1ZBSA

Crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
MILIGDSGSTKTDWCIAKEGKSLGRFQTSGINPFQQDRNEIDTALRSEVLPAIGQKASSIRAVYFYGAGCTPAKAPMLNEALDSMLPHCDRIEVAGDMLGAARALCGDSEGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQMPEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSFDDFLVRNVLRYNRPDLPLHFIGSVAFHYREVLSSVIKKRGLTLGSVLQSPMEGLIQYHHNNHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PG1100
publication title Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 82
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zbsA03
2P9KB 5FPNA 3MN6A 1HJOA 2NRHA 5AZJB 2QXLA 3MN5A 5AQQA 3HTVA 4I6MB 2P9PB 3W3DA 1JCFA 3A5NC 3VF4A 2YCHA 3WQTA 1LOTB 2E2NA 3AY9A 4BVOA 2E20A 1X3MA 4KBOA 1ATRA 4BRKA 1MDUB 1NM1A 5AQGA 4BRLA 2BUPA 2P9SB 3TPQA 4CZMA 1RDWX 1ZBSA 2F9TA 2H3GX 4A62A 2F9WA 4DCHA 3A5MC 3UKUB 4K25A 4B9QA 3FZLA 3UE5A 2CGKA 3FGUA 5AQYA 3MMVA 1KXPA 4CZJA 3D2EA 3QMLA 3QFPA 4XEIA 3DXMA 1GLDG 1NGHA 4WQ5C 3C0BA 2QWOA 4BR4A 4BRNA 3A5OC 2ZWHA 3DAWA 5AR0A 4H5WA 4MO5A 3LDQA 5AFUA 3VEWA 5AFUH 2PBDA 2GWKA 1GLCG 1BU6O 1DGKN 4FWPA 2BTFA 4HWIA 3GG4A 5EY4A 4CBUA 4WYBA 3TU5A 4CZIA 2A3ZA 3ENHA 1NGAA 3ULEA 2I7NA 2YJEA 2ZF5O 3LL3A 1OKJA 3D7EO 3MN9A 2Q36A 3SMPA 4BR0A 4CD1A 3U8XA 3DXKB 3R9PA 4CJ7A 3UKRB 4CZFA 2FLOA 3VENA 1YXQA 4CZHA 1SQKA 1X3NA 2ZGYA 3O4WA 4WQ5A 4BRDA 2E1ZA 3DJCA 4B1UB 4BC3A 3HBTA 3RSEA 4QS8A 2OANA 2A6AA 2QWRA 2Q1NA 4AM6A 4BR2A 3U9ZA 1XQSC 3B8AX 3HSCA 4FOEA 3DWLA 1RGIA 3SK3A 2VYPA 4EFHA 1ESVA 1P8ZA 4H03B 3GDQA 4FOIA 5AQUA 2V7ZA 1NMDA 2A40A 4QS7A 1NWKA 3LDPA 3SLCA 5AQTA 2P9NA 1IJJA 2ASPA 3O80A 2P9UA 2YHXA 3MK6A 5BRDA 1DEJA 4BRPA 3O1WA 1T6CA 1BG3A 4FL9A 5JLHA 3LDOA 1QHAA 2EWSA 2YI1A 3M3ZA 4B1ZA 4CBXA 3C7NA 4K41A 2AP1A 1QQOA 2FSJA 1BWFO 4DHYA 1ZXOA 4JD2A 2W41A 4BC2A 1NGEA 3EL2A 3ZETA 1S22A 3WXIA 5ADXA 4FWLA 3VGLA 5ADXH 2Q0UA 3FR0A 4CD3A 2QM1A 1BA1A 2GEMA 5KPZA 1H1VA 3JXUA 4BR5A 3CETA 2HMPA 5BREA 3FZFA 1U2VA 1ATNA 2PAVA 3MCPA 3QICA 4BC4A 4BRIA 5BN8A 3O8MA 5BRFA 4K42A 5AZIA 3SJHA 1NGGA 4A2AA 4FO0A 4B1YB 5BR9A 3FE1A 3VEXA 3F9MA 1V4SA 3LDNA 5E26A 3VETA 3A5LC 3DXMB 4H0PA 1JCEA 1CZAN 3CI5A 3H3OB 4EHUA 3CJBA 5F1XA 3ZX3A 2W40A 2E1YA 3AAQA 3QB0A 2UYTA 1NLVA 1WOQA 4XH5A 5AQVA 4CZGA 4M7YA 4QS9A 5AQIA 4Y0WA 4GNIA 4ISFA 4O8KA 3U9DA 5AQOA 1GLJO 5AQNA 5KPTA 4PKGA 3VEOA 4EAHD 1T6DA 4XH4A 1WUAA 1BOTO 3ZEUB 5F0XA 5JMVA 2P9IA 1NBWA 1Z05A 1R59O 3JS6A 2E2PA 2P9KA 2YHWA 1HKBA 4PKHA 5E84A 2E88A 5BPLA 1V4TA 3AAPA 3H45C 3HI0A 4PKIA 4Z94A 5AZJA 1SAZA 1Y64A 1GLAG 4LC9B 4B1XB 3L4IA 3VEVA 5KPRA 3H1VX 4A61A 4CZLA 3A0IX 2FXUA 2ITMA 3L0QA 4AM7A 4FWNA 3HM8A 4E1JA 4BG8A 3H6EA 3ATVA 2Q31A 3MDQA 3EKSA 3CJ1A 2P9SA 3MN7A 4CBWA 1MWKA 5AQJA 3UKUA 4IJNA 2CGJA 3SMSA 3R8EA 3GOIA 3GE1A 3EN9A 2GTDA 5AQLA 1QZ6A 3WEEA 1E4GT 3VEZA 3M6GA 3FFKB 1NGCA 2E2OA 4JHDA 1QQMA 2HF3A 2QWNA 4FSVA 4BGAA 3WT0A 3IMXA 4CI6A 1BDGA 3CJCA 1HLUA 1TUUA 3WXKA 1U6ZA 5LJWA 2CH5A 3LDLA 3CQYA 4BR7A 4H5VA 4XH1A 4H0OA 4FWKA 2WUSA 4L3QA 3KZBA 1KAYA 1GLFO 3VESA 2V52B 4RWTA 3A8YA 4PL7A 1G99A 1TYQA 1Q18A 5FPMA 3VF2A 1EQYA 3DXKA 3ATUA 1X9JA 1C0GA 1HX1A 4M63C 3UKRA 2AA4A 1K8KA 3R6MA 4GY2B 2A41A 3IUCA 3LM2A 5BRHA 1RFQA 5AZIB 1J6ZA 3CERA 3G25A 4BRGA 2V7YA 4PL8A 3ENOA 4B1VA 2I7PA 2D0OA 3VGMA 3IDHA 4IZ9A 3QBWA 1NGIA 4JAXA 4HTLA 1Z6RA 2P9LA 4H5TA 4BR9A 4BQZA 4H0XB 4EHTA 1YUWA 2E8AA 3I33A 3ZX2A 1NGBA 2HF4A 4FWOA 1QQNA 5LJVA 3D2EB 5F2RA 3QFUA 2D4WA 4MLHA 5AQXA 2D1KA 4H5RA 3O1BA 4IJAA 5AQHA 2CGLA 2P9IB 4BRFA 2ASMA 1ZC6A 4MO4A 5TKYA 4IWVA 4NO7A 2NLXA 4FPAA 3VGKA 4RTFD 2ZGZA 4BVPA 1NGDA 3AARA 3D2FA 3M1FA 3I8BA 1BA0A 4YDUC 3VERA 3FZMA 3ULEB 1QZ5A 1GLBG 4BQLA 2Q2RA 3VF6A 1HUXA 3FLCO 5AQWA 3H46O 2QWMA 3ID8A 2D0PA 4BRMA 3QDKA 2GWJA 5AQZA 4ISGA 5KQDA 5AQFA 3EZWA 2HOEA 4BGBA 5KQ8A 5AQKA 3KVGA 4FPBA 2ASOA 2FF3B 2IIRA 4M7XA 2FSNA 2KHOA 4I6MA 4BRQA 4RCHA 2P9PA 1DKGD 4JN4A 3W0LA 3RSEB 4A2BA 3WEEB 3GL1A 4JHDB 3BEXA 4FWRA 2Q97A 1YVNA 3CQXA 1MA9B 3EO3A 2IVNA 4FWMA 5BN9A 2FSKA 5AQSA 1IG8A 1NGJA 4YDUA 3LM9A 4H0YB 4B1WB 1ATSA 3FZHA 5CE3A 4WQ4C 3WXLA 3VOVA 4BRAA 2P9NB 4FWQA 3QBXA 3CJAA 2P9UB 5EOYA 5B8HA 1KAZA 2VWBA 1XUPO 4EIAA 1S3XA 4BROA 1JCGA 3WXJA 1HPMA 1MWMA 3UB5A 1TYQB 3ZEUA 3P4IA 2IVOA 2YHYA 4FWSA 2A42A 4H5NA 4IO8A 3CIPA 1K8KB 5AQPA 3C7NB 2CH6A 3U4LA 3ZX0A 5JLFA 1XC3A 2QW9A 3GBTA 3HZ6A 4JD2B 1NGFA 1YAGA 4JNEA 3ZETB 5I9EB 2V51B 2Q0RA 4H0TB 1BO5O 3WUHA 5BPNA 3BF3A 4WQ4A 4BG9A 2P9LB 2A5XA 1HKGA 1GLEG 3FZKA 1GLLO 3O6WA 1HKCA 5BPMA 5FPEA 2GUPA 1TUYA 1BUPA 1U2VB 5LY3A 5EVZA 3CHWA 4NB4A 5AQRA 3VPZA 1D4XA 2NZTA 4BREA 4BC5A 5AQMA 4K43A 1LCUA 3CJ7A 3O5BA 2QWQA 4BRCA 5JICA 4C23A 1SZ2A 3EKUA 5EX5A 4MLEA 4CZKA 4F9OA 4BRHA 4J8FA 2QWPA 3BF1A 4IXCA 3WQUA 4DQ8A 5FPDA 3L6QA 2GELA 2FF6A 4O5FA 2VCPA 3O08A 3BP8A 3H3NO 2E2QA 3J8AA 1E4FT 1KAXA 4H0VB 5EXWA 3OHRA 3VEYA 4CZEA 3BUZB 1C0FA 3D2FB 5ELZA 2IVPA 2YJFA 2QWLA 2J4RA 4ISEA 3CJ9A 3KHYA 3IFRA 2DPNA 3S41A 1T44A 4DB3A 3H1QA
chains in the Genus database with same CATH superfamily
1ZBIA 2XO7A 2P9KB 1TVRA 2YU9C 5FPNA 4JK9A 1EO1A 1EWRA 2RHKA 3VQPA 2JH3A 3MN5A 1N8RO 4CGHA 3OS1A 2P9PB 4NYFA 1LWFA 4FJHA 3VF4A 3L3UA 2VG6A 1IKXA 4CJVA 2E2NA 3VQ4A 4BVOA 2E20A 4KBOA 1ATRA 4BRLA 3M8RA 3VA3A 4CZMA 3C95A 4B8AB 3CCJN 3PO2C 3AVHA 3GTMA 4BBSC 4B9QA 1Q8IA 4FM1A 4H4OA 4F3OA 4NYNA 4JI5K 1D5AA 4JKBA 4GVMA 3D2EA 3O3GA 3H0GA 1KFSA 4A3DK 2NUBA 3QFPA 4KDDA 1FK9A 4JV5K 4FJLA 2R92C 4A93K 1VQKN 1EXQA 3OYLA 3SPZA 4JKCA 4BRNA 2BANA 2X6NA 2ZWHA 3DAWA 4BY1C 3V1OA 4H5WA 4OIOA 1IG9A 4OIRA 1RDDA 3NMUA 3OS2A 3CXCM 1QE1A 3SQ1A 3CAGA 3ZSXA 4KMHA 1IBKK 3GTJA 4P5BA 2E2IA 4BWJA 3ENHA 3ULEA 3LAKA 2HHTA 3AVFA 5IOSA 1VQMN 2YJEA 4BXXC 4CHNA 3D7EO 1RBRA 4NCAA 3CCLN 3U8XA 4CJ7A 3UKRB 4CZFA 2OPRA 2FLOA 4DFJA 3VENA 5MLCQ 4CZHA 2ZGYA 3AA2A 2O8FA 2LSNA 3I4NK 1KSPA 3K7AK 1ASWA 3S0XA 3RSEA 3RZOC 2QWRA 1XQSC 2ZJPL 4FOEA 2JGUA 1K6YA 1RGIA 3SPYA 1RCHA 3SK3A 1VQNN 4A3JC 1SS6A 2VYPA 3L2UA 4K0KK 4H03B 3KKRA 2A40A 4QIWL 5AQTA 5FLXO 1JQWA 4V19S 3S3OA 4C3JC 4E1NA 5IP7K 4LOWA 3VN5A 2JA5K 4A3CK 4ELUA 4BRPA 3O1WA 1BG3A 4FL9A 5JLHA 1WORA 3LDOA 3F73A 4CEEA 3DRPA 1VQ5N 3VA7A 4YFUA 4LK1A 3T7ZA 3A8JA 3CCMN 4N47A 2YI1A 4E7IA 4B1ZA 5LMNK 5IOQA 4CBXA 2FBTA 2OPPA 3C7NA 2RH6A 1QQOA 3HOUK 2FSJA 4O55A 4FM9A 2WAQD 4CEBA 3QEXA 2HNYA 2YV0X 2NNWA 4DG1A 3GTPK 5FLMC 4YOVA 3FKIA 1XXAA 3H3VL 1Q86O 4C1NK 3HPHA 3AVIA 1H1VA 2Y0SD 1DCHA 1Z26A 1U2VA 2PAVA 4DLGA 1BQMA 3MCPA 3QICA 3VQ7A 3EEQA 1UAXA 3ULDA 3EE9A 5BRFA 5BR8K 4CEAA 2O8CA 3NHGA 1PJ6A 3PO3K 3RMAA 3LDNA 1L3UA 3AVGA 4H0PA 4LFAK 4CK1A 1CZAN 3M4OK 4PQUA 1VQ8N 1KD1O 2HSTA 1ILYA 2W40A 1Q81O 4P9SA 3QB0A 4AF1A 2PA8L 1NLVA 4K8ZA 4IFVA 3SCXA 1WOQA 3SUQA 4GMJB 4CZGA 4K8XA 4KB2A 4QS9A 4CJ3A 4GNIA 4CF8A 4DTMA 1OH8A 1O2AA 1CXUA 5AQOA 1GLJO 1USMA 4W5OA 5AQNA 5HROA 4KREA 1SKWA 1BOTO 3ZEUB 1VSKA 3PX6A 3WNFA 4MDBA 2D0BA 4LFCK 3JS6A 5E84A 2E2PA 2P9KA 4PKHA 3ZSYA 2E88A 3KLIA 4A3GK 1V4TA 4PKIA 2JA5A 4KHYA 1D9FA 1ZQ1C 2HMIA 1Y64A 4EZ9A 4LC9B 4CJUA 1N34K 4FM0A 4CEQA 3L4IA 3ZT2A 4RW7A 4DV1K 1XPPA 4CZLA 4OKEA 3L0QA 5L46A 1XXBA 4LH5A 1KC8O 3SUNA 3HM8A 3RMDA 3IPJA 1TWFC 1KVAA 2HHVA 3CJ1A 4CBWA 4IBNA 3NGZA 4HUFA 2Y1IA 4LF6K 1ZBHA 2WB1D 3Q7BA 3AVBA 4BDYA 2GTDA 5AQLA 1QZ6A 4Q4ZA 3T1AA 4OPAA 3NAEA 2V6TA 4AH9A 4FSVA 3I4MC 3WT0A 2W6KA 4M41A 1VQ6N 1L3VA 3K57A 1JL2A 5LJWA 3ADAC 3S1NC 1BCMA 1Y1VK 2NVTC 1REVA 5CY4A 2VG5A 3M8PA 3CC4N 3CQYA 4OX9K 4ICLA 2KWAA 1TWFA 3AGRA 1Q9XA 4DTJA 3BP8C 1KVBA 2NVXK 1OH6A 2PHCB 4CCHA 3T3FA 2V52B 2B5JA 4U67L 4RWTA 4FW2A 5HL8A 1TYQA 1VHXA 4J2BA 1NK7A 3KK3A 3NBPA 1HNWK 1F93A 4M63C 3UKRA 1VQON 2AA4A 3UIQA 1JLEA 1INNA 1KCFA 3IUCA 5AZIB 3NF8A 4A3EC 3CERA 4BRGA 2V7YA 4CIFA 1YHQN 3GTQC 4CECA 1J6VA 4OPHA 3ALYA 3IDHA 3QBWA 3TTFA 1NGIA 3I8DA 1I3QK 4CJPA 2I5JA 3OW2M 1S9EA 1FW6A 1NJZA 1FKPA 4BR9A 3QETA 3ZSWA 4FLXA 3S1QC 4W5RA 3ZX2A 3DOLA 4FWOA 1TWAC 2GBZA 4DTSA 1QQNA 3P38A 5F2RA 3QFUA 3S16C 2D4WA 3O3FA 5M5YK 3F5TA 3I0SA 2UU9K 2D1KA 5TMFA 3ISNC 4FJGA 4BRFA 1HRHA 2BE2A 1ZC6A 1KFDA 2E2HC 4O2DA 1VSMA 5TKYA 1EWQA 5JVHL 2NLXA 3AVKA 3J80O 5J2MA 3VGKA 3S15K 4MQ3A 1NGDA 2BGGA 3HRGA 4PABA 3CCRN 3I8BA 2OPSA 2O8EA 3K5LA 1X9SA 3VERA 2WAQL 4F2SA 5CYMA 2XY6A 2PFUA 3FZMA 4DS4A 4LFBK 1Y1VA 2E6LA 1B92A 1XMQK 3VF6A 1HUXA 3H46O 1YNJA 4BRMA 4J2DA 3HSTB 4DF4A 2GWJA 4BY7C 5DK5A 1T05A 5AQZA 2Y0SL 4ISGA 5AQFA 4CHPA 3RTVA 1O25A 2B4JA 4IEEA 4FLZA 3TABA 2FF3B 2KHOA 4I6MA 3AQOA 4JI1K 2JA8C 4JEPA 2JWLA 4JN4A 2QK9A 2E2HA 5DM6L 5C44K 3BEXA 2Q97A 1VK0A 1ZBFA 1JLGA 4CF2A 1RTDA 1RTIA 1UWBA 4FWMA 2FSKA 1XWLA 5AQSA 3O9UA 3HOSA 1QHTA 4H0YB 4B1WB 4KPYA 1TGOA 2QA4N 5FRMA 3WXLA 4A3LC 3LAMA 2X6SA 4U7BA 4FWQA 4O0JA 4B9SA 1O26A 3V9UA 1KAZA 1UA1A 3IAYA 1XUPO 1QVGM 4EIAA 1IBLK 4AYBD 4BROA 4N5SA 3WXJA 3VQDA 1HPMA 1MWMA 5HRRA 3QNNA 5HRNA 4OKJA 3ZEUA 4FWSA 4HUEA 1WLJA 3G6EN 3M8SA 1Y1WA 1DT9A 4I2PA 1I39A 1S1WA 4BE2A 3S3NA 4A3BC 4JKEA 3HOYC 4JNEA 3GTKK 2RKIA 3CCQN 2V51B 4CERA 1SKRA 3AO3A 4KHUA 4FK4A 4BG9A 3AVJA 2A5XA 1HKGA 1GLEG 3KD1E 4GV3A 1HKCA 1ASUA 4OLBA 3RMCA 2XRIA 2BE5A 1BDFA 4WILA 4ZHRA 2GUPA 1BUPA 4FJ9A 5LY3A 4DR4K 4HVJA 3LAPA 3VPZA 4NB4A 2NZTA 3SQ4A 3MEEA 4KFBA 4M45A 4BREA 1KTQA 4Z4FA 4BRCA 2WB1L 1SZ2A 3I0RA 3LAJA 3S17C 2VQFK 3SYZA 5EX5A 1HNIA 3L2WA 1CZBA 4C2MK 1VQPN 4F9OA 1VSHA 4FVUA 5C4XK 4J8FA 4NXMK 4G0WA 3WQUA 3T1YK 3PIPL 3SZYA 4O5FA 3E9OA 1NK5A 1KLMA 4IKFA 4CZEA 4GKJK 1IQ0A 4HUGA 1N32K 3KLGA 1QSYA 1B4BA 1DD5A 4ISEA 4CK2A 1U47A 3KHYA 1U4BA 1NJWA 1G15A 2D6FC 4IG0A 4Q5SA 2JA7K 3H08A 1K73O 4JI4K 2R7ZC 1N5YA 1KQ4A 4B3RK 3MN6A 3HO1A 1K8AO 3O4NA 5AQQA 4KI4A 1GOBA 3FFIA 3HTVA 2A6EA 3RMBA 1S6QA 2UXDK 1RBSA 3W3DA 1NK9A 3D6RA 1XXCA 4BBRC 4CFCA 3V1RA 1TWHA 4WF9L 3WQTA 3NVKA 2CFAB 1WCMC 3LZJA 4DLEA 1D8YA 1MDUB 4ID1A 3TPQA 2VG7A 1RDCA 4CHYA 4OGCA 2H3GX 2F9WA 3ZSVA 2GSNA 3TFHA 3GTKA 3A5MC 3NVMA 4A3MK 4AHRA 2Z1IA 2RPIA 1YJNN 3AO4A 5J2NA 4KV8A 2HB5A 4R5PA 4LQYA 1WOPA 4EP4A 3ZSRA 1VSEA 3VTIA 4IFEA 1J54A 4FJNA 3T69A 2QWOA 3QIOA 4Z4GA 3V4IA 1EK8A 3M3YK 3LPUA 5IYCC 4FJJA 3OYJA 4MO5A 5IYBC 2YHBA 4DR6K 4JKFA 1SFOK 1VRUA 2Y1JA 2GWKA 1GLCG 4YOWA 1JOEA 4NOIA 1DGKN 1YF5L 1WCMA 3CG7A 4DSKA 3QO9A 4GTFA 4DDQA 1NKEA 1NOZA 2WTUA 4OVLA 3P39A 4KARA 4F8RA 5D3GA 1B9FA 3DXKB 4KHNA 3QESA 1S1XA 1E3MA 1PJ5A 1IKVA 3EZ5A 4G9ZA 2HHHK 4YFNA 2E1ZA 2OTLN 2O8DB 1D9DA 1K83K 3DXJA 4QS8A 3S2DK 2A6AA 3VQ5A 3LP2A 3B8AX 1TWGC 3VQ9A 4CFBA 1TKDA 4B3OA 5EGEA 2YU9K 2NRRA 1EP4A 3DLRA 4A57A 4EFHA 3U3YA 2HW3A 2HHQA 3AQPA 3G4CA 3SLCA 1NWKA 4GTDA 4DQQA 2E2JK 1FXXA 3TAGA 1U48A 3O80A 2YHXA 3MK6A 1DEJA 4C8KA 4X65K 2EWSA 3U6FA 2P5OA 2E2IK 3M3ZA 1A5WA 4KTZA 3S1MK 1I6HC 2D5RA 3PO2K 5TJ3A 2HVHA 1SL0A 4BBSK 4K41A 3LZIA 1TWGA 2QKBA 1BWFO 3IRXA 2W41A 3THYB 3J7YP 1I50C 3EL2A 1YT3A 3HPGA 4ILGB 4ELVA 4AHTA 5ADXA 3TARA 2R92K 5ADXH 4UQGA 2Q0UA 1TL1A 5GIOA 2QM1A 1RBVA 3FOEA 4BY1K 1HJRA 3CD6N 3CETA 2HMPA 5T7BA 3OJUA 3TI0A 4CF1A 5BN8A 3CCEN 1U04A 2P5MA 3O8MA 2G8UA 1BGXT 4K42A 1NK4A 4CJKA 1L0WA 1VSDA 3I56N 1KRPA 3GTOC 3HK2A 3VEXA 3F9MA 3LWLA 5E26A 3A5LC 3DXMB 3SBGA 2G8FA 2GAGC 5C2DA 2GV9A 3ZT3A 3MX2A 4PA1A 4FK0A 1I50A 2UYTA 1K83A 5C25A 3V9SA 4A3KC 1RT4A 4XH5A 4FLTA 4C8LA 5IYDC 4GW6A 4Y0WA 5HBMA 5M3FK 1IH7A 3RZOK 3OYFA 2YU9A 1AB4A 3V1QA 4M3WA 4RW4A 1YI2N 4W5NA 2XCRB 1VQ4N 2QTDA 5F0XA 2P9IA 1NBWA 4A3JK 1Z05A 3THXA 3QEVA 3FKIK 4Z94A 2NVYC 3GEHA 3BZKA 2FBVA 4FZBA 3V9XA 3HKZD 4C3JK 2JWKA 5KPRA 3H1VX 4PY5A 3A0IX 3CPEA 2WC9A 4BE0A 2ITMA 3J7AP 1SMYA 4DSFA 2F7TA 3S2HK 4PWDA 2F8TA 4AM7A 4X62K 1WQGA 2CFAA 1YJ9N 3A2FA 3MN7A 4C45A 3OBWA 4Y52K 3RR7A 3E9LA 3L2QA 3THWA 4JYAK 2R92A 4GVEA 1J5EK 3V4GA 1BIUA 4KHSA 3EN9A 3L2RA 4B9NA 3WEEA 4MFBA 5FLMK 1BQNA 1E4GT 3M6GA 3FFKB 3VEZA 3MECA 3CF5L 4CFAA 3TAFA 4OLAA 2E2OA 2HF3A 2QWNA 3SAHA 2NVYA 4CI6A 1BDGA 3CJCA 1TUUA 2ZUEA 4YY3K 3LP3A 5A2QO 4QJVA 4DQPA 4JI0K 4RMFA 1L3TA 1YITN 2CH5A 4YFKA 2YKNA 1L5UA 4I9QA 1TL3A 4DU4A 4DV7K 5C12A 4JRPA 4OGEA 4E7KA 5D4DA 4CEZA 1W7AA 4OINA 4M1XA 3ZCMA 2WUSA 3PY8A 3C6UA 1NU0A 3LPXA 4A3DC 3HJFA 2VWKA 1EFWA 4B9MA 4OIPA 4CEFA 1IW7A 4KKOA 5FPMA 4OJRA 3VF2A 4B9LA 4A3IC 3DXKA 1XI1A 3ATUA 1X9JA 3RZDC 1C0GA 4LF4K 3S1NK 2UUAK 2WONA 3AA5X 4MEXA 3TTGA 1RFQA 2PYLA 4GT9A 1J6ZA 1XNQK 1U45A 4PL8A 2AJQA 2B63C 2D0OA 1BGWA 3VGMA 4IZ9A 1X1PA 1S1TA 1J53A 4DSEA 4HTLA 4FXDA 2P9LA 5DMRA 3OS0A 4Z4IA 5JVGL 1N33K 3GEIA 4H5TA 1JLCA 4EHTA 2O8BB 3V6DA 3I33A 1WBBA 3I4NC 3AVNA 3D0PA 1NOYA 5IT9O 3VMFB 1S5JA 3VQQA 3S9HA 1VSJA 1VSFA 1TWFK 5C2FA 2CGLA 4Z4EA 1HR0K 2B63A 4G7OA 4MO4A 4Y1CA 1C1CA 4P5AA 4IWVA 2NRVA 2ZGZA 1HQMA 3AARA 3D2FA 2FQTA 4KB1A 3QEWA 3THYA 1BA0A 1BI4A 1RT3A 4GTEA 4O5BA 5IP7C 1GLBG 3CQZC 2Q2RA 1C1AA 4H8KA 2IDOA 1ISEA 4NLBA 2VWJA 3JAMO 2DY4A 5C3EC 3VTHA 4BACA 2NVTK 1V5VA 4WJ3M 2GSOA 4FJXA 4A59A 1GOCA 2ZM6K 4XSZA 5KQ8A 5AQKA 2ASOA 1YVUA 4BRQA 1XMOK 4XLPA 5C4JK 5GADP 2P9PA 1DKGD 4JLHA 3G4AA 3GL1A 2A69A 4LD0A 4MDAA 4JHDB 2P51A 3A8IA 1YVNA 3HL8A 4N41A 1MA9B 2NVQK 2IVNA 1R9TC 2XY5A 3KWIA 4BDPA 2RE2A 3E01A 3I55N 3LP1A 1NGJA 1EETA 2HBMA 4CGFA 3LM9A 2KQ2A 3FZHA 4W5TA 3VOVA 1WNSA 4BRAA 4A3EK 1TKZA 1NK6A 1Z25A 3QBXA 5GAGP 2P9UB 1OH7A 2D0AA 1HYVA 3ZSOA 4FLUA 1MU2A 4DTOA 3TAEA 2P1JA 2VWBA 1S3XA 1JCGA 3HM9A 4BE1A 1T8EA 3MWTA 3TAMA 3M4OC 4DTNA 2IVOA 3SNNA 2YHYA 4IDHA 4KM9A 4JKAA 2A42A 1TK8A 4MQ9A 1ASVA 4CJRA 3CIPA 4CHOA 1K8KB 4M3RA 2CH6A 2RGRA 1TWCC 3VQCA 5JLFA 1TWAK 2QW9A 3GBTA 1KLNA 3KJVA 2WOMA 3HZ6A 4JD2B 1NGFA 2Y3PA 3HKZL 3S16K 4QAGA 3THVA 3PX4A 5IWAK 1W0HA 4YOTA 4YHHK 4IOCL 1WOOA 1ZBUA 1HYSA 5FPEA 3PO5A 3O6WA 2GSUA 1GLLO 4CGGA 4ZTFA 5BPMA 2HHUA 4AHSA 1A5XA 1EKEA 2E2HK 3L2VA 1O27A 3K2PA 3KD5E 5EVZA 3CHWA 1U49A 5AQRA 4A3GC 1D4XA 1SUQA 3CM5A 3QLHA 5AQMA 1LCUA 3S14C 2OCEA 2QWQA 4C23A 4KI6A 3C94A 3PO4A 4CJWA 3PX0A 4MLEA 1XHXA 3K5MA 2G8HA 4J2AA 4BRHA 3DRRA 3OEPA 4Y7NK 3AO2A 3BF1A 4DQ8A 4M3ZA 4BY7K 1S9GA 2GELA 1P90A 5CZ2A 1BS2A 4JKGB 3O08A 4B9TA 4HCCA 3BP8A 3H3NO 5LL6Z 4XIUA 4H0VB 3VEYA 3OHRA 4RW9A 3BUZB 1C0FA 1F7UA 2JA8K 3NF7A 1C0MA 2VUMC 2IVPA 2YJFA 2QWLA 4N56A 3CJ9A 3IFRA 1NKCA 1Y1WK 3DLLL 4X6AK 1WSVA 3SAFA 1XHZA 4DR2K 4DB3A 1HNZK 1JXEA 5CYQA 2UXCK 3GTQA 2NRHA 4FVMA 5AZJB 3K5NA 4LR2A 2QXLA 4A3LK 4LF9K 2OPQA 2ETJA 3G10A 3KK1A 3ZSZA 4FLVA 4DV2K 1JCFA 5C10A 3ENBA 1JLBA 1TV6A 1B9DA 3AY9A 3NE6A 4FM2A 3LP0A 3O9TA 4BRKA 4CIEA 1TWAA 4DMNA 4HHTA 2A1SA 3SZZA 1RDWX 2F9TA 3S1RK 4A62A 4JKDA 2KZZA 3UKUB 4K25A 3C6HA 3QEPA 4E0DA 3UE5A 3CQ8A 1L3SA 2B6AA 4A3BK 3HOYK 1IO2A 3PIOL 1KXPA 1ZYRA 4CZJA 3QMLA 2O5JA 1GLDG 1NGHA 4MEYA 1XZPB 3ITHA 4I7FA 4BR4A 5AR0A 1BIZA 4A5BA 4KM8A 2OYQA 1BHLA 4WFBL 2ZFZA 5KRTA 2PBDA 1Q82O 4ILHA 1RILA 4LF8K 4BLAA 3TAQA 3S17K 1G51A 3OTOK 3GG4A 3GEEA 4CBUA 1RNHA 3PSIA 5C42A 3TU5A 3DLHA 4CGDA 3AVCA 4DU3A 1OKJA 4Q0BA 2Q36A 4CD1A 1TWHK 2ATQA 1HI9A 4CJ5A 3MXJA 5J1EA 4LF5K 3RVCA 3OYAA 1RTHA 4E19A 4OPJA 1SQKA 4BRDA 3L4QA 1T7PA 3DJCA 1NK8A 4BC3A 1ZVUA 3NGIA 2OANA 4BR2A 2Q1NA 4AM6A 3DRSA 4L8RB 3U9ZA 5IP9C 2R7ZK 3DWLA 3OREA 2ZD1A 3AD7C 4G7ZA 2NRXA 1HNXK 4JS4A 3HOWC 2V7ZA 1NMDA 4QS7A 2JA6C 3LDPA 5GIPA 3JSMA 5BRDA 2R7YA 2P9UA 3GTGC 3SV3A 1T6CA 1Q9YA 3MMLB 1WCMK 3O4QA 4CJTA 2G8VA 2HBKA 3HOZK 4B3TK 3NH0A 3Q3QA 3HT3A 3CCVN 3HP9A 4DSJA 4IFYA 1IBMK 2HNZA 1HPZA 4JD2A 4BC2A 5M1FA 4WE1A 3WXIA 3VGLA 3FR0A 2NRTA 1JL1A 1BA1A 2GEMA 3GTLC 2R93C 5KPZA 3T02A 5IYCK 3JXUA 1VGXA 1TK0A 5BREA 5IYBK 2PY5A 3HPOA 4BC4A 5I42A 5K14A 3B6OA 5AZIA 1NGGA 5M5WK 4A2AA 4FO0A 4B1YB 5BR9A 3FE1A 2YNFA 4DQRA 5HRSA 4DV4K 4ZTJA 4DR7K 4EHUA 5F1XA 3CJBA 5H1SQ 3ZX3A 4HTUA 3AAQA 4C3HK 3E66A 2XY7A 1RT1A 2QXFA 4KB4A 1QQCA 3HOVK 5AQVA 2R7ZA 2R93A 3LDSA 3N0BA 4AHVA 3BDPA 3S3MA 2EX3A 3WNHA 4O8KA 3U9DA 4YORA 2KFNA 2A68A 1TWGK 4C2MC 5KPTA 4ILDA 4EAHD 1WUAA 4HCBA 4FJIA 3EE8A 3OYBA 1IKWA 2HBLA 1HKBA 5FDLA 3HVRA 5BPLA 5AZJA 4A3FK 1SAZA 3HOXK 5JS1A 5CHIA 4B1XB 4DS5A 1J6XA 3MAQA 3VEVA 4CHQA 2FXUA 2HHSA 4DUZK 2PPBA 4DSIA 4FWNA 1NJIO 4LY7A 3PUFA 4KH4A 1BISA 4OKKA 4E1JA 2Q31A 4CGJA 3OYGA 1I6HK 3MDQA 3EKSA 4KH5A 2HNDA 3GDZA 4XSXA 1MWKA 3KLHA 3UKUA 4IJNA 2CGJA 3SMSA 3G4SN 3R8EA 3GOIA 5CHPA 4WFAL 1S6PA 1I50K 3NFAA 3SQ0A 4FLYA 3KIOA 4WJ4A 3CYMA 3SZ2A 4CE9A 4UY8O 1QQMA 3K59A 3IMXA 2GUIA 3AGKA 4NCGA 1HLUA 3WXKA 1U6ZA 4C1NI 3IKMA 3MX5A 3LDLA 1CZ9A 1NKBA 2VGMA 2QKKA 4GTAA 4A3MC 4BR7A 4M3YA 1SKSA 4Z4CA 2KZMA 3GTOK 4H5VA 4FWKA 1VQ7N 3KTQA 4L3QA 3OYDA 2YX6A 3KZBA 1KAYA 5M3MK 1GLFO 1WOSA 3VQBA 4CW7B 4DFPA 4PL7A 4BLBA 3DYAA 1DTQA 1Q18A 3QEIA 4A3KK 3QIPA 3CCSN 3EYZA 3R6MA 2JLEA 3V81A 4GY2B 4KTQA 1SFOC 1TKTA 4ZH4A 4KMAA 4DF8A 2O8CB 3G25A 1J5OA 1VQLN 1RTJA 3ENOA 2PZSA 4M3XA 2V6UA 3K5OA 2HHWA 2FBYA 3GIRA 4JAXA 1LW0A 4EZ6A 2NRWA 3LPTA 3FOFA 4O0IA 1T3VA 3K0SA 3RWUA 3EQLA 2ZJQL 2NVYK 1YUWA 2E8AA 1NGBA 2HF4A 2DTUA 1RT6A 2FC0A 2A6HA 1WAFA 4Y1DA 1QTMA 3NDKA 4GZYA 4AHUA 1O24A 4MLHA 3O9RA 4JI8K 4KN4A 5AQXA 3GTMC 3S2DC 3SBTA 3O1BA 4IJAA 3QX3A 4BXXK 5AQHA 3VQAA 2ASMA 3AV9A 4FLWA 3H0GC 3N0CA 3OA9A 1WAJA 2W6LA 4NO7A 5DM7L 1I6VA 5M5XK 4FZYA 3MCAB 4FPAA 1BCOA 4RTFD 4C8NA 1R0AA 4E7HA 2KFZA 3B6PA 2E2JC 4KMUA 1QZ5A 3CC7N 4BQLA 4B08A 4KTWA 4B3MK 4E3SA 2QWMA 3ID8A 2D0PA 5J2QA 4C3IC 3MEGA 5M1NA 3QDKA 4G7HA 5AJ3K 3CCUN 3T1HK 3OYEA 3DM2A 3DI6A 5KQDA 3GTOA 1NJYA 3GTJC 1RT2A 1FJGK 2E2IC 3S1MC 3EZWA 2O5IA 2HOEA 3C6TA 5TKWA 4BGBA 3TSPA 3F9KA 4FPBA 4YOXA 5GAEP 3VQ6A 1W2BM 5C0YA 2G8WA 2P5GA 4FWRA 2YNHA 1I3AA 2OTJN 3EO3A 1GE9A 1JKHA 3BP3A 5BN9A 4A3IK 3TTCA 3RZDK 5GAHP 4QCLA 3HP6A 4IOAL 3KKSA 5FRNA 1YTUA 1VH2A 1NJXA 4JK8A 2P9NB 2B63K 5I3UA 2ITGA 3CJAA 3NH1A 1C0UA 5B8HA 4JI2K 1BL3A 4Z0UA 3F2KA 3TR8A 4PHTX 3SUOA 4BY9C 1F9NA 2EBBA 1TYQB 3FHZA 3P4IA 5M1PA 5KRSA 1LWEA 5J2PA 4DQSA 2KKZA 1UA0A 4CJFA 3U4LA 4FJMA 3ZX0A 3TWHA 1XC3A 4KRFA 1EX4A 3T00A 2YKMA 3V9WA 1IS1A 5KI6A 2QI2A 1XZQB 4FJ5A 1IE0A 1YAGA 3ZETB 4CF0A 3MXIA 5I9EB 1W9HA 2KW4A 2Q0RA 4RG8A 3TTDA 2F8SA 1ZBLA 1WBDA 1NK0A 4LLGA 5BPNA 3TFIA 4A93C 4CJEA 3MEDA 3M8QA 1TUYA 4B9UA 3ZSQA 4YOYA 1SV5A 1WSGA 3L3VA 1O1WA 3FKIC 4BC5A 4K43A 2CW0A 5CJ9A 4FK2A 4DTXA 2PMZD 2O8DA 2RN2A 3EKUA 3A8KA 4IDKA 4FJ7A 3SJJA 3CQZK 4BWMA 2BDPA 1C1BA 3S2HC 4I2QA 5FPDA 3ZT4A 5C3EK 4M3TA 3L6QA 3IS9A 1K9MO 1YIJN 2VCPA 1IL2A 2XCOA 4LF7K 3J8AA 1E4FT 1KAXA 5EXWA 3KWGA 4Y52C 4DTUA 3KLEA 4CFDA 3AO5A 1HMVA 2XY8A 5ELZA 5HLFA 1TAUA 3K7AC 2O8EB 2J4RA 1YTAA 3VQEA 4AH6A 1O2FB 2E5LK 2DPNA 5KGWA 1R9TK 4B8CA 4FCYA 3OYCA 5IOTA 3CFOA 1XNRK 1HYZA 4DV6K 4DFMA 1VAZA 2D0CA 1I94K 1HJOA 5M1OA 1X9WA 4NCBA 4O8UA 3OYIA 5SZTA 1DCPA 4I6MB 4GFQA 4KMDA 3A5NC 1WIHA 1NMNA 2JA5C 5E41A 2YCHA 3I4MK 1VLOA 4A3CC 1LOTB 3OBYA 1FKOA 1X3MA 5KGXA 1NM1A 5AQGA 5FROA 2BUPA 2P9SB 4G1QA 4A5AA 4KATA 1KVCA 4EP5A 1ZBSA 4FW1A 3G0ZA 4DCHA 4F2RA 1TWCK 1VSIA 3CFPA 3FZLA 5HRPA 3HOUC 4C8MA 4M3UA 2CGKA 3FGUA 4FJ8A 5AQYA 2VGNA 3MMVA 3O3HA 3L4KA 1IBAA 3NH2A 4XEIA 3GTPC 3AA4A 3DXMA 4WQ5C 1ITGA 3ERED 3C0BA 4YOUA 4DKWA 3SI6A 3A5OC 4I9LA 1BJTA 4IOXA 3LDQA 4JS5A 3G71N 5AFUA 3VEWA 4KO0A 5AFUH 4E89A 1RDAA 1JJ2M 3CQZA 1TKXA 1HQUA 3S14K 1BU6O 1O2BA 4FWPA 2BTFA 3BUEA 2KTQA 4HWIA 5EY4A 3GTQK 4WYBA 3KK2A 4CZIA 1QSLA 3PO3C 2A3ZA 4JK1A 1NGAA 5JFEA 1QVFM 4W5QA 2I7NA 2NRZA 2ZF5O 3LL3A 1J9AA 3CPWM 3CMEN 3MN9A 3SMPA 4BR0A 1QS4A 3DLKA 2E4LA 1X31C 3R9PA 3S1QK 1YXQA 4X66K 3GTPA 1X3NA 3O4WA 4WQ5A 4ELTA 2VUMK 2WFBA 1CXQA 2GX9A 1R9TA 4CK3A 1ZYQA 4B1UB 3HBTA 3WODA 1SL2A 3HOTA 3HSCA 4LJZA 3ASMA 1EH1A 3NF9A 5EGHA 3TSQA 1EQRA 3OYHA 4WCEL 3JSTA 1ESVA 1HQEA 1LAVA 2DFEA 1P8ZA 3T01A 4CIGA 3GDQA 4FOIA 5AQUA 1VSLA 2P9NA 5C4JC 2HBJA 1IJJA 2ASPA 1JLAA 3AVMA 3ZYYX 1F21A 2P8TA 5LMUK 1TWCA 1RT5A 1QHAA 3HXAA 2NVQC 2KLAA 4DTRA 3TSUA 4YFXA 3PLAA 3OYNA 4DV3K 1DTTA 3NF6A 4KHQA 1YCLA 4N76A 1JVIA 3EY1A 2AP1A 3DOKA 3ZT0A 5CR4A 4X64K 4FYDA 4DHYA 1ZXOA 4Q5VA 1XZQA 5JS2A 1NGEA 1IKYA 4DTPA 3ZETA 5M1KA 4B3SK 1S22A 4OPKA 4JKHA 3P1GA 4FWLA 1WB9A 3IG1A 4CD3A 2HVIA 2X74A 1PJ7A 4BR5A 1LV5A 3FZFA 2E6MA 1ATNA 3WNEA 1Y1VC 3R3LA 1C0TA 3O9QA 4BRIA 3LALA 2O4GA 4G0VA 4AQYK 3AA3A 4KC6A 3SJHA 2PMZL 1RDUA 2F96A 1V4SA 4DQIA 3VETA 4OO1J 2NVXC 4E7JA 4KAWX 2G8IA 1JCEA 4YG2A 2QEXN 3CI5A 3H3OB 2UUBK 4H4MA 2E1YA 4ID5A 2VUMA 2A1RA 1WSJA 1T03A 2FQOA 1X9MA 3V9ZA 1RBUA 2O8BA 1WSRA 3OY9A 3PSFA 4M7YA 4JRQA 1N36K 5AQIA 2O4IA 2ZUFA 2YNIA 4ISFA 3HYFA 4GTLA 5IP9K 4F3TA 2FBXA 1USOA 4PKGA 3VEOA 1RBTA 1T6DA 4XH4A 4Y7NC 5JMVA 3O9SA 1I3QC 2EHGA 3OPFA 1R59O 4J2EA 1OVQA 4KB0A 2YHWA 1JLFA 1LW2A 4CJSA 1VRTA 3AAPA 3H45C 3HI0A 3SUPA 3BGRA 2NVXA 3HOWK 1YNNA 4O44A 2JA6K 2GAHC 3L4JA 1GLAG 3N3YA 1JXBA 5GINA 2OZMA 1O28A 2F4VK 4A61A 4R79A 3GTGK 1A5VA 4DWIA 1DLOA 4OIQA 1Y1WC 4DV5K 5M1QA 3AH5A 4X6AC 5JVOA 4BG8A 3H6EA 3ATVA 2P9SA 2OZSA 2BH1A 3PV8A 5HOOA 4DFKA 2YHAA 5AQJA 2WBNA 1WSHA 1VQ9N 3VA0A 3GE1A 1S1UA 3S15C 1I3QA 1LAWA 1NGCA 1WN7A 4JHDA 4BGAA 1JLQA 3GTLK 2R93K 2IC3A 3RRGA 1RT7A 2X78A 4G0UA 5HL7L 3SQ2A 3P31A 2IGIA 5HP1A 3MWPA 3CMAN 3SV4A 4IG3A 3S1RC 1WSEA 3DMJA 4JI7K 3QINA 1TAQA 5C24A 4XH1A 4DUYK 4H0OA 4BBRK 5E68A 4ILJA 3RRHA 3J81O 4DR3K 4CJ4A 4FJKA 3VESA 2XHBA 3A8YA 1YJWN 5C44C 4CGIA 1XC9A 2DFFA 1G99A 3Q7CA 1EQYA 3P83D 1N6QA 1J6WA 1M90O 1WSIA 1HX1A 4LH4A 4IO9L 1K8KA 2A41A 1Q7YO 3LM2A 3QNOA 5BRHA 4B1VA 2I7PA 1J98A 3KK7A 3TANA 4WFNL 5C15A 4E7LA 1KQSM 1B4AA 1Z6RA 1O13A 3TFJA 2JA6A 3BZCA 1S72N 3C6AA 2YNGA 3KLFA 2V6SA 1TWHC 3GTGA 4DU1A 4BQZA 3E1YA 4H0XB 3NCIA 2IOCA 3VQ8A 2Q3SA 5IORA 3OYKA 4CHZA 5LJVA 3D2EB 1WQHA 3GTKC 1NG9A 3T19A 4H5RA 1Y97A 1GOAA 4XLNA 4CVNE 3GSIA 2P9IB 4DV0K 5KTQA 4DSLA 4LSNA 4NXNK 3THXB 3JYTA 1RDBA 4JKGA 3ZT1A 3BY5A 3P5JA 2Z1GA 5FJ8K 1VRQC 3CC2N 1UV7A 4BVPA 3GTLA 5CZ1A 3M1FA 4XCHA 4YDUC 4FZZA 3HVTA 1LWCA 4F4KA 3ULEB 4KAZA 3N4PA 4KASA 3OJSA 3FLCO 5C4XC 5AQWA 4KHPK 3HOZC 3LANA 2ZQBA 3OVNA 3AVAA 3THWB 4JK7A 2UXBK 4YNQA 4BDZA 1W97L 2O8FB 3NUHA 1OVYA 3KVGA 4M42A 4M7XA 2IIRA 2VQEK 2FSNA 4RCHA 4JI3K 3MXMA 4DR1K 3C65A 3W0LA 4GV6A 3RSEB 4A2BA 3WEEB 3L8BA 4KHWA 3K9JA 4GV9A 1VJEA 3J7ZO 4DR5K 3CQXA 2JA7C 4CF9A 2G8KA 2Z1HA 4QJVB 4IEIA 4JI6K 3DLGA 1DCOA 3AD9C 4CJLA 1IG8A 4YDUA 1ATSA 5CE3A 1OH5A 4WQ4C 4GKKK 3CM6A 4QIWD 3AVLA 4CEOA 3DLBA 1C0AA 3HXMA 1RU0A 5EOYA 4CEDA 4FZXC 3ID6A 2W42A 3TAPA 5EU7A 3QERA 1WSFA 3UB5A 4AHCA 4PUOA 1XZPA 4J3NA 4B9VA 4BKWA 1HNVA 1TK5A 2UUCK 4C3HC 4H5NA 4IO8A 3K58A 5AQPA 3C7NB 3LWMA 3WXMB 1EI6A 3HOVC 1S1VA 4CESA 4AILC 1M1KO 1QSSA 2JA7A 3K9KA 1UOCA 3GTMK 4H0TB 3AO1A 1WQFA 3H3VD 2ZJRL 4LK0A 4RW6A 3CFRA 1BO5O 3WUHA 2ZE2A 3BF3A 2RF2A 4WQ4A 3AD8C 2P9LB 3FZKA 3RR8A 4E1MA 3DLEA 5TMCA 3D45A 3M3YC 3H0GK 1U2VB 2IS3A 3R1XA 2HHXA 1YX2A 2W7VA 1SL1A 3N4QA 4A3FC 3SAGA 5IYDK 3CJ7A 3HOXC 3O5BA 1IV0A 2XCQA 5JICA 4O4GA 4PAAA 4KH6A 2PYJA 4C8OA 4QOZB 4CZKA 4LSLA 4AYBL 2QWPA 1F7VA 4IXCA 4C3IK 3U3GA 2FF6A 2OA8A 2PA8D 4KN7A 3GTJK 4NLCA 2E2QA 4GTBA 3WNGA 4TSXA 3NGYA 4CJQA 2Z1JA 4GTCA 1O29A 3ZLJA 2IAJA 3D2FB 4Z4HA 1CLQA 5SWMA 1BI4B 1K83C 3M5RA 1C6VA 4RW8A 3S41A 1T44A 2DFHA 1SFOA 3H1QA 1NNEA 3E9PA 3OYMA
chains in the Genus database with same CATH topology
1KQ4A 2P9KB 5FPNA 1VAZA 3MN6A 4JK9A 3GTQA 4UY8O 1HJOA 2NRHA 5AZJB 5M1OA 1EO1A 4LR2A 2RHKA 2JH3A 4O8UA 2QXLA 3MN5A 1K8AO 5AQQA 3HTVA 1N8RO 4I6MB 4GFQA 2P9PB 3W3DA 3D6RA 4KMDA 1JCFA 1XXCA 3A5NC 1TWHA 3VF4A 5C10A 1WIHA 3ENBA 4WF9L 2YCHA 3WQTA 1LOTB 3OBYA 2E2NA 3AY9A 4BVOA 2E20A 3NVKA 2CFAB 1X3MA 3O9TA 1ATRA 4KBOA 1MDUB 4BRKA 1NM1A 5AQGA 4A5AA 2BUPA 2P9SB 3TPQA 4BRLA 1TWAA 4KATA 4CZMA 1RDWX 1ZBSA 3CCJN 2F9TA 2H3GX 4A62A 2F9WA 3GTKA 2GSNA 4JKDA 4DCHA 3A5MC 3UKUB 3GTMA 4K25A 3C6HA 3NVMA 4B9QA 3FZLA 3UE5A 1YJNN 2CGKA 3FGUA 3PIOL 5AQYA 4JKBA 2VGNA 3MMVA 1KXPA 4LQYA 4CZJA 3L4KA 3D2EA 3H0GA 3QMLA 4KDDA 3QFPA 3VTIA 4IFEA 4XEIA 3DXMA 1GLDG 1NGHA 4WQ5C 1VQKN 3ERED 3T69A 3C0BA 4YOUA 2QWOA 4JKCA 1EK8A 4BR4A 4BRNA 4DKWA 3A5OC 2ZWHA 3DAWA 5AR0A 1BJTA 4H5WA 4IOXA 4A5BA 4MO5A 3LDQA 4KM8A 3G71N 5AFUA 3VEWA 4WFBL 5AFUH 2ZFZA 1JJ2M 2PBDA 4JKFA 3CXCM 1Q82O 3NMUA 2GWKA 1GLCG 1BU6O 4ILHA 4YOWA 1DGKN 1YF5L 4FWPA 2BTFA 1O2BA 1WCMA 4BLAA 3BUEA 3CAGA 4HWIA 3GG4A 5EY4A 4GTFA 4CBUA 4DDQA 4WYBA 4KMHA 3TU5A 3GTJA 4CZIA 4P5BA 2E2IA 2A3ZA 3ENHA 1NGAA 3ULEA 5JFEA 5IOSA 1QVFM 3P39A 4KARA 2I7NA 2NRZA 2YJEA 2ZF5O 3LL3A 1VQMN 3CPWM 3CMEN 1OKJA 3D7EO 3MN9A 2Q36A 3SMPA 4BR0A 4CD1A 3CCLN 3U8XA 3DXKB 3R9PA 3RVCA 4CJ7A 3UKRB 4CZFA 2FLOA 3VENA 1YXQA 5MLCQ 4CZHA 3GTPA 1SQKA 1X3NA 2ZGYA 3O4WA 4WQ5A 4BRDA 4G9ZA 2E1ZA 3L4QA 2OTLN 2WFBA 1R9TA 2GX9A 3DJCA 3S0XA 4B1UB 4BC3A 1ZVUA 3HBTA 3RSEA 4QS8A 2OANA 2A6AA 2QWRA 2Q1NA 4AM6A 4BR2A 3HOTA 3U9ZA 1XQSC 2ZJPL 3B8AX 3HSCA 4FOEA 1EH1A 3DWLA 1RGIA 5EGHA 3TSQA 3OREA 5EGEA 3SK3A 2NRRA 1VQNN 1SS6A 2NRXA 2VYPA 4WCEL 4A57A 4EFHA 1ESVA 1P8ZA 4H03B 3GDQA 4FOIA 5AQUA 2V7ZA 3AQPA 3G4CA 1NMDA 2A40A 4QS7A 1NWKA 3LDPA 3SLCA 5GIPA 5AQTA 2P9NA 4GTDA 4C3JC 2HBJA 1IJJA 2ASPA 3O80A 2P9UA 2YHXA 3MK6A 5BRDA 1DEJA 4BRPA 3O1WA 1T6CA 1BG3A 4FL9A 3ZYYX 5JLHA 3MMLB 3LDOA 1TWCA 3VA7A 1VQ5N 2HBKA 1QHAA 2EWSA 3T7ZA 2KLAA 3CCMN 3Q3QA 2YI1A 3TSUA 3M3ZA 3PLAA 4B1ZA 3CCVN 5TJ3A 5IOQA 4CBXA 3C7NA 4K41A 2AP1A 1TWGA 2RH6A 1QQOA 5CR4A 2FSJA 1BWFO 4DHYA 1ZXOA 4JD2A 2W41A 4BC2A 4FM9A 1NGEA 3EL2A 3ZETA 4ILGB 5M1FA 1S22A 5M1KA 4JKHA 3WXIA 2NNWA 4FWLA 5ADXA 3VGLA 5ADXH 2Q0UA 3FR0A 4CD3A 5GIOA 4YOVA 2NRTA 2QM1A 1XXAA 1BA1A 2GEMA 3FKIA 1Q86O 4C1NK 5KPZA 1H1VA 3FOEA 3JXUA 3CD6N 4BR5A 3CQZA 3CETA 2HMPA 5BREA 3FZFA 1U2VA 1ATNA 2PAVA 3MCPA 3QICA 3R3LA 3O9QA 4BC4A 4BRIA 5BN8A 3CCEN 2P5MA 3O8MA 4G0VA 3EE9A 5BRFA 4K42A 4KC6A 5AZIA 3SJHA 1NGGA 4A2AA 1RDUA 4FO0A 4B1YB 5BR9A 3I56N 3FE1A 3VEXA 3F9MA 1V4SA 3LDNA 5E26A 3VETA 3A5LC 4OO1J 3DXMB 3SBGA 4H0PA 4KAWX 1JCEA 5C2DA 2QEXN 1CZAN 3CI5A 3H3OB 4EHUA 3CJBA 2HSTA 5F1XA 5H1SQ 3ZX3A 2W40A 1KD1O 1Q81O 1VQ8N 2E1YA 3MX2A 3AAQA 3QB0A 2VUMA 1I50A 2UYTA 3E66A 4AF1A 1K83A 1NLVA 4KB4A 1WOQA 4XH5A 5AQVA 4CZGA 4KB2A 4M7YA 4QS9A 5AQIA 2R7ZA 2R93A 4Y0WA 3N0BA 4GNIA 4ISFA 4O8KA 2YU9A 3U9DA 1O2AA 4GTLA 4YORA 5AQOA 1GLJO 1AB4A 5AQNA 4C2MC 5KPTA 4PKGA 4ILDA 1YI2N 3VEOA 2XCRB 4EAHD 1T6DA 4XH4A 1WUAA 1BOTO 1VQ4N 2QTDA 3ZEUB 5F0XA 2P9IA 3EE8A 1NBWA 3O9SA 5JMVA 1Z05A 4MDBA 3OPFA 1R59O 2HBLA 2E2PA 2P9KA 2YHWA 1HKBA 3JS6A 4PKHA 2E88A 5E84A 5BPLA 1V4TA 3AAPA 3H45C 3HI0A 4PKIA 4Z94A 5AZJA 2NVXA 1ILYA 2JA5A 1SAZA 1Y64A 5CHIA 3L4JA 1GLAG 4LC9B 4B1XB 3N3YA 4FZBA 3L4IA 5GINA 3VEVA 1O28A 2JWKA 5KPRA 3H1VX 4A61A 4R79A 4CZLA 3A0IX 3CPEA 2WC9A 2FXUA 2ITMA 3L0QA 2F7TA 1XXBA 1KC8O 4AM7A 5M1QA 4FWNA 1NJIO 3AH5A 3HM8A 5JVOA 4E1JA 4KH4A 4BG8A 1WQGA 3H6EA 3ATVA 1YJ9N 2Q31A 2CFAA 3MDQA 3EKSA 3CJ1A 2P9SA 3MN7A 2BH1A 5GADP 4KH5A 4CBWA 5HOOA 1MWKA 3OBWA 3E9LA 5AQJA 3UKUA 2WBNA 4IJNA 2CGJA 2R92A 4GVEA 3SMSA 3R8EA 3GOIA 3G4SN 5CHPA 1VQ9N 4WFAL 3Q7BA 3V4GA 3GE1A 3EN9A 2GTDA 5AQLA 1QZ6A 1I3QA 3WEEA 1E4GT 3VEZA 3M6GA 3FFKB 4OPAA 1NGCA 3CF5L 2E2OA 4JHDA 1QQMA 2HF3A 2QWNA 4FSVA 4BGAA 3SAHA 3WT0A 3IMXA 2NVYA 3AGKA 4CI6A 1BDGA 4G0UA 5HL7L 3CJCA 1HLUA 1TUUA 3P31A 3WXKA 1VQ6N 1U6ZA 4C1NI 3IKMA 3MWPA 5LJWA 1YITN 3MX5A 2CH5A 3CMAN 3LDLA 3CC4N 2VGMA 3CQYA 5C12A 2KWAA 4GTAA 4BR7A 1TWFA 3AGRA 4H5VA 4XH1A 4H0OA 4FWKA 4M1XA 1VQ7N 4ILJA 2WUSA 4L3QA 2YX6A 3KZBA 1KAYA 1GLFO 2PHCB 3LPXA 3VESA 2V52B 4U67L 4RWTA 3A8YA 1YJWN 4PL7A 1G99A 4BLBA 1TYQA 1Q18A 5FPMA 3Q7CA 3VF2A 1EQYA 3DXKA 3ATUA 1X9JA 1M90O 1C0GA 1HX1A 4M63C 3UKRA 3CCSN 2AA4A 1K8KA 3R6MA 4IO9L 1VQON 4GY2B 2A41A 1Q7YO 3IUCA 3LM2A 4KMAA 5BRHA 1RFQA 5AZIB 4GT9A 1J6ZA 3CERA 3G25A 4BRGA 2V7YA 4PL8A 1VQLN 3ENOA 4B1VA 2I7PA 1YHQN 2D0OA 1BGWA 3VGMA 3KK7A 4OPHA 3IDHA 4IZ9A 3QBWA 3TTFA 4WFNL 5C15A 1NGIA 4JAXA 1KQSM 4HTLA 1B4AA 1Z6RA 1O13A 2P9LA 2JA6A 2NRWA 1S72N 3C6AA 3FOFA 1T3VA 5JVGL 3OW2M 4H5TA 3GTGA 4BR9A 2ZJQL 4BQZA 3E1YA 4H0XB 4EHTA 1YUWA 2E8AA 3I33A 3ZX2A 1NGBA 2HF4A 4FWOA 5IORA 1QQNA 3P38A 5LJVA 3D2EB 5F2RA 1WQHA 3QFUA 3VMFB 1O24A 2D4WA 3O9RA 4MLHA 5AQXA 3F5TA 2D1KA 4H5RA 3SBTA 3O1BA 4IJAA 3QX3A 5AQHA 5C2FA 2CGLA 2P9IB 4BRFA 2ASMA 1ZC6A 4JKGA 3N0CA 2B63A 3OA9A 4MO4A 4P5AA 5TKYA 5JVHL 4IWVA 4NO7A 5DM7L 2NLXA 2NRVA 3MCAB 4FPAA 3VGKA 4RTFD 3CC2N 2ZGZA 4BVPA 1NGDA 3AARA 3D2FA 3HRGA 3GTLA 3M1FA 3CCRN 3I8BA 1BA0A 4YDUC 3VERA 4GTEA 2PFUA 3FZMA 3ULEB 1QZ5A 1Y1VA 1GLBG 3CC7N 4BQLA 2Q2RA 3N4PA 3VF6A 1HUXA 3FLCO 4KASA 5AQWA 3H46O 2QWMA 3ID8A 2D0PA 4BRMA 1ISEA 4NLBA 5M1NA 3QDKA 4C3IC 3CCUN 2GWJA 3VTHA 5AQZA 4ISGA 5KQDA 3GTOA 5AQFA 2GSOA 3EZWA 1O25A 4A59A 2HOEA 4JK7A 4IEEA 5TKWA 5AQKA 4BGBA 1W97L 5KQ8A 3NUHA 1OVYA 3KVGA 4FPBA 2ASOA 3TSPA 4YOXA 2FF3B 2IIRA 4M7XA 2FSNA 2KHOA 4I6MA 4BRQA 4RCHA 2P9PA 5GAEP 1DKGD 4JEPA 2JWLA 3C65A 4JN4A 3RSEB 3W0LA 3WEEB 4A2BA 4GV6A 3G4AA 3GL1A 1W2BM 2E2HA 3K9JA 4GV9A 4MDAA 5C0YA 4JHDB 3J7ZO 5DM6L 3BEXA 4FWRA 2Q97A 1YVNA 3CQXA 2OTJN 1MA9B 3EO3A 2IVNA 1GE9A 3KWIA 4FWMA 2RE2A 4IEIA 2FSKA 5BN9A 3TTCA 3I55N 5AQSA 1IG8A 1NGJA 4YDUA 3O9UA 3HOSA 2HBMA 5GAHP 3LM9A 4H0YB 4B1WB 2QA4N 1ATSA 3FZHA 5CE3A 4WQ4C 4IOAL 3WXLA 3VOVA 4BRAA 4U7BA 4JK8A 2P9NB 4FWQA 3QBXA 5GAGP 1O26A 3CJAA 2P9UB 5EOYA 5B8HA 1KAZA 2VWBA 1XUPO 1QVGM 3F2KA 1S3XA 3ID6A 4EIAA 4BROA 4PHTX 1JCGA 3WXJA 1HPMA 1MWMA 3MWTA 4BY9C 1F9NA 3UB5A 1TYQB 4J3NA 3FHZA 3ZEUA 3P4IA 2IVOA 4KM9A 2YHYA 4FWSA 4IDHA 5M1PA 4BKWA 4JKAA 4C3HC 2KKZA 2A42A 4H5NA 4IO8A 3G6EN 3CIPA 1K8KB 5AQPA 3C7NB 2CH6A 3U4LA 3WXMB 2RGRA 1Y1WA 3ZX0A 5JLFA 1XC3A 1DT9A 2QW9A 3GBTA 1M1KO 2JA7A 1IS1A 3HZ6A 2QI2A 4JD2B 1NGFA 3K9KA 2Y3PA 4JKEA 1YAGA 4JNEA 3ZETB 5I9EB 3CCQN 2V51B 2Q0RA 4H0TB 4YOTA 3TTDA 1WQFA 4IOCL 2ZJRL 1BO5O 3WUHA 5BPNA 3BF3A 4WQ4A 4BG9A 2P9LB 2A5XA 1HKGA 1GLEG 3FZKA 1GLLO 3O6WA 1HKCA 5BPMA 5FPEA 4GV3A 2GSUA 2GUPA 1TUYA 1BUPA 1O27A 1U2VB 5LY3A 4YOYA 3R1XA 5EVZA 3LAPA 3CHWA 4NB4A 5AQRA 3VPZA 1D4XA 2NZTA 4BREA 3N4QA 4BC5A 5AQMA 4K43A 3SAGA 1LCUA 4GTBA 3CJ7A 5CJ9A 3O5BA 2QWQA 4BRCA 5JICA 2XCQA 4C23A 1SZ2A 3LAJA 3EKUA 4KH6A 5EX5A 4MLEA 4CZKA 1VQPN 4F9OA 4BRHA 4FVUA 4J8FA 3OEPA 4G0WA 2QWPA 3BF1A 4IXCA 3WQUA 4DQ8A 5FPDA 3L6QA 3PIPL 1K9MO 2GELA 2FF6A 4O5FA 1P90A 1YIJN 2VCPA 3E9OA 4JKGB 3AQOA 4NLCA 3O08A 2XCOA 3BP8A 3H3NO 2E2QA 3J8AA 1E4FT 1KAXA 4H0VB 3KWGA 3OHRA 5EXWA 3VEYA 3BUZB 1C0FA 4CZEA 4GTCA 1O29A 3D2FB 5ELZA 2IVPA 2YJFA 2QWLA 1B4BA 1DD5A 2J4RA 4ISEA 3M5RA 3CJ9A 3KHYA 3IFRA 3DLLL 3SAFA 2DPNA 3S41A 1K73O 1T44A 1SFOA 4DB3A 3H1QA 3E9PA 5IOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9K B;  5FPN A;  3MN6 A;  1HJO A;  2NRH A;  5AZJ B;  2QXL A;  3MN5 A;  5AQQ A;  3HTV A;  4I6M B;  2P9P B;  3W3D A;  1JCF A;  3A5N C;  3VF4 A;  2YCH A;  3WQT A;  1LOT B;  2E2N A;  3AY9 A;  4BVO A;  2E20 A;  1X3M A;  4KBO A;  1ATR A;  4BRK A;  1MDU B;  1NM1 A;  5AQG A;  4BRL A;  2BUP A;  2P9S B;  3TPQ A;  4CZM A;  1RDW X;  1ZBS A;  2F9T A;  2H3G X;  4A62 A;  2F9W A;  4DCH A;  3A5M C;  3UKU B;  4K25 A;  4B9Q A;  3FZL A;  3UE5 A;  2CGK A;  3FGU A;  5AQY A;  3MMV A;  1KXP A;  4CZJ A;  3D2E A;  3QML A;  3QFP A;  4XEI A;  3DXM A;  1GLD G;  1NGH A;  4WQ5 C;  3C0B A;  2QWO A;  4BR4 A;  4BRN A;  3A5O C;  2ZWH A;  3DAW A;  5AR0 A;  4H5W A;  4MO5 A;  3LDQ A;  5AFU A;  3VEW A;  5AFU H;  2PBD A;  2GWK A;  1GLC G;  1BU6 O;  1DGK N;  4FWP A;  2BTF A;  4HWI A;  3GG4 A;  5EY4 A;  4CBU A;  4WYB A;  3TU5 A;  4CZI A;  2A3Z A;  3ENH A;  1NGA A;  3ULE A;  2I7N A;  2YJE A;  2ZF5 O;  3LL3 A;  1OKJ A;  3D7E O;  3MN9 A;  2Q36 A;  3SMP A;  4BR0 A;  4CD1 A;  3U8X A;  3DXK B;  3R9P A;  4CJ7 A;  3UKR B;  4CZF A;  2FLO A;  3VEN A;  1YXQ A;  4CZH A;  1SQK A;  1X3N A;  2ZGY A;  3O4W A;  4WQ5 A;  4BRD A;  2E1Z A;  3DJC A;  4B1U B;  4BC3 A;  3HBT A;  3RSE A;  4QS8 A;  2OAN A;  2A6A A;  2QWR A;  2Q1N A;  4AM6 A;  4BR2 A;  3U9Z A;  1XQS C;  3B8A X;  3HSC A;  4FOE A;  3DWL A;  1RGI A;  3SK3 A;  2VYP A;  4EFH A;  1ESV A;  1P8Z A;  4H03 B;  3GDQ A;  4FOI A;  5AQU A;  2V7Z A;  1NMD A;  2A40 A;  4QS7 A;  1NWK A;  3LDP A;  3SLC A;  5AQT A;  2P9N A;  1IJJ A;  2ASP A;  3O80 A;  2P9U A;  2YHX A;  3MK6 A;  5BRD A;  1DEJ A;  4BRP A;  3O1W A;  1T6C A;  1BG3 A;  4FL9 A;  5JLH A;  3LDO A;  1QHA A;  2EWS A;  2YI1 A;  3M3Z A;  4B1Z A;  4CBX A;  3C7N A;  4K41 A;  2AP1 A;  1QQO A;  2FSJ A;  1BWF O;  4DHY A;  1ZXO A;  4JD2 A;  2W41 A;  4BC2 A;  1NGE A;  3EL2 A;  3ZET A;  1S22 A;  3WXI A;  5ADX A;  4FWL A;  3VGL A;  5ADX H;  2Q0U A;  3FR0 A;  4CD3 A;  2QM1 A;  1BA1 A;  2GEM A;  5KPZ A;  1H1V A;  3JXU A;  4BR5 A;  3CET A;  2HMP A;  5BRE A;  3FZF A;  1U2V A;  1ATN A;  2PAV A;  3MCP A;  3QIC A;  4BC4 A;  4BRI A;  5BN8 A;  3O8M A;  5BRF A;  4K42 A;  5AZI A;  3SJH A;  1NGG A;  4A2A A;  4FO0 A;  4B1Y B;  5BR9 A;  3FE1 A;  3VEX A;  3F9M A;  1V4S A;  3LDN A;  5E26 A;  3VET A;  3A5L C;  3DXM B;  4H0P A;  1JCE A;  1CZA N;  3CI5 A;  3H3O B;  4EHU A;  3CJB A;  5F1X A;  3ZX3 A;  2W40 A;  2E1Y A;  3AAQ A;  3QB0 A;  2UYT A;  1NLV A;  1WOQ A;  4XH5 A;  5AQV A;  4CZG A;  4M7Y A;  4QS9 A;  5AQI A;  4Y0W A;  4GNI A;  4ISF A;  4O8K A;  3U9D A;  5AQO A;  1GLJ O;  5AQN A;  5KPT A;  4PKG A;  3VEO A;  4EAH D;  1T6D A;  4XH4 A;  1WUA A;  1BOT O;  3ZEU B;  5F0X A;  5JMV A;  2P9I A;  1NBW A;  1Z05 A;  1R59 O;  3JS6 A;  2E2P A;  2P9K A;  2YHW A;  1HKB A;  4PKH A;  5E84 A;  2E88 A;  5BPL A;  1V4T A;  3AAP A;  3H45 C;  3HI0 A;  4PKI A;  4Z94 A;  5AZJ A;  1SAZ A;  1Y64 A;  1GLA G;  4LC9 B;  4B1X B;  3L4I A;  3VEV A;  5KPR A;  3H1V X;  4A61 A;  4CZL A;  3A0I X;  2FXU A;  2ITM A;  3L0Q A;  4AM7 A;  4FWN A;  3HM8 A;  4E1J A;  4BG8 A;  3H6E A;  3ATV A;  2Q31 A;  3MDQ A;  3EKS A;  3CJ1 A;  2P9S A;  3MN7 A;  4CBW A;  1MWK A;  5AQJ A;  3UKU A;  4IJN A;  2CGJ A;  3SMS A;  3R8E A;  3GOI A;  3GE1 A;  3EN9 A;  2GTD A;  5AQL A;  1QZ6 A;  3WEE A;  1E4G T;  3VEZ A;  3M6G A;  3FFK B;  1NGC A;  2E2O A;  4JHD A;  1QQM A;  2HF3 A;  2QWN A;  4FSV A;  4BGA A;  3WT0 A;  3IMX A;  4CI6 A;  1BDG A;  3CJC A;  1HLU A;  1TUU A;  3WXK A;  1U6Z A;  5LJW A;  2CH5 A;  3LDL A;  3CQY A;  4BR7 A;  4H5V A;  4XH1 A;  4H0O A;  4FWK A;  2WUS A;  4L3Q A;  3KZB A;  1KAY A;  1GLF O;  3VES A;  2V52 B;  4RWT A;  3A8Y A;  4PL7 A;  1G99 A;  1TYQ A;  1Q18 A;  5FPM A;  3VF2 A;  1EQY A;  3DXK A;  3ATU A;  1X9J A;  1C0G A;  1HX1 A;  4M63 C;  3UKR A;  2AA4 A;  1K8K A;  3R6M A;  4GY2 B;  2A41 A;  3IUC A;  3LM2 A;  5BRH A;  1RFQ A;  5AZI B;  1J6Z A;  3CER A;  3G25 A;  4BRG A;  2V7Y A;  4PL8 A;  3ENO A;  4B1V A;  2I7P A;  2D0O A;  3VGM A;  3IDH A;  4IZ9 A;  3QBW A;  1NGI A;  4JAX A;  4HTL A;  1Z6R A;  2P9L A;  4H5T A;  4BR9 A;  4BQZ A;  4H0X B;  4EHT A;  1YUW A;  2E8A A;  3I33 A;  3ZX2 A;  1NGB A;  2HF4 A;  4FWO A;  1QQN A;  5LJV A;  3D2E B;  5F2R A;  3QFU A;  2D4W A;  4MLH A;  5AQX A;  2D1K A;  4H5R A;  3O1B A;  4IJA A;  5AQH A;  2CGL A;  2P9I B;  4BRF A;  2ASM A;  1ZC6 A;  4MO4 A;  5TKY A;  4IWV A;  4NO7 A;  2NLX A;  4FPA A;  3VGK A;  4RTF D;  2ZGZ A;  4BVP A;  1NGD A;  3AAR A;  3D2F A;  3M1F A;  3I8B A;  1BA0 A;  4YDU C;  3VER A;  3FZM A;  3ULE B;  1QZ5 A;  1GLB G;  4BQL A;  2Q2R A;  3VF6 A;  1HUX A;  3FLC O;  5AQW A;  3H46 O;  2QWM A;  3ID8 A;  2D0P A;  4BRM A;  3QDK A;  2GWJ A;  5AQZ A;  4ISG A;  5KQD A;  5AQF A;  3EZW A;  2HOE A;  4BGB A;  5KQ8 A;  5AQK A;  3KVG A;  4FPB A;  2ASO A;  2FF3 B;  2IIR A;  4M7X A;  2FSN A;  2KHO A;  4I6M A;  4BRQ A;  4RCH A;  2P9P A;  1DKG D;  4JN4 A;  3W0L A;  3RSE B;  4A2B A;  3WEE B;  3GL1 A;  4JHD B;  3BEX A;  4FWR A;  2Q97 A;  1YVN A;  3CQX A;  1MA9 B;  3EO3 A;  2IVN A;  4FWM A;  5BN9 A;  2FSK A;  5AQS A;  1IG8 A;  1NGJ A;  4YDU A;  3LM9 A;  4H0Y B;  4B1W B;  1ATS A;  3FZH A;  5CE3 A;  4WQ4 C;  3WXL A;  3VOV A;  4BRA A;  2P9N B;  4FWQ A;  3QBX A;  3CJA A;  2P9U B;  5EOY A;  5B8H A;  1KAZ A;  2VWB A;  1XUP O;  4EIA A;  1S3X A;  4BRO A;  1JCG A;  3WXJ A;  1HPM A;  1MWM A;  3UB5 A;  1TYQ B;  3ZEU A;  3P4I A;  2IVO A;  2YHY A;  4FWS A;  2A42 A;  4H5N A;  4IO8 A;  3CIP A;  1K8K B;  5AQP A;  3C7N B;  2CH6 A;  3U4L A;  3ZX0 A;  5JLF A;  1XC3 A;  2QW9 A;  3GBT A;  3HZ6 A;  4JD2 B;  1NGF A;  1YAG A;  4JNE A;  3ZET B;  5I9E B;  2V51 B;  2Q0R A;  4H0T B;  1BO5 O;  3WUH A;  5BPN A;  3BF3 A;  4WQ4 A;  4BG9 A;  2P9L B;  2A5X A;  1HKG A;  1GLE G;  3FZK A;  1GLL O;  3O6W A;  1HKC A;  5BPM A;  5FPE A;  2GUP A;  1TUY A;  1BUP A;  1U2V B;  5LY3 A;  5EVZ A;  3CHW A;  4NB4 A;  5AQR A;  3VPZ A;  1D4X A;  2NZT A;  4BRE A;  4BC5 A;  5AQM A;  4K43 A;  1LCU A;  3CJ7 A;  3O5B A;  2QWQ A;  4BRC A;  5JIC A;  4C23 A;  1SZ2 A;  3EKU A;  5EX5 A;  4MLE A;  4CZK A;  4F9O A;  4BRH A;  4J8F A;  2QWP A;  3BF1 A;  4IXC A;  3WQU A;  4DQ8 A;  5FPD A;  3L6Q A;  2GEL A;  2FF6 A;  4O5F A;  2VCP A;  3O08 A;  3BP8 A;  3H3N O;  2E2Q A;  3J8A A;  1E4F T;  1KAX A;  4H0V B;  5EXW A;  3OHR A;  3VEY A;  4CZE A;  3BUZ B;  1C0F A;  3D2F B;  5ELZ A;  2IVP A;  2YJF A;  2QWL A;  2J4R A;  4ISE A;  3CJ9 A;  3KHY A;  3IFR A;  2DPN A;  3S41 A;  1T44 A;  4DB3 A;  3H1Q A; 
#chains in the Genus database with same CATH topology
 1ZBI A;  2XO7 A;  2P9K B;  1TVR A;  2YU9 C;  5FPN A;  4JK9 A;  1EO1 A;  1EWR A;  2RHK A;  3VQP A;  2JH3 A;  3MN5 A;  1N8R O;  4CGH A;  3OS1 A;  2P9P B;  4NYF A;  1LWF A;  4FJH A;  3VF4 A;  3L3U A;  2VG6 A;  1IKX A;  4CJV A;  2E2N A;  3VQ4 A;  4BVO A;  2E20 A;  4KBO A;  1ATR A;  4BRL A;  3M8R A;  3VA3 A;  4CZM A;  3C95 A;  4B8A B;  3CCJ N;  3PO2 C;  3AVH A;  3GTM A;  4BBS C;  4B9Q A;  1Q8I A;  4FM1 A;  4H4O A;  4F3O A;  4NYN A;  4JI5 K;  1D5A A;  4JKB A;  4GVM A;  3D2E A;  3O3G A;  3H0G A;  1KFS A;  4A3D K;  2NUB A;  3QFP A;  4KDD A;  1FK9 A;  4JV5 K;  4FJL A;  2R92 C;  4A93 K;  1VQK N;  1EXQ A;  3OYL A;  3SPZ A;  4JKC A;  4BRN A;  2BAN A;  2X6N A;  2ZWH A;  3DAW A;  4BY1 C;  3V1O A;  4H5W A;  4OIO A;  1IG9 A;  4OIR A;  1RDD A;  3NMU A;  3OS2 A;  3CXC M;  1QE1 A;  3SQ1 A;  3CAG A;  3ZSX A;  4KMH A;  1IBK K;  3GTJ A;  4P5B A;  2E2I A;  4BWJ A;  3ENH A;  3ULE A;  3LAK A;  2HHT A;  3AVF A;  5IOS A;  1VQM N;  2YJE A;  4BXX C;  4CHN A;  3D7E O;  1RBR A;  4NCA A;  3CCL N;  3U8X A;  4CJ7 A;  3UKR B;  4CZF A;  2OPR A;  2FLO A;  4DFJ A;  3VEN A;  5MLC Q;  4CZH A;  2ZGY A;  3AA2 A;  2O8F A;  2LSN A;  3I4N K;  1KSP A;  3K7A K;  1ASW A;  3S0X A;  3RSE A;  3RZO C;  2QWR A;  1XQS C;  2ZJP L;  4FOE A;  2JGU A;  1K6Y A;  1RGI A;  3SPY A;  1RCH A;  3SK3 A;  1VQN N;  4A3J C;  1SS6 A;  2VYP A;  3L2U A;  4K0K K;  4H03 B;  3KKR A;  2A40 A;  4QIW L;  5AQT A;  5FLX O;  1JQW A;  4V19 S;  3S3O A;  4C3J C;  4E1N A;  5IP7 K;  4LOW A;  3VN5 A;  2JA5 K;  4A3C K;  4ELU A;  4BRP A;  3O1W A;  1BG3 A;  4FL9 A;  5JLH A;  1WOR A;  3LDO A;  3F73 A;  4CEE A;  3DRP A;  1VQ5 N;  3VA7 A;  4YFU A;  4LK1 A;  3T7Z A;  3A8J A;  3CCM N;  4N47 A;  2YI1 A;  4E7I A;  4B1Z A;  5LMN K;  5IOQ A;  4CBX A;  2FBT A;  2OPP A;  3C7N A;  2RH6 A;  1QQO A;  3HOU K;  2FSJ A;  4O55 A;  4FM9 A;  2WAQ D;  4CEB A;  3QEX A;  2HNY A;  2YV0 X;  2NNW A;  4DG1 A;  3GTP K;  5FLM C;  4YOV A;  3FKI A;  1XXA A;  3H3V L;  1Q86 O;  4C1N K;  3HPH A;  3AVI A;  1H1V A;  2Y0S D;  1DCH A;  1Z26 A;  1U2V A;  2PAV A;  4DLG A;  1BQM A;  3MCP A;  3QIC A;  3VQ7 A;  3EEQ A;  1UAX A;  3ULD A;  3EE9 A;  5BRF A;  5BR8 K;  4CEA A;  2O8C A;  3NHG A;  1PJ6 A;  3PO3 K;  3RMA A;  3LDN A;  1L3U A;  3AVG A;  4H0P A;  4LFA K;  4CK1 A;  1CZA N;  3M4O K;  4PQU A;  1VQ8 N;  1KD1 O;  2HST A;  1ILY A;  2W40 A;  1Q81 O;  4P9S A;  3QB0 A;  4AF1 A;  2PA8 L;  1NLV A;  4K8Z A;  4IFV A;  3SCX A;  1WOQ A;  3SUQ A;  4GMJ B;  4CZG A;  4K8X A;  4KB2 A;  4QS9 A;  4CJ3 A;  4GNI A;  4CF8 A;  4DTM A;  1OH8 A;  1O2A A;  1CXU A;  5AQO A;  1GLJ O;  1USM A;  4W5O A;  5AQN A;  5HRO A;  4KRE A;  1SKW A;  1BOT O;  3ZEU B;  1VSK A;  3PX6 A;  3WNF A;  4MDB A;  2D0B A;  4LFC K;  3JS6 A;  5E84 A;  2E2P A;  2P9K A;  4PKH A;  3ZSY A;  2E88 A;  3KLI A;  4A3G K;  1V4T A;  4PKI A;  2JA5 A;  4KHY A;  1D9F A;  1ZQ1 C;  2HMI A;  1Y64 A;  4EZ9 A;  4LC9 B;  4CJU A;  1N34 K;  4FM0 A;  4CEQ A;  3L4I A;  3ZT2 A;  4RW7 A;  4DV1 K;  1XPP A;  4CZL A;  4OKE A;  3L0Q A;  5L46 A;  1XXB A;  4LH5 A;  1KC8 O;  3SUN A;  3HM8 A;  3RMD A;  3IPJ A;  1TWF C;  1KVA A;  2HHV A;  3CJ1 A;  4CBW A;  4IBN A;  3NGZ A;  4HUF A;  2Y1I A;  4LF6 K;  1ZBH A;  2WB1 D;  3Q7B A;  3AVB A;  4BDY A;  2GTD A;  5AQL A;  1QZ6 A;  4Q4Z A;  3T1A A;  4OPA A;  3NAE A;  2V6T A;  4AH9 A;  4FSV A;  3I4M C;  3WT0 A;  2W6K A;  4M41 A;  1VQ6 N;  1L3V A;  3K57 A;  1JL2 A;  5LJW A;  3ADA C;  3S1N C;  1BCM A;  1Y1V K;  2NVT C;  1REV A;  5CY4 A;  2VG5 A;  3M8P A;  3CC4 N;  3CQY A;  4OX9 K;  4ICL A;  2KWA A;  1TWF A;  3AGR A;  1Q9X A;  4DTJ A;  3BP8 C;  1KVB A;  2NVX K;  1OH6 A;  2PHC B;  4CCH A;  3T3F A;  2V52 B;  2B5J A;  4U67 L;  4RWT A;  4FW2 A;  5HL8 A;  1TYQ A;  1VHX A;  4J2B A;  1NK7 A;  3KK3 A;  3NBP A;  1HNW K;  1F93 A;  4M63 C;  3UKR A;  1VQO N;  2AA4 A;  3UIQ A;  1JLE A;  1INN A;  1KCF A;  3IUC A;  5AZI B;  3NF8 A;  4A3E C;  3CER A;  4BRG A;  2V7Y A;  4CIF A;  1YHQ N;  3GTQ C;  4CEC A;  1J6V A;  4OPH A;  3ALY A;  3IDH A;  3QBW A;  3TTF A;  1NGI A;  3I8D A;  1I3Q K;  4CJP A;  2I5J A;  3OW2 M;  1S9E A;  1FW6 A;  1NJZ A;  1FKP A;  4BR9 A;  3QET A;  3ZSW A;  4FLX A;  3S1Q C;  4W5R A;  3ZX2 A;  3DOL A;  4FWO A;  1TWA C;  2GBZ A;  4DTS A;  1QQN A;  3P38 A;  5F2R A;  3QFU A;  3S16 C;  2D4W A;  3O3F A;  5M5Y K;  3F5T A;  3I0S A;  2UU9 K;  2D1K A;  5TMF A;  3ISN C;  4FJG A;  4BRF A;  1HRH A;  2BE2 A;  1ZC6 A;  1KFD A;  2E2H C;  4O2D A;  1VSM A;  5TKY A;  1EWQ A;  5JVH L;  2NLX A;  3AVK A;  3J80 O;  5J2M A;  3VGK A;  3S15 K;  4MQ3 A;  1NGD A;  2BGG A;  3HRG A;  4PAB A;  3CCR N;  3I8B A;  2OPS A;  2O8E A;  3K5L A;  1X9S A;  3VER A;  2WAQ L;  4F2S A;  5CYM A;  2XY6 A;  2PFU A;  3FZM A;  4DS4 A;  4LFB K;  1Y1V A;  2E6L A;  1B92 A;  1XMQ K;  3VF6 A;  1HUX A;  3H46 O;  1YNJ A;  4BRM A;  4J2D A;  3HST B;  4DF4 A;  2GWJ A;  4BY7 C;  5DK5 A;  1T05 A;  5AQZ A;  2Y0S L;  4ISG A;  5AQF A;  4CHP A;  3RTV A;  1O25 A;  2B4J A;  4IEE A;  4FLZ A;  3TAB A;  2FF3 B;  2KHO A;  4I6M A;  3AQO A;  4JI1 K;  2JA8 C;  4JEP A;  2JWL A;  4JN4 A;  2QK9 A;  2E2H A;  5DM6 L;  5C44 K;  3BEX A;  2Q97 A;  1VK0 A;  1ZBF A;  1JLG A;  4CF2 A;  1RTD A;  1RTI A;  1UWB A;  4FWM A;  2FSK A;  1XWL A;  5AQS A;  3O9U A;  3HOS A;  1QHT A;  4H0Y B;  4B1W B;  4KPY A;  1TGO A;  2QA4 N;  5FRM A;  3WXL A;  4A3L C;  3LAM A;  2X6S A;  4U7B A;  4FWQ A;  4O0J A;  4B9S A;  1O26 A;  3V9U A;  1KAZ A;  1UA1 A;  3IAY A;  1XUP O;  1QVG M;  4EIA A;  1IBL K;  4AYB D;  4BRO A;  4N5S A;  3WXJ A;  3VQD A;  1HPM A;  1MWM A;  5HRR A;  3QNN A;  5HRN A;  4OKJ A;  3ZEU A;  4FWS A;  4HUE A;  1WLJ A;  3G6E N;  3M8S A;  1Y1W A;  1DT9 A;  4I2P A;  1I39 A;  1S1W A;  4BE2 A;  3S3N A;  4A3B C;  4JKE A;  3HOY C;  4JNE A;  3GTK K;  2RKI A;  3CCQ N;  2V51 B;  4CER A;  1SKR A;  3AO3 A;  4KHU A;  4FK4 A;  4BG9 A;  3AVJ A;  2A5X A;  1HKG A;  1GLE G;  3KD1 E;  4GV3 A;  1HKC A;  1ASU A;  4OLB A;  3RMC A;  2XRI A;  2BE5 A;  1BDF A;  4WIL A;  4ZHR A;  2GUP A;  1BUP A;  4FJ9 A;  5LY3 A;  4DR4 K;  4HVJ A;  3LAP A;  3VPZ A;  4NB4 A;  2NZT A;  3SQ4 A;  3MEE A;  4KFB A;  4M45 A;  4BRE A;  1KTQ A;  4Z4F A;  4BRC A;  2WB1 L;  1SZ2 A;  3I0R A;  3LAJ A;  3S17 C;  2VQF K;  3SYZ A;  5EX5 A;  1HNI A;  3L2W A;  1CZB A;  4C2M K;  1VQP N;  4F9O A;  1VSH A;  4FVU A;  5C4X K;  4J8F A;  4NXM K;  4G0W A;  3WQU A;  3T1Y K;  3PIP L;  3SZY A;  4O5F A;  3E9O A;  1NK5 A;  1KLM A;  4IKF A;  4CZE A;  4GKJ K;  1IQ0 A;  4HUG A;  1N32 K;  3KLG A;  1QSY A;  1B4B A;  1DD5 A;  4ISE A;  4CK2 A;  1U47 A;  3KHY A;  1U4B A;  1NJW A;  1G15 A;  2D6F C;  4IG0 A;  4Q5S A;  2JA7 K;  3H08 A;  1K73 O;  4JI4 K;  2R7Z C;  1N5Y A;  1KQ4 A;  4B3R K;  3MN6 A;  3HO1 A;  1K8A O;  3O4N A;  5AQQ A;  4KI4 A;  1GOB A;  3FFI A;  3HTV A;  2A6E A;  3RMB A;  1S6Q A;  2UXD K;  1RBS A;  3W3D A;  1NK9 A;  3D6R A;  1XXC A;  4BBR C;  4CFC A;  3V1R A;  1TWH A;  4WF9 L;  3WQT A;  3NVK A;  2CFA B;  1WCM C;  3LZJ A;  4DLE A;  1D8Y A;  1MDU B;  4ID1 A;  3TPQ A;  2VG7 A;  1RDC A;  4CHY A;  4OGC A;  2H3G X;  2F9W A;  3ZSV A;  2GSN A;  3TFH A;  3GTK A;  3A5M C;  3NVM A;  4A3M K;  4AHR A;  2Z1I A;  2RPI A;  1YJN N;  3AO4 A;  5J2N A;  4KV8 A;  2HB5 A;  4R5P A;  4LQY A;  1WOP A;  4EP4 A;  3ZSR A;  1VSE A;  3VTI A;  4IFE A;  1J54 A;  4FJN A;  3T69 A;  2QWO A;  3QIO A;  4Z4G A;  3V4I A;  1EK8 A;  3M3Y K;  3LPU A;  5IYC C;  4FJJ A;  3OYJ A;  4MO5 A;  5IYB C;  2YHB A;  4DR6 K;  4JKF A;  1SFO K;  1VRU A;  2Y1J A;  2GWK A;  1GLC G;  4YOW A;  1JOE A;  4NOI A;  1DGK N;  1YF5 L;  1WCM A;  3CG7 A;  4DSK A;  3QO9 A;  4GTF A;  4DDQ A;  1NKE A;  1NOZ A;  2WTU A;  4OVL A;  3P39 A;  4KAR A;  4F8R A;  5D3G A;  1B9F A;  3DXK B;  4KHN A;  3QES A;  1S1X A;  1E3M A;  1PJ5 A;  1IKV A;  3EZ5 A;  4G9Z A;  2HHH K;  4YFN A;  2E1Z A;  2OTL N;  2O8D B;  1D9D A;  1K83 K;  3DXJ A;  4QS8 A;  3S2D K;  2A6A A;  3VQ5 A;  3LP2 A;  3B8A X;  1TWG C;  3VQ9 A;  4CFB A;  1TKD A;  4B3O A;  5EGE A;  2YU9 K;  2NRR A;  1EP4 A;  3DLR A;  4A57 A;  4EFH A;  3U3Y A;  2HW3 A;  2HHQ A;  3AQP A;  3G4C A;  3SLC A;  1NWK A;  4GTD A;  4DQQ A;  2E2J K;  1FXX A;  3TAG A;  1U48 A;  3O80 A;  2YHX A;  3MK6 A;  1DEJ A;  4C8K A;  4X65 K;  2EWS A;  3U6F A;  2P5O A;  2E2I K;  3M3Z A;  1A5W A;  4KTZ A;  3S1M K;  1I6H C;  2D5R A;  3PO2 K;  5TJ3 A;  2HVH A;  1SL0 A;  4BBS K;  4K41 A;  3LZI A;  1TWG A;  2QKB A;  1BWF O;  3IRX A;  2W41 A;  3THY B;  3J7Y P;  1I50 C;  3EL2 A;  1YT3 A;  3HPG A;  4ILG B;  4ELV A;  4AHT A;  5ADX A;  3TAR A;  2R92 K;  5ADX H;  4UQG A;  2Q0U A;  1TL1 A;  5GIO A;  2QM1 A;  1RBV A;  3FOE A;  4BY1 K;  1HJR A;  3CD6 N;  3CET A;  2HMP A;  5T7B A;  3OJU A;  3TI0 A;  4CF1 A;  5BN8 A;  3CCE N;  1U04 A;  2P5M A;  3O8M A;  2G8U A;  1BGX T;  4K42 A;  1NK4 A;  4CJK A;  1L0W A;  1VSD A;  3I56 N;  1KRP A;  3GTO C;  3HK2 A;  3VEX A;  3F9M A;  3LWL A;  5E26 A;  3A5L C;  3DXM B;  3SBG A;  2G8F A;  2GAG C;  5C2D A;  2GV9 A;  3ZT3 A;  3MX2 A;  4PA1 A;  4FK0 A;  1I50 A;  2UYT A;  1K83 A;  5C25 A;  3V9S A;  4A3K C;  1RT4 A;  4XH5 A;  4FLT A;  4C8L A;  5IYD C;  4GW6 A;  4Y0W A;  5HBM A;  5M3F K;  1IH7 A;  3RZO K;  3OYF A;  2YU9 A;  1AB4 A;  3V1Q A;  4M3W A;  4RW4 A;  1YI2 N;  4W5N A;  2XCR B;  1VQ4 N;  2QTD A;  5F0X A;  2P9I A;  1NBW A;  4A3J K;  1Z05 A;  3THX A;  3QEV A;  3FKI K;  4Z94 A;  2NVY C;  3GEH A;  3BZK A;  2FBV A;  4FZB A;  3V9X A;  3HKZ D;  4C3J K;  2JWK A;  5KPR A;  3H1V X;  4PY5 A;  3A0I X;  3CPE A;  2WC9 A;  4BE0 A;  2ITM A;  3J7A P;  1SMY A;  4DSF A;  2F7T A;  3S2H K;  4PWD A;  2F8T A;  4AM7 A;  4X62 K;  1WQG A;  2CFA A;  1YJ9 N;  3A2F A;  3MN7 A;  4C45 A;  3OBW A;  4Y52 K;  3RR7 A;  3E9L A;  3L2Q A;  3THW A;  4JYA K;  2R92 A;  4GVE A;  1J5E K;  3V4G A;  1BIU A;  4KHS A;  3EN9 A;  3L2R A;  4B9N A;  3WEE A;  4MFB A;  5FLM K;  1BQN A;  1E4G T;  3M6G A;  3FFK B;  3VEZ A;  3MEC A;  3CF5 L;  4CFA A;  3TAF A;  4OLA A;  2E2O A;  2HF3 A;  2QWN A;  3SAH A;  2NVY A;  4CI6 A;  1BDG A;  3CJC A;  1TUU A;  2ZUE A;  4YY3 K;  3LP3 A;  5A2Q O;  4QJV A;  4DQP A;  4JI0 K;  4RMF A;  1L3T A;  1YIT N;  2CH5 A;  4YFK A;  2YKN A;  1L5U A;  4I9Q A;  1TL3 A;  4DU4 A;  4DV7 K;  5C12 A;  4JRP A;  4OGE A;  4E7K A;  5D4D A;  4CEZ A;  1W7A A;  4OIN A;  4M1X A;  3ZCM A;  2WUS A;  3PY8 A;  3C6U A;  1NU0 A;  3LPX A;  4A3D C;  3HJF A;  2VWK A;  1EFW A;  4B9M A;  4OIP A;  4CEF A;  1IW7 A;  4KKO A;  5FPM A;  4OJR A;  3VF2 A;  4B9L A;  4A3I C;  3DXK A;  1XI1 A;  3ATU A;  1X9J A;  3RZD C;  1C0G A;  4LF4 K;  3S1N K;  2UUA K;  2WON A;  3AA5 X;  4MEX A;  3TTG A;  1RFQ A;  2PYL A;  4GT9 A;  1J6Z A;  1XNQ K;  1U45 A;  4PL8 A;  2AJQ A;  2B63 C;  2D0O A;  1BGW A;  3VGM A;  4IZ9 A;  1X1P A;  1S1T A;  1J53 A;  4DSE A;  4HTL A;  4FXD A;  2P9L A;  5DMR A;  3OS0 A;  4Z4I A;  5JVG L;  1N33 K;  3GEI A;  4H5T A;  1JLC A;  4EHT A;  2O8B B;  3V6D A;  3I33 A;  1WBB A;  3I4N C;  3AVN A;  3D0P A;  1NOY A;  5IT9 O;  3VMF B;  1S5J A;  3VQQ A;  3S9H A;  1VSJ A;  1VSF A;  1TWF K;  5C2F A;  2CGL A;  4Z4E A;  1HR0 K;  2B63 A;  4G7O A;  4MO4 A;  4Y1C A;  1C1C A;  4P5A A;  4IWV A;  2NRV A;  2ZGZ A;  1HQM A;  3AAR A;  3D2F A;  2FQT A;  4KB1 A;  3QEW A;  3THY A;  1BA0 A;  1BI4 A;  1RT3 A;  4GTE A;  4O5B A;  5IP7 C;  1GLB G;  3CQZ C;  2Q2R A;  1C1A A;  4H8K A;  2IDO A;  1ISE A;  4NLB A;  2VWJ A;  3JAM O;  2DY4 A;  5C3E C;  3VTH A;  4BAC A;  2NVT K;  1V5V A;  4WJ3 M;  2GSO A;  4FJX A;  4A59 A;  1GOC A;  2ZM6 K;  4XSZ A;  5KQ8 A;  5AQK A;  2ASO A;  1YVU A;  4BRQ A;  1XMO K;  4XLP A;  5C4J K;  5GAD P;  2P9P A;  1DKG D;  4JLH A;  3G4A A;  3GL1 A;  2A69 A;  4LD0 A;  4MDA A;  4JHD B;  2P51 A;  3A8I A;  1YVN A;  3HL8 A;  4N41 A;  1MA9 B;  2NVQ K;  2IVN A;  1R9T C;  2XY5 A;  3KWI A;  4BDP A;  2RE2 A;  3E01 A;  3I55 N;  3LP1 A;  1NGJ A;  1EET A;  2HBM A;  4CGF A;  3LM9 A;  2KQ2 A;  3FZH A;  4W5T A;  3VOV A;  1WNS A;  4BRA A;  4A3E K;  1TKZ A;  1NK6 A;  1Z25 A;  3QBX A;  5GAG P;  2P9U B;  1OH7 A;  2D0A A;  1HYV A;  3ZSO A;  4FLU A;  1MU2 A;  4DTO A;  3TAE A;  2P1J A;  2VWB A;  1S3X A;  1JCG A;  3HM9 A;  4BE1 A;  1T8E A;  3MWT A;  3TAM A;  3M4O C;  4DTN A;  2IVO A;  3SNN A;  2YHY A;  4IDH A;  4KM9 A;  4JKA A;  2A42 A;  1TK8 A;  4MQ9 A;  1ASV A;  4CJR A;  3CIP A;  4CHO A;  1K8K B;  4M3R A;  2CH6 A;  2RGR A;  1TWC C;  3VQC A;  5JLF A;  1TWA K;  2QW9 A;  3GBT A;  1KLN A;  3KJV A;  2WOM A;  3HZ6 A;  4JD2 B;  1NGF A;  2Y3P A;  3HKZ L;  3S16 K;  4QAG A;  3THV A;  3PX4 A;  5IWA K;  1W0H A;  4YOT A;  4YHH K;  4IOC L;  1WOO A;  1ZBU A;  1HYS A;  5FPE A;  3PO5 A;  3O6W A;  2GSU A;  1GLL O;  4CGG A;  4ZTF A;  5BPM A;  2HHU A;  4AHS A;  1A5X A;  1EKE A;  2E2H K;  3L2V A;  1O27 A;  3K2P A;  3KD5 E;  5EVZ A;  3CHW A;  1U49 A;  5AQR A;  4A3G C;  1D4X A;  1SUQ A;  3CM5 A;  3QLH A;  5AQM A;  1LCU A;  3S14 C;  2OCE A;  2QWQ A;  4C23 A;  4KI6 A;  3C94 A;  3PO4 A;  4CJW A;  3PX0 A;  4MLE A;  1XHX A;  3K5M A;  2G8H A;  4J2A A;  4BRH A;  3DRR A;  3OEP A;  4Y7N K;  3AO2 A;  3BF1 A;  4DQ8 A;  4M3Z A;  4BY7 K;  1S9G A;  2GEL A;  1P90 A;  5CZ2 A;  1BS2 A;  4JKG B;  3O08 A;  4B9T A;  4HCC A;  3BP8 A;  3H3N O;  5LL6 Z;  4XIU A;  4H0V B;  3VEY A;  3OHR A;  4RW9 A;  3BUZ B;  1C0F A;  1F7U A;  2JA8 K;  3NF7 A;  1C0M A;  2VUM C;  2IVP A;  2YJF A;  2QWL A;  4N56 A;  3CJ9 A;  3IFR A;  1NKC A;  1Y1W K;  3DLL L;  4X6A K;  1WSV A;  3SAF A;  1XHZ A;  4DR2 K;  4DB3 A;  1HNZ K;  1JXE A;  5CYQ A;  2UXC K;  3GTQ A;  2NRH A;  4FVM A;  5AZJ B;  3K5N A;  4LR2 A;  2QXL A;  4A3L K;  4LF9 K;  2OPQ A;  2ETJ A;  3G10 A;  3KK1 A;  3ZSZ A;  4FLV A;  4DV2 K;  1JCF A;  5C10 A;  3ENB A;  1JLB A;  1TV6 A;  1B9D A;  3AY9 A;  3NE6 A;  4FM2 A;  3LP0 A;  3O9T A;  4BRK A;  4CIE A;  1TWA A;  4DMN A;  4HHT A;  2A1S A;  3SZZ A;  1RDW X;  2F9T A;  3S1R K;  4A62 A;  4JKD A;  2KZZ A;  3UKU B;  4K25 A;  3C6H A;  3QEP A;  4E0D A;  3UE5 A;  3CQ8 A;  1L3S A;  2B6A A;  4A3B K;  3HOY K;  1IO2 A;  3PIO L;  1KXP A;  1ZYR A;  4CZJ A;  3QML A;  2O5J A;  1GLD G;  1NGH A;  4MEY A;  1XZP B;  3ITH A;  4I7F A;  4BR4 A;  5AR0 A;  1BIZ A;  4A5B A;  4KM8 A;  2OYQ A;  1BHL A;  4WFB L;  2ZFZ A;  5KRT A;  2PBD A;  1Q82 O;  4ILH A;  1RIL A;  4LF8 K;  4BLA A;  3TAQ A;  3S17 K;  1G51 A;  3OTO K;  3GG4 A;  3GEE A;  4CBU A;  1RNH A;  3PSI A;  5C42 A;  3TU5 A;  3DLH A;  4CGD A;  3AVC A;  4DU3 A;  1OKJ A;  4Q0B A;  2Q36 A;  4CD1 A;  1TWH K;  2ATQ A;  1HI9 A;  4CJ5 A;  3MXJ A;  5J1E A;  4LF5 K;  3RVC A;  3OYA A;  1RTH A;  4E19 A;  4OPJ A;  1SQK A;  4BRD A;  3L4Q A;  1T7P A;  3DJC A;  1NK8 A;  4BC3 A;  1ZVU A;  3NGI A;  2OAN A;  4BR2 A;  2Q1N A;  4AM6 A;  3DRS A;  4L8R B;  3U9Z A;  5IP9 C;  2R7Z K;  3DWL A;  3ORE A;  2ZD1 A;  3AD7 C;  4G7Z A;  2NRX A;  1HNX K;  4JS4 A;  3HOW C;  2V7Z A;  1NMD A;  4QS7 A;  2JA6 C;  3LDP A;  5GIP A;  3JSM A;  5BRD A;  2R7Y A;  2P9U A;  3GTG C;  3SV3 A;  1T6C A;  1Q9Y A;  3MML B;  1WCM K;  3O4Q A;  4CJT A;  2G8V A;  2HBK A;  3HOZ K;  4B3T K;  3NH0 A;  3Q3Q A;  3HT3 A;  3CCV N;  3HP9 A;  4DSJ A;  4IFY A;  1IBM K;  2HNZ A;  1HPZ A;  4JD2 A;  4BC2 A;  5M1F A;  4WE1 A;  3WXI A;  3VGL A;  3FR0 A;  2NRT A;  1JL1 A;  1BA1 A;  2GEM A;  3GTL C;  2R93 C;  5KPZ A;  3T02 A;  5IYC K;  3JXU A;  1VGX A;  1TK0 A;  5BRE A;  5IYB K;  2PY5 A;  3HPO A;  4BC4 A;  5I42 A;  5K14 A;  3B6O A;  5AZI A;  1NGG A;  5M5W K;  4A2A A;  4FO0 A;  4B1Y B;  5BR9 A;  3FE1 A;  2YNF A;  4DQR A;  5HRS A;  4DV4 K;  4ZTJ A;  4DR7 K;  4EHU A;  5F1X A;  3CJB A;  5H1S Q;  3ZX3 A;  4HTU A;  3AAQ A;  4C3H K;  3E66 A;  2XY7 A;  1RT1 A;  2QXF A;  4KB4 A;  1QQC A;  3HOV K;  5AQV A;  2R7Z A;  2R93 A;  3LDS A;  3N0B A;  4AHV A;  3BDP A;  3S3M A;  2EX3 A;  3WNH A;  4O8K A;  3U9D A;  4YOR A;  2KFN A;  2A68 A;  1TWG K;  4C2M C;  5KPT A;  4ILD A;  4EAH D;  1WUA A;  4HCB A;  4FJI A;  3EE8 A;  3OYB A;  1IKW A;  2HBL A;  1HKB A;  5FDL A;  3HVR A;  5BPL A;  5AZJ A;  4A3F K;  1SAZ A;  3HOX K;  5JS1 A;  5CHI A;  4B1X B;  4DS5 A;  1J6X A;  3MAQ A;  3VEV A;  4CHQ A;  2FXU A;  2HHS A;  4DUZ K;  2PPB A;  4DSI A;  4FWN A;  1NJI O;  4LY7 A;  3PUF A;  4KH4 A;  1BIS A;  4OKK A;  4E1J A;  2Q31 A;  4CGJ A;  3OYG A;  1I6H K;  3MDQ A;  3EKS A;  4KH5 A;  2HND A;  3GDZ A;  4XSX A;  1MWK A;  3KLH A;  3UKU A;  4IJN A;  2CGJ A;  3SMS A;  3G4S N;  3R8E A;  3GOI A;  5CHP A;  4WFA L;  1S6P A;  1I50 K;  3NFA A;  3SQ0 A;  4FLY A;  3KIO A;  4WJ4 A;  3CYM A;  3SZ2 A;  4CE9 A;  4UY8 O;  1QQM A;  3K59 A;  3IMX A;  2GUI A;  3AGK A;  4NCG A;  1HLU A;  3WXK A;  1U6Z A;  4C1N I;  3IKM A;  3MX5 A;  3LDL A;  1CZ9 A;  1NKB A;  2VGM A;  2QKK A;  4GTA A;  4A3M C;  4BR7 A;  4M3Y A;  1SKS A;  4Z4C A;  2KZM A;  3GTO K;  4H5V A;  4FWK A;  1VQ7 N;  3KTQ A;  4L3Q A;  3OYD A;  2YX6 A;  3KZB A;  1KAY A;  5M3M K;  1GLF O;  1WOS A;  3VQB A;  4CW7 B;  4DFP A;  4PL7 A;  4BLB A;  3DYA A;  1DTQ A;  1Q18 A;  3QEI A;  4A3K K;  3QIP A;  3CCS N;  3EYZ A;  3R6M A;  2JLE A;  3V81 A;  4GY2 B;  4KTQ A;  1SFO C;  1TKT A;  4ZH4 A;  4KMA A;  4DF8 A;  2O8C B;  3G25 A;  1J5O A;  1VQL N;  1RTJ A;  3ENO A;  2PZS A;  4M3X A;  2V6U A;  3K5O A;  2HHW A;  2FBY A;  3GIR A;  4JAX A;  1LW0 A;  4EZ6 A;  2NRW A;  3LPT A;  3FOF A;  4O0I A;  1T3V A;  3K0S A;  3RWU A;  3EQL A;  2ZJQ L;  2NVY K;  1YUW A;  2E8A A;  1NGB A;  2HF4 A;  2DTU A;  1RT6 A;  2FC0 A;  2A6H A;  1WAF A;  4Y1D A;  1QTM A;  3NDK A;  4GZY A;  4AHU A;  1O24 A;  4MLH A;  3O9R A;  4JI8 K;  4KN4 A;  5AQX A;  3GTM C;  3S2D C;  3SBT A;  3O1B A;  4IJA A;  3QX3 A;  4BXX K;  5AQH A;  3VQA A;  2ASM A;  3AV9 A;  4FLW A;  3H0G C;  3N0C A;  3OA9 A;  1WAJ A;  2W6L A;  4NO7 A;  5DM7 L;  1I6V A;  5M5X K;  4FZY A;  3MCA B;  4FPA A;  1BCO A;  4RTF D;  4C8N A;  1R0A A;  4E7H A;  2KFZ A;  3B6P A;  2E2J C;  4KMU A;  1QZ5 A;  3CC7 N;  4BQL A;  4B08 A;  4KTW A;  4B3M K;  4E3S A;  2QWM A;  3ID8 A;  2D0P A;  5J2Q A;  4C3I C;  3MEG A;  5M1N A;  3QDK A;  4G7H A;  5AJ3 K;  3CCU N;  3T1H K;  3OYE A;  3DM2 A;  3DI6 A;  5KQD A;  3GTO A;  1NJY A;  3GTJ C;  1RT2 A;  1FJG K;  2E2I C;  3S1M C;  3EZW A;  2O5I A;  2HOE A;  3C6T A;  5TKW A;  4BGB A;  3TSP A;  3F9K A;  4FPB A;  4YOX A;  5GAE P;  3VQ6 A;  1W2B M;  5C0Y A;  2G8W A;  2P5G A;  4FWR A;  2YNH A;  1I3A A;  2OTJ N;  3EO3 A;  1GE9 A;  1JKH A;  3BP3 A;  5BN9 A;  4A3I K;  3TTC A;  3RZD K;  5GAH P;  4QCL A;  3HP6 A;  4IOA L;  3KKS A;  5FRN A;  1YTU A;  1VH2 A;  1NJX A;  4JK8 A;  2P9N B;  2B63 K;  5I3U A;  2ITG A;  3CJA A;  3NH1 A;  1C0U A;  5B8H A;  4JI2 K;  1BL3 A;  4Z0U A;  3F2K A;  3TR8 A;  4PHT X;  3SUO A;  4BY9 C;  1F9N A;  2EBB A;  1TYQ B;  3FHZ A;  3P4I A;  5M1P A;  5KRS A;  1LWE A;  5J2P A;  4DQS A;  2KKZ A;  1UA0 A;  4CJF A;  3U4L A;  4FJM A;  3ZX0 A;  3TWH A;  1XC3 A;  4KRF A;  1EX4 A;  3T00 A;  2YKM A;  3V9W A;  1IS1 A;  5KI6 A;  2QI2 A;  1XZQ B;  4FJ5 A;  1IE0 A;  1YAG A;  3ZET B;  4CF0 A;  3MXI A;  5I9E B;  1W9H A;  2KW4 A;  2Q0R A;  4RG8 A;  3TTD A;  2F8S A;  1ZBL A;  1WBD A;  1NK0 A;  4LLG A;  5BPN A;  3TFI A;  4A93 C;  4CJE A;  3MED A;  3M8Q A;  1TUY A;  4B9U A;  3ZSQ A;  4YOY A;  1SV5 A;  1WSG A;  3L3V A;  1O1W A;  3FKI C;  4BC5 A;  4K43 A;  2CW0 A;  5CJ9 A;  4FK2 A;  4DTX A;  2PMZ D;  2O8D A;  2RN2 A;  3EKU A;  3A8K A;  4IDK A;  4FJ7 A;  3SJJ A;  3CQZ K;  4BWM A;  2BDP A;  1C1B A;  3S2H C;  4I2Q A;  5FPD A;  3ZT4 A;  5C3E K;  4M3T A;  3L6Q A;  3IS9 A;  1K9M O;  1YIJ N;  2VCP A;  1IL2 A;  2XCO A;  4LF7 K;  3J8A A;  1E4F T;  1KAX A;  5EXW A;  3KWG A;  4Y52 C;  4DTU A;  3KLE A;  4CFD A;  3AO5 A;  1HMV A;  2XY8 A;  5ELZ A;  5HLF A;  1TAU A;  3K7A C;  2O8E B;  2J4R A;  1YTA A;  3VQE A;  4AH6 A;  1O2F B;  2E5L K;  2DPN A;  5KGW A;  1R9T K;  4B8C A;  4FCY A;  3OYC A;  5IOT A;  3CFO A;  1XNR K;  1HYZ A;  4DV6 K;  4DFM A;  1VAZ A;  2D0C A;  1I94 K;  1HJO A;  5M1O A;  1X9W A;  4NCB A;  4O8U A;  3OYI A;  5SZT A;  1DCP A;  4I6M B;  4GFQ A;  4KMD A;  3A5N C;  1WIH A;  1NMN A;  2JA5 C;  5E41 A;  2YCH A;  3I4M K;  1VLO A;  4A3C C;  1LOT B;  3OBY A;  1FKO A;  1X3M A;  5KGX A;  1NM1 A;  5AQG A;  5FRO A;  2BUP A;  2P9S B;  4G1Q A;  4A5A A;  4KAT A;  1KVC A;  4EP5 A;  1ZBS A;  4FW1 A;  3G0Z A;  4DCH A;  4F2R A;  1TWC K;  1VSI A;  3CFP A;  3FZL A;  5HRP A;  3HOU C;  4C8M A;  4M3U A;  2CGK A;  3FGU A;  4FJ8 A;  5AQY A;  2VGN A;  3MMV A;  3O3H A;  3L4K A;  1IBA A;  3NH2 A;  4XEI A;  3GTP C;  3AA4 A;  3DXM A;  4WQ5 C;  1ITG A;  3ERE D;  3C0B A;  4YOU A;  4DKW A;  3SI6 A;  3A5O C;  4I9L A;  1BJT A;  4IOX A;  3LDQ A;  4JS5 A;  3G71 N;  5AFU A;  3VEW A;  4KO0 A;  5AFU H;  4E89 A;  1RDA A;  1JJ2 M;  3CQZ A;  1TKX A;  1HQU A;  3S14 K;  1BU6 O;  1O2B A;  4FWP A;  2BTF A;  3BUE A;  2KTQ A;  4HWI A;  5EY4 A;  3GTQ K;  4WYB A;  3KK2 A;  4CZI A;  1QSL A;  3PO3 C;  2A3Z A;  4JK1 A;  1NGA A;  5JFE A;  1QVF M;  4W5Q A;  2I7N A;  2NRZ A;  2ZF5 O;  3LL3 A;  1J9A A;  3CPW M;  3CME N;  3MN9 A;  3SMP A;  4BR0 A;  1QS4 A;  3DLK A;  2E4L A;  1X31 C;  3R9P A;  3S1Q K;  1YXQ A;  4X66 K;  3GTP A;  1X3N A;  3O4W A;  4WQ5 A;  4ELT A;  2VUM K;  2WFB A;  1CXQ A;  2GX9 A;  1R9T A;  4CK3 A;  1ZYQ A;  4B1U B;  3HBT A;  3WOD A;  1SL2 A;  3HOT A;  3HSC A;  4LJZ A;  3ASM A;  1EH1 A;  3NF9 A;  5EGH A;  3TSQ A;  1EQR A;  3OYH A;  4WCE L;  3JST A;  1ESV A;  1HQE A;  1LAV A;  2DFE A;  1P8Z A;  3T01 A;  4CIG A;  3GDQ A;  4FOI A;  5AQU A;  1VSL A;  2P9N A;  5C4J C;  2HBJ A;  1IJJ A;  2ASP A;  1JLA A;  3AVM A;  3ZYY X;  1F21 A;  2P8T A;  5LMU K;  1TWC A;  1RT5 A;  1QHA A;  3HXA A;  2NVQ C;  2KLA A;  4DTR A;  3TSU A;  4YFX A;  3PLA A;  3OYN A;  4DV3 K;  1DTT A;  3NF6 A;  4KHQ A;  1YCL A;  4N76 A;  1JVI A;  3EY1 A;  2AP1 A;  3DOK A;  3ZT0 A;  5CR4 A;  4X64 K;  4FYD A;  4DHY A;  1ZXO A;  4Q5V A;  1XZQ A;  5JS2 A;  1NGE A;  1IKY A;  4DTP A;  3ZET A;  5M1K A;  4B3S K;  1S22 A;  4OPK A;  4JKH A;  3P1G A;  4FWL A;  1WB9 A;  3IG1 A;  4CD3 A;  2HVI A;  2X74 A;  1PJ7 A;  4BR5 A;  1LV5 A;  3FZF A;  2E6M A;  1ATN A;  3WNE A;  1Y1V C;  3R3L A;  1C0T A;  3O9Q A;  4BRI A;  3LAL A;  2O4G A;  4G0V A;  4AQY K;  3AA3 A;  4KC6 A;  3SJH A;  2PMZ L;  1RDU A;  2F96 A;  1V4S A;  4DQI A;  3VET A;  4OO1 J;  2NVX C;  4E7J A;  4KAW X;  2G8I A;  1JCE A;  4YG2 A;  2QEX N;  3CI5 A;  3H3O B;  2UUB K;  4H4M A;  2E1Y A;  4ID5 A;  2VUM A;  2A1R A;  1WSJ A;  1T03 A;  2FQO A;  1X9M A;  3V9Z A;  1RBU A;  2O8B A;  1WSR A;  3OY9 A;  3PSF A;  4M7Y A;  4JRQ A;  1N36 K;  5AQI A;  2O4I A;  2ZUF A;  2YNI A;  4ISF A;  3HYF A;  4GTL A;  5IP9 K;  4F3T A;  2FBX A;  1USO A;  4PKG A;  3VEO A;  1RBT A;  1T6D A;  4XH4 A;  4Y7N C;  5JMV A;  3O9S A;  1I3Q C;  2EHG A;  3OPF A;  1R59 O;  4J2E A;  1OVQ A;  4KB0 A;  2YHW A;  1JLF A;  1LW2 A;  4CJS A;  1VRT A;  3AAP A;  3H45 C;  3HI0 A;  3SUP A;  3BGR A;  2NVX A;  3HOW K;  1YNN A;  4O44 A;  2JA6 K;  2GAH C;  3L4J A;  1GLA G;  3N3Y A;  1JXB A;  5GIN A;  2OZM A;  1O28 A;  2F4V K;  4A61 A;  4R79 A;  3GTG K;  1A5V A;  4DWI A;  1DLO A;  4OIQ A;  1Y1W C;  4DV5 K;  5M1Q A;  3AH5 A;  4X6A C;  5JVO A;  4BG8 A;  3H6E A;  3ATV A;  2P9S A;  2OZS A;  2BH1 A;  3PV8 A;  5HOO A;  4DFK A;  2YHA A;  5AQJ A;  2WBN A;  1WSH A;  1VQ9 N;  3VA0 A;  3GE1 A;  1S1U A;  3S15 C;  1I3Q A;  1LAW A;  1NGC A;  1WN7 A;  4JHD A;  4BGA A;  1JLQ A;  3GTL K;  2R93 K;  2IC3 A;  3RRG A;  1RT7 A;  2X78 A;  4G0U A;  5HL7 L;  3SQ2 A;  3P31 A;  2IGI A;  5HP1 A;  3MWP A;  3CMA N;  3SV4 A;  4IG3 A;  3S1R C;  1WSE A;  3DMJ A;  4JI7 K;  3QIN A;  1TAQ A;  5C24 A;  4XH1 A;  4DUY K;  4H0O A;  4BBR K;  5E68 A;  4ILJ A;  3RRH A;  3J81 O;  4DR3 K;  4CJ4 A;  4FJK A;  3VES A;  2XHB A;  3A8Y A;  1YJW N;  5C44 C;  4CGI A;  1XC9 A;  2DFF A;  1G99 A;  3Q7C A;  1EQY A;  3P83 D;  1N6Q A;  1J6W A;  1M90 O;  1WSI A;  1HX1 A;  4LH4 A;  4IO9 L;  1K8K A;  2A41 A;  1Q7Y O;  3LM2 A;  3QNO A;  5BRH A;  4B1V A;  2I7P A;  1J98 A;  3KK7 A;  3TAN A;  4WFN L;  5C15 A;  4E7L A;  1KQS M;  1B4A A;  1Z6R A;  1O13 A;  3TFJ A;  2JA6 A;  3BZC A;  1S72 N;  3C6A A;  2YNG A;  3KLF A;  2V6S A;  1TWH C;  3GTG A;  4DU1 A;  4BQZ A;  3E1Y A;  4H0X B;  3NCI A;  2IOC A;  3VQ8 A;  2Q3S A;  5IOR A;  3OYK A;  4CHZ A;  5LJV A;  3D2E B;  1WQH A;  3GTK C;  1NG9 A;  3T19 A;  4H5R A;  1Y97 A;  1GOA A;  4XLN A;  4CVN E;  3GSI A;  2P9I B;  4DV0 K;  5KTQ A;  4DSL A;  4LSN A;  4NXN K;  3THX B;  3JYT A;  1RDB A;  4JKG A;  3ZT1 A;  3BY5 A;  3P5J A;  2Z1G A;  5FJ8 K;  1VRQ C;  3CC2 N;  1UV7 A;  4BVP A;  3GTL A;  5CZ1 A;  3M1F A;  4XCH A;  4YDU C;  4FZZ A;  3HVT A;  1LWC A;  4F4K A;  3ULE B;  4KAZ A;  3N4P A;  4KAS A;  3OJS A;  3FLC O;  5C4X C;  5AQW A;  4KHP K;  3HOZ C;  3LAN A;  2ZQB A;  3OVN A;  3AVA A;  3THW B;  4JK7 A;  2UXB K;  4YNQ A;  4BDZ A;  1W97 L;  2O8F B;  3NUH A;  1OVY A;  3KVG A;  4M42 A;  4M7X A;  2IIR A;  2VQE K;  2FSN A;  4RCH A;  4JI3 K;  3MXM A;  4DR1 K;  3C65 A;  3W0L A;  4GV6 A;  3RSE B;  4A2B A;  3WEE B;  3L8B A;  4KHW A;  3K9J A;  4GV9 A;  1VJE A;  3J7Z O;  4DR5 K;  3CQX A;  2JA7 C;  4CF9 A;  2G8K A;  2Z1H A;  4QJV B;  4IEI A;  4JI6 K;  3DLG A;  1DCO A;  3AD9 C;  4CJL A;  1IG8 A;  4YDU A;  1ATS A;  5CE3 A;  1OH5 A;  4WQ4 C;  4GKK K;  3CM6 A;  4QIW D;  3AVL A;  4CEO A;  3DLB A;  1C0A A;  3HXM A;  1RU0 A;  5EOY A;  4CED A;  4FZX C;  3ID6 A;  2W42 A;  3TAP A;  5EU7 A;  3QER A;  1WSF A;  3UB5 A;  4AHC A;  4PUO A;  1XZP A;  4J3N A;  4B9V A;  4BKW A;  1HNV A;  1TK5 A;  2UUC K;  4C3H C;  4H5N A;  4IO8 A;  3K58 A;  5AQP A;  3C7N B;  3LWM A;  3WXM B;  1EI6 A;  3HOV C;  1S1V A;  4CES A;  4AIL C;  1M1K O;  1QSS A;  2JA7 A;  3K9K A;  1UOC A;  3GTM K;  4H0T B;  3AO1 A;  1WQF A;  3H3V D;  2ZJR L;  4LK0 A;  4RW6 A;  3CFR A;  1BO5 O;  3WUH A;  2ZE2 A;  3BF3 A;  2RF2 A;  4WQ4 A;  3AD8 C;  2P9L B;  3FZK A;  3RR8 A;  4E1M A;  3DLE A;  5TMC A;  3D45 A;  3M3Y C;  3H0G K;  1U2V B;  2IS3 A;  3R1X A;  2HHX A;  1YX2 A;  2W7V A;  1SL1 A;  3N4Q A;  4A3F C;  3SAG A;  5IYD K;  3CJ7 A;  3HOX C;  3O5B A;  1IV0 A;  2XCQ A;  5JIC A;  4O4G A;  4PAA A;  4KH6 A;  2PYJ A;  4C8O A;  4QOZ B;  4CZK A;  4LSL A;  4AYB L;  2QWP A;  1F7V A;  4IXC A;  4C3I K;  3U3G A;  2FF6 A;  2OA8 A;  2PA8 D;  4KN7 A;  3GTJ K;  4NLC A;  2E2Q A;  4GTB A;  3WNG A;  4TSX A;  3NGY A;  4CJQ A;  2Z1J A;  4GTC A;  1O29 A;  3ZLJ A;  2IAJ A;  3D2F B;  4Z4H A;  1CLQ A;  5SWM A;  1BI4 B;  1K83 C;  3M5R A;  1C6V A;  4RW8 A;  3S41 A;  1T44 A;  2DFH A;  1SFO A;  3H1Q A;  1NNE A;  3E9P A;  3OYM A; 
#chains in the Genus database with same CATH homology
 1KQ4 A;  2P9K B;  5FPN A;  1VAZ A;  3MN6 A;  4JK9 A;  3GTQ A;  4UY8 O;  1HJO A;  2NRH A;  5AZJ B;  5M1O A;  1EO1 A;  4LR2 A;  2RHK A;  2JH3 A;  4O8U A;  2QXL A;  3MN5 A;  1K8A O;  5AQQ A;  3HTV A;  1N8R O;  4I6M B;  4GFQ A;  2P9P B;  3W3D A;  3D6R A;  4KMD A;  1JCF A;  1XXC A;  3A5N C;  1TWH A;  3VF4 A;  5C10 A;  1WIH A;  3ENB A;  4WF9 L;  2YCH A;  3WQT A;  1LOT B;  3OBY A;  2E2N A;  3AY9 A;  4BVO A;  2E20 A;  3NVK A;  2CFA B;  1X3M A;  3O9T A;  1ATR A;  4KBO A;  1MDU B;  4BRK A;  1NM1 A;  5AQG A;  4A5A A;  2BUP A;  2P9S B;  3TPQ A;  4BRL A;  1TWA A;  4KAT A;  4CZM A;  1RDW X;  1ZBS A;  3CCJ N;  2F9T A;  2H3G X;  4A62 A;  2F9W A;  3GTK A;  2GSN A;  4JKD A;  4DCH A;  3A5M C;  3UKU B;  3GTM A;  4K25 A;  3C6H A;  3NVM A;  4B9Q A;  3FZL A;  3UE5 A;  1YJN N;  2CGK A;  3FGU A;  3PIO L;  5AQY A;  4JKB A;  2VGN A;  3MMV A;  1KXP A;  4LQY A;  4CZJ A;  3L4K A;  3D2E A;  3H0G A;  3QML A;  4KDD A;  3QFP A;  3VTI A;  4IFE A;  4XEI A;  3DXM A;  1GLD G;  1NGH A;  4WQ5 C;  1VQK N;  3ERE D;  3T69 A;  3C0B A;  4YOU A;  2QWO A;  4JKC A;  1EK8 A;  4BR4 A;  4BRN A;  4DKW A;  3A5O C;  2ZWH A;  3DAW A;  5AR0 A;  1BJT A;  4H5W A;  4IOX A;  4A5B A;  4MO5 A;  3LDQ A;  4KM8 A;  3G71 N;  5AFU A;  3VEW A;  4WFB L;  5AFU H;  2ZFZ A;  1JJ2 M;  2PBD A;  4JKF A;  3CXC M;  1Q82 O;  3NMU A;  2GWK A;  1GLC G;  1BU6 O;  4ILH A;  4YOW A;  1DGK N;  1YF5 L;  4FWP A;  2BTF A;  1O2B A;  1WCM A;  4BLA A;  3BUE A;  3CAG A;  4HWI A;  3GG4 A;  5EY4 A;  4GTF A;  4CBU A;  4DDQ A;  4WYB A;  4KMH A;  3TU5 A;  3GTJ A;  4CZI A;  4P5B A;  2E2I A;  2A3Z A;  3ENH A;  1NGA A;  3ULE A;  5JFE A;  5IOS A;  1QVF M;  3P39 A;  4KAR A;  2I7N A;  2NRZ A;  2YJE A;  2ZF5 O;  3LL3 A;  1VQM N;  3CPW M;  3CME N;  1OKJ A;  3D7E O;  3MN9 A;  2Q36 A;  3SMP A;  4BR0 A;  4CD1 A;  3CCL N;  3U8X A;  3DXK B;  3R9P A;  3RVC A;  4CJ7 A;  3UKR B;  4CZF A;  2FLO A;  3VEN A;  1YXQ A;  5MLC Q;  4CZH A;  3GTP A;  1SQK A;  1X3N A;  2ZGY A;  3O4W A;  4WQ5 A;  4BRD A;  4G9Z A;  2E1Z A;  3L4Q A;  2OTL N;  2WFB A;  1R9T A;  2GX9 A;  3DJC A;  3S0X A;  4B1U B;  4BC3 A;  1ZVU A;  3HBT A;  3RSE A;  4QS8 A;  2OAN A;  2A6A A;  2QWR A;  2Q1N A;  4AM6 A;  4BR2 A;  3HOT A;  3U9Z A;  1XQS C;  2ZJP L;  3B8A X;  3HSC A;  4FOE A;  1EH1 A;  3DWL A;  1RGI A;  5EGH A;  3TSQ A;  3ORE A;  5EGE A;  3SK3 A;  2NRR A;  1VQN N;  1SS6 A;  2NRX A;  2VYP A;  4WCE L;  4A57 A;  4EFH A;  1ESV A;  1P8Z A;  4H03 B;  3GDQ A;  4FOI A;  5AQU A;  2V7Z A;  3AQP A;  3G4C A;  1NMD A;  2A40 A;  4QS7 A;  1NWK A;  3LDP A;  3SLC A;  5GIP A;  5AQT A;  2P9N A;  4GTD A;  4C3J C;  2HBJ A;  1IJJ A;  2ASP A;  3O80 A;  2P9U A;  2YHX A;  3MK6 A;  5BRD A;  1DEJ A;  4BRP A;  3O1W A;  1T6C A;  1BG3 A;  4FL9 A;  3ZYY X;  5JLH A;  3MML B;  3LDO A;  1TWC A;  3VA7 A;  1VQ5 N;  2HBK A;  1QHA A;  2EWS A;  3T7Z A;  2KLA A;  3CCM N;  3Q3Q A;  2YI1 A;  3TSU A;  3M3Z A;  3PLA A;  4B1Z A;  3CCV N;  5TJ3 A;  5IOQ A;  4CBX A;  3C7N A;  4K41 A;  2AP1 A;  1TWG A;  2RH6 A;  1QQO A;  5CR4 A;  2FSJ A;  1BWF O;  4DHY A;  1ZXO A;  4JD2 A;  2W41 A;  4BC2 A;  4FM9 A;  1NGE A;  3EL2 A;  3ZET A;  4ILG B;  5M1F A;  1S22 A;  5M1K A;  4JKH A;  3WXI A;  2NNW A;  4FWL A;  5ADX A;  3VGL A;  5ADX H;  2Q0U A;  3FR0 A;  4CD3 A;  5GIO A;  4YOV A;  2NRT A;  2QM1 A;  1XXA A;  1BA1 A;  2GEM A;  3FKI A;  1Q86 O;  4C1N K;  5KPZ A;  1H1V A;  3FOE A;  3JXU A;  3CD6 N;  4BR5 A;  3CQZ A;  3CET A;  2HMP A;  5BRE A;  3FZF A;  1U2V A;  1ATN A;  2PAV A;  3MCP A;  3QIC A;  3R3L A;  3O9Q A;  4BC4 A;  4BRI A;  5BN8 A;  3CCE N;  2P5M A;  3O8M A;  4G0V A;  3EE9 A;  5BRF A;  4K42 A;  4KC6 A;  5AZI A;  3SJH A;  1NGG A;  4A2A A;  1RDU A;  4FO0 A;  4B1Y B;  5BR9 A;  3I56 N;  3FE1 A;  3VEX A;  3F9M A;  1V4S A;  3LDN A;  5E26 A;  3VET A;  3A5L C;  4OO1 J;  3DXM B;  3SBG A;  4H0P A;  4KAW X;  1JCE A;  5C2D A;  2QEX N;  1CZA N;  3CI5 A;  3H3O B;  4EHU A;  3CJB A;  2HST A;  5F1X A;  5H1S Q;  3ZX3 A;  2W40 A;  1KD1 O;  1Q81 O;  1VQ8 N;  2E1Y A;  3MX2 A;  3AAQ A;  3QB0 A;  2VUM A;  1I50 A;  2UYT A;  3E66 A;  4AF1 A;  1K83 A;  1NLV A;  4KB4 A;  1WOQ A;  4XH5 A;  5AQV A;  4CZG A;  4KB2 A;  4M7Y A;  4QS9 A;  5AQI A;  2R7Z A;  2R93 A;  4Y0W A;  3N0B A;  4GNI A;  4ISF A;  4O8K A;  2YU9 A;  3U9D A;  1O2A A;  4GTL A;  4YOR A;  5AQO A;  1GLJ O;  1AB4 A;  5AQN A;  4C2M C;  5KPT A;  4PKG A;  4ILD A;  1YI2 N;  3VEO A;  2XCR B;  4EAH D;  1T6D A;  4XH4 A;  1WUA A;  1BOT O;  1VQ4 N;  2QTD A;  3ZEU B;  5F0X A;  2P9I A;  3EE8 A;  1NBW A;  3O9S A;  5JMV A;  1Z05 A;  4MDB A;  3OPF A;  1R59 O;  2HBL A;  2E2P A;  2P9K A;  2YHW A;  1HKB A;  3JS6 A;  4PKH A;  2E88 A;  5E84 A;  5BPL A;  1V4T A;  3AAP A;  3H45 C;  3HI0 A;  4PKI A;  4Z94 A;  5AZJ A;  2NVX A;  1ILY A;  2JA5 A;  1SAZ A;  1Y64 A;  5CHI A;  3L4J A;  1GLA G;  4LC9 B;  4B1X B;  3N3Y A;  4FZB A;  3L4I A;  5GIN A;  3VEV A;  1O28 A;  2JWK A;  5KPR A;  3H1V X;  4A61 A;  4R79 A;  4CZL A;  3A0I X;  3CPE A;  2WC9 A;  2FXU A;  2ITM A;  3L0Q A;  2F7T A;  1XXB A;  1KC8 O;  4AM7 A;  5M1Q A;  4FWN A;  1NJI O;  3AH5 A;  3HM8 A;  5JVO A;  4E1J A;  4KH4 A;  4BG8 A;  1WQG A;  3H6E A;  3ATV A;  1YJ9 N;  2Q31 A;  2CFA A;  3MDQ A;  3EKS A;  3CJ1 A;  2P9S A;  3MN7 A;  2BH1 A;  5GAD P;  4KH5 A;  4CBW A;  5HOO A;  1MWK A;  3OBW A;  3E9L A;  5AQJ A;  3UKU A;  2WBN A;  4IJN A;  2CGJ A;  2R92 A;  4GVE A;  3SMS A;  3R8E A;  3GOI A;  3G4S N;  5CHP A;  1VQ9 N;  4WFA L;  3Q7B A;  3V4G A;  3GE1 A;  3EN9 A;  2GTD A;  5AQL A;  1QZ6 A;  1I3Q A;  3WEE A;  1E4G T;  3VEZ A;  3M6G A;  3FFK B;  4OPA A;  1NGC A;  3CF5 L;  2E2O A;  4JHD A;  1QQM A;  2HF3 A;  2QWN A;  4FSV A;  4BGA A;  3SAH A;  3WT0 A;  3IMX A;  2NVY A;  3AGK A;  4CI6 A;  1BDG A;  4G0U A;  5HL7 L;  3CJC A;  1HLU A;  1TUU A;  3P31 A;  3WXK A;  1VQ6 N;  1U6Z A;  4C1N I;  3IKM A;  3MWP A;  5LJW A;  1YIT N;  3MX5 A;  2CH5 A;  3CMA N;  3LDL A;  3CC4 N;  2VGM A;  3CQY A;  5C12 A;  2KWA A;  4GTA A;  4BR7 A;  1TWF A;  3AGR A;  4H5V A;  4XH1 A;  4H0O A;  4FWK A;  4M1X A;  1VQ7 N;  4ILJ A;  2WUS A;  4L3Q A;  2YX6 A;  3KZB A;  1KAY A;  1GLF O;  2PHC B;  3LPX A;  3VES A;  2V52 B;  4U67 L;  4RWT A;  3A8Y A;  1YJW N;  4PL7 A;  1G99 A;  4BLB A;  1TYQ A;  1Q18 A;  5FPM A;  3Q7C A;  3VF2 A;  1EQY A;  3DXK A;  3ATU A;  1X9J A;  1M90 O;  1C0G A;  1HX1 A;  4M63 C;  3UKR A;  3CCS N;  2AA4 A;  1K8K A;  3R6M A;  4IO9 L;  1VQO N;  4GY2 B;  2A41 A;  1Q7Y O;  3IUC A;  3LM2 A;  4KMA A;  5BRH A;  1RFQ A;  5AZI B;  4GT9 A;  1J6Z A;  3CER A;  3G25 A;  4BRG A;  2V7Y A;  4PL8 A;  1VQL N;  3ENO A;  4B1V A;  2I7P A;  1YHQ N;  2D0O A;  1BGW A;  3VGM A;  3KK7 A;  4OPH A;  3IDH A;  4IZ9 A;  3QBW A;  3TTF A;  4WFN L;  5C15 A;  1NGI A;  4JAX A;  1KQS M;  4HTL A;  1B4A A;  1Z6R A;  1O13 A;  2P9L A;  2JA6 A;  2NRW A;  1S72 N;  3C6A A;  3FOF A;  1T3V A;  5JVG L;  3OW2 M;  4H5T A;  3GTG A;  4BR9 A;  2ZJQ L;  4BQZ A;  3E1Y A;  4H0X B;  4EHT A;  1YUW A;  2E8A A;  3I33 A;  3ZX2 A;  1NGB A;  2HF4 A;  4FWO A;  5IOR A;  1QQN A;  3P38 A;  5LJV A;  3D2E B;  5F2R A;  1WQH A;  3QFU A;  3VMF B;  1O24 A;  2D4W A;  3O9R A;  4MLH A;  5AQX A;  3F5T A;  2D1K A;  4H5R A;  3SBT A;  3O1B A;  4IJA A;  3QX3 A;  5AQH A;  5C2F A;  2CGL A;  2P9I B;  4BRF A;  2ASM A;  1ZC6 A;  4JKG A;  3N0C A;  2B63 A;  3OA9 A;  4MO4 A;  4P5A A;  5TKY A;  5JVH L;  4IWV A;  4NO7 A;  5DM7 L;  2NLX A;  2NRV A;  3MCA B;  4FPA A;  3VGK A;  4RTF D;  3CC2 N;  2ZGZ A;  4BVP A;  1NGD A;  3AAR A;  3D2F A;  3HRG A;  3GTL A;  3M1F A;  3CCR N;  3I8B A;  1BA0 A;  4YDU C;  3VER A;  4GTE A;  2PFU A;  3FZM A;  3ULE B;  1QZ5 A;  1Y1V A;  1GLB G;  3CC7 N;  4BQL A;  2Q2R A;  3N4P A;  3VF6 A;  1HUX A;  3FLC O;  4KAS A;  5AQW A;  3H46 O;  2QWM A;  3ID8 A;  2D0P A;  4BRM A;  1ISE A;  4NLB A;  5M1N A;  3QDK A;  4C3I C;  3CCU N;  2GWJ A;  3VTH A;  5AQZ A;  4ISG A;  5KQD A;  3GTO A;  5AQF A;  2GSO A;  3EZW A;  1O25 A;  4A59 A;  2HOE A;  4JK7 A;  4IEE A;  5TKW A;  5AQK A;  4BGB A;  1W97 L;  5KQ8 A;  3NUH A;  1OVY A;  3KVG A;  4FPB A;  2ASO A;  3TSP A;  4YOX A;  2FF3 B;  2IIR A;  4M7X A;  2FSN A;  2KHO A;  4I6M A;  4BRQ A;  4RCH A;  2P9P A;  5GAE P;  1DKG D;  4JEP A;  2JWL A;  3C65 A;  4JN4 A;  3RSE B;  3W0L A;  3WEE B;  4A2B A;  4GV6 A;  3G4A A;  3GL1 A;  1W2B M;  2E2H A;  3K9J A;  4GV9 A;  4MDA A;  5C0Y A;  4JHD B;  3J7Z O;  5DM6 L;  3BEX A;  4FWR A;  2Q97 A;  1YVN A;  3CQX A;  2OTJ N;  1MA9 B;  3EO3 A;  2IVN A;  1GE9 A;  3KWI A;  4FWM A;  2RE2 A;  4IEI A;  2FSK A;  5BN9 A;  3TTC A;  3I55 N;  5AQS A;  1IG8 A;  1NGJ A;  4YDU A;  3O9U A;  3HOS A;  2HBM A;  5GAH P;  3LM9 A;  4H0Y B;  4B1W B;  2QA4 N;  1ATS A;  3FZH A;  5CE3 A;  4WQ4 C;  4IOA L;  3WXL A;  3VOV A;  4BRA A;  4U7B A;  4JK8 A;  2P9N B;  4FWQ A;  3QBX A;  5GAG P;  1O26 A;  3CJA A;  2P9U B;  5EOY A;  5B8H A;  1KAZ A;  2VWB A;  1XUP O;  1QVG M;  3F2K A;  1S3X A;  3ID6 A;  4EIA A;  4BRO A;  4PHT X;  1JCG A;  3WXJ A;  1HPM A;  1MWM A;  3MWT A;  4BY9 C;  1F9N A;  3UB5 A;  1TYQ B;  4J3N A;  3FHZ A;  3ZEU A;  3P4I A;  2IVO A;  4KM9 A;  2YHY A;  4FWS A;  4IDH A;  5M1P A;  4BKW A;  4JKA A;  4C3H C;  2KKZ A;  2A42 A;  4H5N A;  4IO8 A;  3G6E N;  3CIP A;  1K8K B;  5AQP A;  3C7N B;  2CH6 A;  3U4L A;  3WXM B;  2RGR A;  1Y1W A;  3ZX0 A;  5JLF A;  1XC3 A;  1DT9 A;  2QW9 A;  3GBT A;  1M1K O;  2JA7 A;  1IS1 A;  3HZ6 A;  2QI2 A;  4JD2 B;  1NGF A;  3K9K A;  2Y3P A;  4JKE A;  1YAG A;  4JNE A;  3ZET B;  5I9E B;  3CCQ N;  2V51 B;  2Q0R A;  4H0T B;  4YOT A;  3TTD A;  1WQF A;  4IOC L;  2ZJR L;  1BO5 O;  3WUH A;  5BPN A;  3BF3 A;  4WQ4 A;  4BG9 A;  2P9L B;  2A5X A;  1HKG A;  1GLE G;  3FZK A;  1GLL O;  3O6W A;  1HKC A;  5BPM A;  5FPE A;  4GV3 A;  2GSU A;  2GUP A;  1TUY A;  1BUP A;  1O27 A;  1U2V B;  5LY3 A;  4YOY A;  3R1X A;  5EVZ A;  3LAP A;  3CHW A;  4NB4 A;  5AQR A;  3VPZ A;  1D4X A;  2NZT A;  4BRE A;  3N4Q A;  4BC5 A;  5AQM A;  4K43 A;  3SAG A;  1LCU A;  4GTB A;  3CJ7 A;  5CJ9 A;  3O5B A;  2QWQ A;  4BRC A;  5JIC A;  2XCQ A;  4C23 A;  1SZ2 A;  3LAJ A;  3EKU A;  4KH6 A;  5EX5 A;  4MLE A;  4CZK A;  1VQP N;  4F9O A;  4BRH A;  4FVU A;  4J8F A;  3OEP A;  4G0W A;  2QWP A;  3BF1 A;  4IXC A;  3WQU A;  4DQ8 A;  5FPD A;  3L6Q A;  3PIP L;  1K9M O;  2GEL A;  2FF6 A;  4O5F A;  1P90 A;  1YIJ N;  2VCP A;  3E9O A;  4JKG B;  3AQO A;  4NLC A;  3O08 A;  2XCO A;  3BP8 A;  3H3N O;  2E2Q A;  3J8A A;  1E4F T;  1KAX A;  4H0V B;  3KWG A;  3OHR A;  5EXW A;  3VEY A;  3BUZ B;  1C0F A;  4CZE A;  4GTC A;  1O29 A;  3D2F B;  5ELZ A;  2IVP A;  2YJF A;  2QWL A;  1B4B A;  1DD5 A;  2J4R A;  4ISE A;  3M5R A;  3CJ9 A;  3KHY A;  3IFR A;  3DLL L;  3SAF A;  2DPN A;  3S41 A;  1K73 O;  1T44 A;  1SFO A;  4DB3 A;  3H1Q A;  3E9P A;  5IOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...