1ZBSA

Crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
b'MILIGDSGSTKTDWCIAKEGKSLGRFQTSGINPFQQDRNEIDTALRSEVLPAIGQKASSIRAVYFYGAGCTPAKAPMLNEALDSMLPHCDRIEVAGDMLGAARALCGDSEGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQMPEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSFDDFLVRNVLRYNRPDLPLHFIGSVAFHYREVLSSVIKKRGLTLGSVLQSPMEGLIQYHHNNHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PG1100
publication title Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 82
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zbsA03
3CJAA 3WXJA 5AZJA 1K8KB 5AQRA 5LY3A 2D0OA 3HBTA 4WQ5C 1U2VA 5AQSA 3CJBA 2FF3B 3G25A 3BF1A 3FFKB 4K41A 2A42A 4B1ZA 3L0QA 3QDKA 2E88A 2CGKA 4BR4A 3O1BA 3O8MA 4FSVA 5AQPA 3ULEA 3LL3A 1GLDG 3VEVA 3L6QA 1WOQA 5AQNA 3VETA 4H0TB 4IXCA 4FO0A 4H5RA 3VERA 3VF4A 1MDUB 3R8EA 5AQOA 3VGMA 4QS9A 2FXUA 5EOYA 1GLEG 1S3XA 4M63C 4BRDA 5AFUA 3DXKB 3U4LA 5KPRA 3SMSA 2IVNA 4BR2A 2BTFA 3EKSA 1CZAN 4BRMA 2YHWA 1ATRA 3FZFA 5AQYA 1XUPO 4CZHA 3GBTA 5EXWA 2NLXA 3CQYA 3SMPA 3D2EA 4FWQA 2P9KA 4Z94A 3D2FB 4H5TA 3H1QA 3ZX2A 1BA0A 5JLFA 2QWLA 3FZMA 1NGHA 1Y64A 4F9OA 1YAGA 5BRDA 3WUHA 1NGAA 1Q18A 2E8AA 2WUSA 4NO7A 4B1WB 3AARA 3VOVA 5BPNA 4BG9A 4WQ5A 2E20A 2HF3A 3DAWA 4JHDA 1ATNA 5AQKA 4H5WA 5AQIA 4H0YB 4B1UB 5AQGA 3H6EA 4MO5A 4BQZA 5B8HA 5BN9A 1T6CA 1NM1A 4FWPA 1P8ZA 2ASOA 2ITMA 2IVPA 3ZX0A 3MN6A 5AQHA 3MN9A 2FF6A 4C23A 4JD2B 4Y0WA 5BN8A 2YJFA 2P9SA 3I8BA 3IUCA 1BWFO 3BP8A 1K8KA 3CQXA 2F9WA 4M7XA 3LDOA 1NBWA 4DHYA 3MDQA 4I6MA 2ZF5O 5AQFA 4MLEA 3CHWA 4IJAA 3M1FA 5BREA 2CH5A 4ISFA 3DXMB 5LJVA 1KXPA 4CI6A 5BPLA 2YJEA 3EKUA 3AY9A 3HZ6A 1HKCA 1DKGD 3WXKA 5KPZA 3A5LC 3ENOA 5JICA 5ADXH 3ZETA 3SLCA 1NMDA 3EN9A 4FWRA 5BR9A 3MN5A 1BOTO 4IZ9A 1GLCG 4K25A 3H1VX 3J8AA 2HMPA 4FWLA 4HWIA 3OHRA 2GTDA 2FSKA 2FSNA 5AQUA 3S41A 1QZ6A 2P9LB 4H0OA 4NB4A 2E2QA 2Q31A 4BRKA 2HOEA 3HI0A 4BRAA 4XH1A 1YUWA 2QXLA 1G99A 1BO5O 2V51B 3F9MA 3W3DA 2QWOA 1LOTB 4FWOA 3IDHA 1YVNA 4PKIA 1JCGA 2PAVA 4GY2B 2YCHA 4PKGA 5TKYA 2GUPA 3VEYA 2E1YA 2D4WA 3O80A 3WT0A 1OKJA 4DQ8A 5BRFA 2VYPA 3I33A 2NRHA 4IWVA 5AQTA 1NGGA 4PL7A 4MLHA 2GEMA 4CZEA 4BRGA 1NGBA 3CI5A 5AQLA 1GLJO 5AQJA 1T44A 3LM2A 2Q0UA 2QWRA 1ESVA 3CIPA 1TUYA 2YHYA 4DB3A 4BC2A 3FGUA 4BRFA 2Q2RA 2QWQA 1SZ2A 4CD1A 3KZBA 3O5BA 4FWNA 1D4XA 5FPDA 1TYQB 3H45C 3QFUA 2ASPA 4PKHA 4ISEA 2NZTA 2W41A 1YXQA 3W0LA 4H0PA 1H1VA 2AA4A 4EIAA 4K42A 2Q1NA 4RWTA 5AQVA 4B1YB 4XH4A 3L4IA 1HKGA 3BUZB 3DXMA 3WEEB 5AQWA 1XC3A 4DCHA 3CERA 1GLFO 2ZGYA 1NGFA 3HTVA 3M3ZA 3AAPA 4B1XB 4BRQA 3QBWA 1QQNA 5JMVA 4JN4A 1S22A 4BREA 4BVPA 3B8AX 2P9IB 4EHUA 4EHTA 3KHYA 3UE5A 3VGLA 3WQTA 5F1XA 1DEJA 4QS7A 3UKRA 3D7EO 3ID8A 1RFQA 1R59O 3VEXA 4BR0A 2P9LA 5AFUH 3HM8A 3WQUA 4BC4A 3GE1A 3A5MC 4J8FA 2A41A 3LDNA 4E1JA 1TUUA 3O6WA 2Q36A 4A61A 4CBWA 1BA1A 3JXUA 4BVOA 1NLVA 4MO4A 3FZHA 5E26A 5ADXA 4H0XB 4YDUA 2CH6A 4CZKA 4BRHA 2EWSA 3UKUB 4BRCA 4FPAA 5JLHA 2D0PA 3AAQA 1EQYA 3ULEB 1V4SA 2KHOA 3VENA 4FWKA 1HKBA 3VESA 4BRLA 2GELA 2OANA 3LM9A 4FOEA 5E84A 4CBUA 3MMVA 1C0GA 2IVOA 2QWMA 2VWBA 4RCHA 1ZXOA 4BR5A 4CZLA 3MN7A 1HLUA 4K43A 2QWNA 4EFHA 4PL8A 2I7NA 4AM7A 4CZFA 4BGAA 3DXKA 3QFPA 4WYBA 4EAHD 1RDWX 1BG3A 4A2AA 1MWKA 4B9QA 1X9JA 3FR0A 1BU6O 1LCUA 1QQMA 4O8KA 2AP1A 4AM6A 1Z6RA 3SK3A 3JS6A 4CJ7A 1BDGA 4CBXA 4BC3A 3GL1A 2F9TA 5FPMA 3IFRA 3HSCA 2FSJA 2P9UB 4IJNA 2HF4A 3D2FA 3A5OC 5F2RA 1DGKN 3WXIA 3A8YA 2VCPA 1HX1A 5I9EB 4JHDB 1MWMA 2PBDA 3ENHA 3VEZA 4ISGA 4BRPA 3VGKA 4WQ4A 3TU5A 1HUXA 4QS8A 1SAZA 1BUPA 1HJOA 4M7YA 4GNIA 2A6AA 5EVZA 5AR0A 2V7YA 2IIRA 2A40A 2A5XA 4BG8A 3R9PA 2P9SB 4YDUC 3ZX3A 3LDLA 1T6DA 4CZMA 3R6MA 2E2NA 5KPTA 1HPMA 3C0BA 3A5NC 3GDQA 1ATSA 2P9NB 4L3QA 5AQQA 4JD2A 3BF3A 4I6MB 3ZEUB 3FZKA 5CE3A 3UB5A 3UKUA 1V4TA 2V52B 3RSEB 2ZWHA 4IO8A 1NGDA 3U8XA 1QHAA 4HTLA 3IMXA 2YI1A 2A3ZA 3LDQA 1QQOA 2H3GX 4A62A 1KAZA 3LDPA 4B1VA 2J4RA 2GWKA 2ASMA 4FWMA 3ZETB 4H5NA 4O5FA 4BC5A 1E4FT 5AZIB 3P4IA 3VEOA 3O1WA 4H0VB 2Q97A 3C7NB 3O4WA 4BGBA 5FPEA 2P9PB 5KQ8A 3FE1A 3H46O 1NGIA 4XEIA 2E1ZA 4BRNA 1MA9B 5ELZA 3M6GA 3U9DA 3VF2A 5AQMA 3U9ZA 3VPZA 3VF6A 1KAXA 1WUAA 5EX5A 3H3NO 3VEWA 2D1KA 5AZJB 4FPBA 3ATVA 1RGIA 2P9UA 4JAXA 3BEXA 3A0IX 4CZGA 1U2VB 1IJJA 1NGJA 2GWJA 3H3OB 1Z05A 2E2PA 4FOIA 3GOIA 4WQ4C 3CETA 5FPNA 4BQLA 1ZBSA 3KVGA 3MK6A 2CGLA 4BROA 1E4GT 5EY4A 4A2BA 1NGCA 4JNEA 4LC9B 2FLOA 5AQXA 5BRHA 2V7ZA 3CJ7A 3FZLA 2QWPA 4BR7A 3QB0A 4CD3A 1GLLO 2UYTA 4XH5A 2DPNA 4KBOA 3SJHA 1JCEA 1TYQA 4BR9A 2P9NA 2QM1A 4CZIA 1GLAG 3ZEUA 2YHXA 1J6ZA 3MCPA 1JCFA 1X3MA 3RSEA 3D2EB 1C0FA 4FWSA 2P9KB 3FLCO 2E2OA 3QICA 1SQKA 2CGJA 4H03B 3EL2A 1X3NA 2QW9A 1NWKA 3QMLA 1NGEA 1XQSC 3QBXA 3CJ1A 1GLBG 3WEEA 5LJWA 4BRIA 3ATUA 3CJCA 5AZIA 2Q0RA 3O08A 1ZC6A 2I7PA 5BPMA 1KAYA 3C7NA 3TPQA 3WXLA 3DJCA 4FL9A 3UKRB 2P9PA 1QZ5A 5F0XA 2ZGZA 2P9IA 3CJ9A 4H5VA 3EZWA 3EO3A 4RTFD 5KQDA 3GG4A 1U6ZA 2BUPA 5AQZA 2W40A 1IG8A 3DWLA 4CZJA
chains in the Genus database with same CATH superfamily
3HJFA 3CJAA 1RT2A 3O4QA 5AZJA 3M8SA 1HYSA 3M5RA 1TWAA 4A3IK 3CJBA 3G25A 4DS5A 3LALA 1KVCA 3KK7A 3VQ6A 1VQON 2PA8D 2KZZA 3QDKA 4I2QA 2CGKA 3HP9A 4BLBA 3T1AA 3ULEA 1WOSA 3GTJA 1N5YA 2HNDA 3CCMN 5IOTA 3VERA 3VF4A 3C6HA 3R8EA 1JXEA 2G8VA 3G10A 4C3JK 3AVAA 1T05A 4ID1A 1Y97A 1S3XA 5HROA 4M63C 4BXXC 4YG2A 3DXKB 1SMYA 3SMSA 4BR2A 1K83C 2YHWA 1ATRA 4KREA 3QEXA 3CCEN 4KTWA 4A93C 1WQGA 4MFBA 1B4BA 2R92K 5J2PA 3ZLJA 3HVTA 3TAQA 3SJJA 3PY8A 2KWAA 3TFJA 3CQYA 1LW2A 3S1MK 2P9KA 4Z94A 3LPXA 1HPZA 1EI6A 1QE1A 2BDPA 4I9LA 3ZX2A 4XLPA 2HVIA 3P38A 4CHQA 2QWLA 3FZMA 1XZPA 2E8AA 4CJEA 4KHPK 1IQ0A 4B1WB 1Y1WC 2F96A 4PHTX 3GEEA 4CHOA 4RW7A 3OYEA 5BPNA 3THXA 3SZ2A 2E20A 4AH6A 2OTJN 3QEPA 3K9JA 2EX3A 2R7ZC 5AQGA 4CFDA 4O8UA 3LPTA 1T6CA 4FWPA 3RMBA 4OIPA 3CQZK 3VA0A 3M3YK 3G4SN 3CCSN 2V6TA 3MN6A 5JVGL 3MN9A 1J54A 3WNGA 4FJJA 4Y0WA 3C94A 4CJ5A 3I8BA 5GAHP 3PX0A 3IUCA 1FJGK 1BWFO 3CQXA 4AF1A 1U45A 1SFOC 2NVXK 4CJWA 3HOVK 4DHYA 4FLYA 3T1YK 4JK8A 4PWDA 3S16C 2YKNA 4NCGA 4C3HK 4DV5K 4IJAA 4ISFA 3FKIC 5BPLA 2HHQA 4PABA 4GV9A 3HPOA 3T01A 1MU2A 3EE9A 3A5LC 3LP1A 4FZBA 3SLCA 3EN9A 1IKWA 4CJTA 3MN5A 4DFJA 4AILC 4FJ8A 4IZ9A 1IW7A 4K25A 1L3VA 3J8AA 5SZTA 3KLHA 1T3VA 3OHRA 2GTDA 1R9TC 3QEWA 5E41A 3S1RC 2VG5A 2FSNA 5JVHL 1XXCA 4Y7NC 3ISNC 3RMAA 2F8SA 4H4OA 4PA1A 2HOEA 1TWHK 3RZDC 5C2DA 1IBKK 4BRAA 2O8CB 3S3MA 4M42A 4XH1A 1BO5O 3F9MA 3CAGA 2XY7A 4KH4A 2A69A 2ZFZA 2DTUA 4GY2B 2PY5A 3SNNA 2YCHA 3OYLA 1W97L 1BQMA 3IG1A 1U49A 1IO2A 2VYPA 3I33A 1SFOA 4MLHA 2A68A 4BY7K 3CI5A 1BL3A 5IT9O 3AVJA 3HKZL 4DR7K 2Q0UA 4A3CC 2O5IA 2YHYA 5C12A 3BP8C 2P1JA 4Y52C 3E1YA 1QS4A 4O0IA 3ZSZA 3QNOA 4ID5A 4HVJA 4J3NA 4QCLA 4JS5A 4YFUA 4OINA 5IP7K 4P5AA 2FC0A 5IWAK 4DSIA 2AA4A 2WBNA 4EIAA 4K42A 5J2QA 3AO3A 2O8BA 4KB4A 1UV7A 4A57A 3KWIA 4XH4A 3L4IA 1KCFA 3BUZB 3DXMA 1XC3A 2I5JA 3CERA 4DV6K 3NF7A 1VQKN 1XWLA 4DQSA 2ZJRL 4YHHK 4B1XB 1XI1A 3HOXK 4BRQA 3QBWA 1QQNA 1U4BA 5JMVA 4JN4A 2V6SA 4BVPA 3OJSA 3TI0A 5C0YA 2B63K 4EHUA 4Z4CA 4EHTA 3KHYA 3VGLA 5CYQA 3KK2A 1DEJA 4RW6A 3OW2M 4E7LA 3TTCA 2OTLN 4LFCK 4FJ7A 1ASWA 2P9LA 2QEXN 1D9DA 4OIOA 4GTLA 1JL1A 4J8FA 4ICLA 1O24A 3AQOA 1KVBA 4FXDA 1SS6A 2ITGA 3O6WA 4CHYA 2FBYA 3OYHA 3A8JA 3V6DA 1XZQA 3EYZA 3DRPA 3L3UA 4HCCA 3QIPA 3VTIA 1V4SA 4IKFA 3TSPA 4M41A 4FWKA 3VQAA 3S3OA 2OANA 1RBSA 2YKMA 3TSQA 3GTOC 3CD6N 2KTQA 4CBUA 3OA9A 1C0GA 4C8MA 3MEDA 1X31C 4CZLA 1ZXOA 5C4JC 2RE2A 2Z1JA 1UA1A 3SYZA 4EFHA 1WQHA 4AM7A 3CQ8A 4B9NA 4FCYA 1VSEA 4DQIA 4BGAA 4E7IA 4KHUA 3DXKA 4WYBA 2JWLA 3KIOA 4A2AA 1JLGA 4BBRK 4B9QA 4DF8A 3NVMA 3FR0A 4LD0A 4AM6A 4Q5SA 1QQCA 4ZHRA 1W0HA 1RCHA 1V5VA 3SQ4A 2F9TA 4CF9A 3HSCA 1VSDA 2FSJA 3OYMA 2X6NA 1VRTA 3CYMA 3OYFA 1IH7A 1P90A 4DR4K 4M1XA 1NKCA 3V1QA 3A8YA 2VCPA 4HTUA 2Q3SA 5GADP 1IG9A 3N0CA 2XY8A 2HVHA 4JHDB 3BZKA 4CW7B 2JA7A 4ZH4A 3AO4A 5FRNA 3D0PA 3ID6A 3RMCA 4JI8K 1XHXA 1SAZA 4PAAA 1B9DA 1RILA 3LWLA 5AR0A 3M4OC 4M3XA 1FKOA 4FJGA 3R9PA 4YDUC 3L2QA 5KPTA 1YCLA 1K6YA 3S14C 3C0BA 3GDQA 1TK8A 1IE0A 1B9FA 3CPEA 3BF3A 3ZEUB 1HMVA 2RF2A 3DRRA 4DTMA 5CE3A 1I50K 2OYQA 1V4TA 1JLEA 2V52B 4KI6A 2ZWHA 4IO8A 3U8XA 1TWFC 3LDQA 1B92A 3KWGA 2JA5C 1QVFM 3SBTA 2H3GX 4CJ4A 4PY5A 2GWKA 1VLOA 4FJKA 3AD9C 3ZETB 4BC5A 1L3SA 3P4IA 3CF5L 4AYBL 3WODA 2Q97A 4DV3K 4CGJA 1EETA 2E2JC 3FE1A 3VTHA 3H46O 3ZSYA 4BRNA 3B6OA 3F73A 3DRSA 3VPZA 2BH1A 1QSYA 1TKXA 2GX9A 3OS1A 3TABA 1VQ8N 4LF5K 3NGIA 1S6QA 2FBTA 4MEXA 1TK0A 4KAWX 3HOYK 1EFWA 5AZJB 4FPBA 4C45A 5C25A 5I3UA 1R0AA 3A0IX 4CZGA 1KRPA 1IJJA 5HL7L 1NGJA 2GWJA 2CFAA 3NBPA 3GDZA 1BI4A 3LAJA 1QHTA 3VQEA 4W5RA 1J5OA 4XSXA 3NF6A 3HP6A 4M3TA 4WILA 3I4MC 1ZBSA 4BWMA 1Q9XA 3BDPA 3V1OA 3C6AA 1S9GA 4YOYA 5EY4A 2XY6A 4P9SA 4JNEA 1TWFA 4FVUA 4X66K 5BRHA 1DCHA 4N56A 3CJ7A 5TMFA 3C95A 2E2HC 1ZBFA 3HKZD 5FLMC 4JI5K 3QB0A 4CD3A 3CFPA 4CHPA 5IYDK 3T7ZA 2D0BA 1ZBIA 2QM1A 3H08A 3AQPA 4RMFA 5C3EK 3MCPA 3L4KA 3N0BA 3ENBA 2G8KA 4I9QA 2P9KB 2JA6C 4CE9A 4U67L 4LY7A 2IS3A 3THYB 3EL2A 2XHBA 3E9OA 4DUYK 1XZPB 3OEPA 5LJWA 4C3IC 4BDYA 5EGHA 5C4XC 3BY5A 3O08A 2JA8K 1I3QA 3QETA 4FL9A 3UKRB 2GSNA 3GTMC 2QTDA 4KB0A 3AH5A 1ZBLA 1A5XA 1NNEA 2RHKA 4KN7A 4X6AC 3RVCA 1SUQA 1YHQN 4I2PA 4RTFD 3D6RA 4CFBA 1IKYA 1O2BA 3THWA 3I4NK 2W40A 1IG8A 5DK5A 3N4PA 3OYKA 3WXJA 4FLVA 5LY3A 3T1HK 4GMJB 3PLAA 5C10A 2RPIA 4B1ZA 2D5RA 3MEGA 5AQPA 1K73O 3T69A 3LL3A 1GLDG 4DKWA 1WOQA 2G8UA 5AQNA 4H0TB 1CXUA 1NK9A 2JWKA 3F2KA 2E2IC 1S6PA 2O8FA 3SUQA 3I0SA 4A3MK 5AQOA 3VGMA 2UU9K 4DSLA 1N33K 1D5AA 5EOYA 4G7HA 2VGNA 3GTKA 4G7OA 3CCVN 2IVNA 4N5SA 1KFSA 3PUFA 4BRMA 1G51A 4GVEA 5KGXA 4FJMA 2CW0A 3FZFA 5AQYA 3S17K 1T8EA 1BHLA 1KQ4A 1DCOA 4G9ZA 4CZHA 4C8KA 2HHSA 1C1BA 3GTLC 5EXWA 1C0TA 4LOWA 4A5BA 3D2EA 2DY4A 4CERA 4BE0A 4A3LK 2FBVA 3H1QA 3I56N 1WLJA 1Q18A 2WUSA 4BY9C 1WCMC 3N4QA 4ILHA 1WSEA 5GIPA 4KV8A 3VOVA 2WTUA 1HQMA 2HHTA 4KM9A 4JHDA 3MECA 3RRGA 4A3IC 4B1UB 2YU9A 4KPYA 4DSKA 4QIWD 3FFIA 1BGXT 3CMEN 4JRPA 4G7ZA 3G0ZA 3ZX0A 2IVPA 2AJQA 1TWAC 2D0AA 4CEDA 3OBWA 3ZCMA 5AQHA 3CMAN 1Y1VA 1CXQA 2YJFA 3O9RA 1AB4A 4B3RK 1K8KA 5IYBC 3GTGK 3OYBA 4KC6A 4OPJA 1BIZA 3LDOA 3GTJC 3S2DK 2O8BB 4FJXA 2VUMK 5AQFA 5FLXO 4MLEA 4OGEA 3TTGA 3CHWA 3P83D 3AO1A 2CH5A 4AHSA 3DXMB 2YNHA 4FW1A 4DTPA 3DLRA 4G0VA 5LJVA 4BY1K 3AVMA 3HRGA 3GTLA 3KLFA 4A3GK 2PHCB 2OZMA 1DKGD 2BGGA 5KPZA 4GZYA 3ENOA 4WFNL 5ADXH 3ZETA 2O4IA 4ILDA 4FWRA 3S1MC 3LPUA 3PO2C 1O28A 2ETJA 3O4NA 4MDBA 3O3FA 2HMPA 5JS2A 5M1FA 4FWLA 4AYBD 4KI4A 2FSKA 4QAGA 5AQUA 3S41A 3CM5A 2F4VK 2P9LB 4H0OA 4NB4A 1WBDA 1L3UA 3MWPA 1VK0A 5KGWA 3TWHA 1B4AA 1G99A 4KHNA 1O1WA 4JYAK 2VQFK 3SUNA 5C42A 1VJEA 5JVOA 4FWOA 1XZQB 4PKIA 2PAVA 2Y3PA 3PO3K 3EY1A 3UIQA 1VRUA 3O9QA 5TKYA 4HUGA 2E1YA 4DQ8A 1OKJA 3M3YC 5BRFA 3HVRA 3AO2A 3PX4A 4DR5K 4CZEA 4BRGA 4CEZA 1NGBA 2A6EA 4A3EC 4CJQA 5M1QA 3WNHA 2HBJA 3AA4A 2OZSA 3HOZK 1DCPA 4JK7A 1XNRK 3BP3A 3TTFA 3VQCA 4C3HC 5A2QO 4DB3A 2PYJA 2Q2RA 2QWQA 4B9VA 2NVYA 3KZBA 4N47A 2GBZA 3O5BA 1D4XA 3NH2A 3CCQN 3AO5A 2R92A 2XCOA 4PKHA 2WONA 2ZJPL 3DMJA 1VGXA 3W0LA 2X78A 4CJLA 4AQYK 2NVYK 1T03A 3VN5A 2O4GA 1F93A 2NVTK 4QOZB 3OREA 4OIRA 5AJ3K 3OYNA 4DU4A 5E68A 3WEEB 3CXCM 1BDFA 1BIUA 3THYA 3IRXA 2WAQD 2NRRA 3J7ZO 3NE6A 4DU1A 5I42A 3M3ZA 3HT3A 3RR7A 3DLBA 3S2HK 1SV5A 1ITGA 3VMFB 3HOWK 3ZT2A 1YT3A 1RDAA 4QS7A 4LQYA 2NRZA 3UKRA 3SV4A 1VQMN 3PO4A 3HSTB 3F5TA 3CQZA 4DDQA 4DV1K 4J2DA 1RDBA 4CIEA 4BR0A 4KTQA 4OPAA 3LP3A 4KMHA 3HM8A 3A5MC 1KLMA 3LDNA 4DSFA 3TAFA 1N34K 2Q36A 4CBWA 2NVXA 4BVOA 3PX6A 1VSMA 4CCHA 3G4CA 2EWSA 4A3KC 3E01A 2GV9A 5HRPA 4IFYA 5LMNK 3S15C 2YNIA 3S1QC 1HKBA 4BRLA 4DF4A 4R5PA 1LW0A 4DV2K 4FOEA 3HOUK 5E84A 3MMVA 2QWMA 1UWBA 4RCHA 1ZQ1C 3OS2A 4G0WA 3JSMA 4K43A 3P5JA 4EP4A 3WNEA 4GTBA 1YVUA 4RG8A 4FK4A 5IYCK 1TL1A 3QFPA 1BG3A 2D0CA 1TWHA 2WB1D 1XPPA 1N8RO 4DR6K 4J2AA 4LJZA 1Z6RA 5TJ3A 3EZ5A 3MXJA 1K83K 3SK3A 3JS6A 1GOAA 2B63C 1BDGA 5M1KA 3R3LA 4BC3A 5IOSA 3VQ5A 4HUFA 1RT7A 4AHVA 4IJNA 2OPPA 4DU3A 3LAPA 3A5OC 3HXMA 3TFHA 2CFAB 1UAXA 1BI4B 1W7AA 4IDHA 1JLAA 4DSJA 4IG0A 3P1GA 3ENHA 1D9FA 2G8WA 3VEZA 4ISGA 1T7PA 3FHZA 4QS8A 4LR2A 3L2WA 3EQLA 5HRSA 1RBVA 2WFBA 5EVZA 1FK9A 1TVRA 4C8LA 4FK0A 4JKBA 2IIRA 4IOCL 2OA8A 2A40A 2A5XA 3OBYA 4JI4K 4Q5VA 4OO1J 1C1CA 3SUPA 4YFNA 4WJ4A 1Q7YO 3I55N 1HPMA 1UA0A 4GT9A 3NMUA 3FOEA 4FVMA 1X9SA 4L3QA 4YOXA 4EZ9A 3NHGA 3UB5A 3ZT1A 4HTLA 1IKVA 1WN7A 3K5OA 1ZYQA 2A3ZA 2HBMA 1WSIA 3S1NC 1QQOA 2HHWA 4KDDA 1KAZA 5JS1A 4B8AB 3SAGA 4H5NA 4O5FA 4RW9A 2B63A 3VEOA 2YHAA 1USMA 3O1WA 1Q82O 4IBNA 2PMZD 3VQBA 3GTPK 3CC4N 5FPEA 3KLGA 2NRTA 3DOLA 1TAUA 1FXXA 4DTOA 4XEIA 3M6GA 1SL1A 1J9AA 1J6VA 1QVGM 4JKDA 3VF6A 3THWB 3H3NO 3VEWA 3AVIA 2G8HA 1EK8A 5FRMA 4KH5A 4MQ3A 4A5AA 1REVA 3S1RK 4KAZA 3AD7C 4Y7NK 2LSNA 4U7BA 1NJWA 1KLNA 4A3JC 1ASVA 4OX9K 2HBKA 4OKKA 2JA7C 1Z05A 2E2PA 3QESA 2X6SA 5FPNA 2HSTA 2B4JA 1TKTA 4NXMK 2CGLA 4BROA 3AV9A 4A2BA 3KD1E 2O8FB 3TAMA 2NRVA 1F7VA 1HR0K 2Z1GA 4HHTA 5CY4A 2KKZA 3TSUA 5T7BA 1YJ9N 4DTXA 4JI7K 4LF9K 1EH1A 1VQ5N 2QWPA 4NLCA 4CIGA 3HO1A 4YOUA 2QK9A 4DTRA 2DPNA 4KBOA 3TAPA 3SJHA 2DFEA 4A3CK 3J81O 2YHBA 1GLAG 4CECA 3K7AK 1JVIA 1O27A 1JCFA 1X3MA 3RSEA 4CJ3A 2BE5A 3D2EB 2EBBA 3IAYA 1OH6A 1CLQA 1PJ5A 5DM7L 4A3BK 5EU7A 3DM2A 2YNGA 2QW9A 3GTQK 4CK2A 4DQPA 1XQSC 4TSXA 4F8RA 3AD8C 3WEEA 5K14A 4BRIA 3ATUA 3C6TA 3CJCA 4HUEA 5AZIA 2Q0RA 1ZC6A 5BPMA 2W42A 1KAYA 1IBMK 5M1NA 2Y0SL 2YV0X 2RH6A 3DJCA 4N76A 4LF4K 3HOYC 4OIQA 4ELVA 5F0XA 3VQPA 4G0UA 3MXIA 5M1PA 5C44C 5TKWA 4KMDA 3QX3A 3L4QA 4ZTFA 2GAHC 2KFNA 3MMLB 3NUHA 3OYCA 4YFXA 5KQDA 3T3FA 2EHGA 3L8BA 3H3VL 3GG4A 1U6ZA 5AQZA 3KLEA 3ALYA 4KHSA 2GSOA 1TK5A 1I50A 5GAGP 4DTJA 1K8KB 4K8ZA 4WQ5C 1PJ6A 5L46A 5AQSA 5IP9K 2FF3B 4C2MC 4GTDA 4KN4A 4CEOA 1KVAA 4BR4A 4E1MA 3O1BA 3O8MA 3AVBA 3VEVA 3RMDA 2HW3A 2XY5A 3VETA 1GOCA 4FO0A 2E4LA 3QLHA 4H5RA 1MDUB 2D6FC 3HOSA 3N3YA 4QS9A 5C3EC 3DOKA 3VA7A 2FXUA 5HLFA 1GLEG 4BRDA 3L3VA 5AFUA 3NVKA 1TWGA 3NH0A 3G4AA 4A3FK 3GTOK 3SPZA 2BTFA 2PZSA 1CZAN 5C4JK 1HYZA 1NK7A 4A3DK 4GTCA 4DTNA 1TWGK 2DFFA 3CCJN 4CGIA 1XUPO 1YF5L 1M1KO 3P31A 3NH1A 1VQ9N 3M8PA 3M8QA 3HYFA 3SMPA 4WFBL 1VH2A 4O2DA 3D2FB 1YITN 3G6EN 4YOVA 2E6LA 4F3TA 4E1NA 1NGHA 1Y64A 2QXFA 5BRDA 1YAGA 1NGAA 1I3QC 2HMIA 2QA4N 3CC2N 3TTDA 2Z1HA 3AARA 4DLGA 3J80O 3I4NC 2O8EA 3LP2A 4WQ5A 2QI2A 3DAWA 4X62K 1VSHA 4BDZA 3TAEA 4GW6A 5AQKA 3V1RA 4M3UA 1JL2A 4H5WA 5AQIA 2PYLA 4FJHA 4C1NI 2YX6A 2W6KA 3H6EA 4E7KA 1XC9A 5B8HA 3OY9A 4DLEA 1P8ZA 1S72N 2ITMA 3T02A 2PA8L 3OVNA 4H4MA 4L8RB 5BN8A 2FF6A 4OPKA 4KM8A 1WQFA 4NXNK 1J6XA 4KO0A 4JV5K 3CFRA 2F9WA 4M7XA 4H8KA 3ZSRA 4C1NK 1NBWA 1J5EK 3VQ7A 1K9MO 4ELUA 2ZF5O 3I0RA 1G15A 4CEAA 1U47A 3S14K 1NK5A 2WC9A 4KHYA 5CHIA 1FKPA 3CCRN 1ISEA 1ASUA 4CI6A 4WCEL 1WAJA 3S17C 1J6WA 3GTKC 3OYAA 3AY9A 3GIRA 3WXKA 5JICA 2F8TA 4KB2A 3ZSOA 1NMDA 2JA5K 1CZ9A 1BOTO 1GLCG 4CJSA 3H1VX 2O8DA 4BWJA 2DFHA 3K5MA 4C8OA 1NKEA 5IOQA 2ZUEA 1YNJA 4JI2K 1QZ6A 4AH9A 2E2QA 1A5VA 4BRKA 4O44A 3ZYYX 2E2JK 2PFUA 1NOZA 4M45A 3PV8A 2XRIA 1YUWA 2QXLA 4XIUA 2IGIA 3W3DA 1NK8A 3KJVA 2QWOA 1LOTB 3IDHA 5M1OA 1JCGA 1EXQA 4PKGA 3K57A 1JQWA 1TKDA 3HOTA 3PIOL 1NKBA 4XLNA 4DFKA 1TAQA 2D4WA 3O80A 1C0AA 1GE9A 1EWQA 4NCBA 1BGWA 2YU9C 1Q9YA 4WJ3M 4Z0UA 2NRHA 2NVQK 2GEMA 4CGDA 4CF0A 4DTUA 1O2AA 1UOCA 1TGOA 2KFZA 3K2PA 3LM2A 1XHZA 4CHNA 4DUZK 2QWRA 4CK1A 2JH3A 1ESVA 1WBBA 3I4MK 1TUYA 1Y1VC 1OH7A 4LK1A 1XXBA 1RTIA 4BC2A 2VUMC 3FGUA 4IEEA 1SZ2A 3RWUA 3AA3A 1OVQA 5FPDA 3RZOC 4YY3K 4ISEA 3G71N 2B6AA 3KK3A 5M5YK 4MDAA 1H1VA 4NYFA 1S1XA 2E2HK 3AVLA 2Q1NA 3HPHA 3WXMB 4B1YB 3NF8A 3K0SA 3V9UA 1JLFA 1F21A 4JKCA 3DLLL 5AQWA 4LF6K 5HRNA 5JFEA 2FBXA 4DCHA 4GTEA 3CPWM 1GLFO 4JKEA 4CGGA 1YI2N 3VQQA 1S9EA 3O9UA 3AAPA 1RU0A 4LK0A 2JA6K 1O26A 3NGZA 4FM1A 2QKKA 4EZ6A 1S22A 5D3GA 4LSNA 3B8AX 1O13A 4CJKA 3AVHA 3M8RA 4KRFA 3Q7BA 3AGRA 3WQTA 3OYDA 1IV0A 5KRSA 3IKMA 3DLGA 2Y0SD 4C3IK 3U3YA 4CEQA 2XO7A 3ID8A 2VWJA 5C4XK 3ZSXA 1RFQA 3VEXA 3KKRA 1RT4A 4JKGA 2HHXA 5AFUH 3GTMK 4BC4A 1VSKA 4YOTA 3GTGA 4V19S 3GTQA 3K58A 1O25A 1TUUA 4QJVA 5C24A 3H0GA 4GTFA 3BGRA 4DTSA 3CG7A 4BBSK 4X6AK 3JXUA 1NLVA 2IOCA 4MO4A 5H1SQ 3FZHA 5E26A 4H0XB 2CH6A 1TWCA 4BRHA 2VUMA 1JLBA 4GVMA 4BRCA 5JLHA 1I6HK 2D0PA 4B3TK 4C3JC 1CZBA 3AAQA 1YTUA 4Q4ZA 5M3FK 3H0GK 2KHOA 5CJ9A 1NJIO 2GELA 4BE2A 1TWCK 4E19A 5BR8K 3SI6A 4DFPA 1HNIA 1RDUA 2VWBA 1OH8A 5HL8A 4FJ5A 3MN7A 1HLUA 2QWNA 2NVYC 1SKWA 2R92C 4OGCA 4Z4GA 2VWKA 4N41A 4FLTA 3SZZA 4EAHD 3ZSWA 1RDWX 5SWMA 4Z4FA 1KQSM 2KZMA 4GKKK 1X9JA 1YIJN 4YNQA 3GSIA 4O8KA 1QQMA 2AP1A 1OH5A 4JI1K 4CBXA 3THVA 4BACA 3A2FA 2P8TA 3SAFA 3VQ9A 5FPMA 4CVNE 3SAHA 4KMAA 3IFRA 4KTZA 3PSIA 4OLBA 4E7HA 1WOOA 3D2FA 2HHVA 2IAJA 4X65K 4K8XA 3AA2A 3TARA 1DGKN 1Q81O 5I9EB 4GV6A 2A1SA 2P5MA 4FLUA 1LAVA 1MWMA 4WF9L 2R93A 3CQZC 3LZJA 3TAGA 3HL8A 4BRPA 1VQNN 1LWCA 4WQ4A 1BUPA 4XSZA 4M7YA 4CEBA 1NK6A 2A6AA 1WCMK 2R93K 1I94K 2NVXC 2VG7A 3HOVC 4JK9A 4CGHA 4BG8A 5KI6A 1RBUA 1S1VA 2P9SB 3LDLA 3ZX3A 1T6DA 3OYJA 3ASMA 1TL3A 4W5NA 3HOUC 4FZYA 3A5NC 3K59A 4IDKA 1NU0A 3V9SA 4LFAK 4I6MB 3FZKA 3UKUA 2OPQA 3RSEB 4ILGB 1NGDA 3OS0A 1TWAK 1XNQK 5IYCC 2JGUA 4DS4A 2Y1JA 3Q7CA 4IEIA 5IYBK 4A62A 3LDPA 4B1VA 3T19A 2J4RA 2BANA 3GTJK 2ASMA 4FWMA 1EX4A 3RR8A 5AZIB 1DT9A 3K9KA 4IFVA 4B9TA 2FQOA 3S0XA 3VQDA 4LH5A 4M3WA 1BJTA 3LP0A 1TWHC 4NOIA 5KQ8A 1XMOK 1F7UA 4KARA 3CCLN 3AVFA 2E1ZA 1MA9B 3VF2A 2A1RA 2RN2A 3TANA 5AQMA 3KTQA 5M3MK 4B9LA 3U9ZA 1N36K 1A5WA 2VGMA 3LWMA 3PO2K 1KAXA 1WUAA 4C8NA 3IPJA 5EX5A 2D1KA 4KFBA 5CHPA 1Z25A 3ATVA 4JAXA 2P9UA 1C0MA 4B8CA 4FM0A 1VSFA 1HNVA 4BY7C 2ZE2A 1VRQC 1K8AO 3H3OB 5J2NA 4JK1A 4JKHA 1SL0A 4BQLA 1VSJA 4P5BA 3KVGA 3MK6A 1E4GT 2FLOA 5AQXA 4W5TA 4CGFA 4E7JA 4IO9L 2A6HA 3R1XA 3LZIA 4DQRA 2Z1IA 5IP7C 5FDLA 2GSUA 3AVGA 1S1TA 2R7YA 4HCBA 1EO1A 4DR3K 3S9HA 4A3EK 3QO9A 1GOBA 4JI6K 4CEEA 4BR9A 2P9NA 4CZIA 1K83A 4B3SK 4FW2A 5GINA 1J6ZA 3MCAB 4M3ZA 1VQ7N 5GIOA 4ZTJA 4BXXK 1BQNA 2HBLA 3GTPC 3HOXC 2E2OA 3SCXA 4G1QA 1C6VA 4F3OA 1WSHA 4DSEA 1X9WA 1NWKA 3QMLA 3AVKA 1NGEA 4A93K 3CJ1A 1NJXA 2NNWA 4NLBA 5CYMA 4IG3A 1JOEA 5IORA 4BLAA 4CJPA 4F2RA 3IS9A 4A59A 3U3GA 3C7NA 2O8EB 3WXLA 3KD5E 2P9PA 3QEIA 3K5NA 2P51A 4X64K 3B6PA 4JRQA 4F4KA 1Y1WA 3L4JA 4M3RA 3CJ9A 4JLHA 1NG9A 3E66A 3PIPL 2E5LK 3K5LA 1Y1WK 3DI6A 2BUPA 2R7ZA 3DWLA 3MX5A 4RW4A 3E9PA 4CF1A 1VQ4N 4OLAA 5AQRA 2D0OA 3HBTA 1U2VA 3DLHA 2R7ZK 3BF1A 4KHQA 3FFKB 2NUBA 3HPGA 4K41A 2UXCK 2A42A 1KFDA 3L0QA 2E88A 2Y1IA 4FSVA 1X9MA 3L6QA 4IXCA 3ADAC 1VSLA 3MWTA 4I7FA 1IBLK 4A3KK 4FZZA 3S15K 3GTPA 1SFOK 4BBRC 3SPYA 3FKIA 3K7AC 3SQ1A 3J7AP 3S1QK 4CJFA 1KSPA 4KHWA 3S16K 1NMNA 3U4LA 5KPRA 1JLCA 2ZD1A 3OPFA 3LAKA 2O8DB 4A3BC 3EKSA 3FKIK 5EGEA 2WOMA 2IDOA 4Z4HA 4NYNA 3HXAA 4Y1DA 1ZBUA 1R9TA 1NK0A 3GBTA 1YNNA 2NLXA 3AVNA 2X74A 4FWQA 1RTDA 4CEFA 4BDPA 1WSVA 1WSGA 2ZM6K 2E6MA 4H5TA 4JKAA 4CFCA 1IBAA 1LWEA 1BA0A 5JLFA 1R9TK 4PUOA 4CHZA 4F9OA 3WUHA 1RTJA 4NO7A 4PQUA 1W2BM 1JXBA 3RZDK 3KK1A 1M90O 4BG9A 4KB1A 4B9UA 2HF3A 4LFBK 4CESA 1ATNA 3BUEA 4JEPA 4H0YB 5IP9C 1HJRA 3F9KA 3O3GA 4MO5A 4BQZA 3MXMA 5BN9A 1I50C 1NM1A 3FOFA 4FLWA 2ASOA 3ZSQA 1RT6A 2UXBK 3DLKA 1RT5A 4C23A 4JD2B 3JAMO 2KLAA 2BE2A 2P9SA 5HP1A 3BP8A 3V81A 3T00A 3QIOA 2O5JA 3LANA 4DR1K 3ULDA 1EQRA 3V4GA 3LAMA 2B5JA 1JJ2M 3MDQA 1EKEA 4I6MA 4JI3K 4A3FC 4J2BA 3P39A 4Y52K 3VQ8A 1RT1A 3SQ0A 3M1FA 5BREA 1IL2A 2W6LA 3EEQA 1KXPA 1D8YA 5M5XK 4MEYA 4A3DC 5HBMA 4AHCA 4NCAA 1TWGC 4DQQA 2YJEA 4KKOA 3EKUA 3HZ6A 1PJ7A 1HKCA 1TKZA 1HNZK 1J53A 1KTQA 1JLQA 3SBGA 5BR9A 3S1NK 3E9LA 3O9SA 1VHXA 4EP5A 1S1WA 4UQGA 5C15A 4HWIA 5C2FA 2RKIA 4K0KK 1C1AA 4CJRA 4UY8O 4ELTA 4Z4IA 3MX2A 4M3YA 1W9HA 4O0JA 4JKGB 3OJUA 2Q31A 4LH4A 1SL2A 1FW6A 3HI0A 3OTOK 1ZYRA 4DFMA 4QJVB 2V51B 1RBTA 4OVLA 5MLCQ 1YVNA 1E3MA 3Q3QA 4AHTA 4FM2A 5LMUK 2UUBK 3QERA 3CCUN 3VQ4A 1WB9A 2GUPA 3VEYA 2F7TA 3O3HA 1YX2A 4QIWL 1NJZA 3WT0A 4IOAL 4OKEA 4DG1A 4IWVA 5AQTA 1F9NA 1NGGA 4PL7A 3NFAA 4A3JK 5AQLA 1GLJO 3TFIA 4AHUA 4CFAA 1RT3A 5AQJA 5IYDC 1T44A 3ERED 2JA7K 3GTOA 1VQPN 4MQ9A 3CIPA 1HNWK 4CD1A 4BRFA 3GEHA 2PPBA 4WFAL 1I39A 4FWNA 2KW4A 2VG6A 1TYQB 3H45C 3QFUA 1S5JA 1U04A 2ASPA 4LLGA 1DTQA 2NZTA 2W41A 1YXQA 2ZUFA 4B9MA 4H0PA 4LF8K 4Q0BA 1IKXA 4RWTA 5AQVA 4JS4A 2JA8C 2XCRB 4Z4EA 1HKGA 1L0WA 2IC3A 3DLEA 1Q8IA 2YNFA 2UUCK 4YFKA 2ZGYA 1QSSA 4DMNA 1VQ6N 1ZBHA 1NGFA 3HTVA 3L2UA 4KASA 4CK3A 3SUOA 1EWRA 3J7YP 4BREA 1I6VA 4FZXC 4W5QA 1U48A 2P9IB 4FJLA 4E3SA 1WSFA 3UE5A 5F1XA 1HQEA 3BZCA 3D45A 2OPRA 3D7EO 2W7VA 2HHUA 1SKRA 1R59O 1YJWN 1O2FB 4Y1CA 3EE8A 2JLEA 1KD1O 3WQUA 3GE1A 5KTQA 2O8CA 5CZ1A 2A41A 3ZT3A 4E1JA 3HK2A 5C44K 1LV5A 2NVQC 4A61A 2GUIA 1BA1A 1TV6A 1WSRA 1Z26A 5ADXA 4YDUA 4CZKA 3UKUB 4FPAA 4A3MC 4CJVA 1EQYA 3ULEB 3M4OK 3VENA 3VESA 2QKBA 4FJIA 1S1UA 1USOA 3A8KA 3LM9A 5KRTA 3CC7N 1HI9A 1QTMA 4CJUA 2IVOA 5J2MA 4BR5A 3HM9A 1ZVUA 4C2MK 4DV7K 2JA5A 3C65A 1NOYA 4PL8A 1WSJA 4WE1A 2I7NA 4FM9A 3QNNA 1TWFK 1N6QA 3O9TA 1WAFA 4JKFA 2ZQBA 4CZFA 2RGRA 3SV3A 1RDDA 1RTHA 1BISA 1LWFA 4A3LC 3LDSA 1MWKA 4DV0K 1X1PA 2HNYA 3KLIA 5DM6L 3QEVA 4O55A 1BU6O 1LCUA 1BCOA 2KQ2A 2P5OA 1HRHA 4IFEA 2WAQL 5J1EA 3PO5A 1KC8O 4E89A 4CJ7A 3GL1A 2ATQA 5HRRA 2UXDK 2P9UB 4O4GA 4AHRA 3V4IA 2HF4A 3OYGA 1WIHA 4YORA 2NRWA 5LL6Z 5F2RA 3WXIA 4YOWA 5FROA 3I8DA 3V9ZA 1HX1A 3S3NA 4KATA 3THXB 3U6FA 2P5GA 1DD5A 4FYDA 1I3AA 4ILJA 4JI0K 2PBDA 1BCMA 1C0UA 2NRXA 4BBSC 4XCHA 3VGKA 3TU5A 1HUXA 2HB5A 2HHHK 1I3QK 4KMUA 1HJOA 4GNIA 1I6HC 3GTGC 4KH6A 3GTQC 3V9XA 2V7YA 1RNHA 3H0GC 1RBRA 3JYTA 3S2DC 1ILYA 1WOPA 1TWCC 4CZMA 4GKJK 3R6MA 2E2NA 4R79A 3NGYA 3ZT0A 2E2HA 1ATSA 2HNZA 2P9NB 5AQQA 3TR8A 4JD2A 2VQEK 2V6UA 4BY1C 1WORA 5M5WK 4LF7K 4B3OA 4FLZA 1N32K 4A3GC 3L2VA 3RRHA 1QHAA 1L5UA 3IMXA 2OPSA 1VAZA 3OYIA 2YI1A 3WNFA 5FLMK 4GV3A 1NK4A 5CR4A 4F2SA 2JA6A 2G8IA 1IS1A 1BS2A 1DTTA 3AGKA 1E4FT 4DV4K 3QINA 4H0VB 1YJNN 2WB1L 3C7NB 3O4WA 3JSTA 4BGBA 4GTAA 2P9PB 3NAEA 1YTAA 2UUAK 1NGIA 3GTKK 1INNA 5TMCA 5ELZA 3U9DA 3GTMA 3DXJA 4FK2A 3PO3C 3L2RA 3PSFA 4GFQA 3AA5X 4BE1A 1NJYA 1XMQK 1JKHA 1RGIA 4O5BA 1HNXK 4J2EA 3BEXA 1U2VB 3SZYA 3H3VD 2R93C 3HOZC 4E0DA 3CM6A 4B3MK 4BKWA 3V9WA 4FOIA 3GOIA 4WQ4C 2ZJQL 3CETA 2GAGC 3C6UA 3A8IA 4OJRA 4DWIA 1NGCA 4LC9B 4LSLA 3MEEA 3ZT4A 4CIFA 2V7ZA 1SKSA 2E2IA 3FZLA 5FJ8K 5DMRA 3ITHA 4OPHA 2YU9K 2NVTC 4BR7A 1GLLO 2UYTA 4XH5A 1VQLN 1HQUA 4RW8A 4IOXA 1JCEA 2E2IK 1TYQA 4B08A 5GAEP 2FQTA 3ZEUA 4CF2A 1QSLA 2YHXA 1Y1VK 3RTVA 4FJ9A 3NF9A 1OVYA 4CF8A 3CFOA 3S2HC 1C0FA 4FWSA 1L3TA 3MAQA 1J98A 3FLCO 4FJNA 3QICA 1XXAA 5D4DA 3RZOK 1SQKA 2PMZL 2CGJA 3HOWC 4H03B 1RDCA 1X3NA 2G8FA 3QBXA 3SQ2A 1GLBG 3NDKA 3NCIA 4W5OA 2I7PA 4OKJA 3GEIA 3GTLK 1VSIA 1LAWA 5CZ2A 3TPQA 1EP4A 5HOOA 1DLOA 1QZ5A 4DR2K 1WCMA 1Q86O 2ZGZA 1HYVA 2P9IA 3AVCA 1O29A 4H5VA 3DYAA 3EZWA 4FLXA 1WNSA 3EO3A 2XCQA 3VA3A 4B9SA 2OCEA 3ZSVA 3KKSA 4CZJA
chains in the Genus database with same CATH topology
3MX5A 3CJAA 3E9PA 3WXJA 1VQ4N 1I50A 5AZJA 5GAGP 1K8KB 3M5RA 5AQRA 2D0OA 3HBTA 5LY3A 4WQ5C 1U2VA 1TWAA 5AQSA 3CJBA 2FF3B 3G25A 3PLAA 3BF1A 5C10A 4C2MC 4GTDA 3FFKB 3KK7A 4K41A 1VQON 2A42A 4B1ZA 3L0QA 3QDKA 2E88A 2CGKA 4BR4A 3O1BA 4BLBA 3O8MA 4FSVA 5AQPA 3ULEA 3T69A 1K73O 3LL3A 3GTJA 1GLDG 3VEVA 4DKWA 3L6QA 1WOQA 5AQNA 3VETA 4H0TB 4IXCA 3CCMN 4FO0A 2JWKA 3F2KA 3MWTA 5IOTA 4H5RA 3VERA 3VF4A 1MDUB 3C6HA 3R8EA 5AQOA 3VGMA 3GTPA 3HOSA 3N3YA 3FKIA 4QS9A 3VA7A 2FXUA 5EOYA 1GLEG 1S3XA 4M63C 4BRDA 5AFUA 3NVKA 3DXKB 1TWGA 2VGNA 3U4LA 5KPRA 3G4AA 3SMSA 3CCVN 2IVNA 4BR2A 3GTKA 3OPFA 2BTFA 3EKSA 1CZAN 4BRMA 2YHWA 1ATRA 4GVEA 3CCEN 4GTCA 5EGEA 3FZFA 5AQYA 1B4BA 1WQGA 3CCJN 1KQ4A 4G9ZA 1XUPO 1YF5L 4CZHA 3P31A 1M1KO 1VQ9N 1R9TA 3GBTA 5EXWA 2KWAA 2NLXA 3CQYA 3SMPA 4A5BA 3D2EA 4FWQA 2P9KA 4Z94A 3LPXA 4WFBL 3D2FB 1YITN 4H5TA 4JKAA 3G6EN 3H1QA 3ZX2A 4YOVA 3I56N 3P38A 1BA0A 5JLFA 2QWLA 3FZMA 1NGHA 1Y64A 4F9OA 1YAGA 5BRDA 3WUHA 1NGAA 1Q18A 2E8AA 2WUSA 4NO7A 4BY9C 1W2BM 2QA4N 4B1WB 3N4QA 4ILHA 3CC2N 3TTDA 5GIPA 3AARA 3VOVA 4PHTX 5BPNA 1M90O 4BG9A 4WQ5A 2E20A 2HF3A 2QI2A 2OTJN 4KM9A 3DAWA 4JHDA 1ATNA 3K9JA 3BUEA 5AQKA 4H5WA 4JEPA 4H0YB 5AQIA 4B1UB 2YU9A 4C1NI 2YX6A 5AQGA 3H6EA 4MO5A 4BQZA 4O8UA 5B8HA 5BN9A 3CMEN 1T6CA 1NM1A 4FWPA 1P8ZA 1S72N 3FOFA 2ASOA 2ITMA 2IVPA 3ZX0A 3G4SN 3CCSN 3OBWA 3MN6A 5AQHA 3MN9A 2FF6A 4C23A 4JD2B 4Y0WA 5BN8A 2YJFA 3O9RA 2KLAA 3CMAN 1WQFA 2P9SA 3I8BA 5GAHP 3IUCA 1AB4A 1BWFO 3BP8A 1K8KA 3CQXA 4AF1A 3V4GA 2F9WA 4M7XA 4C1NK 4KC6A 3LDOA 1NBWA 1JJ2M 4DHYA 3MDQA 4JK8A 4I6MA 1K9MO 2ZF5O 5AQFA 3P39A 4MLEA 3CHWA 4IJAA 3M1FA 5BREA 2CH5A 2WC9A 4ISFA 3DXMB 5CHIA 4G0VA 3CCRN 5LJVA 1ISEA 1KXPA 4CI6A 5BPLA 4WCEL 3HRGA 3GTLA 4GV9A 2YJEA 3EKUA 3AY9A 3HZ6A 2PHCB 1HKCA 3EE9A 1DKGD 3WXKA 5KPZA 3A5LC 3ENOA 5JICA 5ADXH 4WFNL 4KB2A 3ZETA 4FZBA 3SLCA 1NMDA 3EN9A 3SBGA 4ILDA 4FWRA 5BR9A 3MN5A 1BOTO 4IZ9A 3E9LA 3O9SA 1GLCG 4K25A 1O28A 4MDBA 5C15A 3H1VX 3J8AA 2HMPA 5M1FA 4FWLA 4HWIA 1T3VA 5C2FA 3OHRA 2GTDA 5IOQA 4UY8O 2FSKA 2FSNA 5JVHL 5AQUA 1XXCA 3MX2A 3S41A 4KM8A 1QZ6A 2P9LB 4H0OA 4JKGB 4NB4A 2E2QA 2Q31A 4BRKA 2HOEA 3ZYYX 3HI0A 2PFUA 5C2DA 4BRAA 3MWPA 4XH1A 1YUWA 1B4AA 2QXLA 1G99A 1BO5O 2V51B 5MLCQ 3F9MA 3W3DA 3CAGA 2QWOA 5JVOA 4KH4A 1LOTB 4FWOA 3IDHA 1YVNA 4PKIA 5M1OA 2ZFZA 1JCGA 2PAVA 4GY2B 2Y3PA 3Q3QA 2YCHA 4PKGA 3CCUN 3O9QA 5TKYA 2GUPA 3HOTA 3PIOL 3VEYA 2E1YA 1W97L 2F7TA 2D4WA 3O80A 1GE9A 3WT0A 1OKJA 4DQ8A 4IOAL 5BRFA 1BGWA 2VYPA 3I33A 2NRHA 4IWVA 5AQTA 1F9NA 1NGGA 4PL7A 1SFOA 4MLHA 2GEMA 4CZEA 4BRGA 1NGBA 3CI5A 5AQLA 1GLJO 1O2AA 5M1QA 2HBJA 5AQJA 1T44A 3ERED 3LM2A 2Q0UA 3GTOA 4JK7A 2QWRA 2JH3A 1VQPN 1ESVA 3CIPA 1TUYA 3TTFA 4C3HC 2YHYA 1XXBA 4DB3A 4BC2A 5C12A 3E1YA 3FGUA 2Q2RA 2QWQA 1SZ2A 4IEEA 4BRFA 3KZBA 4CD1A 3O5BA 4FWNA 1D4XA 4WFAL 5FPDA 3CCQN 1TYQB 3H45C 3QFUA 2ASPA 2R92A 2XCOA 4PKHA 4ISEA 3G71N 4J3NA 2NZTA 2W41A 1YXQA 2ZJPL 3W0LA 4H0PA 4MDAA 1H1VA 4P5AA 2AA4A 2WBNA 4EIAA 4K42A 2Q1NA 4RWTA 3WXMB 5AQVA 4B1YB 3OREA 4KB4A 2XCRB 4A57A 3KWIA 4XH4A 3L4IA 1HKGA 4JKCA 3BUZB 3DLLL 3DXMA 3WEEB 5AQWA 5JFEA 1XC3A 4DCHA 3CXCM 4GTEA 3CERA 1GLFO 3CPWM 4JKEA 1VQKN 1YI2N 2ZGYA 2NVYA 2NRRA 3J7ZO 1VQ6N 1NGFA 2ZJRL 3O9UA 3HTVA 3M3ZA 3AAPA 4B1XB 4KASA 4BRQA 3QBWA 1QQNA 1O26A 5JMVA 4JN4A 1S22A 3VMFB 4BREA 4BVPA 5C0YA 3B8AX 1O13A 2P9IB 4EHUA 4EHTA 3KHYA 3Q7BA 3AGRA 3UE5A 3VGLA 3WQTA 5F1XA 1DEJA 4QS7A 2NRZA 3UKRA 3IKMA 3OW2M 4LQYA 1VQMN 3D7EO 3ID8A 3TTCA 3F5TA 2OTLN 3CQZA 4DDQA 1RFQA 1R59O 3VEXA 4BR0A 4CBUA 2P9LA 4JKGA 2QEXN 1YJWN 4OPAA 3EE8A 1KD1O 5AFUH 4GTLA 3HM8A 3WQUA 4BC4A 3GE1A 3A5MC 4J8FA 4KMHA 4YOTA 1O24A 2A41A 3GTGA 3LDNA 3AQOA 3GTQA 4E1JA 1TUUA 1SS6A 3O6WA 2Q36A 1O25A 4A61A 4CBWA 3H0GA 4GTFA 2NVXA 1BA1A 3JXUA 4BVOA 1NLVA 4MO4A 5H1SQ 1Y1VA 3FZHA 5E26A 5ADXA 4H0XB 4YDUA 2CH6A 4CZKA 1TWCA 4BRHA 3G4CA 2VUMA 2EWSA 3UKUB 4BRCA 4FPAA 5JLHA 2D0PA 4C3JC 3AAQA 1EQYA 3ULEB 1V4SA 3VTIA 2KHOA 3TSPA 3VENA 5CJ9A 4FWKA 1HKBA 3VESA 1NJIO 4BRLA 2GELA 2OANA 3LM9A 3CC7N 4FOEA 3TSQA 3CD6N 5E84A 1RDUA 3MMVA 1C0GA 2IVOA 2QWMA 2VWBA 3OA9A 1ZXOA 4RCHA 4BR5A 2RE2A 4CZLA 3MN7A 1HLUA 1ZVUA 4G0WA 4K43A 2QWNA 2JA5A 4EFHA 2GSOA 3C65A 1WQHA 4PL8A 4GTBA 2I7NA 4FM9A 4AM7A 3O9TA 4CZFA 4JKFA 4BGAA 2RGRA 3DXKA 3QFPA 4WYBA 4EAHD 1RDWX 2JWLA 1BG3A 4A2AA 1KQSM 1MWKA 4B9QA 1TWHA 3NVMA 1X9JA 5DM6L 1YIJN 3FR0A 1BU6O 1N8RO 1LCUA 1QQMA 4O8KA 2AP1A 4IFEA 4AM6A 1Z6RA 5TJ3A 1KC8O 3SK3A 3JS6A 4CJ7A 1BDGA 4CBXA 3R3LA 4BC3A 3GL1A 5M1KA 3SAFA 2F9TA 5IOSA 5FPMA 3SAHA 4KMAA 3IFRA 3HSCA 2FSJA 2P9UB 4IJNA 2HF4A 3D2FA 3LAPA 1P90A 3A5OC 1WIHA 4YORA 4M1XA 2NRWA 2CFAB 5F2RA 1DGKN 3WXIA 3A8YA 2VCPA 4YOWA 1Q81O 1HX1A 5I9EB 4KATA 4GV6A 5GADP 2P5MA 4IDHA 1DD5A 3N0CA 4JHDB 4ILJA 2R93A 1MWMA 4WF9L 2PBDA 2JA7A 2NRXA 3ENHA 3ID6A 3VEZA 4ISGA 4BRPA 1VQNN 3FHZA 3VGKA 4WQ4A 3TU5A 1HUXA 4QS8A 1SAZA 1BUPA 1HJOA 4LR2A 4M7YA 4GNIA 2A6AA 2WFBA 5EVZA 4KH6A 4JKBA 5AR0A 2V7YA 2IIRA 4IOCL 2A40A 2A5XA 3OBYA 4JK9A 4BG8A 1ILYA 4OO1J 3R9PA 2P9SB 4YDUC 3ZX3A 3LDLA 1T6DA 4CZMA 1Q7YO 3R6MA 2E2NA 5KPTA 4R79A 1HPMA 3I55N 3C0BA 4GT9A 3A5NC 3GDQA 3NMUA 3FOEA 2E2HA 1ATSA 2P9NB 4L3QA 5AQQA 4JD2A 3CPEA 3BF3A 4YOXA 4I6MB 3ZEUB 3FZKA 5CE3A 3UB5A 3UKUA 1V4TA 2V52B 3RSEB 2ZWHA 4IO8A 4ILGB 1NGDA 3U8XA 1QHAA 4HTLA 3IMXA 1VAZA 2YI1A 2A3ZA 3LDQA 3KWGA 2HBMA 3Q7CA 4IEIA 1QQOA 1QVFM 3SBTA 2H3GX 4GV3A 4KDDA 4A62A 1KAZA 3LDPA 5CR4A 4B1VA 2J4RA 2JA6A 2GWKA 3SAGA 2ASMA 4FWMA 3ZETB 4H5NA 1IS1A 3AGKA 4O5FA 4BC5A 2B63A 1E4FT 5AZIB 1DT9A 3P4IA 3K9KA 3VEOA 3O1WA 3CF5L 4H0VB 1YJNN 1Q82O 3S0XA 2Q97A 3C7NB 3O4WA 1BJTA 4BGBA 3CC4N 5FPEA 4GTAA 2P9PB 2NRTA 5KQ8A 3FE1A 3VTHA 3H46O 3CCLN 4KARA 1NGIA 4XEIA 2E1ZA 4BRNA 1MA9B 5ELZA 3M6GA 3U9DA 3VF2A 3GTMA 5AQMA 3U9ZA 4GFQA 3VPZA 2BH1A 2VGMA 4JKDA 2GX9A 3VF6A 1KAXA 1WUAA 1QVGM 1VQ8N 5EX5A 3H3NO 3VEWA 2D1KA 1EK8A 4KAWX 4KH5A 5CHPA 5AZJB 4A5AA 4FPBA 3ATVA 1RGIA 2P9UA 4JAXA 3BEXA 3A0IX 4CZGA 1U2VB 4U7BA 1IJJA 1K8AO 5HL7L 1NGJA 2GWJA 2CFAA 2HBKA 3H3OB 3LAJA 4BKWA 1Z05A 2E2PA 4FOIA 3GOIA 4WQ4C 2ZJQL 3CETA 5FPNA 2HSTA 4JKHA 4P5BA 4BQLA 1ZBSA 3KVGA 3MK6A 3C6AA 4YOYA 2CGLA 4BROA 1E4GT 5EY4A 4A2BA 1NGCA 4JNEA 4LC9B 1TWFA 2FLOA 2NRVA 4FVUA 5AQXA 5BRHA 2V7ZA 4IO9L 3R1XA 3CJ7A 2KKZA 2E2IA 3FZLA 3TSUA 4OPHA 1YJ9N 2GSUA 1EH1A 1VQ5N 2QWPA 1EO1A 4NLCA 4BR7A 3QB0A 4CD3A 1GLLO 2UYTA 4XH5A 4YOUA 1VQLN 2DPNA 4KBOA 3T7ZA 3SJHA 4IOXA 1JCEA 1TYQA 4BR9A 2P9NA 2QM1A 4CZIA 5GAEP 1K83A 3AQPA 1GLAG 3ZEUA 5GINA 2YHXA 1J6ZA 3MCAB 3MCPA 1JCFA 1X3MA 3RSEA 5GIOA 1OVYA 1VQ7N 1O27A 3L4KA 2HBLA 3N0BA 3D2EB 1C0FA 3ENBA 4FWSA 2P9KB 3FLCO 2E2OA 4U67L 3QICA 1XXAA 1SQKA 5DM7L 2CGJA 4H03B 1X3NA 2QW9A 3EL2A 1NWKA 3QMLA 1NGEA 1XQSC 3E9OA 3CJ1A 3QBXA 1GLBG 3WEEA 5LJWA 3OEPA 4BRIA 4C3IC 3ATUA 2NNWA 3CJCA 4NLBA 5AZIA 5EGHA 2Q0RA 5IORA 3O08A 4BLAA 1ZC6A 2I7PA 5BPMA 1KAYA 5M1NA 4A59A 3C7NA 2RH6A 3TPQA 1I3QA 5HOOA 3WXLA 3DJCA 4FL9A 3UKRB 2P9PA 2GSNA 2QTDA 1QZ5A 5JVGL 5F0XA 1WCMA 1Q86O 3AH5A 4G0UA 1Y1WA 2ZGZA 5M1PA 3L4JA 2P9IA 2RHKA 5TKWA 3CJ9A 4KMDA 1O29A 3QX3A 4H5VA 3RVCA 3L4QA 3E66A 3PIPL 3EZWA 1YHQN 3MMLB 3NUHA 3EO3A 2XCQA 4RTFD 5KQDA 3D6RA 1O2BA 3GG4A 1U6ZA 2BUPA 5AQZA 2W40A 2R7ZA 1IG8A 3DWLA 3N4PA 4CZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJA A;  3WXJ A;  5AZJ A;  1K8K B;  5AQR A;  5LY3 A;  2D0O A;  3HBT A;  4WQ5 C;  1U2V A;  5AQS A;  3CJB A;  2FF3 B;  3G25 A;  3BF1 A;  3FFK B;  4K41 A;  2A42 A;  4B1Z A;  3L0Q A;  3QDK A;  2E88 A;  2CGK A;  4BR4 A;  3O1B A;  3O8M A;  4FSV A;  5AQP A;  3ULE A;  3LL3 A;  1GLD G;  3VEV A;  3L6Q A;  1WOQ A;  5AQN A;  3VET A;  4H0T B;  4IXC A;  4FO0 A;  4H5R A;  3VER A;  3VF4 A;  1MDU B;  3R8E A;  5AQO A;  3VGM A;  4QS9 A;  2FXU A;  5EOY A;  1GLE G;  1S3X A;  4M63 C;  4BRD A;  5AFU A;  3DXK B;  3U4L A;  5KPR A;  3SMS A;  2IVN A;  4BR2 A;  2BTF A;  3EKS A;  1CZA N;  4BRM A;  2YHW A;  1ATR A;  3FZF A;  5AQY A;  1XUP O;  4CZH A;  3GBT A;  5EXW A;  2NLX A;  3CQY A;  3SMP A;  3D2E A;  4FWQ A;  2P9K A;  4Z94 A;  3D2F B;  4H5T A;  3H1Q A;  3ZX2 A;  1BA0 A;  5JLF A;  2QWL A;  3FZM A;  1NGH A;  1Y64 A;  4F9O A;  1YAG A;  5BRD A;  3WUH A;  1NGA A;  1Q18 A;  2E8A A;  2WUS A;  4NO7 A;  4B1W B;  3AAR A;  3VOV A;  5BPN A;  4BG9 A;  4WQ5 A;  2E20 A;  2HF3 A;  3DAW A;  4JHD A;  1ATN A;  5AQK A;  4H5W A;  5AQI A;  4H0Y B;  4B1U B;  5AQG A;  3H6E A;  4MO5 A;  4BQZ A;  5B8H A;  5BN9 A;  1T6C A;  1NM1 A;  4FWP A;  1P8Z A;  2ASO A;  2ITM A;  2IVP A;  3ZX0 A;  3MN6 A;  5AQH A;  3MN9 A;  2FF6 A;  4C23 A;  4JD2 B;  4Y0W A;  5BN8 A;  2YJF A;  2P9S A;  3I8B A;  3IUC A;  1BWF O;  3BP8 A;  1K8K A;  3CQX A;  2F9W A;  4M7X A;  3LDO A;  1NBW A;  4DHY A;  3MDQ A;  4I6M A;  2ZF5 O;  5AQF A;  4MLE A;  3CHW A;  4IJA A;  3M1F A;  5BRE A;  2CH5 A;  4ISF A;  3DXM B;  5LJV A;  1KXP A;  4CI6 A;  5BPL A;  2YJE A;  3EKU A;  3AY9 A;  3HZ6 A;  1HKC A;  1DKG D;  3WXK A;  5KPZ A;  3A5L C;  3ENO A;  5JIC A;  5ADX H;  3ZET A;  3SLC A;  1NMD A;  3EN9 A;  4FWR A;  5BR9 A;  3MN5 A;  1BOT O;  4IZ9 A;  1GLC G;  4K25 A;  3H1V X;  3J8A A;  2HMP A;  4FWL A;  4HWI A;  3OHR A;  2GTD A;  2FSK A;  2FSN A;  5AQU A;  3S41 A;  1QZ6 A;  2P9L B;  4H0O A;  4NB4 A;  2E2Q A;  2Q31 A;  4BRK A;  2HOE A;  3HI0 A;  4BRA A;  4XH1 A;  1YUW A;  2QXL A;  1G99 A;  1BO5 O;  2V51 B;  3F9M A;  3W3D A;  2QWO A;  1LOT B;  4FWO A;  3IDH A;  1YVN A;  4PKI A;  1JCG A;  2PAV A;  4GY2 B;  2YCH A;  4PKG A;  5TKY A;  2GUP A;  3VEY A;  2E1Y A;  2D4W A;  3O80 A;  3WT0 A;  1OKJ A;  4DQ8 A;  5BRF A;  2VYP A;  3I33 A;  2NRH A;  4IWV A;  5AQT A;  1NGG A;  4PL7 A;  4MLH A;  2GEM A;  4CZE A;  4BRG A;  1NGB A;  3CI5 A;  5AQL A;  1GLJ O;  5AQJ A;  1T44 A;  3LM2 A;  2Q0U A;  2QWR A;  1ESV A;  3CIP A;  1TUY A;  2YHY A;  4DB3 A;  4BC2 A;  3FGU A;  4BRF A;  2Q2R A;  2QWQ A;  1SZ2 A;  4CD1 A;  3KZB A;  3O5B A;  4FWN A;  1D4X A;  5FPD A;  1TYQ B;  3H45 C;  3QFU A;  2ASP A;  4PKH A;  4ISE A;  2NZT A;  2W41 A;  1YXQ A;  3W0L A;  4H0P A;  1H1V A;  2AA4 A;  4EIA A;  4K42 A;  2Q1N A;  4RWT A;  5AQV A;  4B1Y B;  4XH4 A;  3L4I A;  1HKG A;  3BUZ B;  3DXM A;  3WEE B;  5AQW A;  1XC3 A;  4DCH A;  3CER A;  1GLF O;  2ZGY A;  1NGF A;  3HTV A;  3M3Z A;  3AAP A;  4B1X B;  4BRQ A;  3QBW A;  1QQN A;  5JMV A;  4JN4 A;  1S22 A;  4BRE A;  4BVP A;  3B8A X;  2P9I B;  4EHU A;  4EHT A;  3KHY A;  3UE5 A;  3VGL A;  3WQT A;  5F1X A;  1DEJ A;  4QS7 A;  3UKR A;  3D7E O;  3ID8 A;  1RFQ A;  1R59 O;  3VEX A;  4BR0 A;  2P9L A;  5AFU H;  3HM8 A;  3WQU A;  4BC4 A;  3GE1 A;  3A5M C;  4J8F A;  2A41 A;  3LDN A;  4E1J A;  1TUU A;  3O6W A;  2Q36 A;  4A61 A;  4CBW A;  1BA1 A;  3JXU A;  4BVO A;  1NLV A;  4MO4 A;  3FZH A;  5E26 A;  5ADX A;  4H0X B;  4YDU A;  2CH6 A;  4CZK A;  4BRH A;  2EWS A;  3UKU B;  4BRC A;  4FPA A;  5JLH A;  2D0P A;  3AAQ A;  1EQY A;  3ULE B;  1V4S A;  2KHO A;  3VEN A;  4FWK A;  1HKB A;  3VES A;  4BRL A;  2GEL A;  2OAN A;  3LM9 A;  4FOE A;  5E84 A;  4CBU A;  3MMV A;  1C0G A;  2IVO A;  2QWM A;  2VWB A;  4RCH A;  1ZXO A;  4BR5 A;  4CZL A;  3MN7 A;  1HLU A;  4K43 A;  2QWN A;  4EFH A;  4PL8 A;  2I7N A;  4AM7 A;  4CZF A;  4BGA A;  3DXK A;  3QFP A;  4WYB A;  4EAH D;  1RDW X;  1BG3 A;  4A2A A;  1MWK A;  4B9Q A;  1X9J A;  3FR0 A;  1BU6 O;  1LCU A;  1QQM A;  4O8K A;  2AP1 A;  4AM6 A;  1Z6R A;  3SK3 A;  3JS6 A;  4CJ7 A;  1BDG A;  4CBX A;  4BC3 A;  3GL1 A;  2F9T A;  5FPM A;  3IFR A;  3HSC A;  2FSJ A;  2P9U B;  4IJN A;  2HF4 A;  3D2F A;  3A5O C;  5F2R A;  1DGK N;  3WXI A;  3A8Y A;  2VCP A;  1HX1 A;  5I9E B;  4JHD B;  1MWM A;  2PBD A;  3ENH A;  3VEZ A;  4ISG A;  4BRP A;  3VGK A;  4WQ4 A;  3TU5 A;  1HUX A;  4QS8 A;  1SAZ A;  1BUP A;  1HJO A;  4M7Y A;  4GNI A;  2A6A A;  5EVZ A;  5AR0 A;  2V7Y A;  2IIR A;  2A40 A;  2A5X A;  4BG8 A;  3R9P A;  2P9S B;  4YDU C;  3ZX3 A;  3LDL A;  1T6D A;  4CZM A;  3R6M A;  2E2N A;  5KPT A;  1HPM A;  3C0B A;  3A5N C;  3GDQ A;  1ATS A;  2P9N B;  4L3Q A;  5AQQ A;  4JD2 A;  3BF3 A;  4I6M B;  3ZEU B;  3FZK A;  5CE3 A;  3UB5 A;  3UKU A;  1V4T A;  2V52 B;  3RSE B;  2ZWH A;  4IO8 A;  1NGD A;  3U8X A;  1QHA A;  4HTL A;  3IMX A;  2YI1 A;  2A3Z A;  3LDQ A;  1QQO A;  2H3G X;  4A62 A;  1KAZ A;  3LDP A;  4B1V A;  2J4R A;  2GWK A;  2ASM A;  4FWM A;  3ZET B;  4H5N A;  4O5F A;  4BC5 A;  1E4F T;  5AZI B;  3P4I A;  3VEO A;  3O1W A;  4H0V B;  2Q97 A;  3C7N B;  3O4W A;  4BGB A;  5FPE A;  2P9P B;  5KQ8 A;  3FE1 A;  3H46 O;  1NGI A;  4XEI A;  2E1Z A;  4BRN A;  1MA9 B;  5ELZ A;  3M6G A;  3U9D A;  3VF2 A;  5AQM A;  3U9Z A;  3VPZ A;  3VF6 A;  1KAX A;  1WUA A;  5EX5 A;  3H3N O;  3VEW A;  2D1K A;  5AZJ B;  4FPB A;  3ATV A;  1RGI A;  2P9U A;  4JAX A;  3BEX A;  3A0I X;  4CZG A;  1U2V B;  1IJJ A;  1NGJ A;  2GWJ A;  3H3O B;  1Z05 A;  2E2P A;  4FOI A;  3GOI A;  4WQ4 C;  3CET A;  5FPN A;  4BQL A;  1ZBS A;  3KVG A;  3MK6 A;  2CGL A;  4BRO A;  1E4G T;  5EY4 A;  4A2B A;  1NGC A;  4JNE A;  4LC9 B;  2FLO A;  5AQX A;  5BRH A;  2V7Z A;  3CJ7 A;  3FZL A;  2QWP A;  4BR7 A;  3QB0 A;  4CD3 A;  1GLL O;  2UYT A;  4XH5 A;  2DPN A;  4KBO A;  3SJH A;  1JCE A;  1TYQ A;  4BR9 A;  2P9N A;  2QM1 A;  4CZI A;  1GLA G;  3ZEU A;  2YHX A;  1J6Z A;  3MCP A;  1JCF A;  1X3M A;  3RSE A;  3D2E B;  1C0F A;  4FWS A;  2P9K B;  3FLC O;  2E2O A;  3QIC A;  1SQK A;  2CGJ A;  4H03 B;  3EL2 A;  1X3N A;  2QW9 A;  1NWK A;  3QML A;  1NGE A;  1XQS C;  3QBX A;  3CJ1 A;  1GLB G;  3WEE A;  5LJW A;  4BRI A;  3ATU A;  3CJC A;  5AZI A;  2Q0R A;  3O08 A;  1ZC6 A;  2I7P A;  5BPM A;  1KAY A;  3C7N A;  3TPQ A;  3WXL A;  3DJC A;  4FL9 A;  3UKR B;  2P9P A;  1QZ5 A;  5F0X A;  2ZGZ A;  2P9I A;  3CJ9 A;  4H5V A;  3EZW A;  3EO3 A;  4RTF D;  5KQD A;  3GG4 A;  1U6Z A;  2BUP A;  5AQZ A;  2W40 A;  1IG8 A;  3DWL A;  4CZJ A; 
#chains in the Genus database with same CATH topology
 3HJF A;  3CJA A;  1RT2 A;  3O4Q A;  5AZJ A;  3M8S A;  1HYS A;  3M5R A;  1TWA A;  4A3I K;  3CJB A;  3G25 A;  4DS5 A;  3LAL A;  1KVC A;  3KK7 A;  3VQ6 A;  1VQO N;  2PA8 D;  2KZZ A;  3QDK A;  4I2Q A;  2CGK A;  3HP9 A;  4BLB A;  3T1A A;  3ULE A;  1WOS A;  3GTJ A;  1N5Y A;  2HND A;  3CCM N;  5IOT A;  3VER A;  3VF4 A;  3C6H A;  3R8E A;  1JXE A;  2G8V A;  3G10 A;  4C3J K;  3AVA A;  1T05 A;  4ID1 A;  1Y97 A;  1S3X A;  5HRO A;  4M63 C;  4BXX C;  4YG2 A;  3DXK B;  1SMY A;  3SMS A;  4BR2 A;  1K83 C;  2YHW A;  1ATR A;  4KRE A;  3QEX A;  3CCE N;  4KTW A;  4A93 C;  1WQG A;  4MFB A;  1B4B A;  2R92 K;  5J2P A;  3ZLJ A;  3HVT A;  3TAQ A;  3SJJ A;  3PY8 A;  2KWA A;  3TFJ A;  3CQY A;  1LW2 A;  3S1M K;  2P9K A;  4Z94 A;  3LPX A;  1HPZ A;  1EI6 A;  1QE1 A;  2BDP A;  4I9L A;  3ZX2 A;  4XLP A;  2HVI A;  3P38 A;  4CHQ A;  2QWL A;  3FZM A;  1XZP A;  2E8A A;  4CJE A;  4KHP K;  1IQ0 A;  4B1W B;  1Y1W C;  2F96 A;  4PHT X;  3GEE A;  4CHO A;  4RW7 A;  3OYE A;  5BPN A;  3THX A;  3SZ2 A;  2E20 A;  4AH6 A;  2OTJ N;  3QEP A;  3K9J A;  2EX3 A;  2R7Z C;  5AQG A;  4CFD A;  4O8U A;  3LPT A;  1T6C A;  4FWP A;  3RMB A;  4OIP A;  3CQZ K;  3VA0 A;  3M3Y K;  3G4S N;  3CCS N;  2V6T A;  3MN6 A;  5JVG L;  3MN9 A;  1J54 A;  3WNG A;  4FJJ A;  4Y0W A;  3C94 A;  4CJ5 A;  3I8B A;  5GAH P;  3PX0 A;  3IUC A;  1FJG K;  1BWF O;  3CQX A;  4AF1 A;  1U45 A;  1SFO C;  2NVX K;  4CJW A;  3HOV K;  4DHY A;  4FLY A;  3T1Y K;  4JK8 A;  4PWD A;  3S16 C;  2YKN A;  4NCG A;  4C3H K;  4DV5 K;  4IJA A;  4ISF A;  3FKI C;  5BPL A;  2HHQ A;  4PAB A;  4GV9 A;  3HPO A;  3T01 A;  1MU2 A;  3EE9 A;  3A5L C;  3LP1 A;  4FZB A;  3SLC A;  3EN9 A;  1IKW A;  4CJT A;  3MN5 A;  4DFJ A;  4AIL C;  4FJ8 A;  4IZ9 A;  1IW7 A;  4K25 A;  1L3V A;  3J8A A;  5SZT A;  3KLH A;  1T3V A;  3OHR A;  2GTD A;  1R9T C;  3QEW A;  5E41 A;  3S1R C;  2VG5 A;  2FSN A;  5JVH L;  1XXC A;  4Y7N C;  3ISN C;  3RMA A;  2F8S A;  4H4O A;  4PA1 A;  2HOE A;  1TWH K;  3RZD C;  5C2D A;  1IBK K;  4BRA A;  2O8C B;  3S3M A;  4M42 A;  4XH1 A;  1BO5 O;  3F9M A;  3CAG A;  2XY7 A;  4KH4 A;  2A69 A;  2ZFZ A;  2DTU A;  4GY2 B;  2PY5 A;  3SNN A;  2YCH A;  3OYL A;  1W97 L;  1BQM A;  3IG1 A;  1U49 A;  1IO2 A;  2VYP A;  3I33 A;  1SFO A;  4MLH A;  2A68 A;  4BY7 K;  3CI5 A;  1BL3 A;  5IT9 O;  3AVJ A;  3HKZ L;  4DR7 K;  2Q0U A;  4A3C C;  2O5I A;  2YHY A;  5C12 A;  3BP8 C;  2P1J A;  4Y52 C;  3E1Y A;  1QS4 A;  4O0I A;  3ZSZ A;  3QNO A;  4ID5 A;  4HVJ A;  4J3N A;  4QCL A;  4JS5 A;  4YFU A;  4OIN A;  5IP7 K;  4P5A A;  2FC0 A;  5IWA K;  4DSI A;  2AA4 A;  2WBN A;  4EIA A;  4K42 A;  5J2Q A;  3AO3 A;  2O8B A;  4KB4 A;  1UV7 A;  4A57 A;  3KWI A;  4XH4 A;  3L4I A;  1KCF A;  3BUZ B;  3DXM A;  1XC3 A;  2I5J A;  3CER A;  4DV6 K;  3NF7 A;  1VQK N;  1XWL A;  4DQS A;  2ZJR L;  4YHH K;  4B1X B;  1XI1 A;  3HOX K;  4BRQ A;  3QBW A;  1QQN A;  1U4B A;  5JMV A;  4JN4 A;  2V6S A;  4BVP A;  3OJS A;  3TI0 A;  5C0Y A;  2B63 K;  4EHU A;  4Z4C A;  4EHT A;  3KHY A;  3VGL A;  5CYQ A;  3KK2 A;  1DEJ A;  4RW6 A;  3OW2 M;  4E7L A;  3TTC A;  2OTL N;  4LFC K;  4FJ7 A;  1ASW A;  2P9L A;  2QEX N;  1D9D A;  4OIO A;  4GTL A;  1JL1 A;  4J8F A;  4ICL A;  1O24 A;  3AQO A;  1KVB A;  4FXD A;  1SS6 A;  2ITG A;  3O6W A;  4CHY A;  2FBY A;  3OYH A;  3A8J A;  3V6D A;  1XZQ A;  3EYZ A;  3DRP A;  3L3U A;  4HCC A;  3QIP A;  3VTI A;  1V4S A;  4IKF A;  3TSP A;  4M41 A;  4FWK A;  3VQA A;  3S3O A;  2OAN A;  1RBS A;  2YKM A;  3TSQ A;  3GTO C;  3CD6 N;  2KTQ A;  4CBU A;  3OA9 A;  1C0G A;  4C8M A;  3MED A;  1X31 C;  4CZL A;  1ZXO A;  5C4J C;  2RE2 A;  2Z1J A;  1UA1 A;  3SYZ A;  4EFH A;  1WQH A;  4AM7 A;  3CQ8 A;  4B9N A;  4FCY A;  1VSE A;  4DQI A;  4BGA A;  4E7I A;  4KHU A;  3DXK A;  4WYB A;  2JWL A;  3KIO A;  4A2A A;  1JLG A;  4BBR K;  4B9Q A;  4DF8 A;  3NVM A;  3FR0 A;  4LD0 A;  4AM6 A;  4Q5S A;  1QQC A;  4ZHR A;  1W0H A;  1RCH A;  1V5V A;  3SQ4 A;  2F9T A;  4CF9 A;  3HSC A;  1VSD A;  2FSJ A;  3OYM A;  2X6N A;  1VRT A;  3CYM A;  3OYF A;  1IH7 A;  1P90 A;  4DR4 K;  4M1X A;  1NKC A;  3V1Q A;  3A8Y A;  2VCP A;  4HTU A;  2Q3S A;  5GAD P;  1IG9 A;  3N0C A;  2XY8 A;  2HVH A;  4JHD B;  3BZK A;  4CW7 B;  2JA7 A;  4ZH4 A;  3AO4 A;  5FRN A;  3D0P A;  3ID6 A;  3RMC A;  4JI8 K;  1XHX A;  1SAZ A;  4PAA A;  1B9D A;  1RIL A;  3LWL A;  5AR0 A;  3M4O C;  4M3X A;  1FKO A;  4FJG A;  3R9P A;  4YDU C;  3L2Q A;  5KPT A;  1YCL A;  1K6Y A;  3S14 C;  3C0B A;  3GDQ A;  1TK8 A;  1IE0 A;  1B9F A;  3CPE A;  3BF3 A;  3ZEU B;  1HMV A;  2RF2 A;  3DRR A;  4DTM A;  5CE3 A;  1I50 K;  2OYQ A;  1V4T A;  1JLE A;  2V52 B;  4KI6 A;  2ZWH A;  4IO8 A;  3U8X A;  1TWF C;  3LDQ A;  1B92 A;  3KWG A;  2JA5 C;  1QVF M;  3SBT A;  2H3G X;  4CJ4 A;  4PY5 A;  2GWK A;  1VLO A;  4FJK A;  3AD9 C;  3ZET B;  4BC5 A;  1L3S A;  3P4I A;  3CF5 L;  4AYB L;  3WOD A;  2Q97 A;  4DV3 K;  4CGJ A;  1EET A;  2E2J C;  3FE1 A;  3VTH A;  3H46 O;  3ZSY A;  4BRN A;  3B6O A;  3F73 A;  3DRS A;  3VPZ A;  2BH1 A;  1QSY A;  1TKX A;  2GX9 A;  3OS1 A;  3TAB A;  1VQ8 N;  4LF5 K;  3NGI A;  1S6Q A;  2FBT A;  4MEX A;  1TK0 A;  4KAW X;  3HOY K;  1EFW A;  5AZJ B;  4FPB A;  4C45 A;  5C25 A;  5I3U A;  1R0A A;  3A0I X;  4CZG A;  1KRP A;  1IJJ A;  5HL7 L;  1NGJ A;  2GWJ A;  2CFA A;  3NBP A;  3GDZ A;  1BI4 A;  3LAJ A;  1QHT A;  3VQE A;  4W5R A;  1J5O A;  4XSX A;  3NF6 A;  3HP6 A;  4M3T A;  4WIL A;  3I4M C;  1ZBS A;  4BWM A;  1Q9X A;  3BDP A;  3V1O A;  3C6A A;  1S9G A;  4YOY A;  5EY4 A;  2XY6 A;  4P9S A;  4JNE A;  1TWF A;  4FVU A;  4X66 K;  5BRH A;  1DCH A;  4N56 A;  3CJ7 A;  5TMF A;  3C95 A;  2E2H C;  1ZBF A;  3HKZ D;  5FLM C;  4JI5 K;  3QB0 A;  4CD3 A;  3CFP A;  4CHP A;  5IYD K;  3T7Z A;  2D0B A;  1ZBI A;  2QM1 A;  3H08 A;  3AQP A;  4RMF A;  5C3E K;  3MCP A;  3L4K A;  3N0B A;  3ENB A;  2G8K A;  4I9Q A;  2P9K B;  2JA6 C;  4CE9 A;  4U67 L;  4LY7 A;  2IS3 A;  3THY B;  3EL2 A;  2XHB A;  3E9O A;  4DUY K;  1XZP B;  3OEP A;  5LJW A;  4C3I C;  4BDY A;  5EGH A;  5C4X C;  3BY5 A;  3O08 A;  2JA8 K;  1I3Q A;  3QET A;  4FL9 A;  3UKR B;  2GSN A;  3GTM C;  2QTD A;  4KB0 A;  3AH5 A;  1ZBL A;  1A5X A;  1NNE A;  2RHK A;  4KN7 A;  4X6A C;  3RVC A;  1SUQ A;  1YHQ N;  4I2P A;  4RTF D;  3D6R A;  4CFB A;  1IKY A;  1O2B A;  3THW A;  3I4N K;  2W40 A;  1IG8 A;  5DK5 A;  3N4P A;  3OYK A;  3WXJ A;  4FLV A;  5LY3 A;  3T1H K;  4GMJ B;  3PLA A;  5C10 A;  2RPI A;  4B1Z A;  2D5R A;  3MEG A;  5AQP A;  1K73 O;  3T69 A;  3LL3 A;  1GLD G;  4DKW A;  1WOQ A;  2G8U A;  5AQN A;  4H0T B;  1CXU A;  1NK9 A;  2JWK A;  3F2K A;  2E2I C;  1S6P A;  2O8F A;  3SUQ A;  3I0S A;  4A3M K;  5AQO A;  3VGM A;  2UU9 K;  4DSL A;  1N33 K;  1D5A A;  5EOY A;  4G7H A;  2VGN A;  3GTK A;  4G7O A;  3CCV N;  2IVN A;  4N5S A;  1KFS A;  3PUF A;  4BRM A;  1G51 A;  4GVE A;  5KGX A;  4FJM A;  2CW0 A;  3FZF A;  5AQY A;  3S17 K;  1T8E A;  1BHL A;  1KQ4 A;  1DCO A;  4G9Z A;  4CZH A;  4C8K A;  2HHS A;  1C1B A;  3GTL C;  5EXW A;  1C0T A;  4LOW A;  4A5B A;  3D2E A;  2DY4 A;  4CER A;  4BE0 A;  4A3L K;  2FBV A;  3H1Q A;  3I56 N;  1WLJ A;  1Q18 A;  2WUS A;  4BY9 C;  1WCM C;  3N4Q A;  4ILH A;  1WSE A;  5GIP A;  4KV8 A;  3VOV A;  2WTU A;  1HQM A;  2HHT A;  4KM9 A;  4JHD A;  3MEC A;  3RRG A;  4A3I C;  4B1U B;  2YU9 A;  4KPY A;  4DSK A;  4QIW D;  3FFI A;  1BGX T;  3CME N;  4JRP A;  4G7Z A;  3G0Z A;  3ZX0 A;  2IVP A;  2AJQ A;  1TWA C;  2D0A A;  4CED A;  3OBW A;  3ZCM A;  5AQH A;  3CMA N;  1Y1V A;  1CXQ A;  2YJF A;  3O9R A;  1AB4 A;  4B3R K;  1K8K A;  5IYB C;  3GTG K;  3OYB A;  4KC6 A;  4OPJ A;  1BIZ A;  3LDO A;  3GTJ C;  3S2D K;  2O8B B;  4FJX A;  2VUM K;  5AQF A;  5FLX O;  4MLE A;  4OGE A;  3TTG A;  3CHW A;  3P83 D;  3AO1 A;  2CH5 A;  4AHS A;  3DXM B;  2YNH A;  4FW1 A;  4DTP A;  3DLR A;  4G0V A;  5LJV A;  4BY1 K;  3AVM A;  3HRG A;  3GTL A;  3KLF A;  4A3G K;  2PHC B;  2OZM A;  1DKG D;  2BGG A;  5KPZ A;  4GZY A;  3ENO A;  4WFN L;  5ADX H;  3ZET A;  2O4I A;  4ILD A;  4FWR A;  3S1M C;  3LPU A;  3PO2 C;  1O28 A;  2ETJ A;  3O4N A;  4MDB A;  3O3F A;  2HMP A;  5JS2 A;  5M1F A;  4FWL A;  4AYB D;  4KI4 A;  2FSK A;  4QAG A;  5AQU A;  3S41 A;  3CM5 A;  2F4V K;  2P9L B;  4H0O A;  4NB4 A;  1WBD A;  1L3U A;  3MWP A;  1VK0 A;  5KGW A;  3TWH A;  1B4A A;  1G99 A;  4KHN A;  1O1W A;  4JYA K;  2VQF K;  3SUN A;  5C42 A;  1VJE A;  5JVO A;  4FWO A;  1XZQ B;  4PKI A;  2PAV A;  2Y3P A;  3PO3 K;  3EY1 A;  3UIQ A;  1VRU A;  3O9Q A;  5TKY A;  4HUG A;  2E1Y A;  4DQ8 A;  1OKJ A;  3M3Y C;  5BRF A;  3HVR A;  3AO2 A;  3PX4 A;  4DR5 K;  4CZE A;  4BRG A;  4CEZ A;  1NGB A;  2A6E A;  4A3E C;  4CJQ A;  5M1Q A;  3WNH A;  2HBJ A;  3AA4 A;  2OZS A;  3HOZ K;  1DCP A;  4JK7 A;  1XNR K;  3BP3 A;  3TTF A;  3VQC A;  4C3H C;  5A2Q O;  4DB3 A;  2PYJ A;  2Q2R A;  2QWQ A;  4B9V A;  2NVY A;  3KZB A;  4N47 A;  2GBZ A;  3O5B A;  1D4X A;  3NH2 A;  3CCQ N;  3AO5 A;  2R92 A;  2XCO A;  4PKH A;  2WON A;  2ZJP L;  3DMJ A;  1VGX A;  3W0L A;  2X78 A;  4CJL A;  4AQY K;  2NVY K;  1T03 A;  3VN5 A;  2O4G A;  1F93 A;  2NVT K;  4QOZ B;  3ORE A;  4OIR A;  5AJ3 K;  3OYN A;  4DU4 A;  5E68 A;  3WEE B;  3CXC M;  1BDF A;  1BIU A;  3THY A;  3IRX A;  2WAQ D;  2NRR A;  3J7Z O;  3NE6 A;  4DU1 A;  5I42 A;  3M3Z A;  3HT3 A;  3RR7 A;  3DLB A;  3S2H K;  1SV5 A;  1ITG A;  3VMF B;  3HOW K;  3ZT2 A;  1YT3 A;  1RDA A;  4QS7 A;  4LQY A;  2NRZ A;  3UKR A;  3SV4 A;  1VQM N;  3PO4 A;  3HST B;  3F5T A;  3CQZ A;  4DDQ A;  4DV1 K;  4J2D A;  1RDB A;  4CIE A;  4BR0 A;  4KTQ A;  4OPA A;  3LP3 A;  4KMH A;  3HM8 A;  3A5M C;  1KLM A;  3LDN A;  4DSF A;  3TAF A;  1N34 K;  2Q36 A;  4CBW A;  2NVX A;  4BVO A;  3PX6 A;  1VSM A;  4CCH A;  3G4C A;  2EWS A;  4A3K C;  3E01 A;  2GV9 A;  5HRP A;  4IFY A;  5LMN K;  3S15 C;  2YNI A;  3S1Q C;  1HKB A;  4BRL A;  4DF4 A;  4R5P A;  1LW0 A;  4DV2 K;  4FOE A;  3HOU K;  5E84 A;  3MMV A;  2QWM A;  1UWB A;  4RCH A;  1ZQ1 C;  3OS2 A;  4G0W A;  3JSM A;  4K43 A;  3P5J A;  4EP4 A;  3WNE A;  4GTB A;  1YVU A;  4RG8 A;  4FK4 A;  5IYC K;  1TL1 A;  3QFP A;  1BG3 A;  2D0C A;  1TWH A;  2WB1 D;  1XPP A;  1N8R O;  4DR6 K;  4J2A A;  4LJZ A;  1Z6R A;  5TJ3 A;  3EZ5 A;  3MXJ A;  1K83 K;  3SK3 A;  3JS6 A;  1GOA A;  2B63 C;  1BDG A;  5M1K A;  3R3L A;  4BC3 A;  5IOS A;  3VQ5 A;  4HUF A;  1RT7 A;  4AHV A;  4IJN A;  2OPP A;  4DU3 A;  3LAP A;  3A5O C;  3HXM A;  3TFH A;  2CFA B;  1UAX A;  1BI4 B;  1W7A A;  4IDH A;  1JLA A;  4DSJ A;  4IG0 A;  3P1G A;  3ENH A;  1D9F A;  2G8W A;  3VEZ A;  4ISG A;  1T7P A;  3FHZ A;  4QS8 A;  4LR2 A;  3L2W A;  3EQL A;  5HRS A;  1RBV A;  2WFB A;  5EVZ A;  1FK9 A;  1TVR A;  4C8L A;  4FK0 A;  4JKB A;  2IIR A;  4IOC L;  2OA8 A;  2A40 A;  2A5X A;  3OBY A;  4JI4 K;  4Q5V A;  4OO1 J;  1C1C A;  3SUP A;  4YFN A;  4WJ4 A;  1Q7Y O;  3I55 N;  1HPM A;  1UA0 A;  4GT9 A;  3NMU A;  3FOE A;  4FVM A;  1X9S A;  4L3Q A;  4YOX A;  4EZ9 A;  3NHG A;  3UB5 A;  3ZT1 A;  4HTL A;  1IKV A;  1WN7 A;  3K5O A;  1ZYQ A;  2A3Z A;  2HBM A;  1WSI A;  3S1N C;  1QQO A;  2HHW A;  4KDD A;  1KAZ A;  5JS1 A;  4B8A B;  3SAG A;  4H5N A;  4O5F A;  4RW9 A;  2B63 A;  3VEO A;  2YHA A;  1USM A;  3O1W A;  1Q82 O;  4IBN A;  2PMZ D;  3VQB A;  3GTP K;  3CC4 N;  5FPE A;  3KLG A;  2NRT A;  3DOL A;  1TAU A;  1FXX A;  4DTO A;  4XEI A;  3M6G A;  1SL1 A;  1J9A A;  1J6V A;  1QVG M;  4JKD A;  3VF6 A;  3THW B;  3H3N O;  3VEW A;  3AVI A;  2G8H A;  1EK8 A;  5FRM A;  4KH5 A;  4MQ3 A;  4A5A A;  1REV A;  3S1R K;  4KAZ A;  3AD7 C;  4Y7N K;  2LSN A;  4U7B A;  1NJW A;  1KLN A;  4A3J C;  1ASV A;  4OX9 K;  2HBK A;  4OKK A;  2JA7 C;  1Z05 A;  2E2P A;  3QES A;  2X6S A;  5FPN A;  2HST A;  2B4J A;  1TKT A;  4NXM K;  2CGL A;  4BRO A;  3AV9 A;  4A2B A;  3KD1 E;  2O8F B;  3TAM A;  2NRV A;  1F7V A;  1HR0 K;  2Z1G A;  4HHT A;  5CY4 A;  2KKZ A;  3TSU A;  5T7B A;  1YJ9 N;  4DTX A;  4JI7 K;  4LF9 K;  1EH1 A;  1VQ5 N;  2QWP A;  4NLC A;  4CIG A;  3HO1 A;  4YOU A;  2QK9 A;  4DTR A;  2DPN A;  4KBO A;  3TAP A;  3SJH A;  2DFE A;  4A3C K;  3J81 O;  2YHB A;  1GLA G;  4CEC A;  3K7A K;  1JVI A;  1O27 A;  1JCF A;  1X3M A;  3RSE A;  4CJ3 A;  2BE5 A;  3D2E B;  2EBB A;  3IAY A;  1OH6 A;  1CLQ A;  1PJ5 A;  5DM7 L;  4A3B K;  5EU7 A;  3DM2 A;  2YNG A;  2QW9 A;  3GTQ K;  4CK2 A;  4DQP A;  1XQS C;  4TSX A;  4F8R A;  3AD8 C;  3WEE A;  5K14 A;  4BRI A;  3ATU A;  3C6T A;  3CJC A;  4HUE A;  5AZI A;  2Q0R A;  1ZC6 A;  5BPM A;  2W42 A;  1KAY A;  1IBM K;  5M1N A;  2Y0S L;  2YV0 X;  2RH6 A;  3DJC A;  4N76 A;  4LF4 K;  3HOY C;  4OIQ A;  4ELV A;  5F0X A;  3VQP A;  4G0U A;  3MXI A;  5M1P A;  5C44 C;  5TKW A;  4KMD A;  3QX3 A;  3L4Q A;  4ZTF A;  2GAH C;  2KFN A;  3MML B;  3NUH A;  3OYC A;  4YFX A;  5KQD A;  3T3F A;  2EHG A;  3L8B A;  3H3V L;  3GG4 A;  1U6Z A;  5AQZ A;  3KLE A;  3ALY A;  4KHS A;  2GSO A;  1TK5 A;  1I50 A;  5GAG P;  4DTJ A;  1K8K B;  4K8Z A;  4WQ5 C;  1PJ6 A;  5L46 A;  5AQS A;  5IP9 K;  2FF3 B;  4C2M C;  4GTD A;  4KN4 A;  4CEO A;  1KVA A;  4BR4 A;  4E1M A;  3O1B A;  3O8M A;  3AVB A;  3VEV A;  3RMD A;  2HW3 A;  2XY5 A;  3VET A;  1GOC A;  4FO0 A;  2E4L A;  3QLH A;  4H5R A;  1MDU B;  2D6F C;  3HOS A;  3N3Y A;  4QS9 A;  5C3E C;  3DOK A;  3VA7 A;  2FXU A;  5HLF A;  1GLE G;  4BRD A;  3L3V A;  5AFU A;  3NVK A;  1TWG A;  3NH0 A;  3G4A A;  4A3F K;  3GTO K;  3SPZ A;  2BTF A;  2PZS A;  1CZA N;  5C4J K;  1HYZ A;  1NK7 A;  4A3D K;  4GTC A;  4DTN A;  1TWG K;  2DFF A;  3CCJ N;  4CGI A;  1XUP O;  1YF5 L;  1M1K O;  3P31 A;  3NH1 A;  1VQ9 N;  3M8P A;  3M8Q A;  3HYF A;  3SMP A;  4WFB L;  1VH2 A;  4O2D A;  3D2F B;  1YIT N;  3G6E N;  4YOV A;  2E6L A;  4F3T A;  4E1N A;  1NGH A;  1Y64 A;  2QXF A;  5BRD A;  1YAG A;  1NGA A;  1I3Q C;  2HMI A;  2QA4 N;  3CC2 N;  3TTD A;  2Z1H A;  3AAR A;  4DLG A;  3J80 O;  3I4N C;  2O8E A;  3LP2 A;  4WQ5 A;  2QI2 A;  3DAW A;  4X62 K;  1VSH A;  4BDZ A;  3TAE A;  4GW6 A;  5AQK A;  3V1R A;  4M3U A;  1JL2 A;  4H5W A;  5AQI A;  2PYL A;  4FJH A;  4C1N I;  2YX6 A;  2W6K A;  3H6E A;  4E7K A;  1XC9 A;  5B8H A;  3OY9 A;  4DLE A;  1P8Z A;  1S72 N;  2ITM A;  3T02 A;  2PA8 L;  3OVN A;  4H4M A;  4L8R B;  5BN8 A;  2FF6 A;  4OPK A;  4KM8 A;  1WQF A;  4NXN K;  1J6X A;  4KO0 A;  4JV5 K;  3CFR A;  2F9W A;  4M7X A;  4H8K A;  3ZSR A;  4C1N K;  1NBW A;  1J5E K;  3VQ7 A;  1K9M O;  4ELU A;  2ZF5 O;  3I0R A;  1G15 A;  4CEA A;  1U47 A;  3S14 K;  1NK5 A;  2WC9 A;  4KHY A;  5CHI A;  1FKP A;  3CCR N;  1ISE A;  1ASU A;  4CI6 A;  4WCE L;  1WAJ A;  3S17 C;  1J6W A;  3GTK C;  3OYA A;  3AY9 A;  3GIR A;  3WXK A;  5JIC A;  2F8T A;  4KB2 A;  3ZSO A;  1NMD A;  2JA5 K;  1CZ9 A;  1BOT O;  1GLC G;  4CJS A;  3H1V X;  2O8D A;  4BWJ A;  2DFH A;  3K5M A;  4C8O A;  1NKE A;  5IOQ A;  2ZUE A;  1YNJ A;  4JI2 K;  1QZ6 A;  4AH9 A;  2E2Q A;  1A5V A;  4BRK A;  4O44 A;  3ZYY X;  2E2J K;  2PFU A;  1NOZ A;  4M45 A;  3PV8 A;  2XRI A;  1YUW A;  2QXL A;  4XIU A;  2IGI A;  3W3D A;  1NK8 A;  3KJV A;  2QWO A;  1LOT B;  3IDH A;  5M1O A;  1JCG A;  1EXQ A;  4PKG A;  3K57 A;  1JQW A;  1TKD A;  3HOT A;  3PIO L;  1NKB A;  4XLN A;  4DFK A;  1TAQ A;  2D4W A;  3O80 A;  1C0A A;  1GE9 A;  1EWQ A;  4NCB A;  1BGW A;  2YU9 C;  1Q9Y A;  4WJ3 M;  4Z0U A;  2NRH A;  2NVQ K;  2GEM A;  4CGD A;  4CF0 A;  4DTU A;  1O2A A;  1UOC A;  1TGO A;  2KFZ A;  3K2P A;  3LM2 A;  1XHZ A;  4CHN A;  4DUZ K;  2QWR A;  4CK1 A;  2JH3 A;  1ESV A;  1WBB A;  3I4M K;  1TUY A;  1Y1V C;  1OH7 A;  4LK1 A;  1XXB A;  1RTI A;  4BC2 A;  2VUM C;  3FGU A;  4IEE A;  1SZ2 A;  3RWU A;  3AA3 A;  1OVQ A;  5FPD A;  3RZO C;  4YY3 K;  4ISE A;  3G71 N;  2B6A A;  3KK3 A;  5M5Y K;  4MDA A;  1H1V A;  4NYF A;  1S1X A;  2E2H K;  3AVL A;  2Q1N A;  3HPH A;  3WXM B;  4B1Y B;  3NF8 A;  3K0S A;  3V9U A;  1JLF A;  1F21 A;  4JKC A;  3DLL L;  5AQW A;  4LF6 K;  5HRN A;  5JFE A;  2FBX A;  4DCH A;  4GTE A;  3CPW M;  1GLF O;  4JKE A;  4CGG A;  1YI2 N;  3VQQ A;  1S9E A;  3O9U A;  3AAP A;  1RU0 A;  4LK0 A;  2JA6 K;  1O26 A;  3NGZ A;  4FM1 A;  2QKK A;  4EZ6 A;  1S22 A;  5D3G A;  4LSN A;  3B8A X;  1O13 A;  4CJK A;  3AVH A;  3M8R A;  4KRF A;  3Q7B A;  3AGR A;  3WQT A;  3OYD A;  1IV0 A;  5KRS A;  3IKM A;  3DLG A;  2Y0S D;  4C3I K;  3U3Y A;  4CEQ A;  2XO7 A;  3ID8 A;  2VWJ A;  5C4X K;  3ZSX A;  1RFQ A;  3VEX A;  3KKR A;  1RT4 A;  4JKG A;  2HHX A;  5AFU H;  3GTM K;  4BC4 A;  1VSK A;  4YOT A;  3GTG A;  4V19 S;  3GTQ A;  3K58 A;  1O25 A;  1TUU A;  4QJV A;  5C24 A;  3H0G A;  4GTF A;  3BGR A;  4DTS A;  3CG7 A;  4BBS K;  4X6A K;  3JXU A;  1NLV A;  2IOC A;  4MO4 A;  5H1S Q;  3FZH A;  5E26 A;  4H0X B;  2CH6 A;  1TWC A;  4BRH A;  2VUM A;  1JLB A;  4GVM A;  4BRC A;  5JLH A;  1I6H K;  2D0P A;  4B3T K;  4C3J C;  1CZB A;  3AAQ A;  1YTU A;  4Q4Z A;  5M3F K;  3H0G K;  2KHO A;  5CJ9 A;  1NJI O;  2GEL A;  4BE2 A;  1TWC K;  4E19 A;  5BR8 K;  3SI6 A;  4DFP A;  1HNI A;  1RDU A;  2VWB A;  1OH8 A;  5HL8 A;  4FJ5 A;  3MN7 A;  1HLU A;  2QWN A;  2NVY C;  1SKW A;  2R92 C;  4OGC A;  4Z4G A;  2VWK A;  4N41 A;  4FLT A;  3SZZ A;  4EAH D;  3ZSW A;  1RDW X;  5SWM A;  4Z4F A;  1KQS M;  2KZM A;  4GKK K;  1X9J A;  1YIJ N;  4YNQ A;  3GSI A;  4O8K A;  1QQM A;  2AP1 A;  1OH5 A;  4JI1 K;  4CBX A;  3THV A;  4BAC A;  3A2F A;  2P8T A;  3SAF A;  3VQ9 A;  5FPM A;  4CVN E;  3SAH A;  4KMA A;  3IFR A;  4KTZ A;  3PSI A;  4OLB A;  4E7H A;  1WOO A;  3D2F A;  2HHV A;  2IAJ A;  4X65 K;  4K8X A;  3AA2 A;  3TAR A;  1DGK N;  1Q81 O;  5I9E B;  4GV6 A;  2A1S A;  2P5M A;  4FLU A;  1LAV A;  1MWM A;  4WF9 L;  2R93 A;  3CQZ C;  3LZJ A;  3TAG A;  3HL8 A;  4BRP A;  1VQN N;  1LWC A;  4WQ4 A;  1BUP A;  4XSZ A;  4M7Y A;  4CEB A;  1NK6 A;  2A6A A;  1WCM K;  2R93 K;  1I94 K;  2NVX C;  2VG7 A;  3HOV C;  4JK9 A;  4CGH A;  4BG8 A;  5KI6 A;  1RBU A;  1S1V A;  2P9S B;  3LDL A;  3ZX3 A;  1T6D A;  3OYJ A;  3ASM A;  1TL3 A;  4W5N A;  3HOU C;  4FZY A;  3A5N C;  3K59 A;  4IDK A;  1NU0 A;  3V9S A;  4LFA K;  4I6M B;  3FZK A;  3UKU A;  2OPQ A;  3RSE B;  4ILG B;  1NGD A;  3OS0 A;  1TWA K;  1XNQ K;  5IYC C;  2JGU A;  4DS4 A;  2Y1J A;  3Q7C A;  4IEI A;  5IYB K;  4A62 A;  3LDP A;  4B1V A;  3T19 A;  2J4R A;  2BAN A;  3GTJ K;  2ASM A;  4FWM A;  1EX4 A;  3RR8 A;  5AZI B;  1DT9 A;  3K9K A;  4IFV A;  4B9T A;  2FQO A;  3S0X A;  3VQD A;  4LH5 A;  4M3W A;  1BJT A;  3LP0 A;  1TWH C;  4NOI A;  5KQ8 A;  1XMO K;  1F7U A;  4KAR A;  3CCL N;  3AVF A;  2E1Z A;  1MA9 B;  3VF2 A;  2A1R A;  2RN2 A;  3TAN A;  5AQM A;  3KTQ A;  5M3M K;  4B9L A;  3U9Z A;  1N36 K;  1A5W A;  2VGM A;  3LWM A;  3PO2 K;  1KAX A;  1WUA A;  4C8N A;  3IPJ A;  5EX5 A;  2D1K A;  4KFB A;  5CHP A;  1Z25 A;  3ATV A;  4JAX A;  2P9U A;  1C0M A;  4B8C A;  4FM0 A;  1VSF A;  1HNV A;  4BY7 C;  2ZE2 A;  1VRQ C;  1K8A O;  3H3O B;  5J2N A;  4JK1 A;  4JKH A;  1SL0 A;  4BQL A;  1VSJ A;  4P5B A;  3KVG A;  3MK6 A;  1E4G T;  2FLO A;  5AQX A;  4W5T A;  4CGF A;  4E7J A;  4IO9 L;  2A6H A;  3R1X A;  3LZI A;  4DQR A;  2Z1I A;  5IP7 C;  5FDL A;  2GSU A;  3AVG A;  1S1T A;  2R7Y A;  4HCB A;  1EO1 A;  4DR3 K;  3S9H A;  4A3E K;  3QO9 A;  1GOB A;  4JI6 K;  4CEE A;  4BR9 A;  2P9N A;  4CZI A;  1K83 A;  4B3S K;  4FW2 A;  5GIN A;  1J6Z A;  3MCA B;  4M3Z A;  1VQ7 N;  5GIO A;  4ZTJ A;  4BXX K;  1BQN A;  2HBL A;  3GTP C;  3HOX C;  2E2O A;  3SCX A;  4G1Q A;  1C6V A;  4F3O A;  1WSH A;  4DSE A;  1X9W A;  1NWK A;  3QML A;  3AVK A;  1NGE A;  4A93 K;  3CJ1 A;  1NJX A;  2NNW A;  4NLB A;  5CYM A;  4IG3 A;  1JOE A;  5IOR A;  4BLA A;  4CJP A;  4F2R A;  3IS9 A;  4A59 A;  3U3G A;  3C7N A;  2O8E B;  3WXL A;  3KD5 E;  2P9P A;  3QEI A;  3K5N A;  2P51 A;  4X64 K;  3B6P A;  4JRQ A;  4F4K A;  1Y1W A;  3L4J A;  4M3R A;  3CJ9 A;  4JLH A;  1NG9 A;  3E66 A;  3PIP L;  2E5L K;  3K5L A;  1Y1W K;  3DI6 A;  2BUP A;  2R7Z A;  3DWL A;  3MX5 A;  4RW4 A;  3E9P A;  4CF1 A;  1VQ4 N;  4OLA A;  5AQR A;  2D0O A;  3HBT A;  1U2V A;  3DLH A;  2R7Z K;  3BF1 A;  4KHQ A;  3FFK B;  2NUB A;  3HPG A;  4K41 A;  2UXC K;  2A42 A;  1KFD A;  3L0Q A;  2E88 A;  2Y1I A;  4FSV A;  1X9M A;  3L6Q A;  4IXC A;  3ADA C;  1VSL A;  3MWT A;  4I7F A;  1IBL K;  4A3K K;  4FZZ A;  3S15 K;  3GTP A;  1SFO K;  4BBR C;  3SPY A;  3FKI A;  3K7A C;  3SQ1 A;  3J7A P;  3S1Q K;  4CJF A;  1KSP A;  4KHW A;  3S16 K;  1NMN A;  3U4L A;  5KPR A;  1JLC A;  2ZD1 A;  3OPF A;  3LAK A;  2O8D B;  4A3B C;  3EKS A;  3FKI K;  5EGE A;  2WOM A;  2IDO A;  4Z4H A;  4NYN A;  3HXA A;  4Y1D A;  1ZBU A;  1R9T A;  1NK0 A;  3GBT A;  1YNN A;  2NLX A;  3AVN A;  2X74 A;  4FWQ A;  1RTD A;  4CEF A;  4BDP A;  1WSV A;  1WSG A;  2ZM6 K;  2E6M A;  4H5T A;  4JKA A;  4CFC A;  1IBA A;  1LWE A;  1BA0 A;  5JLF A;  1R9T K;  4PUO A;  4CHZ A;  4F9O A;  3WUH A;  1RTJ A;  4NO7 A;  4PQU A;  1W2B M;  1JXB A;  3RZD K;  3KK1 A;  1M90 O;  4BG9 A;  4KB1 A;  4B9U A;  2HF3 A;  4LFB K;  4CES A;  1ATN A;  3BUE A;  4JEP A;  4H0Y B;  5IP9 C;  1HJR A;  3F9K A;  3O3G A;  4MO5 A;  4BQZ A;  3MXM A;  5BN9 A;  1I50 C;  1NM1 A;  3FOF A;  4FLW A;  2ASO A;  3ZSQ A;  1RT6 A;  2UXB K;  3DLK A;  1RT5 A;  4C23 A;  4JD2 B;  3JAM O;  2KLA A;  2BE2 A;  2P9S A;  5HP1 A;  3BP8 A;  3V81 A;  3T00 A;  3QIO A;  2O5J A;  3LAN A;  4DR1 K;  3ULD A;  1EQR A;  3V4G A;  3LAM A;  2B5J A;  1JJ2 M;  3MDQ A;  1EKE A;  4I6M A;  4JI3 K;  4A3F C;  4J2B A;  3P39 A;  4Y52 K;  3VQ8 A;  1RT1 A;  3SQ0 A;  3M1F A;  5BRE A;  1IL2 A;  2W6L A;  3EEQ A;  1KXP A;  1D8Y A;  5M5X K;  4MEY A;  4A3D C;  5HBM A;  4AHC A;  4NCA A;  1TWG C;  4DQQ A;  2YJE A;  4KKO A;  3EKU A;  3HZ6 A;  1PJ7 A;  1HKC A;  1TKZ A;  1HNZ K;  1J53 A;  1KTQ A;  1JLQ A;  3SBG A;  5BR9 A;  3S1N K;  3E9L A;  3O9S A;  1VHX A;  4EP5 A;  1S1W A;  4UQG A;  5C15 A;  4HWI A;  5C2F A;  2RKI A;  4K0K K;  1C1A A;  4CJR A;  4UY8 O;  4ELT A;  4Z4I A;  3MX2 A;  4M3Y A;  1W9H A;  4O0J A;  4JKG B;  3OJU A;  2Q31 A;  4LH4 A;  1SL2 A;  1FW6 A;  3HI0 A;  3OTO K;  1ZYR A;  4DFM A;  4QJV B;  2V51 B;  1RBT A;  4OVL A;  5MLC Q;  1YVN A;  1E3M A;  3Q3Q A;  4AHT A;  4FM2 A;  5LMU K;  2UUB K;  3QER A;  3CCU N;  3VQ4 A;  1WB9 A;  2GUP A;  3VEY A;  2F7T A;  3O3H A;  1YX2 A;  4QIW L;  1NJZ A;  3WT0 A;  4IOA L;  4OKE A;  4DG1 A;  4IWV A;  5AQT A;  1F9N A;  1NGG A;  4PL7 A;  3NFA A;  4A3J K;  5AQL A;  1GLJ O;  3TFI A;  4AHU A;  4CFA A;  1RT3 A;  5AQJ A;  5IYD C;  1T44 A;  3ERE D;  2JA7 K;  3GTO A;  1VQP N;  4MQ9 A;  3CIP A;  1HNW K;  4CD1 A;  4BRF A;  3GEH A;  2PPB A;  4WFA L;  1I39 A;  4FWN A;  2KW4 A;  2VG6 A;  1TYQ B;  3H45 C;  3QFU A;  1S5J A;  1U04 A;  2ASP A;  4LLG A;  1DTQ A;  2NZT A;  2W41 A;  1YXQ A;  2ZUF A;  4B9M A;  4H0P A;  4LF8 K;  4Q0B A;  1IKX A;  4RWT A;  5AQV A;  4JS4 A;  2JA8 C;  2XCR B;  4Z4E A;  1HKG A;  1L0W A;  2IC3 A;  3DLE A;  1Q8I A;  2YNF A;  2UUC K;  4YFK A;  2ZGY A;  1QSS A;  4DMN A;  1VQ6 N;  1ZBH A;  1NGF A;  3HTV A;  3L2U A;  4KAS A;  4CK3 A;  3SUO A;  1EWR A;  3J7Y P;  4BRE A;  1I6V A;  4FZX C;  4W5Q A;  1U48 A;  2P9I B;  4FJL A;  4E3S A;  1WSF A;  3UE5 A;  5F1X A;  1HQE A;  3BZC A;  3D45 A;  2OPR A;  3D7E O;  2W7V A;  2HHU A;  1SKR A;  1R59 O;  1YJW N;  1O2F B;  4Y1C A;  3EE8 A;  2JLE A;  1KD1 O;  3WQU A;  3GE1 A;  5KTQ A;  2O8C A;  5CZ1 A;  2A41 A;  3ZT3 A;  4E1J A;  3HK2 A;  5C44 K;  1LV5 A;  2NVQ C;  4A61 A;  2GUI A;  1BA1 A;  1TV6 A;  1WSR A;  1Z26 A;  5ADX A;  4YDU A;  4CZK A;  3UKU B;  4FPA A;  4A3M C;  4CJV A;  1EQY A;  3ULE B;  3M4O K;  3VEN A;  3VES A;  2QKB A;  4FJI A;  1S1U A;  1USO A;  3A8K A;  3LM9 A;  5KRT A;  3CC7 N;  1HI9 A;  1QTM A;  4CJU A;  2IVO A;  5J2M A;  4BR5 A;  3HM9 A;  1ZVU A;  4C2M K;  4DV7 K;  2JA5 A;  3C65 A;  1NOY A;  4PL8 A;  1WSJ A;  4WE1 A;  2I7N A;  4FM9 A;  3QNN A;  1TWF K;  1N6Q A;  3O9T A;  1WAF A;  4JKF A;  2ZQB A;  4CZF A;  2RGR A;  3SV3 A;  1RDD A;  1RTH A;  1BIS A;  1LWF A;  4A3L C;  3LDS A;  1MWK A;  4DV0 K;  1X1P A;  2HNY A;  3KLI A;  5DM6 L;  3QEV A;  4O55 A;  1BU6 O;  1LCU A;  1BCO A;  2KQ2 A;  2P5O A;  1HRH A;  4IFE A;  2WAQ L;  5J1E A;  3PO5 A;  1KC8 O;  4E89 A;  4CJ7 A;  3GL1 A;  2ATQ A;  5HRR A;  2UXD K;  2P9U B;  4O4G A;  4AHR A;  3V4I A;  2HF4 A;  3OYG A;  1WIH A;  4YOR A;  2NRW A;  5LL6 Z;  5F2R A;  3WXI A;  4YOW A;  5FRO A;  3I8D A;  3V9Z A;  1HX1 A;  3S3N A;  4KAT A;  3THX B;  3U6F A;  2P5G A;  1DD5 A;  4FYD A;  1I3A A;  4ILJ A;  4JI0 K;  2PBD A;  1BCM A;  1C0U A;  2NRX A;  4BBS C;  4XCH A;  3VGK A;  3TU5 A;  1HUX A;  2HB5 A;  2HHH K;  1I3Q K;  4KMU A;  1HJO A;  4GNI A;  1I6H C;  3GTG C;  4KH6 A;  3GTQ C;  3V9X A;  2V7Y A;  1RNH A;  3H0G C;  1RBR A;  3JYT A;  3S2D C;  1ILY A;  1WOP A;  1TWC C;  4CZM A;  4GKJ K;  3R6M A;  2E2N A;  4R79 A;  3NGY A;  3ZT0 A;  2E2H A;  1ATS A;  2HNZ A;  2P9N B;  5AQQ A;  3TR8 A;  4JD2 A;  2VQE K;  2V6U A;  4BY1 C;  1WOR A;  5M5W K;  4LF7 K;  4B3O A;  4FLZ A;  1N32 K;  4A3G C;  3L2V A;  3RRH A;  1QHA A;  1L5U A;  3IMX A;  2OPS A;  1VAZ A;  3OYI A;  2YI1 A;  3WNF A;  5FLM K;  4GV3 A;  1NK4 A;  5CR4 A;  4F2S A;  2JA6 A;  2G8I A;  1IS1 A;  1BS2 A;  1DTT A;  3AGK A;  1E4F T;  4DV4 K;  3QIN A;  4H0V B;  1YJN N;  2WB1 L;  3C7N B;  3O4W A;  3JST A;  4BGB A;  4GTA A;  2P9P B;  3NAE A;  1YTA A;  2UUA K;  1NGI A;  3GTK K;  1INN A;  5TMC A;  5ELZ A;  3U9D A;  3GTM A;  3DXJ A;  4FK2 A;  3PO3 C;  3L2R A;  3PSF A;  4GFQ A;  3AA5 X;  4BE1 A;  1NJY A;  1XMQ K;  1JKH A;  1RGI A;  4O5B A;  1HNX K;  4J2E A;  3BEX A;  1U2V B;  3SZY A;  3H3V D;  2R93 C;  3HOZ C;  4E0D A;  3CM6 A;  4B3M K;  4BKW A;  3V9W A;  4FOI A;  3GOI A;  4WQ4 C;  2ZJQ L;  3CET A;  2GAG C;  3C6U A;  3A8I A;  4OJR A;  4DWI A;  1NGC A;  4LC9 B;  4LSL A;  3MEE A;  3ZT4 A;  4CIF A;  2V7Z A;  1SKS A;  2E2I A;  3FZL A;  5FJ8 K;  5DMR A;  3ITH A;  4OPH A;  2YU9 K;  2NVT C;  4BR7 A;  1GLL O;  2UYT A;  4XH5 A;  1VQL N;  1HQU A;  4RW8 A;  4IOX A;  1JCE A;  2E2I K;  1TYQ A;  4B08 A;  5GAE P;  2FQT A;  3ZEU A;  4CF2 A;  1QSL A;  2YHX A;  1Y1V K;  3RTV A;  4FJ9 A;  3NF9 A;  1OVY A;  4CF8 A;  3CFO A;  3S2H C;  1C0F A;  4FWS A;  1L3T A;  3MAQ A;  1J98 A;  3FLC O;  4FJN A;  3QIC A;  1XXA A;  5D4D A;  3RZO K;  1SQK A;  2PMZ L;  2CGJ A;  3HOW C;  4H03 B;  1RDC A;  1X3N A;  2G8F A;  3QBX A;  3SQ2 A;  1GLB G;  3NDK A;  3NCI A;  4W5O A;  2I7P A;  4OKJ A;  3GEI A;  3GTL K;  1VSI A;  1LAW A;  5CZ2 A;  3TPQ A;  1EP4 A;  5HOO A;  1DLO A;  1QZ5 A;  4DR2 K;  1WCM A;  1Q86 O;  2ZGZ A;  1HYV A;  2P9I A;  3AVC A;  1O29 A;  4H5V A;  3DYA A;  3EZW A;  4FLX A;  1WNS A;  3EO3 A;  2XCQ A;  3VA3 A;  4B9S A;  2OCE A;  3ZSV A;  3KKS A;  4CZJ A; 
#chains in the Genus database with same CATH homology
 3MX5 A;  3CJA A;  3E9P A;  3WXJ A;  1VQ4 N;  1I50 A;  5AZJ A;  5GAG P;  1K8K B;  3M5R A;  5AQR A;  2D0O A;  3HBT A;  5LY3 A;  4WQ5 C;  1U2V A;  1TWA A;  5AQS A;  3CJB A;  2FF3 B;  3G25 A;  3PLA A;  3BF1 A;  5C10 A;  4C2M C;  4GTD A;  3FFK B;  3KK7 A;  4K41 A;  1VQO N;  2A42 A;  4B1Z A;  3L0Q A;  3QDK A;  2E88 A;  2CGK A;  4BR4 A;  3O1B A;  4BLB A;  3O8M A;  4FSV A;  5AQP A;  3ULE A;  3T69 A;  1K73 O;  3LL3 A;  3GTJ A;  1GLD G;  3VEV A;  4DKW A;  3L6Q A;  1WOQ A;  5AQN A;  3VET A;  4H0T B;  4IXC A;  3CCM N;  4FO0 A;  2JWK A;  3F2K A;  3MWT A;  5IOT A;  4H5R A;  3VER A;  3VF4 A;  1MDU B;  3C6H A;  3R8E A;  5AQO A;  3VGM A;  3GTP A;  3HOS A;  3N3Y A;  3FKI A;  4QS9 A;  3VA7 A;  2FXU A;  5EOY A;  1GLE G;  1S3X A;  4M63 C;  4BRD A;  5AFU A;  3NVK A;  3DXK B;  1TWG A;  2VGN A;  3U4L A;  5KPR A;  3G4A A;  3SMS A;  3CCV N;  2IVN A;  4BR2 A;  3GTK A;  3OPF A;  2BTF A;  3EKS A;  1CZA N;  4BRM A;  2YHW A;  1ATR A;  4GVE A;  3CCE N;  4GTC A;  5EGE A;  3FZF A;  5AQY A;  1B4B A;  1WQG A;  3CCJ N;  1KQ4 A;  4G9Z A;  1XUP O;  1YF5 L;  4CZH A;  3P31 A;  1M1K O;  1VQ9 N;  1R9T A;  3GBT A;  5EXW A;  2KWA A;  2NLX A;  3CQY A;  3SMP A;  4A5B A;  3D2E A;  4FWQ A;  2P9K A;  4Z94 A;  3LPX A;  4WFB L;  3D2F B;  1YIT N;  4H5T A;  4JKA A;  3G6E N;  3H1Q A;  3ZX2 A;  4YOV A;  3I56 N;  3P38 A;  1BA0 A;  5JLF A;  2QWL A;  3FZM A;  1NGH A;  1Y64 A;  4F9O A;  1YAG A;  5BRD A;  3WUH A;  1NGA A;  1Q18 A;  2E8A A;  2WUS A;  4NO7 A;  4BY9 C;  1W2B M;  2QA4 N;  4B1W B;  3N4Q A;  4ILH A;  3CC2 N;  3TTD A;  5GIP A;  3AAR A;  3VOV A;  4PHT X;  5BPN A;  1M90 O;  4BG9 A;  4WQ5 A;  2E20 A;  2HF3 A;  2QI2 A;  2OTJ N;  4KM9 A;  3DAW A;  4JHD A;  1ATN A;  3K9J A;  3BUE A;  5AQK A;  4H5W A;  4JEP A;  4H0Y B;  5AQI A;  4B1U B;  2YU9 A;  4C1N I;  2YX6 A;  5AQG A;  3H6E A;  4MO5 A;  4BQZ A;  4O8U A;  5B8H A;  5BN9 A;  3CME N;  1T6C A;  1NM1 A;  4FWP A;  1P8Z A;  1S72 N;  3FOF A;  2ASO A;  2ITM A;  2IVP A;  3ZX0 A;  3G4S N;  3CCS N;  3OBW A;  3MN6 A;  5AQH A;  3MN9 A;  2FF6 A;  4C23 A;  4JD2 B;  4Y0W A;  5BN8 A;  2YJF A;  3O9R A;  2KLA A;  3CMA N;  1WQF A;  2P9S A;  3I8B A;  5GAH P;  3IUC A;  1AB4 A;  1BWF O;  3BP8 A;  1K8K A;  3CQX A;  4AF1 A;  3V4G A;  2F9W A;  4M7X A;  4C1N K;  4KC6 A;  3LDO A;  1NBW A;  1JJ2 M;  4DHY A;  3MDQ A;  4JK8 A;  4I6M A;  1K9M O;  2ZF5 O;  5AQF A;  3P39 A;  4MLE A;  3CHW A;  4IJA A;  3M1F A;  5BRE A;  2CH5 A;  2WC9 A;  4ISF A;  3DXM B;  5CHI A;  4G0V A;  3CCR N;  5LJV A;  1ISE A;  1KXP A;  4CI6 A;  5BPL A;  4WCE L;  3HRG A;  3GTL A;  4GV9 A;  2YJE A;  3EKU A;  3AY9 A;  3HZ6 A;  2PHC B;  1HKC A;  3EE9 A;  1DKG D;  3WXK A;  5KPZ A;  3A5L C;  3ENO A;  5JIC A;  5ADX H;  4WFN L;  4KB2 A;  3ZET A;  4FZB A;  3SLC A;  1NMD A;  3EN9 A;  3SBG A;  4ILD A;  4FWR A;  5BR9 A;  3MN5 A;  1BOT O;  4IZ9 A;  3E9L A;  3O9S A;  1GLC G;  4K25 A;  1O28 A;  4MDB A;  5C15 A;  3H1V X;  3J8A A;  2HMP A;  5M1F A;  4FWL A;  4HWI A;  1T3V A;  5C2F A;  3OHR A;  2GTD A;  5IOQ A;  4UY8 O;  2FSK A;  2FSN A;  5JVH L;  5AQU A;  1XXC A;  3MX2 A;  3S41 A;  4KM8 A;  1QZ6 A;  2P9L B;  4H0O A;  4JKG B;  4NB4 A;  2E2Q A;  2Q31 A;  4BRK A;  2HOE A;  3ZYY X;  3HI0 A;  2PFU A;  5C2D A;  4BRA A;  3MWP A;  4XH1 A;  1YUW A;  1B4A A;  2QXL A;  1G99 A;  1BO5 O;  2V51 B;  5MLC Q;  3F9M A;  3W3D A;  3CAG A;  2QWO A;  5JVO A;  4KH4 A;  1LOT B;  4FWO A;  3IDH A;  1YVN A;  4PKI A;  5M1O A;  2ZFZ A;  1JCG A;  2PAV A;  4GY2 B;  2Y3P A;  3Q3Q A;  2YCH A;  4PKG A;  3CCU N;  3O9Q A;  5TKY A;  2GUP A;  3HOT A;  3PIO L;  3VEY A;  2E1Y A;  1W97 L;  2F7T A;  2D4W A;  3O80 A;  1GE9 A;  3WT0 A;  1OKJ A;  4DQ8 A;  4IOA L;  5BRF A;  1BGW A;  2VYP A;  3I33 A;  2NRH A;  4IWV A;  5AQT A;  1F9N A;  1NGG A;  4PL7 A;  1SFO A;  4MLH A;  2GEM A;  4CZE A;  4BRG A;  1NGB A;  3CI5 A;  5AQL A;  1GLJ O;  1O2A A;  5M1Q A;  2HBJ A;  5AQJ A;  1T44 A;  3ERE D;  3LM2 A;  2Q0U A;  3GTO A;  4JK7 A;  2QWR A;  2JH3 A;  1VQP N;  1ESV A;  3CIP A;  1TUY A;  3TTF A;  4C3H C;  2YHY A;  1XXB A;  4DB3 A;  4BC2 A;  5C12 A;  3E1Y A;  3FGU A;  2Q2R A;  2QWQ A;  1SZ2 A;  4IEE A;  4BRF A;  3KZB A;  4CD1 A;  3O5B A;  4FWN A;  1D4X A;  4WFA L;  5FPD A;  3CCQ N;  1TYQ B;  3H45 C;  3QFU A;  2ASP A;  2R92 A;  2XCO A;  4PKH A;  4ISE A;  3G71 N;  4J3N A;  2NZT A;  2W41 A;  1YXQ A;  2ZJP L;  3W0L A;  4H0P A;  4MDA A;  1H1V A;  4P5A A;  2AA4 A;  2WBN A;  4EIA A;  4K42 A;  2Q1N A;  4RWT A;  3WXM B;  5AQV A;  4B1Y B;  3ORE A;  4KB4 A;  2XCR B;  4A57 A;  3KWI A;  4XH4 A;  3L4I A;  1HKG A;  4JKC A;  3BUZ B;  3DLL L;  3DXM A;  3WEE B;  5AQW A;  5JFE A;  1XC3 A;  4DCH A;  3CXC M;  4GTE A;  3CER A;  1GLF O;  3CPW M;  4JKE A;  1VQK N;  1YI2 N;  2ZGY A;  2NVY A;  2NRR A;  3J7Z O;  1VQ6 N;  1NGF A;  2ZJR L;  3O9U A;  3HTV A;  3M3Z A;  3AAP A;  4B1X B;  4KAS A;  4BRQ A;  3QBW A;  1QQN A;  1O26 A;  5JMV A;  4JN4 A;  1S22 A;  3VMF B;  4BRE A;  4BVP A;  5C0Y A;  3B8A X;  1O13 A;  2P9I B;  4EHU A;  4EHT A;  3KHY A;  3Q7B A;  3AGR A;  3UE5 A;  3VGL A;  3WQT A;  5F1X A;  1DEJ A;  4QS7 A;  2NRZ A;  3UKR A;  3IKM A;  3OW2 M;  4LQY A;  1VQM N;  3D7E O;  3ID8 A;  3TTC A;  3F5T A;  2OTL N;  3CQZ A;  4DDQ A;  1RFQ A;  1R59 O;  3VEX A;  4BR0 A;  4CBU A;  2P9L A;  4JKG A;  2QEX N;  1YJW N;  4OPA A;  3EE8 A;  1KD1 O;  5AFU H;  4GTL A;  3HM8 A;  3WQU A;  4BC4 A;  3GE1 A;  3A5M C;  4J8F A;  4KMH A;  4YOT A;  1O24 A;  2A41 A;  3GTG A;  3LDN A;  3AQO A;  3GTQ A;  4E1J A;  1TUU A;  1SS6 A;  3O6W A;  2Q36 A;  1O25 A;  4A61 A;  4CBW A;  3H0G A;  4GTF A;  2NVX A;  1BA1 A;  3JXU A;  4BVO A;  1NLV A;  4MO4 A;  5H1S Q;  1Y1V A;  3FZH A;  5E26 A;  5ADX A;  4H0X B;  4YDU A;  2CH6 A;  4CZK A;  1TWC A;  4BRH A;  3G4C A;  2VUM A;  2EWS A;  3UKU B;  4BRC A;  4FPA A;  5JLH A;  2D0P A;  4C3J C;  3AAQ A;  1EQY A;  3ULE B;  1V4S A;  3VTI A;  2KHO A;  3TSP A;  3VEN A;  5CJ9 A;  4FWK A;  1HKB A;  3VES A;  1NJI O;  4BRL A;  2GEL A;  2OAN A;  3LM9 A;  3CC7 N;  4FOE A;  3TSQ A;  3CD6 N;  5E84 A;  1RDU A;  3MMV A;  1C0G A;  2IVO A;  2QWM A;  2VWB A;  3OA9 A;  1ZXO A;  4RCH A;  4BR5 A;  2RE2 A;  4CZL A;  3MN7 A;  1HLU A;  1ZVU A;  4G0W A;  4K43 A;  2QWN A;  2JA5 A;  4EFH A;  2GSO A;  3C65 A;  1WQH A;  4PL8 A;  4GTB A;  2I7N A;  4FM9 A;  4AM7 A;  3O9T A;  4CZF A;  4JKF A;  4BGA A;  2RGR A;  3DXK A;  3QFP A;  4WYB A;  4EAH D;  1RDW X;  2JWL A;  1BG3 A;  4A2A A;  1KQS M;  1MWK A;  4B9Q A;  1TWH A;  3NVM A;  1X9J A;  5DM6 L;  1YIJ N;  3FR0 A;  1BU6 O;  1N8R O;  1LCU A;  1QQM A;  4O8K A;  2AP1 A;  4IFE A;  4AM6 A;  1Z6R A;  5TJ3 A;  1KC8 O;  3SK3 A;  3JS6 A;  4CJ7 A;  1BDG A;  4CBX A;  3R3L A;  4BC3 A;  3GL1 A;  5M1K A;  3SAF A;  2F9T A;  5IOS A;  5FPM A;  3SAH A;  4KMA A;  3IFR A;  3HSC A;  2FSJ A;  2P9U B;  4IJN A;  2HF4 A;  3D2F A;  3LAP A;  1P90 A;  3A5O C;  1WIH A;  4YOR A;  4M1X A;  2NRW A;  2CFA B;  5F2R A;  1DGK N;  3WXI A;  3A8Y A;  2VCP A;  4YOW A;  1Q81 O;  1HX1 A;  5I9E B;  4KAT A;  4GV6 A;  5GAD P;  2P5M A;  4IDH A;  1DD5 A;  3N0C A;  4JHD B;  4ILJ A;  2R93 A;  1MWM A;  4WF9 L;  2PBD A;  2JA7 A;  2NRX A;  3ENH A;  3ID6 A;  3VEZ A;  4ISG A;  4BRP A;  1VQN N;  3FHZ A;  3VGK A;  4WQ4 A;  3TU5 A;  1HUX A;  4QS8 A;  1SAZ A;  1BUP A;  1HJO A;  4LR2 A;  4M7Y A;  4GNI A;  2A6A A;  2WFB A;  5EVZ A;  4KH6 A;  4JKB A;  5AR0 A;  2V7Y A;  2IIR A;  4IOC L;  2A40 A;  2A5X A;  3OBY A;  4JK9 A;  4BG8 A;  1ILY A;  4OO1 J;  3R9P A;  2P9S B;  4YDU C;  3ZX3 A;  3LDL A;  1T6D A;  4CZM A;  1Q7Y O;  3R6M A;  2E2N A;  5KPT A;  4R79 A;  1HPM A;  3I55 N;  3C0B A;  4GT9 A;  3A5N C;  3GDQ A;  3NMU A;  3FOE A;  2E2H A;  1ATS A;  2P9N B;  4L3Q A;  5AQQ A;  4JD2 A;  3CPE A;  3BF3 A;  4YOX A;  4I6M B;  3ZEU B;  3FZK A;  5CE3 A;  3UB5 A;  3UKU A;  1V4T A;  2V52 B;  3RSE B;  2ZWH A;  4IO8 A;  4ILG B;  1NGD A;  3U8X A;  1QHA A;  4HTL A;  3IMX A;  1VAZ A;  2YI1 A;  2A3Z A;  3LDQ A;  3KWG A;  2HBM A;  3Q7C A;  4IEI A;  1QQO A;  1QVF M;  3SBT A;  2H3G X;  4GV3 A;  4KDD A;  4A62 A;  1KAZ A;  3LDP A;  5CR4 A;  4B1V A;  2J4R A;  2JA6 A;  2GWK A;  3SAG A;  2ASM A;  4FWM A;  3ZET B;  4H5N A;  1IS1 A;  3AGK A;  4O5F A;  4BC5 A;  2B63 A;  1E4F T;  5AZI B;  1DT9 A;  3P4I A;  3K9K A;  3VEO A;  3O1W A;  3CF5 L;  4H0V B;  1YJN N;  1Q82 O;  3S0X A;  2Q97 A;  3C7N B;  3O4W A;  1BJT A;  4BGB A;  3CC4 N;  5FPE A;  4GTA A;  2P9P B;  2NRT A;  5KQ8 A;  3FE1 A;  3VTH A;  3H46 O;  3CCL N;  4KAR A;  1NGI A;  4XEI A;  2E1Z A;  4BRN A;  1MA9 B;  5ELZ A;  3M6G A;  3U9D A;  3VF2 A;  3GTM A;  5AQM A;  3U9Z A;  4GFQ A;  3VPZ A;  2BH1 A;  2VGM A;  4JKD A;  2GX9 A;  3VF6 A;  1KAX A;  1WUA A;  1QVG M;  1VQ8 N;  5EX5 A;  3H3N O;  3VEW A;  2D1K A;  1EK8 A;  4KAW X;  4KH5 A;  5CHP A;  5AZJ B;  4A5A A;  4FPB A;  3ATV A;  1RGI A;  2P9U A;  4JAX A;  3BEX A;  3A0I X;  4CZG A;  1U2V B;  4U7B A;  1IJJ A;  1K8A O;  5HL7 L;  1NGJ A;  2GWJ A;  2CFA A;  2HBK A;  3H3O B;  3LAJ A;  4BKW A;  1Z05 A;  2E2P A;  4FOI A;  3GOI A;  4WQ4 C;  2ZJQ L;  3CET A;  5FPN A;  2HST A;  4JKH A;  4P5B A;  4BQL A;  1ZBS A;  3KVG A;  3MK6 A;  3C6A A;  4YOY A;  2CGL A;  4BRO A;  1E4G T;  5EY4 A;  4A2B A;  1NGC A;  4JNE A;  4LC9 B;  1TWF A;  2FLO A;  2NRV A;  4FVU A;  5AQX A;  5BRH A;  2V7Z A;  4IO9 L;  3R1X A;  3CJ7 A;  2KKZ A;  2E2I A;  3FZL A;  3TSU A;  4OPH A;  1YJ9 N;  2GSU A;  1EH1 A;  1VQ5 N;  2QWP A;  1EO1 A;  4NLC A;  4BR7 A;  3QB0 A;  4CD3 A;  1GLL O;  2UYT A;  4XH5 A;  4YOU A;  1VQL N;  2DPN A;  4KBO A;  3T7Z A;  3SJH A;  4IOX A;  1JCE A;  1TYQ A;  4BR9 A;  2P9N A;  2QM1 A;  4CZI A;  5GAE P;  1K83 A;  3AQP A;  1GLA G;  3ZEU A;  5GIN A;  2YHX A;  1J6Z A;  3MCA B;  3MCP A;  1JCF A;  1X3M A;  3RSE A;  5GIO A;  1OVY A;  1VQ7 N;  1O27 A;  3L4K A;  2HBL A;  3N0B A;  3D2E B;  1C0F A;  3ENB A;  4FWS A;  2P9K B;  3FLC O;  2E2O A;  4U67 L;  3QIC A;  1XXA A;  1SQK A;  5DM7 L;  2CGJ A;  4H03 B;  1X3N A;  2QW9 A;  3EL2 A;  1NWK A;  3QML A;  1NGE A;  1XQS C;  3E9O A;  3CJ1 A;  3QBX A;  1GLB G;  3WEE A;  5LJW A;  3OEP A;  4BRI A;  4C3I C;  3ATU A;  2NNW A;  3CJC A;  4NLB A;  5AZI A;  5EGH A;  2Q0R A;  5IOR A;  3O08 A;  4BLA A;  1ZC6 A;  2I7P A;  5BPM A;  1KAY A;  5M1N A;  4A59 A;  3C7N A;  2RH6 A;  3TPQ A;  1I3Q A;  5HOO A;  3WXL A;  3DJC A;  4FL9 A;  3UKR B;  2P9P A;  2GSN A;  2QTD A;  1QZ5 A;  5JVG L;  5F0X A;  1WCM A;  1Q86 O;  3AH5 A;  4G0U A;  1Y1W A;  2ZGZ A;  5M1P A;  3L4J A;  2P9I A;  2RHK A;  5TKW A;  3CJ9 A;  4KMD A;  1O29 A;  3QX3 A;  4H5V A;  3RVC A;  3L4Q A;  3E66 A;  3PIP L;  3EZW A;  1YHQ N;  3MML B;  3NUH A;  3EO3 A;  2XCQ A;  4RTF D;  5KQD A;  3D6R A;  1O2B A;  3GG4 A;  1U6Z A;  2BUP A;  5AQZ A;  2W40 A;  2R7Z A;  1IG8 A;  3DWL A;  3N4P A;  4CZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...