A;  4IWV A;  1NGF A;  3A8Y A;  2QW9 A;  3ZX0 A;  4B1W B;  4B1X B;  1KAY A;  5AQT A;  3AAP A;  1NMD A;  3A5M C;  3L4I A;  3BF3 A;  5E84 A;  2Q31 A;  2FF3 B;  3H1V X;  3HM8 A;  4BVP A;  3TU5 A;  3AY9 A;  3ZEU B;  1HPM A;  3ID8 A;  2E1Z A;  1NGC A;  5JLF A;  1R59 O;  1P8Z A;  3DXM B;  3RSE A;  1HLU A;  1TUU A;  4MLH A;  1LOT B;  3VEW A;  4CZI A;  1LCU A;  4BR7 A;  1MWM A;  3WQT A;  2PAV A;  4BRL A;  2P9K B;  3C7N B;  1HUX A;  5F0X A;  3MN7 A;  3EKS A;  4FWO A;  3ENO A;  4IJA A;  5JMV A;  3C0B A;  3SMS A;  4CZF A;  3ZEU A;  1SQK A;  2BTF A;  2DPN A;  3CET A;  3ZX3 A;  3SMP A;  5FPE A;  4LC9 B;  4FWK A;  2YHW A;  5BR9 A;  3MMV A;  3BUZ B;  4H0V B;  3M1F A;  2NLX A;  4BRD A;  3VEN A;  4BGB A;  3M3Z A;  2P9U B;  3LDL A;  1TYQ B;  2F9W A;  1QQO A;  3WQU A;  2QXL A;  3KVG A;  4BQL A;  5AQN A;  3FZH A;  3D2F B;  4YDU C;  1JCF A;  1Z05 A;  4QS9 A;  5KPT A;  2Q97 A;  3C7N A;  2CGL A;  1BOT O;  3VF4 A;  1T6D A;  3CJA A;  4QS8 A;  3A5O C;  2W41 A;  4BR9 A;  3LDQ A;  4A2B A;  4H0P A;  3GE1 A;  4JHD B;  3WEE B;  1HKC A;  3EL2 A;  2P9U A;  5BRE A;  3SK3 A;  1S22 A;  4H5N A;  4CZE A;  5KPZ A;  2UYT A;  1ATS A;  3VES A;  4CZJ A;  1TUY A;  4PKI A;  1DKG D;  3L6Q A;  3FZF A;  1GLJ O;  3IMX A;  3GG4 A;  3AAQ A;  4H0X B;  5AQQ A;  3KHY A;  5LJW A;  5KPR A;  4XEI A;  4BRC A;  4BG8 A;  2V51 B;  2E2P A;  3U9Z A;  3EKU A;  5E26 A;  2P9N B;  1YXQ A;  3A5L C;  2P9I B;  3IUC A;  4H5R A;  2CH5 A;  4F9O A;  2D1K A;  1NGB A;  2EWS A;  5AZI A;  3CQX A;  4BRF A;  5BRF A;  2FLO A;  1QZ6 A;  3DWL A;  4H5T A;  4CD1 A;  1U2V B;  3D2E A;  3QBX A;  3W3D A;  3MN5 A;  3MCP A;  4B1V A;  4E1J A;  1ZBS A;  5FPD A;  1GLE G;  2HOE A;  3CQY A;  1G99 A;  5BN9 A;  2Q0U A;  1DGK N;  3WXJ A;  4BRN A;  1NWK A;  3QBW A;  2D0P A;  3DXK B;  2ZGZ A;  3WUH A;  3EZW A;  4FO0 A;  4RTF D;  3CJ7 A;  1GLC G;  3O4W A;  5F1X A;  1Y64 A;  5EY4 A;  1T44 A;  2ZF5 O;  2E2Q A;  4FPB A;  2E1Y A;  3HTV A;  3ZET B;  3VEV A;  2AP1 A;  4BG9 A;  5AQW A;  4IJN A;  4BR0 A;  3DXK A;  2CGJ A;  5JLH A;  3VGK A;  3FR0 A;  3SLC A;  3UE5 A;  2KHO A;  3LM2 A;  4BC5 A;  2W40 A;  4PL8 A;  1GLF O;  3L0Q A;  4M63 C;  1BUP A;  1BWF O;  3CJC A;  3QDK A;  3ZET A;  4XH5 A;  4B1Y B;  4BRE A;  1S3X A;  1BA1 A;  1RFQ A;  2A6A A;  3M6G A;  4CZM A;  4CZG A;  3HSC A;  1EQY A;  1NGA A;  3VEZ A;  3VGL A;  3O08 A;  3QIC A;  2ASP A;  2CH6 A;  3H3N O;  4FWQ A;  2H3G X;  1BG3 A;  3O1B A;  3W0L A;  3KZB A;  4A2A A;  2IVP A;  4BRK A;  2YJE A;  4Y0W A;  1HX1 A;  3U8X A;  2QWP A;  3GBT A;  3CER A;  4JD2 B;  5AQS A;  3CHW A;  5EVZ A;  3O6W A;  3VOV A;  3HBT A;  2QM1 A;  3EO3 A;  4FWS A;  3H6E A;  2HF3 A;  2ITM A;  5AFU A;  2IIR A;  1XC3 A;  5ELZ A;  2D0O A;  5AQJ A;  1X3M A;  1KAZ A;  2I7N A;  4FL9 A;  3WXI A;  5AZJ A;  3HI0 A;  1IG8 A;  4JNE A;  2I7P A;  5TKY A;  4JD2 A;  2F9T A;  4H5V A;  1C0F A;  3CI5 A;  2V7Z A;  4XH4 A;  4M7X A;  4DCH A;  1BO5 O;  3A0I X;  5AZI B;  5BN8 A;  2VWB A;  4FWM A;  1NGI A;  4FWN A;  5BRD A;  4H0T B;  3D2E B;  4M7Y A;  4QS7 A;  5B8H A;  3FLC O;  3VEY A;  3TPQ A;  1MDU B;  2VCP A;  5AQR A;  2YCH A;  2GTD A;  5AQH A;  5BPM A;  5AFU H;  4CD3 A;  5AQZ A;  3VGM A;  3F9M A;  2Q2R A;  3S41 A;  4WQ5 A;  1OKJ A;  3BEX A;  3DJC A;  2P9L B;  5KQ8 A;  3FZM A;  1DEJ A;  4JAX A;  4NO7 A;  1KAX A;  2BUP A;  4MLE A;  3BP8 A;  4PKH A;  1XQS C;  4CZL A;  4WYB A;  2D4W A;  2E2N A;  1YAG A;  2E88 A;  5I9E B;  4IO8 A;  1X3N A;  1HJO A;  4BC2 A;  3AAR A;  1QHA A;  3LM9 A;  3MN9 A;  3VF6 A;  1KXP A;  1E4G T;  5AQF A;  1D4X A;  4BC3 A;  3CIP A;  4CZK A;  1QZ5 A;  3QFP A;  2YHX A;  4MO4 A;  3UKU B;  5AQK A;  1T6C A;  3D7E O;  2P9L A;  3LDN A;  5EOY A;  5JIC A;  1RGI A;  3VF2 A;  3FZL A;  3WT0 A;  2WUS A;  1BU6 O;  4CZH A;  2A42 A;  4BRQ A;  1XUP O;  1J6Z A;  1GLB G;  4H0O A;  2OAN A;  5AQM A;  2CGK A;  5AQO A;  4J8F A;  4BR2 A;  1Q18 A;  3LDP A;  2NZT A;  3ATV A;  3VPZ A;  2HMP A;  2ASO A;  4DB3 A;  4DHY A;  1YUW A;  1JCG A;  1HKG A;  3UKU A;  1SZ2 A;  1GLD G;  5F2R A;  2P9S B;  1QQM A;  4BRO A;  2IVO A;  2YI1 A;  5AQV A;  5AR0 A;  1NGJ A;  5BRH A;  4IZ9 A;  4BGA A;  1H1V A;  2FSN A;  3H45 C;  2J4R A;  4I6M A;  4BRH A;  3GL1 A;  2YJF A;  2E20 A;  3FZK A;  1V4S A;  3R6M A;  4BR5 A;  3MK6 A;  1QQN A;  3UKR B;  1K8K B;  2A41 A;  2GEM A;  1GLL O;  3I8B A;  3VET A;  2GWK A;  3DAW A;  3HZ6 A;  4GNI A;  3MN6 A;  5BPL A;  3H3O B;  4FOI A;  2P9S A;  1HKB A;  2PBD A;  4EAH D;  2FSJ A;  3LL3 A;  3O5B A;  3H1Q A;  3R8E A;  3LDO A;  4H5W A;  3VEO A;  3J8A A;  5BPN A;  1WOQ A;  2NRH A;  4BRI A;  4Z94 A;  3UB5 A;  4FWL A;  4YDU A;  5ADX A;  5FPN A;  3JXU A;  3QFU A;  1U6Z A;  3UKR A;  1K8K A;  5AZJ B;  4K41 A;  2Q36 A;  3ULE B;  3CJ1 A;  3GOI A;  4ISE A;  3QB0 A;  4ISG A;  1ATR A;  4FSV A;  1E4F T;  2Q0R A;  5LJV A;  5AQP A;  2QWO A;  1CZA N;  4DQ8 A;  4EHU A;  1V4T A;  3B8A X;  4BRM A;  1WUA A;  4K42 A;  4AM7 A;  3DXM A;  4BRG A;  2A40 A;  2QWN A;  2YHY A;  1Z6R A;  3H46 O;  4H03 B;  5AQU A;  4RWT A;  2QWQ A;  5AQI A;  5AQG A;  3ULE A;  3O1W A;  5ADX H;  4CI6 A;  4BVO A;  2FSK A;  2P9K A;  3BF1 A;  3P4I A;  4WQ4 A;  4ISF A;  4FWR A;  2ZWH A;  3IFR A;  4BQZ A;  3ENH A;  2GUP A;  5EX5 A;  4BR4 A;  4K25 A;  1BA0 A;  1NBW A;  2AA4 A;  2QWM A;  4CBW A;  5AQX A;  2P9P B;  1JCE A;  1ZXO A;  2FXU A;  3OHR A;  3VEX A;  3ZX2 A;  4IXC A;  4PL7 A;  4BRP A;  1TYQ A;  3O8M A;  1NGD A; 
#chains in the Genus database with same CATH topology
 4IFV A;  3VER A;  1BDG A;  3G6E N;  3O3G A;  3PO3 C;  1WNS A;  4IFY A;  1YF5 L;  1QSL A;  1YVU A;  3T1Y K;  1HYS A;  1YVN A;  4DTN A;  5TMF A;  2IVN A;  4KO0 A;  4LK1 A;  5FJ8 K;  1N33 K;  3WNH A;  4FVM A;  5M1P A;  1RDC A;  3WEE A;  3J81 O;  2KZZ A;  3G25 A;  3HPH A;  1RDW X;  2A68 A;  3E9O A;  2YHA A;  3BP3 A;  1DTT A;  2UUC K;  4CE9 A;  4YOV A;  2WTU A;  3OA9 A;  2GSN A;  4DR1 K;  3O80 A;  4BDZ A;  2V6S A;  4HTL A;  4CED A;  4Y7N K;  2O8B B;  3I4M K;  3U3G A;  3VA7 A;  3KK1 A;  2VUM K;  3CCS N;  4W5Q A;  1EP4 A;  1VQ8 N;  2B63 K;  1XXA A;  1TKX A;  4PAB A;  2BAN A;  2P9I A;  4CJK A;  3M8S A;  3VQ9 A;  2E8A A;  1I3A A;  1O29 A;  2OPR A;  3FFK B;  3HST B;  1Q81 O;  4OIP A;  1K83 K;  3QML A;  3KKS A;  2ZQB A;  1VSM A;  4DF8 A;  3S17 C;  4MO5 A;  1NLV A;  1VQ4 N;  4BRA A;  3KD5 E;  5GAG P;  3V9W A;  1K73 O;  4OKJ A;  3I55 N;  2Y3P A;  4BY1 K;  3CQ8 A;  2QW9 A;  3ZX0 A;  3QEW A;  4ELU A;  1TWC C;  2G8F A;  2NRT A;  1WOP A;  3EYZ A;  2HST A;  1Y1W K;  1VQ7 N;  3AAP A;  2OYQ A;  4IEI A;  3AQO A;  1RBU A;  3AVG A;  2R7Y A;  3PSF A;  3AY9 A;  2HHV A;  2KZM A;  4DTU A;  5JLF A;  3KK3 A;  1P8Z A;  2F8T A;  3RMA A;  3TI0 A;  5IYC K;  3BGR A;  3KIO A;  2HHH K;  3NMU A;  1KLN A;  4MLH A;  3AVK A;  1LCU A;  5IP9 K;  3AGR A;  3WQT A;  3RZD K;  3SAG A;  1FJG K;  1B9D A;  4KB4 A;  3C7N B;  1HUX A;  3M8P A;  3MN7 A;  4BXX K;  4IJA A;  4N47 A;  3PIP L;  3SMS A;  4YFX A;  4DLG A;  1WSI A;  3L2V A;  4FWK A;  3SYZ A;  4W5O A;  3GTJ C;  5BR9 A;  2P1J A;  1J5O A;  4C8N A;  4RW7 A;  4BGB A;  4KH4 A;  3QO9 A;  3R1X A;  4JKD A;  3LDL A;  4Y1D A;  2D0C A;  3MEG A;  2JA7 A;  4BQL A;  4B3T K;  1FW6 A;  3GTL A;  1Z05 A;  1KSP A;  4JKC A;  2CGL A;  4A5B A;  4M42 A;  5CY4 A;  3AD7 C;  3CJA A;  5GIP A;  2R92 K;  1K8A O;  3A5O C;  4M3X A;  4BR9 A;  3LDQ A;  3HOV K;  3JYT A;  2GV9 A;  1KVA A;  3TTD A;  5GAE P;  3DLB A;  3WEE B;  4C1N I;  3CC2 N;  5TJ3 A;  1VJE A;  3I4N K;  3EL2 A;  2NNW A;  4DSK A;  2P9U A;  4A3J C;  4GV3 A;  3F73 A;  4NYF A;  1NKC A;  4LSN A;  5KI6 A;  2JA6 C;  4YG2 A;  4CF1 A;  3ULD A;  3AO3 A;  4RW9 A;  3VQQ A;  2WFB A;  1ATS A;  1B9F A;  3DYA A;  3SPZ A;  1S1V A;  4I2Q A;  4PKI A;  4KMH A;  3TTG A;  1BQM A;  2P8T A;  3OTO K;  3KHY A;  3PLA A;  2HHQ A;  1VK0 A;  1U04 A;  1JVI A;  5EGE A;  2V51 B;  1YJ9 N;  1CXU A;  1CXQ A;  3K58 A;  4CEF A;  3EKU A;  5E26 A;  4M3R A;  3A5L C;  1YXQ A;  3HO1 A;  1Q9Y A;  2P9I B;  1SKS A;  1VQK N;  4FJH A;  2D1K A;  4NCA A;  3HKZ D;  1NGB A;  4YNQ A;  2R93 K;  3TAF A;  3SNN A;  1QZ6 A;  3DWL A;  1F93 A;  5A2Q O;  4OLA A;  1O1W A;  4BE0 A;  4DSF A;  1JKH A;  3QBX A;  5C25 A;  3W3D A;  2HHW A;  3EEQ A;  1WOS A;  1ZBI A;  1SMY A;  1C1C A;  4FLZ A;  4CHO A;  3L8B A;  3NF8 A;  1G99 A;  3E9P A;  1KQS M;  1TWG A;  3WXJ A;  3V9Z A;  4KM9 A;  1HJR A;  4BRN A;  4CGD A;  1BDF A;  3WUH A;  1HNX K;  3C6T A;  4A3D C;  4GTF A;  1W0H A;  4DSE A;  1SUQ A;  5F1X A;  3S3O A;  3VMF B;  4DV0 K;  1A5W A;  1C0T A;  4IOC L;  2ZD1 A;  3T02 A;  4CEO A;  4FPB A;  4HCC A;  3CM5 A;  2AP1 A;  3CD6 N;  4GV9 A;  4BG9 A;  5AQW A;  2KQ2 A;  4IJN A;  4FLY A;  4BR0 A;  1T3V A;  3AVI A;  2X78 A;  2CGJ A;  3UE5 A;  3CPW M;  4BY7 C;  3OJU A;  1WAF A;  3TAB A;  4E3S A;  4DR6 K;  3VN5 A;  5M1Q A;  4WE1 A;  5KRT A;  3L0Q A;  3LAN A;  1BI4 A;  4BAC A;  2E2H A;  1S1U A;  4JKB A;  1TWH A;  5K14 A;  1S3X A;  3HOZ C;  3H0G A;  2NVX A;  4KRE A;  1NGA A;  1WSF A;  3I8D A;  3WNE A;  1D9D A;  3HOT A;  1YTA A;  3S1M C;  3VGL A;  2D5R A;  2HVH A;  1I50 K;  3QER A;  4MEY A;  3QIC A;  1NJY A;  2PZS A;  2KKZ A;  5M1O A;  2UXC K;  1IV0 A;  4A3C K;  2RE2 A;  4GTA A;  2IVP A;  3OVN A;  4C3I K;  4J2E A;  3GTG K;  3LZI A;  4DU1 A;  5GIO A;  3DLE A;  4YOX A;  1L5U A;  4GTL A;  1CZB A;  4XIU A;  2RPI A;  2HND A;  4LY7 A;  3U8X A;  2QWP A;  4BE1 A;  3CER A;  3NAE A;  3VOV A;  3S1R K;  3HBT A;  4KB2 A;  2B6A A;  4FWS A;  1VQP N;  5CHP A;  1X3M A;  2I7N A;  1RCH A;  3L2Q A;  4NCG A;  2NRW A;  3M8R A;  5AZJ A;  2NVX K;  1IG8 A;  2HB5 A;  2IGI A;  4FCY A;  3KKR A;  4E1M A;  4ZHR A;  3DLH A;  2F9T A;  4H5V A;  3K7A K;  1C0F A;  1DCO A;  1X1P A;  3GTP K;  4GVM A;  2CFA B;  4FWM A;  3NFA A;  4FWN A;  5BRD A;  3T3F A;  2QTD A;  1VLO A;  4X65 K;  3OBY A;  4H0T B;  4QS7 A;  3S1N K;  1XI1 A;  3HOU C;  3AO1 A;  1TKD A;  3NF6 A;  1F21 A;  1FKO A;  4N41 A;  2YCH A;  4XLP A;  5AQH A;  1D8Y A;  5IOQ A;  4E7I A;  4QIW D;  5AFU H;  4CGG A;  3S41 A;  4CF8 A;  4HCB A;  4WQ5 A;  4CEB A;  1ASU A;  3DJC A;  3FZM A;  1KAX A;  3AO2 A;  2PA8 D;  3G4C A;  1IBL K;  1JL1 A;  1XQS C;  4CZL A;  4CES A;  4IO8 A;  1HJO A;  3U6F A;  3S9H A;  1QHA A;  1U48 A;  3SZ2 A;  1R9T C;  1HYZ A;  5M1N A;  3Q7C A;  4F4K A;  3ZSV A;  1D4X A;  4LF7 K;  3CIP A;  3QFP A;  2LSN A;  1D9F A;  1NK6 A;  4JS4 A;  1VSD A;  1NU0 A;  2ZE2 A;  3LDN A;  4KAS A;  5EOY A;  1BIU A;  3DRR A;  3ITH A;  3OS0 A;  3FZL A;  3WT0 A;  1BU6 O;  4BRQ A;  4LOW A;  4H0O A;  4XLN A;  5GAH P;  1RT3 A;  3JAM O;  4BR2 A;  4Q0B A;  2NZT A;  4CIG A;  2ZUF A;  3ATV A;  5C3E C;  3M5R A;  2HMP A;  2ASO A;  3VPZ A;  4DTO A;  4DV5 K;  1BGW A;  1YUW A;  3UKU A;  4H4M A;  1GLD G;  4IOX A;  2P9S B;  3RRG A;  1XNQ K;  5HBM A;  3SI6 A;  3QEP A;  2YI1 A;  5J2N A;  3LP2 A;  5AR0 A;  3VQ5 A;  1BIZ A;  2E2I C;  2VWJ A;  3VA3 A;  3PV8 A;  1VRU A;  3H45 C;  1HNI A;  4I6M A;  1XMQ K;  4LF6 K;  1N32 K;  3TSQ A;  4YOR A;  3CQZ C;  4JK7 A;  2YJF A;  1J6W A;  3FZK A;  3R6M A;  3V9U A;  4EP4 A;  4M3U A;  1RTD A;  3C65 A;  5EU7 A;  5FLM K;  2GWK A;  3HZ6 A;  3L2W A;  3MN6 A;  4FOI A;  3QNO A;  4FZB A;  4B08 A;  4DV1 K;  2PBD A;  1HQE A;  3EE8 A;  4Y1C A;  5HOO A;  2A6H A;  2JA5 C;  3ZT2 A;  4W5R A;  4KAZ A;  4I9Q A;  4A3M C;  4CGJ A;  5BPN A;  1WOQ A;  2OPQ A;  4BRI A;  4FJ8 A;  3I56 N;  1BGX T;  4YDU A;  1KTQ A;  3O9T A;  5ADX A;  4A3K K;  5FPN A;  3RVC A;  5HRO A;  1U6Z A;  4KAW X;  5AZJ B;  4NXN K;  4C2M C;  5KRS A;  4FK4 A;  1GOB A;  4DSI A;  3QB0 A;  4ISG A;  1ATR A;  4FSV A;  1X31 C;  3M4O K;  3THX A;  2W7V A;  4MQ3 A;  5AQP A;  1ZVU A;  3E66 A;  4OGE A;  3U3Y A;  2EX3 A;  4AM7 A;  4KHY A;  3F2K A;  2QWN A;  4ICL A;  2HHT A;  2QWQ A;  5AQI A;  3ASM A;  3RMC A;  4BBS K;  4X6A C;  1VSE A;  4C3J C;  2NRR A;  3PO5 A;  4BLA A;  1TAQ A;  3O1W A;  4KFB A;  5JVH L;  2FSK A;  3NF7 A;  3CCM N;  1WSH A;  4G9Z A;  4ISF A;  4FWR A;  4BQZ A;  3LWL A;  3PX4 A;  2O4I A;  4C3H K;  4B9T A;  4K25 A;  3T7Z A;  1BA0 A;  3GTK K;  3SAF A;  1VRQ C;  1Q8I A;  2QWM A;  4CBW A;  3BDP A;  4CF2 A;  4CHY A;  1T7P A;  1I3Q K;  3VEX A;  3OYI A;  3S3M A;  4L8R B;  1TYQ A;  3HJF A;  1NK7 A;  3D2F A;  5DMR A;  5CE3 A;  1MWK A;  5IP7 K;  1ATN A;  4C8O A;  2RKI A;  4JI4 K;  4O8K A;  1VHX A;  5HL7 L;  3HOY K;  4A59 A;  4JV5 K;  2XCQ A;  3S2H C;  4DV3 K;  1INN A;  4KN4 A;  3CCE N;  4JHD A;  2XO7 A;  3HOX C;  4FOE A;  2O4G A;  4OPJ A;  4BBR K;  4A61 A;  3OYG A;  2A5X A;  4AHT A;  4JN4 A;  4Z0U A;  5LY3 A;  3TFJ A;  4A3G C;  5AJ3 K;  1IJJ A;  1WOR A;  4AH9 A;  1I6H C;  4Y52 C;  4RW6 A;  1RT4 A;  4EFH A;  3TAN A;  1HNW K;  4DQR A;  4X64 K;  2E6M A;  2AJQ A;  3CCJ N;  3VQ8 A;  3MCA B;  3ADA C;  1QQC A;  3E01 A;  4I6M B;  4FJ9 A;  1I6V A;  3GDQ A;  2QWR A;  1VQO N;  4C1N K;  4XSX A;  3SUP A;  4H0Y B;  4A3B K;  4V19 S;  1GLA G;  4BKW A;  3SJH A;  3CJ9 A;  1NGH A;  3HM9 A;  1RT6 A;  3KLF A;  4AYB L;  1U4B A;  3WXL A;  1SFO K;  3QLH A;  4NLB A;  5C44 K;  3U9D A;  1MA9 B;  1NM1 A;  3WNG A;  3NBP A;  4EHT A;  3R9P A;  1NGE A;  3CJB A;  2W6K A;  1XNR K;  1NK8 A;  2VGN A;  3NGZ A;  1S9G A;  2PPB A;  4IWV A;  1MU2 A;  3OYB A;  4FW1 A;  4CJ4 A;  1JLG A;  1KAY A;  3VQP A;  3S1Q C;  4A3I K;  4YOU A;  1NMD A;  5C15 A;  4W5N A;  5E84 A;  2FF3 B;  3H1V X;  3FKI A;  4A3E K;  1DD5 A;  4AIL C;  1NGC A;  1C6V A;  2Y1J A;  3IAY A;  3G4A A;  3PY8 A;  1ZYQ A;  1N34 K;  2HW3 A;  2GAG C;  2ATQ A;  3NH2 A;  3N3Y A;  2E2J C;  4EP5 A;  4DU3 A;  4LFC K;  3PX6 A;  4LFA K;  3DRS A;  1O27 A;  2OPP A;  4PA1 A;  4FWO A;  4CGH A;  4Z4H A;  1RIL A;  3C0B A;  1IBK K;  3ZX3 A;  2NVY C;  3SMP A;  5FPE A;  3QNN A;  4LC9 B;  4CEZ A;  2YHW A;  3SJJ A;  4KMA A;  3J7Z O;  4H0V B;  3O9R A;  2NLX A;  4B8A B;  3O3H A;  4BRD A;  3J80 O;  1W2B M;  3DOL A;  3KTQ A;  2OTJ N;  3GTO K;  5J2M A;  3M3Z A;  4KM8 A;  3P83 D;  2OCE A;  1TYQ B;  2F9W A;  4UQG A;  4A3L K;  2QXL A;  3KVG A;  3JSM A;  3FZH A;  3D2F B;  5E41 A;  3C7N A;  2V6U A;  4ILJ A;  1BOT O;  4FYD A;  1T6D A;  4OO1 J;  3VTI A;  4A2B A;  4O5B A;  4JHD B;  1VQ6 N;  1HKC A;  1BIS A;  1WAJ A;  3AD8 C;  2VUM A;  3GTQ K;  1LW2 A;  1S22 A;  4HHT A;  3ID6 A;  4H5N A;  3A8K A;  4CCH A;  4G0V A;  4DTM A;  5HRN A;  1U47 A;  4FK2 A;  2B63 A;  2JA8 K;  2BE5 A;  1Q7Y O;  4RG8 A;  4O4G A;  3OYF A;  3FOF A;  2XRI A;  3FZF A;  5T7B A;  3QEI A;  4WFA L;  3OW2 M;  3P5J A;  3GG4 A;  4HUG A;  3AAQ A;  4H0X B;  5AQQ A;  5LJW A;  4FLV A;  4AH6 A;  1K83 A;  4CFC A;  3S2D K;  2E2P A;  1W9H A;  3SPY A;  1X9S A;  2YU9 K;  1NJZ A;  1WSE A;  3NGY A;  3DLK A;  3GEH A;  5M3F K;  1N8R O;  1Y1W A;  3QIN A;  2G8H A;  5CJ9 A;  4B9L A;  5L46 A;  1QS4 A;  4CJR A;  3I4M C;  1TWF K;  4WJ4 A;  5AZI A;  3CQX A;  1WCM K;  2VUM C;  2BH1 A;  2OPS A;  4DSL A;  3VQC A;  3K0S A;  5HLF A;  1NK9 A;  4ID1 A;  4OLB A;  3VQB A;  3MCP A;  1ZBS A;  3C6U A;  4H8K A;  4DR7 K;  4KHU A;  5BN9 A;  2Q0U A;  1DGK N;  1G51 A;  2F8S A;  3AGK A;  3BUE A;  3EZW A;  4FO0 A;  4RTF D;  3CJ7 A;  1RBT A;  3NVM A;  2E4L A;  3CME N;  1Y64 A;  5EY4 A;  1XZP B;  4BY1 C;  3LP3 A;  3CM6 A;  3P39 A;  4RW4 A;  4YOT A;  3OPF A;  1HQU A;  4LF5 K;  3VEV A;  3GEE A;  1JXE A;  4OGC A;  3LAL A;  2Q3S A;  4CF0 A;  2O5J A;  1YX2 A;  4LQY A;  1HRH A;  4JS5 A;  1N36 K;  5IYC C;  1QHT A;  2W40 A;  4CJW A;  4PL8 A;  1QVG M;  4M63 C;  1BL3 A;  5C10 A;  3NGI A;  4DWI A;  5IP9 C;  2R92 A;  4K0K K;  3QDK A;  2B4J A;  3S17 K;  4E7K A;  2NVQ C;  2X6N A;  1L3T A;  3CCL N;  1BA1 A;  5JS2 A;  3L2R A;  1ZYR A;  1LWE A;  1K6Y A;  4JK8 A;  4CZG A;  1TWC K;  2WB1 D;  1YJW N;  1S1X A;  3JST A;  3VEZ A;  3MX5 A;  2QA4 N;  5TKW A;  2ITG A;  3O08 A;  1O2A A;  2ASP A;  4Z4C A;  2CH6 A;  1KRP A;  3TAE A;  4FWQ A;  4ELV A;  4FM2 A;  3L4K A;  1TKT A;  3NH0 A;  4BDP A;  4U7B A;  3NF9 A;  1TWA K;  2P5M A;  1D5A A;  3MEC A;  2O8C B;  2PMZ L;  1HX1 A;  2EBB A;  1C0U A;  4A93 K;  1VQN N;  4IG0 A;  5M5Y K;  3ZSY A;  4P5A A;  1QE1 A;  3QX3 A;  3CHW A;  3I0R A;  4DR5 K;  1ITG A;  3ZSZ A;  3O6W A;  2HHX A;  2YNI A;  2KFN A;  4OKK A;  4CHQ A;  5SZT A;  3SUN A;  5C4J K;  3K57 A;  2R93 A;  2HF3 A;  4M41 A;  3CYM A;  2IIR A;  2D0O A;  5AQJ A;  3NH1 A;  3MXI A;  4A3F C;  5D4D A;  5C24 A;  4FL9 A;  3GTJ K;  3IPJ A;  3B6O A;  1ZBU A;  3R3L A;  5IOS A;  4KTQ A;  3AVJ A;  1JLE A;  3L3V A;  3S15 K;  4C8K A;  3HP9 A;  3S14 C;  4CGF A;  1SL1 A;  2JWK A;  3H3V D;  2V7Z A;  2GX9 A;  1VQ5 N;  4GTE A;  1BO5 O;  2HBM A;  5AZI B;  3DLL L;  2VWB A;  1NGI A;  2JA7 C;  4JI7 K;  1VRT A;  3GTL C;  3M3Y C;  1TKZ A;  2WAQ L;  3T01 A;  2DFF A;  4QIW L;  2WBN A;  3TPQ A;  2Y0S D;  4BLB A;  4KI4 A;  3TWH A;  1UV7 A;  5BPM A;  3OYL A;  1JLQ A;  4G7O A;  4YY3 K;  4A3J K;  3SZZ A;  4WCE L;  5FRM A;  5KQ8 A;  4FJJ A;  3GTM K;  3V1Q A;  2JA6 K;  4I7F A;  1KVC A;  1N6Q A;  2CFA A;  1QTM A;  3BP8 A;  4DTR A;  4G1Q A;  1EXQ A;  2D4W A;  1A5V A;  4BC2 A;  3MEE A;  3VF6 A;  3DLR A;  3C95 A;  1HR0 K;  1NG9 A;  4LK0 A;  1KXP A;  3EY1 A;  1E4G T;  4J3N A;  4KV8 A;  3M8Q A;  4LF9 K;  1TVR A;  4MO4 A;  2D6F C;  4DTS A;  1O13 A;  2VQE K;  1NK5 A;  4KHP K;  3MXM A;  2RGR A;  1FKP A;  1VSH A;  2HBL A;  3TSU A;  2WUS A;  4CFB A;  1I50 A;  4YFK A;  4JI1 K;  1XUP O;  2OZS A;  2QKB A;  2OAN A;  5CR4 A;  5AQM A;  1WN7 A;  4J8F A;  2PYJ A;  1SS6 A;  3Q7B A;  3ALY A;  3TR8 A;  4DLE A;  3N4Q A;  1U45 A;  2OTL N;  3GTG A;  1JCG A;  1HKG A;  1BQN A;  1SZ2 A;  4B9N A;  4BRO A;  4ZH4 A;  1J9A A;  1QQM A;  2IVO A;  3G0Z A;  1QSS A;  3D0P A;  4E7L A;  1GOA A;  2YNF A;  4BGA A;  2J4R A;  3RR8 A;  1TWG C;  4BRH A;  4BWM A;  1F7V A;  3GL1 A;  2BGG A;  1LWF A;  5BR8 K;  3LP0 A;  1WB9 A;  1V4S A;  1QSY A;  1WSG A;  3UKR B;  4CJQ A;  1K8K B;  2A41 A;  2GEM A;  3DAW A;  5BPL A;  3OYA A;  1I50 C;  2P9S A;  5KGW A;  4U67 L;  4KHQ A;  3H1Q A;  3R8E A;  3QET A;  5CZ2 A;  3J8A A;  4A3C C;  2NRH A;  3GIR A;  3UB5 A;  3A8I A;  3DXJ A;  2KWA A;  3GTP A;  4BY7 K;  1PJ7 A;  4FW2 A;  4OPK A;  2KFZ A;  1KFS A;  1RTI A;  4K41 A;  3ULE B;  4OKE A;  1NK0 A;  2RH6 A;  3KWI A;  3GOI A;  4ISE A;  4CEQ A;  3HVR A;  2JGU A;  3S1R C;  5IYB C;  2E2H C;  3K5N A;  4MDB A;  3TFI A;  3HOZ K;  1SKW A;  1TWH C;  3VTH A;  1WUA A;  4K42 A;  2X6S A;  2A69 A;  3H0G C;  4G7H A;  2NVX C;  3H46 O;  2O8F B;  5AQU A;  3K5M A;  1ILY A;  2R7Z A;  4RW8 A;  5ADX H;  3K7A C;  2GSU A;  4KI6 A;  2ZWH A;  3ENH A;  4BR4 A;  1OH7 A;  4LFB K;  3S1N C;  4X66 K;  1G15 A;  5FRO A;  3PO2 C;  1J53 A;  2PY5 A;  1EK8 A;  1BHL A;  4FLW A;  2NRX A;  2P9P B;  4Z4E A;  1Y97 A;  4DV4 K;  3ZX2 A;  4IXC A;  4BRP A;  3AD9 C;  4DS5 A;  2IC3 A;  4A62 A;  2PFU A;  4BY9 C;  3A5N C;  5FLX O;  2Z1G A;  1KD1 O;  2FF6 A;  5CHI A;  3AA5 X;  2NVT C;  3HT3 A;  1YT3 A;  4UY8 O;  4HWI A;  1ZC6 A;  2R7Z K;  3AO4 A;  1JLB A;  3HPG A;  4C23 A;  1P90 A;  4GY2 B;  4M3W A;  1JLA A;  2ASM A;  2IAJ A;  1KLM A;  2NUB A;  1RT7 A;  3HOU K;  3KK2 A;  3K59 A;  1SAZ A;  3KLH A;  4CBU A;  1NK4 A;  1WBB A;  3ENB A;  4RMF A;  5EXW A;  2OA8 A;  4MFB A;  5FPM A;  4E0D A;  2OZM A;  1EI6 A;  4B1Z A;  2QWL A;  4JK9 A;  4FJX A;  4WQ5 C;  5M1K A;  3ATU A;  4IO9 L;  4K43 A;  3ZT3 A;  2V7Y A;  2DTU A;  1R9T K;  4PKG A;  3IKM A;  3LAJ A;  4CK1 A;  3PIO L;  3ISN C;  4KH5 A;  1C0G A;  4PWD A;  1IS1 A;  4EIA A;  2ZGY A;  4CK3 A;  3FGU A;  2YNH A;  1NOZ A;  2V52 B;  3RSE B;  4FM9 A;  3IDH A;  2ZM6 K;  4DTP A;  1VQM N;  1FK9 A;  1ASV A;  3UIQ A;  1NGF A;  4DTJ A;  3A8Y A;  4ELT A;  4B1X B;  1S1T A;  3L4I A;  3BF3 A;  2Q31 A;  5H1S Q;  5IT9 O;  1IG9 A;  3HM8 A;  4DU4 A;  2D0B A;  3V1O A;  4A3K C;  3KLI A;  3ZEU B;  3O9U A;  4E19 A;  5HRR A;  5CYQ A;  1Y1V A;  2WON A;  5DM7 L;  1R59 O;  1NKE A;  4B3M K;  2G8V A;  1O2F B;  1WOO A;  3RWU A;  2Z1H A;  2E2I K;  3AH5 A;  3GTK A;  5SWM A;  1LOT B;  1YJN N;  4CZI A;  3CQZ K;  3M4O C;  1RU0 A;  2PYL A;  1I3Q A;  1MWM A;  4WFB L;  2PAV A;  2IOC A;  1X9W A;  1T05 A;  3L4Q A;  4E89 A;  3EKS A;  1USO A;  4CZF A;  4OX9 K;  1SQK A;  2BTF A;  4I9L A;  2DPN A;  4HVJ A;  4H4O A;  3CCR N;  2JA5 K;  3EQL A;  1RNH A;  3SUO A;  3MMV A;  3BUZ B;  1FXX A;  3M1F A;  1EWR A;  4CHP A;  3ORE A;  4WJ3 M;  3VEN A;  3LPT A;  3RMD A;  5J2P A;  4FJM A;  4FVU A;  1QQO A;  3WQU A;  4O44 A;  5AQN A;  2YKM A;  4FXD A;  4YDU C;  1JCF A;  4C3H C;  2Q97 A;  3TAR A;  3GTK C;  1Y1V K;  2ZJP L;  4Q4Z A;  3VF4 A;  3ZYY X;  3T1A A;  2W41 A;  5C42 A;  1C1B A;  3CC4 N;  3CXC M;  4YHH K;  2ZFZ A;  2E6L A;  5BRE A;  3SK3 A;  2RN2 A;  1J98 A;  1EFW A;  4F3O A;  1C0M A;  2CW0 A;  4X6A K;  2I5J A;  3MED A;  1T8E A;  4CZE A;  3CCQ N;  3VQ6 A;  1TGO A;  5HP1 A;  4CZJ A;  1TUY A;  1SFO A;  2YKN A;  1DKG D;  4JI3 K;  1GLJ O;  3VQE A;  4CJS A;  1J6V A;  3O3F A;  4EZ6 A;  4BG8 A;  4M3Z A;  1F9N A;  3AVB A;  2B5J A;  1EO1 A;  1SL0 A;  3ZT1 A;  4DUY K;  4GTB A;  1O2B A;  3HVT A;  1WSR A;  5J2Q A;  4ILH A;  3IG1 A;  4CJU A;  4H5R A;  2CH5 A;  4F9O A;  3SQ2 A;  4G0U A;  2EWS A;  2HHS A;  4KTZ A;  4DV6 K;  4K8Z A;  4BRF A;  3PO4 A;  4H5T A;  3CCV N;  2G8U A;  4N56 A;  3P31 A;  2NRZ A;  4FZY A;  3SUQ A;  4CEC A;  1NJI O;  1GLE G;  3QEX A;  4F2R A;  4MDA A;  1B4A A;  2D0P A;  1IH7 A;  3DXK B;  1IKV A;  2ZGZ A;  3N0C A;  1PJ5 A;  5IOR A;  4CIF A;  1ASW A;  3DM2 A;  3L2U A;  1YNJ A;  3O4W A;  1I6H K;  2XCO A;  3QEV A;  2ZF5 O;  2QK9 A;  4DR3 K;  1HNZ K;  3K9K A;  3THV A;  2VQF K;  4CJF A;  5GAD P;  2E2Q A;  4A3I C;  3L3U A;  4DS4 A;  1A5X A;  2E1Y A;  3ZSR A;  3LAP A;  3ZET B;  3GTO A;  1YHQ N;  1EKE A;  4FZX C;  4A3E C;  3MWP A;  4XCH A;  3RZO C;  4FJG A;  1LWC A;  5JLH A;  3VGK A;  4B9M A;  3SLC A;  2KHO A;  4WFN L;  4LJZ A;  2GSO A;  1XZP A;  3OYH A;  3SCX A;  4KKO A;  3L4J A;  3GSI A;  4NYN A;  4LH5 A;  4N5S A;  3WNF A;  3NUH A;  1SKR A;  5JVG L;  3M6G A;  5I42 A;  3GTQ A;  3S16 K;  3S1Q K;  5JS1 A;  4FZZ A;  3CC7 N;  1J54 A;  3AV9 A;  2XHB A;  3V1R A;  4Z4I A;  3Q3Q A;  3H3N O;  2P51 A;  3MWT A;  4AHC A;  3HOW C;  1B92 A;  4MEX A;  3W0L A;  3FKI C;  4A2A A;  4M3T A;  2UXD K;  4Y0W A;  3T1H K;  4KB1 A;  3V4G A;  3QIP A;  3NE6 A;  4DF4 A;  2YU9 A;  1REV A;  2HMI A;  4JD2 B;  3K5O A;  4CJP A;  2VG6 A;  5AQS A;  4DFP A;  1KQ4 A;  1BJT A;  4OIR A;  4AHR A;  3EO3 A;  1Q82 O;  2NRV A;  1BCO A;  4KB0 A;  1TWF A;  1XC3 A;  5ELZ A;  1L3S A;  1WCM A;  3GTQ C;  5IYD K;  2NVY K;  1KAZ A;  1GOC A;  3AVF A;  3OYM A;  3WXI A;  3ZSX A;  2O8C A;  4QJV B;  5M3M K;  1LAW A;  2JA8 C;  1XZQ A;  1HQM A;  2QKK A;  4JNE A;  5TKY A;  4KAT A;  3CF5 L;  2F4V K;  1JLC A;  3CI5 A;  4XH4 A;  4M7X A;  4CER A;  3A0I X;  4CIE A;  3QES A;  5CZ1 A;  5C4X K;  1RDU A;  2G8W A;  5B8H A;  1RBR A;  3FLC O;  3VQD A;  1CLQ A;  2A6E A;  1MDU B;  2VCP A;  5AQR A;  2GTD A;  1Z26 A;  2YHB A;  2YX6 A;  4KN7 A;  4QCL A;  1N5Y A;  4P5B A;  5EGH A;  3O9Q A;  4FM1 A;  4F2S A;  3TFH A;  3HKZ L;  3B6P A;  4CD3 A;  5AQZ A;  3F9M A;  2Q2R A;  3K9J A;  1TWF C;  1WCM C;  1OKJ A;  2P9L B;  1S1W A;  4JAX A;  4Y7N C;  2BUP A;  4MLE A;  3PO3 K;  2E2N A;  1OVQ A;  5I9E B;  1X3N A;  3TTF A;  2B63 C;  1W97 L;  3AAR A;  3KLG A;  3LM9 A;  3MN9 A;  1K9M O;  4LF4 K;  4IOA L;  4A57 A;  3PSI A;  3LPX A;  3KWG A;  1XC9 A;  4OIQ A;  3BZK A;  1OH5 A;  5C2F A;  4LLG A;  2P5G A;  4E7J A;  2YHX A;  1HI9 A;  1K83 C;  4FM0 A;  1WSJ A;  5AQK A;  1T6C A;  1BS2 A;  1RDA A;  4X62 K;  3OYK A;  4MQ9 A;  5JIC A;  1TWC A;  4WIL A;  3KJV A;  5LL6 Z;  4JI8 K;  3VF2 A;  4FJN A;  3K5L A;  2A42 A;  2VG5 A;  3O4Q A;  1C0A A;  1VSK A;  4J2A A;  1TK5 A;  1Y1W C;  3LPU A;  1ZBF A;  1OH6 A;  2CGK A;  4GTC A;  5AQO A;  3VQA A;  1Q18 A;  3LDP A;  4IG3 A;  4JI5 K;  3ZT4 A;  4DHY A;  4DB3 A;  1EQR A;  3ZSW A;  1TWA A;  5F2R A;  1X9M A;  5AQV A;  2A1S A;  4GVE A;  4AYB D;  5BRH A;  3MX2 A;  4WF9 L;  2WOM A;  4IEE A;  3T69 A;  1ZBH A;  4HTU A;  1IL2 A;  4NOI A;  3RZD C;  2KTQ A;  2JH3 A;  1QQN A;  3S3N A;  1KCF A;  3FOE A;  1GLL O;  3I8B A;  3VET A;  1Q9X A;  4BXX C;  3GTJ A;  5HRP A;  5M5X K;  1HKB A;  3O5B A;  5I3U A;  4R5P A;  2JLE A;  5FDL A;  3LDO A;  4H5W A;  3N4P A;  1IBM K;  2Y1I A;  4Z94 A;  4P9S A;  3F9K A;  4CHN A;  1TWA C;  2G8K A;  1YIT N;  4KMD A;  3AVH A;  1VSL A;  3JXU A;  3QFU A;  3CCU N;  4B3O A;  1XXC A;  3UKR A;  4A93 C;  1NMN A;  1K8K A;  1C1A A;  5LMU K;  3CFP A;  1XZQ B;  1RTH A;  5DM6 L;  4FJL A;  2G8I A;  4CJV A;  2NVQ K;  5C4J C;  5LJV A;  3RR7 A;  2R92 C;  1JOE A;  3MAQ A;  3HOV C;  1CZA N;  3OBW A;  2W42 A;  2O8D B;  4EHU A;  3H08 A;  4FJI A;  3GTM A;  3OYN A;  3I4N C;  1F7U A;  2JA6 A;  3DXM A;  2W6L A;  3LAM A;  3HK2 A;  3C94 A;  4RWT A;  4H03 B;  4BE2 A;  5AQG A;  3SAH A;  2HBK A;  3S15 C;  3DI6 A;  3ULE A;  4CI6 A;  1JQW A;  3MML B;  4AF1 A;  1M1K O;  4BVO A;  4DTX A;  4J2D A;  4DDQ A;  4JKA A;  2P9K A;  4AQY K;  2IS3 A;  4WQ4 A;  4LF8 K;  4DR4 K;  3IFR A;  1M90 O;  4AHU A;  2GUP A;  5EX5 A;  1HYV A;  3TTC A;  3BY5 A;  1JXB A;  2KLA A;  1LAV A;  1GE9 A;  5AQX A;  1Q86 O;  2O8F A;  4FLU A;  1ZXO A;  4CW7 B;  1JJ2 M;  4ZTJ A;  4CGI A;  4PL7 A;  4PQU A;  3O8M A;  4FLT A;  1IKY A;  4LH4 A;  3OEP A;  4A3F K;  3DMJ A;  3GTM C;  4OJR A;  2R93 C;  3HXM A;  1TAU A;  3J7A P;  4LD0 A;  5GIN A;  2DFH A;  2PA8 L;  1CZ9 A;  2Q1N A;  4FPA A;  1X9J A;  2DY4 A;  3RTV A;  3FE1 A;  1XMO K;  3S14 K;  5AQL A;  4JYA K;  2XY7 A;  5KQD A;  3NDK A;  3ZSQ A;  3I0S A;  3RMB A;  2VYP A;  3WXK A;  4B9Q A;  2P9P A;  4WQ4 C;  3IS9 A;  3EN9 A;  4NCB A;  2HVI A;  3AA4 A;  1O26 A;  2JA7 K;  1I39 A;  3O4N A;  3GTL K;  3M3Y K;  2A3Z A;  1NJX A;  4GZY A;  1NGG A;  2FQT A;  3V81 A;  4KBO A;  1ESV A;  3SV4 A;  3JS6 A;  1WSV A;  4KRF A;  4CBX A;  2GWJ A;  1RT1 A;  4DQI A;  2E2O A;  4B9U A;  1IE0 A;  1I94 K;  2GEL A;  4Z4F A;  4B1U B;  4DQP A;  3I33 A;  4L3Q A;  3F5T A;  4M45 A;  4C8M A;  4XH1 A;  4E1N A;  4FWP A;  4CJ3 A;  1IBA A;  3PUF A;  3SBT A;  1IKX A;  2HF4 A;  4CJL A;  1HNV A;  4QAG A;  1E3M A;  5AQY A;  3DOK A;  4AM6 A;  2P9N A;  4DG1 A;  3BP8 C;  1WBD A;  3HOS A;  4DSJ A;  1UA0 A;  3HRG A;  3U4L A;  3MDQ A;  3ZT0 A;  3HL8 A;  4BC4 A;  3T00 A;  3O9S A;  4JI2 K;  2ETJ A;  2FBX A;  3OYD A;  4FJ7 A;  4CJ7 A;  4DQQ A;  1U2V A;  4A3D K;  4RCH A;  2XY5 A;  1AB4 A;  4O0J A;  4O5F A;  4NB4 A;  1USM A;  4C8L A;  3V9S A;  1PJ6 A;  4OIO A;  1UOC A;  4B1W B;  1S6Q A;  4E7H A;  2RF2 A;  2GBZ A;  3AVM A;  4EZ9 A;  5AQT A;  3NVK A;  4I2P A;  4ZTF A;  3A5M C;  2HNZ A;  3CMA N;  1TV6 A;  5J1E A;  3CPE A;  4BVP A;  3AQP A;  3TU5 A;  1RBV A;  5KGX A;  1HPM A;  1XHZ A;  3ID8 A;  2E1Z A;  3OS2 A;  3LP1 A;  1NNE A;  3DXM B;  3RSE A;  4C3I C;  3GTG C;  3KLE A;  1HLU A;  3QIO A;  1TUU A;  4AHV A;  1TWG K;  3SQ1 A;  1XHX A;  3G10 A;  4KH6 A;  3VEW A;  4PAA A;  4BR7 A;  2FQO A;  3THW A;  3ZLJ A;  1RDB A;  4BDY A;  4FJ5 A;  4BRL A;  2P9K B;  5F0X A;  4N76 A;  5JMV A;  3ENO A;  1KC8 O;  3ZEU A;  4M3Y A;  3CET A;  4JKG A;  1O24 A;  1JLF A;  3S1M K;  2EHG A;  2FBT A;  4OVL A;  1IKW A;  1YI2 N;  4B9S A;  2P9U B;  4YOW A;  1JL2 A;  3VQ7 A;  2P5O A;  4FLX A;  5C2D A;  4QS9 A;  5KPT A;  3IRX A;  3GTP C;  2PMZ D;  4KHN A;  1DLO A;  4O55 A;  3SZY A;  1NKB A;  5JFE A;  2FBV A;  4NLC A;  5IYB K;  1O25 A;  3SV3 A;  2E2H K;  4QS8 A;  1NOY A;  1TWH K;  2HBJ A;  3GDZ A;  1IO2 A;  2VGM A;  3AVL A;  4H0P A;  3GE1 A;  2Z1J A;  4IDH A;  4CVN E;  2A1R A;  3H0G K;  1SV5 A;  1RT2 A;  3VA0 A;  1L3U A;  5E68 A;  1R9T A;  5KPZ A;  2UYT A;  3VES A;  4W5T A;  2R7Z C;  3RRH A;  4HUE A;  3L6Q A;  1EX4 A;  1KVB A;  3IMX A;  5KPR A;  1IQ0 A;  4XEI A;  4BRC A;  3HP6 A;  1S6P A;  3KD1 E;  3HXA A;  3PO2 K;  3U9Z A;  2WAQ D;  2P9N B;  4OPH A;  4YOY A;  3CFR A;  3IUC A;  4GTD A;  3CFO A;  4DQS A;  4FJK A;  4Z4G A;  2Z1I A;  3J7Y P;  4CK2 A;  2IDO A;  1TL1 A;  3THY A;  5BRF A;  2FLO A;  4CD1 A;  1U2V B;  1VH2 A;  3D2E A;  2NVT K;  4GV6 A;  3MN5 A;  3OYC A;  4B1V A;  4E1J A;  3VQ4 A;  4JKF A;  4GKJ K;  5FPD A;  2E2I A;  2HOE A;  3CQY A;  3OJS A;  1DT9 A;  3TSP A;  3V6D A;  1DCP A;  5MLC Q;  3CQZ A;  3OYJ A;  1NWK A;  3QBW A;  1HPZ A;  2JWL A;  5C0Y A;  1GLC G;  3CAG A;  1RT5 A;  1TK0 A;  1T44 A;  5KTQ A;  3TAQ A;  1BI4 B;  4YFU A;  5FLM C;  2JA5 A;  3LZJ A;  3HTV A;  3OYE A;  4CEE A;  3V4I A;  1TL3 A;  3THW B;  3T19 A;  1EET A;  3DXK A;  3AVA A;  5JVO A;  5C3E K;  3AVC A;  1KFD A;  3FR0 A;  4CHZ A;  2GUI A;  1WQG A;  1YTU A;  3LM2 A;  4BC5 A;  4DV2 K;  4XSZ A;  2KW4 A;  4JKG B;  1SL2 A;  1GLF O;  3EZ5 A;  3ZCM A;  4O8U A;  4GW6 A;  1BUP A;  1BWF O;  4LSL A;  2QEX N;  4IDK A;  3OS1 A;  3CJC A;  4ID5 A;  3ZET A;  1XPP A;  1R0A A;  4XH5 A;  1ZQ1 C;  4B1Y B;  4BRE A;  1RFQ A;  1S5J A;  2A6A A;  4R79 A;  4GT9 A;  3FFI A;  4CFD A;  4CZM A;  4Q5V A;  3HSC A;  1EQY A;  2ZJR L;  3AA3 A;  3CG7 A;  2VG7 A;  3NCI A;  5IWA K;  3FHZ A;  3OY9 A;  4DR2 K;  4BBS C;  3EE9 A;  3G4S N;  4DFJ A;  2H3G X;  1BG3 A;  4A3M K;  3O1B A;  3KZB A;  4BRK A;  3ERE D;  2YJE A;  1J5E K;  1RBS A;  1V5V A;  3K2P A;  1LW0 A;  1Y1V C;  4G7Z A;  3DRP A;  2GAH C;  4Q5S A;  1U49 A;  2F96 A;  3GBT A;  4C2M K;  2FC0 A;  2ZJQ L;  1OVY A;  5EVZ A;  1T03 A;  3A8J A;  2QM1 A;  2O8E A;  1I3Q C;  3H6E A;  2ITM A;  3ZSO A;  5AFU A;  4DFM A;  2XY6 A;  2BE2 A;  3SBG A;  2D0A A;  3DLG A;  5IP7 C;  3HI0 A;  4JI6 K;  4B3R K;  1IW7 A;  4C3J K;  5LMN K;  2I7P A;  3HOY C;  4JD2 A;  1RTJ A;  4DCH A;  5BN8 A;  4KMU A;  3THY B;  4BBR C;  4G0W A;  4DKW A;  2QI2 A;  3AA2 A;  3D2E B;  1Z25 A;  4M7Y A;  5CYM A;  4ILD A;  4JK1 A;  3VEY A;  2F7T A;  3PX0 A;  5TMC A;  4JLH A;  4TSX A;  4QJV A;  2FBY A;  3MXJ A;  5IOT A;  3E9L A;  3VGM A;  4CJE A;  2UXB K;  2DFE A;  2BDP A;  3BEX A;  2XCR B;  4CJ5 A;  1DEJ A;  4NO7 A;  2UU9 K;  3LAK A;  4AHS A;  4PKH A;  5FRN A;  1VSJ A;  4WYB A;  4A3B C;  2E88 A;  4O2D A;  1YAG A;  1DCH A;  4DUZ K;  4B9V A;  1L0W A;  4A5A A;  3V9X A;  4HUF A;  1WQH A;  3S2H K;  4F8R A;  1WLJ A;  4B8C A;  2E5L K;  4C45 A;  1SFO C;  5AQF A;  4BC3 A;  2HHU A;  3HOX K;  4CJT A;  5C44 C;  4CZK A;  1QZ5 A;  2QXF A;  2ZUE A;  3UKU B;  3D7E O;  4OPA A;  2P9L A;  4IKF A;  1EWQ A;  1RGI A;  4A3G K;  3N0B A;  2O5I A;  4Y52 K;  1QVF M;  1ZBL A;  4CZH A;  4JRP A;  1J6Z A;  1GLB G;  3WXM B;  1XXB A;  3C6H A;  2XY8 A;  5M1F A;  1B4B A;  1EH1 A;  3G71 N;  5DK5 A;  3SQ4 A;  1NGJ A;  1W7A A;  4KC6 A;  4IZ9 A;  1H1V A;  2FSN A;  3S0X A;  2O8B A;  1HMV A;  1S9E A;  1RDD A;  4KHS A;  4O0I A;  1UAX A;  1VSF A;  2UUA K;  1WQF A;  2E20 A;  4GFQ A;  4BR5 A;  1YNN A;  3MK6 A;  4GKK K;  4KPY A;  2WB1 L;  3S16 C;  2NVY A;  4GNI A;  1L3V A;  3H3O B;  4PUO A;  4EAH D;  1S72 N;  2FSJ A;  3LL3 A;  4CEA A;  3THX B;  3A2F A;  1TK8 A;  1WIH A;  1VQ9 N;  2YNG A;  4IFE A;  3VEO A;  1YIJ N;  2UUB K;  3RZO K;  4DMN A;  4KDD A;  4JKE A;  1ISE A;  4PHT X;  2O8E B;  3GTO C;  3LDS A;  4F3T A;  1BCM A;  4FWL A;  1VQL N;  1LV5 A;  4K8X A;  4GMJ B;  3KK7 A;  3LWM A;  5C12 A;  2HNY A;  4A3L C;  1J6X A;  5M5W K;  5D3G A;  4B3S K;  3E1Y A;  4DV7 K;  4PY5 A;  2Q36 A;  4FK0 A;  4CF9 A;  3CJ1 A;  4KTW A;  2WC9 A;  1E4F T;  1O28 A;  2E2J K;  4OIN A;  2PHC B;  1UWB A;  1OH8 A;  2Q0R A;  2QWO A;  4DFK A;  4KHW A;  4DQ8 A;  3BZC A;  1V4T A;  1VGX A;  5IYD C;  3B8A X;  1XWL A;  4BRM A;  4JI0 K;  4BRG A;  2A40 A;  3SQ0 A;  3NHG A;  4JEP A;  4NXM K;  2YHY A;  1Z6R A;  3AO5 A;  5HL8 A;  3C6A A;  1YCL A;  4J2B A;  3HOW K;  2YV0 X;  3D6R A;  3FKI K;  3H3V L;  3D45 A;  3P4I A;  3BF1 A;  2RHK A;  1UA1 A;  3HYF A;  5HRS A;  1DTQ A;  2VWK A;  4ILG B;  2V6T A;  5C4X C;  3GEI A;  4QOZ B;  2O8D A;  3AVN A;  1VSI A;  4LR2 A;  4JKH A;  1NBW A;  2AA4 A;  3HPO A;  3S2D C;  2Y0S L;  4JRQ A;  1NJW A;  4IBN A;  2YU9 C;  1VAZ A;  3P38 A;  1JCE A;  4CFA A;  2FXU A;  3TAG A;  3P1G A;  3OHR A;  3WOD A;  3TAP A;  4M1X A;  4YFN A;  4BWJ A;  4KAR A;  3TAM A;  2X74 A;  1NGD A; 
#chains in the Genus database with same CATH homology
 3VER A;  3D2F A;  1BDG A;  3G6E N;  5CE3 A;  4A62 A;  1MWK A;  5GIN A;  2PFU A;  1ATN A;  4BY9 C;  3A5N C;  1YF5 L;  2Q1N A;  4O8K A;  4FPA A;  1KD1 O;  1X9J A;  2FF6 A;  3FE1 A;  5HL7 L;  1YVN A;  4A59 A;  5CHI A;  2IVN A;  5AQL A;  4UY8 O;  2XCQ A;  4HWI A;  1ZC6 A;  5KQD A;  5M1P A;  2VYP A;  3WXK A;  4B9Q A;  2P9P A;  4JHD A;  3CCE N;  3WEE A;  4WQ4 C;  4FOE A;  4C23 A;  1P90 A;  3EN9 A;  4GY2 B;  2ASM A;  4A61 A;  3G25 A;  1O26 A;  1RDW X;  2A5X A;  4JN4 A;  3E9O A;  2A3Z A;  1NGG A;  4KBO A;  1ESV A;  4YOV A;  5LY3 A;  1SAZ A;  3OA9 A;  2GSN A;  3JS6 A;  4CBU A;  3ENB A;  1IJJ A;  2GWJ A;  4CBX A;  5EXW A;  2E2O A;  4EFH A;  3O80 A;  5FPM A;  4HTL A;  2GEL A;  4B1U B;  3I33 A;  3CCJ N;  3MCA B;  4L3Q A;  4B1Z A;  3F5T A;  3BUE A;  2QWL A;  4I6M B;  4JK9 A;  4XH1 A;  3VA7 A;  3GDQ A;  2QWR A;  4FWP A;  4C1N K;  1VQO N;  4WQ5 C;  3SBT A;  5M1K A;  3ATU A;  4H0Y B;  3CCS N;  2HF4 A;  4K43 A;  4IO9 L;  2V7Y A;  1VQ8 N;  1GLA G;  5AQY A;  3SJH A;  4BKW A;  4AM6 A;  1XXA A;  2P9N A;  4PKG A;  3CJ9 A;  2P9I A;  3IKM A;  3LAJ A;  3HOS A;  1NGH A;  3PIO L;  3HRG A;  3U4L A;  3MDQ A;  2E8A A;  4KH5 A;  3WXL A;  4BC4 A;  4NLB A;  1C0G A;  1O29 A;  3O9S A;  1IS1 A;  4EIA A;  3FFK B;  3U9D A;  1Q81 O;  2ZGY A;  3FGU A;  3QML A;  1MA9 B;  4CJ7 A;  2V52 B;  1NM1 A;  1U2V A;  4EHT A;  4RCH A;  3R9P A;  1NGE A;  3CJB A;  1AB4 A;  3RSE B;  4MO5 A;  1NLV A;  4NB4 A;  4O5F A;  1VQ4 N;  3IDH A;  4FM9 A;  2VGN A;  4BRA A;  1VQM N;  5GAG P;  4IWV A;  1NGF A;  1K73 O;  3I55 N;  2Y3P A;  3A8Y A;  2QW9 A;  3ZX0 A;  4B1W B;  2NRT A;  4B1X B;  2HST A;  1KAY A;  5AQT A;  3NVK A;  1VQ7 N;  3AAP A;  4YOU A;  4IEI A;  1NMD A;  3A5M C;  3L4I A;  5C15 A;  3BF3 A;  5E84 A;  2Q31 A;  3CMA N;  5H1S Q;  3AQO A;  2FF3 B;  3H1V X;  3HM8 A;  3CPE A;  3FKI A;  4BVP A;  3AQP A;  3TU5 A;  3AY9 A;  3ZEU B;  3O9U A;  1DD5 A;  1HPM A;  3ID8 A;  2E1Z A;  1NGC A;  1Y1V A;  5JLF A;  5DM7 L;  1R59 O;  1P8Z A;  3DXM B;  3RSE A;  4C3I C;  3G4A A;  1HLU A;  3AH5 A;  3GTK A;  1TUU A;  3NMU A;  4MLH A;  1LOT B;  4KH6 A;  3VEW A;  4CZI A;  1YJN N;  1LCU A;  4BR7 A;  3N3Y A;  1I3Q A;  1MWM A;  3AGR A;  3WQT A;  4WFB L;  2PAV A;  3SAG A;  3L4Q A;  2P9K B;  3C7N B;  1HUX A;  4BRL A;  5F0X A;  3MN7 A;  1O27 A;  4KB4 A;  3EKS A;  4FWO A;  3ENO A;  4IJA A;  5JMV A;  3PIP L;  3C0B A;  3SMS A;  4CZF A;  1KC8 O;  3ZEU A;  1SQK A;  2BTF A;  2DPN A;  3CET A;  3ZX3 A;  3CCR N;  4JKG A;  3SMP A;  5FPE A;  4LC9 B;  1O24 A;  4FWK A;  2YHW A;  4KMA A;  3J7Z O;  5BR9 A;  3MMV A;  3BUZ B;  4H0V B;  3M1F A;  3O9R A;  3ORE A;  2NLX A;  2OTJ N;  1W2B M;  4BRD A;  1YI2 N;  3VEN A;  4BGB A;  4KH4 A;  4FVU A;  3M3Z A;  2P9U B;  3R1X A;  4YOW A;  4KM8 A;  4JKD A;  3LDL A;  1TYQ B;  2F9W A;  1QQO A;  3WQU A;  2QXL A;  3KVG A;  4BQL A;  5AQN A;  5C2D A;  2JA7 A;  3FZH A;  3D2F B;  4YDU C;  1JCF A;  1Z05 A;  4QS9 A;  5KPT A;  4C3H C;  2Q97 A;  3C7N A;  3GTL A;  4ILJ A;  5JFE A;  4JKC A;  2ZJP L;  2CGL A;  4NLC A;  1BOT O;  3VF4 A;  4A5B A;  1O25 A;  1T6D A;  3CJA A;  3ZYY X;  4QS8 A;  5GIP A;  1K8A O;  3A5O C;  4OO1 J;  2W41 A;  3VTI A;  2HBJ A;  3LDQ A;  4BR9 A;  3CC4 N;  3TTD A;  2VGM A;  4H0P A;  4A2B A;  5GAE P;  3GE1 A;  4JHD B;  4IDH A;  3WEE B;  4C1N I;  3CXC M;  3CC2 N;  1HKC A;  1VQ6 N;  3EL2 A;  2NNW A;  2ZFZ A;  5TJ3 A;  2P9U A;  5BRE A;  4GV3 A;  3SK3 A;  2VUM A;  1S22 A;  3ID6 A;  4H5N A;  4G0V A;  2B63 A;  1R9T A;  4CZE A;  5KPZ A;  3CCQ N;  2UYT A;  1ATS A;  2WFB A;  3VES A;  4CZJ A;  1Q7Y O;  1TUY A;  4KMH A;  4PKI A;  1SFO A;  1DKG D;  3L6Q A;  3FOF A;  3FZF A;  1GLJ O;  3IMX A;  4WFA L;  3OW2 M;  3GG4 A;  3AAQ A;  4H0X B;  5AQQ A;  3KHY A;  5LJW A;  3PLA A;  5KPR A;  1K83 A;  5EGE A;  4XEI A;  4BRC A;  4BG8 A;  1F9N A;  2V51 B;  2E2P A;  1YJ9 N;  1EO1 A;  3U9Z A;  3EKU A;  5E26 A;  4GTB A;  2P9N B;  1YXQ A;  3A5L C;  4OPH A;  1O2B A;  2P9I B;  4ILH A;  4YOY A;  4GTD A;  3IUC A;  4H5R A;  1VQK N;  2CH5 A;  4F9O A;  1N8R O;  2D1K A;  1Y1W A;  4G0U A;  1NGB A;  5CJ9 A;  2EWS A;  5AZI A;  3CQX A;  4BRF A;  2BH1 A;  5BRF A;  2FLO A;  1QZ6 A;  3DWL A;  4H5T A;  3CCV N;  4CD1 A;  1U2V B;  3D2E A;  3P31 A;  3QBX A;  4GV6 A;  3W3D A;  3MN5 A;  2NRZ A;  3MCP A;  4B1V A;  4E1J A;  1ZBS A;  4JKF A;  5FPD A;  1NJI O;  2E2I A;  1GLE G;  2HOE A;  3CQY A;  1G99 A;  3E9P A;  5BN9 A;  1DT9 A;  2Q0U A;  1DGK N;  3TSP A;  1KQS M;  1TWG A;  5MLC Q;  3WXJ A;  3CQZ A;  4KM9 A;  4MDA A;  3AGK A;  1NWK A;  3QBW A;  4BRN A;  2D0P A;  1B4A A;  3DXK B;  2JWL A;  5C0Y A;  2ZGZ A;  3WUH A;  3EZW A;  4FO0 A;  4RTF D;  3CJ7 A;  3N0C A;  5IOR A;  1GLC G;  4GTF A;  3O4W A;  3NVM A;  3CAG A;  5F1X A;  3CME N;  1Y64 A;  5EY4 A;  3VMF B;  2XCO A;  1T44 A;  2ZF5 O;  4IOC L;  3K9K A;  3P39 A;  4YOT A;  3OPF A;  2JA5 A;  5GAD P;  2E2Q A;  4FPB A;  2E1Y A;  3HTV A;  3LAP A;  3ZET B;  3VEV A;  1YHQ N;  3GTO A;  2AP1 A;  3CD6 N;  4GV9 A;  3MWP A;  4BG9 A;  5AQW A;  4IJN A;  4BR0 A;  1T3V A;  3DXK A;  5JVO A;  2CGJ A;  5JLH A;  3VGK A;  4LQY A;  3FR0 A;  3SLC A;  3UE5 A;  3CPW M;  1WQG A;  2KHO A;  3LM2 A;  4BC5 A;  4WFN L;  2GSO A;  2W40 A;  5M1Q A;  4JKG B;  4PL8 A;  1GLF O;  1QVG M;  3L0Q A;  3L4J A;  4O8U A;  4M63 C;  1BUP A;  1BWF O;  2E2H A;  5C10 A;  2QEX N;  2R92 A;  4JKB A;  1TWH A;  3CJC A;  3QDK A;  3ZET A;  4XH5 A;  3NUH A;  4B1Y B;  4BRE A;  5JVG L;  1S3X A;  1BA1 A;  1RFQ A;  2A6A A;  4R79 A;  3M6G A;  3CCL N;  4GT9 A;  3H0G A;  4JK8 A;  4CZM A;  4CZG A;  3HSC A;  3GTQ A;  2NVX A;  1EQY A;  1YJW N;  1NGA A;  2ZJR L;  3HOT A;  3VEZ A;  3MX5 A;  2QA4 N;  3VGL A;  3CC7 N;  5TKW A;  3O08 A;  3QIC A;  1O2A A;  2ASP A;  3Q3Q A;  3FHZ A;  2CH6 A;  3H3N O;  4FWQ A;  3EE9 A;  2KKZ A;  3G4S N;  2H3G X;  3MWT A;  5M1O A;  1BG3 A;  3L4K A;  3O1B A;  3W0L A;  2RE2 A;  3KZB A;  4A2A A;  4GTA A;  2IVP A;  4BRK A;  4U7B A;  3ERE D;  2P5M A;  2YJE A;  4Y0W A;  5GIO A;  4YOX A;  3V4G A;  4GTL A;  1HX1 A;  2YU9 A;  1VQN N;  3U8X A;  2QWP A;  3GBT A;  3CER A;  4JD2 B;  4P5A A;  3QX3 A;  5AQS A;  3CHW A;  2ZJQ L;  1OVY A;  3O6W A;  5EVZ A;  3VOV A;  1BJT A;  1KQ4 A;  3HBT A;  4KB2 A;  2QM1 A;  3EO3 A;  4FWS A;  1Q82 O;  2NRV A;  2R93 A;  3H6E A;  2HF3 A;  2ITM A;  1VQP N;  1TWF A;  5AFU A;  2IIR A;  1XC3 A;  5ELZ A;  1WCM A;  2D0O A;  5AQJ A;  5CHP A;  1X3M A;  1KAZ A;  2I7N A;  3SBG A;  2NRW A;  4FL9 A;  3WXI A;  5AZJ A;  3HI0 A;  3R3L A;  1IG8 A;  5IOS A;  4JNE A;  2I7P A;  5TKY A;  4KAT A;  4JD2 A;  3CF5 L;  2F9T A;  4H5V A;  2JWK A;  1C0F A;  3CI5 A;  2V7Z A;  4XH4 A;  4M7X A;  2GX9 A;  1VQ5 N;  4DCH A;  1BO5 O;  2HBM A;  3A0I X;  5AZI B;  2VWB A;  4FWM A;  1NGI A;  4FWN A;  5BN8 A;  5BRD A;  3DLL L;  2QTD A;  4G0W A;  1RDU A;  4DKW A;  3OBY A;  2QI2 A;  4H0T B;  3D2E B;  4M7Y A;  4QS7 A;  5B8H A;  3FLC O;  4ILD A;  4BLB A;  3VEY A;  2F7T A;  2WBN A;  3TPQ A;  2CFA B;  1MDU B;  2VCP A;  5AQR A;  2YCH A;  2GTD A;  5AQH A;  2YX6 A;  5IOQ A;  4P5B A;  5BPM A;  5EGH A;  3O9Q A;  5AFU H;  5IOT A;  3E9L A;  5AQZ A;  3VGM A;  3F9M A;  2Q2R A;  3K9J A;  4CD3 A;  3S41 A;  4WCE L;  4WQ5 A;  1OKJ A;  3BEX A;  3DJC A;  2P9L B;  5KQ8 A;  2XCR B;  3FZM A;  1DEJ A;  4JAX A;  4NO7 A;  1KAX A;  3G4C A;  2BUP A;  2CFA A;  4MLE A;  3BP8 A;  4PKH A;  1XQS C;  4CZL A;  4WYB A;  2D4W A;  2E2N A;  1YAG A;  2E88 A;  5I9E B;  4IO8 A;  1X3N A;  3TTF A;  1HJO A;  1W97 L;  3AAR A;  4BC2 A;  1QHA A;  4A5A A;  1WQH A;  3LM9 A;  3MN9 A;  3VF6 A;  1K9M O;  5M1N A;  4A57 A;  4IOA L;  3LPX A;  3Q7C A;  3KWG A;  1KXP A;  1E4G T;  5AQF A;  1D4X A;  4BC3 A;  5C2F A;  4J3N A;  3CIP A;  4CZK A;  1QZ5 A;  3QFP A;  2YHX A;  4MO4 A;  3UKU B;  5AQK A;  1T6C A;  3D7E O;  4OPA A;  2P9L A;  1O13 A;  3LDN A;  4KAS A;  5EOY A;  5JIC A;  1TWC A;  1RGI A;  3N0B A;  2RGR A;  2HBL A;  3FZL A;  3TSU A;  3VF2 A;  2WUS A;  3WT0 A;  1QVF M;  1BU6 O;  4CZH A;  2A42 A;  4BRQ A;  1I50 A;  1XUP O;  1J6Z A;  1GLB G;  4H0O A;  2OAN A;  5CR4 A;  5AQM A;  3WXM B;  5GAH P;  2CGK A;  4GTC A;  5AQO A;  4J8F A;  4BR2 A;  1Q18 A;  1XXB A;  3LDP A;  2NZT A;  1SS6 A;  3C6H A;  3Q7B A;  3ATV A;  2OTL N;  3M5R A;  2HMP A;  2ASO A;  3N4Q A;  3VPZ A;  4DB3 A;  4DHY A;  5M1F A;  1BGW A;  1TWA A;  1YUW A;  3GTG A;  1JCG A;  1HKG A;  3UKU A;  1SZ2 A;  1GLD G;  4IOX A;  2P9S B;  1QQM A;  5F2R A;  4BRO A;  2IVO A;  1B4B A;  1EH1 A;  3G71 N;  2YI1 A;  5AQV A;  4GVE A;  1NGJ A;  5AR0 A;  5BRH A;  4KC6 A;  3MX2 A;  4IZ9 A;  4WF9 L;  4BGA A;  1H1V A;  2FSN A;  3S0X A;  3H45 C;  2J4R A;  4I6M A;  4BRH A;  3GL1 A;  4IEE A;  3TSQ A;  4YOR A;  3T69 A;  4JK7 A;  2YJF A;  1WQF A;  2E20 A;  3FZK A;  1V4S A;  3R6M A;  4BR5 A;  3MK6 A;  4GFQ A;  2JH3 A;  1QQN A;  3UKR B;  3C65 A;  1K8K B;  2A41 A;  3FOE A;  2GEM A;  1GLL O;  3I8B A;  3VET A;  2GWK A;  3DAW A;  3HZ6 A;  4GNI A;  2NVY A;  3MN6 A;  3GTJ A;  5BPL A;  3H3O B;  4FOI A;  4FZB A;  2P9S A;  1HKB A;  2PBD A;  4EAH D;  3EE8 A;  4U67 L;  5HOO A;  1S72 N;  2FSJ A;  3LL3 A;  3O5B A;  1WIH A;  3H1Q A;  3R8E A;  3LDO A;  4H5W A;  3N4P A;  4IFE A;  3VEO A;  1YIJ N;  1VQ9 N;  3J8A A;  4KDD A;  4JKE A;  1ISE A;  5BPN A;  1WOQ A;  2NRH A;  4BRI A;  4PHT X;  4Z94 A;  3I56 N;  3UB5 A;  1VQL N;  4FWL A;  4YDU A;  3O9T A;  5ADX A;  3KK7 A;  2KWA A;  3GTP A;  5C12 A;  5FPN A;  1YIT N;  4KMD A;  3JXU A;  3QFU A;  3CCU N;  1XXC A;  3RVC A;  1U6Z A;  3UKR A;  3E1Y A;  1K8K A;  5AZJ B;  4KAW X;  4K41 A;  2Q36 A;  3ULE B;  2RH6 A;  4C2M C;  3CJ1 A;  3KWI A;  3GOI A;  4ISE A;  3QB0 A;  4ISG A;  1ATR A;  4FSV A;  5DM6 L;  2WC9 A;  1E4F T;  1O28 A;  4MDB A;  2PHC B;  2Q0R A;  5LJV A;  5AQP A;  2QWO A;  1CZA N;  3OBW A;  3VTH A;  4DQ8 A;  1ZVU A;  4EHU A;  1V4T A;  3B8A X;  3E66 A;  1WUA A;  4K42 A;  4BRM A;  3GTM A;  2JA6 A;  4AM7 A;  3DXM A;  4BRG A;  2A40 A;  3F2K A;  2QWN A;  4JEP A;  2YHY A;  1Z6R A;  3H46 O;  4H03 B;  5AQU A;  4RWT A;  1ILY A;  2QWQ A;  5AQI A;  5AQG A;  3C6A A;  3SAH A;  2R7Z A;  2HBK A;  4C3J C;  2NRR A;  4BLA A;  3ULE A;  3O1W A;  5ADX H;  3D6R A;  5JVH L;  4GTE A;  4CI6 A;  3MML B;  4AF1 A;  1M1K O;  4BVO A;  2FSK A;  4DDQ A;  2GSU A;  4JKA A;  2P9K A;  3BF1 A;  3P4I A;  2RHK A;  3CCM N;  4WQ4 A;  4G9Z A;  4ISF A;  4FWR A;  2ZWH A;  3IFR A;  4ILG B;  4BQZ A;  1M90 O;  3ENH A;  2GUP A;  5EX5 A;  4BR4 A;  3TTC A;  4LR2 A;  4K25 A;  4JKH A;  1BA0 A;  1NBW A;  2KLA A;  3T7Z A;  3SAF A;  2AA4 A;  1GE9 A;  2QWM A;  4CBW A;  1EK8 A;  5AQX A;  2NRX A;  1VAZ A;  2P9P B;  1JCE A;  1ZXO A;  2FXU A;  3P38 A;  1Q86 O;  3OHR A;  3VEX A;  3ZX2 A;  1JJ2 M;  4M1X A;  4IXC A;  4PL7 A;  4KAR A;  4BRP A;  1TYQ A;  3O8M A;  1NGD A;  3OEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...