1ZBSA

Crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
MILIGDSGSTKTDWCIAKEGKSLGRFQTSGINPFQQDRNEIDTALRSEVLPAIGQKASSIRAVYFYGAGCTPAKAPMLNEALDSMLPHCDRIEVAGDMLGAARALCGDSEGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQMPEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSFDDFLVRNVLRYNRPDLPLHFIGSVAFHYREVLSSVIKKRGLTLGSVLQSPMEGLIQYHHNNHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PG1100
publication title Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 82
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zbsA03
2A3ZA 4Z94A 2P9LA 3EZWA 5KPZA 4ISGA 2AA4A 3AY9A 3CHWA 3R9PA 2E2OA 3H6EA 5LJWA 1X3MA 3F9MA 1J6ZA 1BU6O 1C0GA 4FO0A 4WQ4A 1TYQB 3H45C 1LOTB 3D7EO 4BGAA 5AFUA 4CZHA 2F9TA 4MO4A 2J4RA 1KAXA 2CH5A 3ENOA 2Q0RA 3FZFA 4DCHA 3LM9A 4BRNA 3A5OC 3D2EA 4H5VA 2VCPA 5F2RA 4CZEA 3MN6A 1U2VB 5F1XA 3UKUA 4FWMA 4B1UB 2A6AA 3CJ9A 4QS9A 1WOQA 3KZBA 1ZBSA 2NZTA 3VEVA 5LY3A 4WQ5C 2KHOA 2Q1NA 4FWLA 4H0VB 1JCFA 4RWTA 3QMLA 1NGDA 4BR7A 4BR5A 2IVNA 3J8AA 4I6MA 1IG8A 4K25A 2Q36A 1T6DA 3LDQA 3ZETA 2P9IB 3WXJA 4K43A 1RFQA 3H3OB 3ZX3A 1H1VA 4YDUC 3D2EB 3O8MA 3ATUA 3QICA 3UKUB 3P4IA 1BDGA 4XEIA 4BRCA 5AQPA 4O8KA 3FZLA 5KQDA 3HI0A 4EFHA 3KVGA 3MN7A 3DAWA 4QS8A 4XH4A 2A5XA 2CH6A 1U6ZA 1E4FT 1NLVA 1NM1A 1NMDA 1ESVA 3O5BA 3U4LA 3DWLA 1NGHA 3GBTA 2ZGZA 5JICA 4I6MB 2FF3B 1K8KA 5AFUH 2Q2RA 1BG3A 3ZETB 3I33A 2E88A 4NB4A 1SZ2A 5AQJA 3VF4A 5AQSA 2A40A 2GELA 3M3ZA 3VESA 4ISFA 3DXMA 2E1YA 5EX5A 2ASMA 1NGFA 3EKUA 5AQTA 4CZMA 4E1JA 2D1KA 5EOYA 2FSKA 4CBXA 3R8EA 3GDQA 3HTVA 3GE1A 4HTLA 3ZX0A 3L0QA 3VERA 1DKGD 3BF1A 4BC4A 2P9KA 4BC2A 4EHUA 1HLUA 2BTFA 5AZIA 3HBTA 1K8KB 4H5NA 2E2NA 4C23A 4BROA 3CJ1A 2CGKA 4H0OA 3C7NA 5AQMA 2P9NA 4DHYA 1KAYA 3DXMB 5BRHA 5AQGA 1S22A 4FPBA 5AQZA 3ZEUA 3A8YA 4BC5A 1ZC6A 5AQWA 3VPZA 1JCGA 2QM1A 2YJEA 1YUWA 3IUCA 3WEEA 3L4IA 3S41A 1V4SA 1HPMA 5F0XA 3VETA 3DJCA 3CQXA 3ATVA 3VGKA 2YCHA 4J8FA 5AQYA 4CZGA 4BVOA 3R6MA 4EAHD 2YHXA 2P9KB 3OHRA 1E4GT 5AQVA 2ASOA 4RCHA 5AZIB 3O4WA 2GWKA 2YHWA 5B8HA 1KAZA 2GEMA 4BRGA 3BP8A 4JD2A 3C7NB 3CIPA 4BR4A 4BRDA 2P9NB 2P9IA 3O08A 2W40A 4BGBA 1DEJA 3FR0A 3U9ZA 2ASPA 3BEXA 4BRLA 3ZEUB 4CD3A 3M1FA 5BN9A 3UB5A 3WQTA 4FPAA 5AQQA 3HSCA 2Q0UA 2GWJA 3B8AX 4BRAA 4CZFA 3FFKB 3U8XA 5ADXH 2QW9A 4BRKA 2HOEA 1GLBG 3A0IX 3WEEB 4GNIA 4IZ9A 3SK3A 5AQNA 3CERA 2VYPA 2YHYA 3QFUA 5JMVA 4FWPA 5AQKA 4A2AA 1NGBA 1XUPO 4H0TB 2D0OA 4JHDA 3M6GA 3JXUA 1Y64A 4IWVA 2QWLA 4ISEA 3VGMA 4JD2B 4A61A 3CJBA 4H0XB 3GOIA 3W0LA 3AAPA 1HKBA 5JLFA 4PKHA 2P9SA 3VEYA 1QZ6A 3ZX2A 2P9PA 2E2PA 4CZIA 4FWRA 4H5RA 3AARA 5KPTA 4B1ZA 2V51B 3SLCA 4Y0WA 1GLLO 3WXIA 2PBDA 3MCPA 4M7XA 4AM7A 3LM2A 3ULEA 1YXQA 3VEXA 3A5LC 3WXLA 4B1VA 3U9DA 3BUZB 4JHDB 3EO3A 4WQ4C 4BR0A 1CZAN 1GLAG 3IMXA 2QWNA 2NRHA 4CBWA 4BRQA 4FOIA 5CE3A 2D4WA 4BRMA 1WUAA 5ELZA 1YAGA 2P9SB 4PL7A 4LC9B 2P9PB 4IXCA 4O5FA 3HM8A 5AQUA 5AZJA 2FF6A 3H3NO 1V4TA 4IJNA 4CJ7A 3ULEB 3LDOA 5BPMA 1Q18A 2NLXA 2VWBA 3RSEA 5FPMA 2HF4A 3GG4A 4BRHA 4CBUA 5LJVA 1NGAA 4B1YB 5BREA 2DPNA 2EWSA 2V52B 2P9UA 1XQSC 1MA9B 3FE1A 1QZ5A 4H0YB 2FXUA 4H0PA 4B9QA 3WUHA 1HJOA 3IFRA 2ZWHA 2I7PA 1BOTO 2A41A 1IJJA 5AZJB 4BR2A 4BG8A 2QWPA 2OANA 3WQUA 4DQ8A 5E84A 3O1BA 2GUPA 4H5WA 1NWKA 1BO5O 1ZXOA 4FSVA 5KPRA 3SJHA 4BVPA 2V7ZA 1Z05A 1GLDG 1QQMA 3RSEB 4M63C 4WYBA 1NGEA 4B1WB 5EVZA 3AAQA 3A5MC 3TPQA 2P9UB 1T6CA 4A62A 4IJAA 3QBXA 5BPLA 3UKRA 5FPNA 2H3GX 1ATRA 4FWKA 4JNEA 1BUPA 1NBWA 3VF2A 5I9EB 1BA1A 3FLCO 3CETA 5AQXA 4RTFD 5AQOA 4BRPA 1NGJA 5BN8A 4MO5A 4PKIA 4BG9A 3ID8A 3A5NC 2QWQA 2HF3A 3O6WA 4CZJA 3GL1A 5AQLA 2FLOA 2Q97A 1X3NA 2E8AA 3DXKB 4B1XB 3LL3A 1D4XA 3VENA 3BF3A 1GLCG 3IDHA 3LDPA 4BRIA 1MDUB 4PKGA 1HKGA 3SMPA 3KHYA 4AM6A 3O80A 3QFPA 2HMPA 1YVNA 2E2QA 1XC3A 1S3XA 3FZMA 3UKRB 2WUSA 2CGJA 4GY2B 3VF6A 2AP1A 2QWOA 3QB0A 2E1ZA 3MN5A 4XH5A 5AQIA 1P8ZA 2QWRA 2Q31A 3MMVA 3WT0A 2P9LB 1LCUA 2IVOA 2IIRA 2YI1A 4BRFA 4FWSA 1SQKA 1GLEG 4K41A 2E20A 1HX1A 1MWKA 2QWMA 4HWIA 2QXLA 3QDKA 3EKSA 4L3QA 5AQRA 2I7NA 2UYTA 4PL8A 4F9OA 3QBWA 3EL2A 1RGIA 3FZHA 1TUUA 5EY4A 3CQYA 4EHTA 3WXKA 2IVPA 3HZ6A 4FOEA 1KXPA 1NGIA 3FZKA 4H5TA 4BQZA 1QQOA 1SAZA 1TUYA 3O1WA 3UE5A 3H1VX 4FWNA 3VGLA 5BPNA 4CZLA 4EIAA 4KBOA 1MWMA 4FWQA 5FPEA 3D2FA 1T44A 5BRFA 3H1QA 1C0FA 2FSJA 3W3DA 5E26A 1G99A 5BRDA 2F9WA 4JN4A 4H03B 2PAVA 1EQYA 3CJCA 5JLHA 3VEOA 4CI6A 1GLJO 4IO8A 2BUPA 3C0BA 3VEZA 1GLFO 3LDNA 3CJ7A 2ZF5O 5FPDA 1QHAA 3H46O 4JAXA 1OKJA 5AQHA 2ITMA 5BR9A 4M7YA 3JS6A 5ADXA 1HUXA 4CD1A 4K42A 3MK6A 4MLHA 3FGUA 1ATNA 1Z6RA 2ZGYA 4FL9A 4BQLA 3D2FB 3VEWA 2D0PA 1X9JA 2GTDA 1BWFO 1NGCA 3L6QA 4CZKA 5KQ8A 4A2BA 3I8BA 3MDQA 5EXWA 4WQ5A 3CI5A 3DXKA 2V7YA 1NGGA 1DGKN 1TYQA 2YJFA 5AQFA 4MLEA 3EN9A 1QQNA 2CGLA 4BREA 3SMSA 1JCEA 2FSNA 3ENHA 1RDWX 3LDLA 3VOVA 1HKCA 4YDUA 3CJAA 1U2VA 4NO7A 5TKYA 3TU5A 4BC3A 5AR0A 3MN9A 4QS7A 1BA0A 3G25A 4BR9A 1R59O 4FWOA 1ATSA 4XH1A 2W41A 2A42A 4DB3A
chains in the Genus database with same CATH superfamily
2A3ZA 3QLHA 4Z94A 4CF9A 5KPZA 2AA4A 3CHWA 4CGDA 3NGZA 4OLBA 1AB4A 2JA5A 4OIRA 4CFBA 4FO0A 1KVBA 3CYMA 4FLZA 1GOBA 2J4RA 4O8UA 2B63A 1HNXK 2XY8A 1F7VA 4A3CC 3FZFA 4C2MK 4DCHA 3SAGA 2JGUA 2O8BB 1TWHC 3UKUA 4FWMA 1QE1A 4B1UB 3F2KA 1RT5A 4CEBA 2A6AA 3NGYA 1LWEA 2NZTA 3TAPA 5L46A 3T7ZA 4B9NA 4EP4A 2HSTA 3WODA 2E2IC 1EH1A 4FWLA 1EXQA 1ZBHA 4A3MC 1NGDA 1O24A 4BR5A 3TAQA 3J8AA 4LSNA 3CD6N 3O9RA 3C65A 4OJRA 4K25A 1PJ5A 3OS2A 5M5XK 3DLBA 1VK0A 4GKKK 3WXMB 4B08A 4Z4CA 2UUBK 3HSTB 1RFQA 1BGXT 4YDUC 5AJ3K 4CF8A 4E3SA 3D2EB 5J2MA 3QEXA 3S3MA 2D0CA 3OA9A 3FOEA 3AA5X 4NYNA 4M3XA 3S1MC 4DV2K 3E9PA 3HI0A 5FLMK 2CH6A 2JA5C 3Q3QA 3O5BA 1NGHA 4CW7B 4BLBA 3BZCA 3GTLA 5LL6Z 3AO4A 1BG3A 3VQ6A 3ZETB 3K7AC 1SL1A 1W97L 5AQJA 1VQLN 1D9FA 1QTMA 3AVHA 3O4NA 3PIOL 3VF4A 5AQSA 3QNNA 3S15C 4Q5SA 4KC6A 4GFQA 4GZYA 5EX5A 4GW6A 1R9TK 1NG9A 3ZSRA 5AQTA 1OVQA 4W5OA 3K9KA 2D1KA 2R7YA 4FJJA 1KFSA 1HYVA 3GDQA 5IYCC 3TTGA 2CFAB 4HTLA 4DSKA 3PLAA 3VERA 1TWFK 4C3JK 4BC2A 1T05A 1GE9A 5AZIA 5I3UA 4DR2K 4Y52K 1O1WA 3AVNA 4BROA 2CGKA 3D6RA 5HP1A 3CCLN 4Q5VA 3TAMA 4FZZA 4Q4ZA 2YKMA 1RDCA 4BACA 3HOYC 1USOA 4JI2K 3DXMB 4JI5K 2QEXN 1S22A 4BDYA 1NU0A 4FJHA 3AVKA 4LLGA 1J53A 3VQEA 1ZC6A 5IYDC 5GAEP 1JCGA 4DKWA 1O29A 3IUCA 2WC9A 4O0JA 4JLHA 1V5VA 5F0XA 3BY5A 4JKAA 3PX0A 4M3ZA 3HOZK 2YCHA 3NH2A 4M3YA 5C4XK 2YHXA 2P9KB 4CHQA 2HNZA 3G0ZA 5IP7K 4KMHA 3TTFA 3AVFA 4DV7K 4DR5K 4ZHRA 2XO7A 3C7NB 4CIFA 3ISNC 4X66K 5IT9O 4C3HC 4O5BA 4BRDA 3NCIA 2P9NB 1WIHA 4P9SA 4BGBA 4JKBA 3UB5A 2Q0UA 1FK9A 4E1MA 4BRAA 1TWAK 5ADXH 1IKVA 3WNFA 4LSLA 1RILA 4GNIA 5GADP 5CZ2A 3U3GA 1J6VA 3CERA 2VYPA 3QFUA 5JMVA 4B9LA 1Q82O 2PPBA 4NCBA 2D0OA 3KJVA 4GKJK 4ISEA 3VGMA 3I55N 5GAHP 1D5AA 3OYJA 2GSOA 1M1KO 3JSMA 5KI6A 4CJ4A 3LPUA 3VEYA 1QZ6A 1VGXA 2P9PA 2ZD1A 4CZIA 1CXQA 3RMBA 1B4BA 1DCOA 5GINA 3RMDA 4DU4A 1GLLO 4WFAL 3GSIA 1S9EA 2PBDA 4M7XA 4HUFA 3K2PA 3ZT1A 4YNQA 1YXQA 1KVCA 3WXLA 1E3MA 2YNGA 3CQZK 3LZJA 1SFOA 3EYZA 4Z0UA 3SQ0A 3EO3A 3TAGA 1WCMA 3IMXA 2QWNA 3F73A 2NVYA 4BRQA 5CE3A 2D4WA 3TFIA 3SV4A 3NUHA 1RT4A 4PL7A 3MWPA 2VGNA 2D0BA 1BIUA 1IH7A 4E7KA 1FW6A 2PHCB 4A3CK 1WSHA 2FF6A 2HBJA 1XZPB 3M8QA 1F93A 2HB5A 4CJ7A 4O2DA 5HRNA 3KLHA 4DLEA 3FKIA 4DQPA 1TWHK 2X6NA 1Q18A 1IV0A 2VWBA 3L4JA 3B6OA 2FC0A 3RSEA 5FPMA 1WAFA 2JA8C 2VQFK 5BREA 4CJVA 1KQ4A 2P9UA 3L2WA 2E2IK 1XQSC 4FM1A 1SUQA 3D0PA 3FE1A 4A3MK 3CC7N 2NRVA 4IDKA 1HJOA 4A3BC 2UUAK 1WSFA 4OKEA 4TSXA 1W9HA 2I7PA 1W7AA 1N32K 1BOTO 4CFCA 1IJJA 5AZJB 3WNHA 4BR2A 2QWPA 4DQ8A 3WQUA 1FXXA 2IGIA 5E84A 4HCBA 2E6MA 3WNGA 4FSVA 1SFOC 1J6WA 1S1TA 5M1KA 3S1MK 1JLGA 1QQMA 4PUOA 4AHVA 3NFAA 3CPEA 4O55A 2BGGA 1WCMC 4RW4A 3P31A 3A5MC 3KLIA 4OO1J 2JH3A 4B8AB 4A62A 4IJAA 2FBXA 1ATRA 2RH6A 1S6QA 3VF2A 5I9EB 3K7AK 5IOTA 5M1QA 5BN8A 4DUYK 4BG9A 3CCQN 1LW2A 3QIPA 3S15K 5TJ3A 3FKIC 2UXDK 3B6PA 5AQLA 3ZSWA 1BJTA 3F9KA 4E0DA 1GLCG 2JA6A 1S72N 1XMQK 3LDPA 4K8XA 1MDUB 1RBUA 2NRXA 1ZQ1C 5IYCK 3O3FA 3KD5E 2WBNA 3TSQA 4F2RA 1S3XA 3FZMA 4OGCA 2O8CB 4F4KA 2X78A 3J7ZO 2WUSA 2CGJA 1IO2A 4N41A 2IS3A 1YTUA 4GV9A 4BY1C 1VSLA 3SUOA 3KLGA 2QWOA 3H08A 3QB0A 1NKBA 4XH5A 4YFKA 2Y0SD 5DMRA 4HUGA 1SMYA 1P8ZA 4HCCA 3AO3A 1RDBA 3OBYA 3L2QA 1WAJA 1OH6A 4E7JA 4KB0A 4KV8A 2YI1A 4BRFA 3LALA 1XNQK 5IYDK 4A3LC 1VQMN 1MWKA 1TKZA 4HWIA 2QXLA 1UA0A 3ADAC 1TWGA 2UXCK 2I7NA 4F9OA 4PL8A 4KTQA 2R7ZK 1XZQA 1RGIA 1L3UA 3CFOA 1ZYRA 1RTDA 3OS0A 3DRSA 1WSEA 2EBBA 3HZ6A 1IBKK 1KXPA 2XHBA 4H5TA 1LWCA 1QQOA 3THWA 5EGEA 4Z4EA 1TUYA 3O1WA 3QNOA 1HR0K 2O8EA 4C3HK 3LAPA 3M8RA 3M8PA 4JYAK 3VGLA 4DTXA 1MWMA 3N4PA 4FWQA 3LP1A 3AQOA 4FZBA 1ZBUA 4A3DC 2R92A 2RPIA 3VQCA 2JA6C 2NVQK 5SWMA 1Q7YO 5C44C 4Y1CA 2DFHA 2PAVA 3CJCA 5M5WK 3MX2A 1GLFO 5FLXO 1G51A 1FKOA 2DFEA 5SZTA 4YOWA 1RT6A 1KLMA 3I0RA 3OYNA 3AD7C 5AQHA 3QERA 4KH6A 3FHZA 4CF1A 3THXA 2FQTA 4N76A 3DLEA 5ADXA 4DR7K 2FBTA 1HUXA 4FJGA 2W6KA 4K42A 3FGUA 4JV5K 3D2FB 1WBBA 3CCMN 4PAAA 4GT9A 1BWFO 4BE0A 4CZKA 4C45A 3KIOA 1L0WA 1N5YA 3I8BA 1NOYA 3MDQA 4JS5A 1U04A 4PQUA 2GUIA 1TAQA 1NGGA 3CAGA 2HHWA 4WCEL 4MLEA 2QI2A 4XIUA 4KHQA 3NH0A 1S6PA 3AVIA 4CJUA 2O8CA 5C15A 4H8KA 3I56N 1QQCA 4LFBK 5J1EA 1QVFM 4DTNA 1EFWA 1EWRA 4QS7A 2JWLA 2ETJA 1HQEA 1HNVA 5BR8K 2R92C 3VQ8A 3AVAA 2PYLA 3EZWA 1ZBFA 3NF6A 3GTQA 4FK0A 1X3MA 3F9MA 2O8FA 1J6ZA 2VQEK 1BU6O 2DY4A 1RT3A 1C0GA 1TWCA 1TYQB 4CEAA 4DSJA 1LOTB 2PMZL 1YF5L 4CGFA 4E89A 4BGAA 5AFUA 1NJYA 4CZHA 3K5MA 5CY4A 2HHSA 1K83C 1KAXA 4RW6A 1EP4A 2CH5A 3ENOA 4B9SA 2JA8K 1C1AA 5IWAK 3A5OC 4LF5K 2VCPA 4CZEA 3OPFA 2HNDA 5CJ9A 4CGGA 1T03A 3AA2A 1PJ7A 4A3BK 3HOTA 3DYAA 3KZBA 3VEVA 3IRXA 1N34K 1I50A 1J9AA 5CHIA 5LY3A 4CF0A 1VQON 3TSUA 2BE5A 4FJMA 4RWTA 3QMLA 4C3IC 1IKYA 4QOZB 2IVNA 4CK1A 4I6MA 1SFOK 4DWIA 3SAHA 2W7VA 4B3OA 2P9IB 2XCOA 3HVTA 3DOKA 3T02A 4OPJA 4IEIA 1K8AO 2F4VK 4RMFA 4BE2A 3ATUA 1DTTA 1ASWA 3UKUB 2NRZA 3P4IA 3OS1A 1HRHA 1VQ8N 4O8KA 5KQDA 3AGKA 1S1WA 4AH6A 3MN7A 1HMVA 3GTQC 2HW3A 4BDZA 1QSLA 1E4FT 4FLYA 1NLVA 4FJIA 2QK9A 3CC2N 1ESVA 1TWCC 4I2QA 3U4LA 3FKIK 1EETA 2ZGZA 2E6LA 3K5NA 3PSFA 4C8NA 2UUCK 1K8KA 1XHZA 1O27A 5FJ8K 2E88A 4NB4A 3K5LA 1RTHA 3GTGK 3OJSA 4B9TA 2A40A 4JKEA 1RDUA 3QEWA 4KHNA 4LQYA 4ISFA 1HNZK 4MEXA 2OPQA 3G4SN 3O9SA 2ZFZA 5M5YK 3EKUA 4KARA 4DTRA 5EOYA 3R8EA 1J98A 4ILDA 4BY1K 3HTVA 4GTAA 1ASVA 3T00A 1J5EK 3CCUN 4ELUA 2YU9A 3ZX0A 2BANA 3L0QA 2XY6A 1ZVUA 3DLGA 4DS5A 1DKGD 3E9OA 2OCEA 4GV6A 4GTEA 4A3KC 1YNJA 4FXDA 1HLUA 2P5GA 2ZJRL 4E1NA 4A5AA 4A3LK 1BL3A 3CJ1A 4OVLA 3KK3A 4DLGA 2G8HA 3AA4A 3KLFA 4U67L 1KAYA 4G0VA 4A5BA 4J2DA 2Z1HA 4KMAA 1WSGA 4FPBA 3ZEUA 5KRSA 5GIOA 4B3RK 4G1QA 3VPZA 5AQWA 5CZ1A 4E19A 2QM1A 1YUWA 4H4OA 3DOLA 4F3OA 5IOQA 1LWFA 3L4IA 3S41A 1HPMA 1CXUA 3K0SA 1U48A 1VQ5N 3CQXA 3OW2M 1RCHA 4J8FA 4MQ3A 3R6MA 3MEGA 4HHTA 1IG9A 2BE2A 5AZIB 1EK8A 4A3DK 4KB4A 3M4OC 2GEMA 2JA6K 3KK7A 3NMUA 5C44K 4CFAA 4JD2A 4CGIA 4FVUA 2P9IA 3BP3A 3FR0A 5JVOA 4CD3A 3RZDC 1O2BA 3WQTA 2P5MA 3S1NC 2GWJA 2NRWA 3I8DA 2KQ2A 4CZFA 1ZYQA 3FFKB 2F8SA 3H0GA 2QW9A 2HOEA 1I3QA 1KVAA 1EQRA 1NNEA 3SK3A 5AQNA 3RWUA 4KPYA 4O0IA 1XHXA 5AQKA 4H0TB 4JHDA 1P90A 4CGHA 2BH1A 4A61A 4H0XB 4CIGA 3W0LA 4ELTA 1HI9A 2RN2A 4AF1A 3S3OA 1HKBA 2HHHK 1WSIA 2E4LA 4PHTX 4LF9K 2NVTC 3S0XA 4BY7C 5KPTA 3P1GA 2V51B 4OX9K 2PMZD 3SLCA 2B4JA 1W2BM 3MCPA 4YG2A 3LM2A 3ULEA 2WB1L 2EHGA 3GTKA 2FBYA 3A5LC 3VEXA 2KW4A 1HNIA 3KKSA 4DR6K 4CE9A 5JS1A 2HBKA 2R92K 2YHBA 5H1SQ 4DTOA 3HYFA 4KMDA 4OLAA 2NRHA 4FJ9A 1YX2A 2B5JA 3V1QA 5E68A 2B63C 3PV8A 1VSHA 4BRMA 3CXCM 3PIPL 1TK8A 2KZZA 1K83K 2P9PB 3JYTA 3T1YK 3CMEN 3GEHA 3ZSQA 3GDZA 1WOPA 4XLPA 1LW0A 5C4JC 3H3NO 4RW8A 1S1XA 4ILHA 1I6HK 3IAYA 3T3FA 5BPMA 4E7IA 2NLXA 4OIPA 4G0UA 1VJEA 3HPGA 4JKCA 2GAHC 2HBMA 4NOIA 3GG4A 3OYLA 5TMCA 3MX5A 3NGIA 3FOFA 2DPNA 2EWSA 2NRTA 4CJQA 1VQ4N 3LP0A 1QZ5A 4H0YB 2FXUA 1VSJA 1WLJA 4C3IK 2P5OA 3P83D 4IFVA 2A1RA 3IFRA 2ZUFA 1XWLA 2IOCA 4CJ5A 5A2QO 4CJWA 2ZWHA 1TGOA 1VAZA 3RMAA 4BG8A 1Q81O 4H5WA 4IEEA 3GTKC 1ZXOA 3KKRA 2UU9K 5TMFA 3SZYA 4KI4A 3OBWA 2YNFA 4BVPA 2V7ZA 1GLDG 3RSEB 1S1UA 4I7FA 4B1WB 1RBVA 2QA4N 2QKKA 4OINA 3AAQA 2O5JA 3GTQK 1XXBA 2P9UB 1L5UA 3V4GA 3GTLC 1JQWA 1TWCK 3PO2C 3S2DC 2H3GX 4JNEA 1NBWA 1TAUA 1NMNA 3LAJA 1IS1A 3S17C 3CETA 4Y1DA 4JRQA 4I9QA 5AQOA 1EKEA 4MO5A 3VQ5A 2HF3A 3AVLA 1O26A 4CZJA 1NK9A 2VUMA 5C42A 3CCRN 1X3NA 4ICLA 4M42A 3DXKB 4KO0A 1D4XA 1JL2A 4KB2A 4BBRC 3AGRA 3BF3A 3O3GA 4DTMA 4JKGA 4NCGA 4DQSA 3CM6A 4PKGA 3L4QA 4AM6A 4JK8A 4AHCA 1O13A 2WTUA 1HQMA 2GBZA 1YVNA 2E2QA 1VRQC 1XC3A 4YFXA 1WN7A 2VG5A 4QIWL 4G0WA 4K0KK 3LPTA 3TABA 4JK9A 4G7OA 4A3KK 1N33K 3TANA 1BCMA 1EWQA 1ILYA 3TTDA 4GY2B 1BHLA 2AP1A 3MECA 3CFRA 3PO5A 3U6FA 4KAZA 3S3NA 2E1ZA 3VQQA 1JLEA 4DV4K 4KM9A 4BWMA 4DF4A 1B92A 1KD1O 3HOXK 1XI1A 3MMVA 3WT0A 3V4IA 4BE1A 1LCUA 1U47A 1N8RO 4CJTA 3HP6A 3BGRA 1QVGM 4X6AC 2IIRA 1IL2A 4FWSA 4Q0BA 1TL3A 1GLEG 4K41A 4XSXA 3HOUC 1HX1A 1QSYA 1Y1WA 3EKSA 4L3QA 4B3SK 2G8VA 5T7BA 3QBWA 3QIOA 4JI7K 5EY4A 4GTDA 4CJSA 4PABA 1XXCA 3T69A 3M4OK 3FZKA 1I39A 1SAZA 3G10A 3LAMA 3UE5A 2Y3PA 3OYDA 5BPNA 1JLBA 4I9LA 1NK8A 4ZTFA 2F96A 2IDOA 5J2PA 1T44A 2NRRA 2HHQA 1OH7A 3RZDK 4FCYA 3P38A 1REVA 4LH5A 1C0AA 1C0TA 3SUQA 3H3VL 1A5XA 2F9WA 3TSPA 2OPSA 4H03B 3TI0A 3VEOA 1ITGA 4CI6A 4DR4K 4KI6A 2BUPA 2OPRA 4BBSC 1KC8O 3VTIA 1XZQB 3LDNA 1SL2A 3LANA 3CJ7A 3MEDA 3VQDA 5FPDA 1X9WA 4LFAK 1QHAA 2ITMA 4DTPA 3TARA 1F21A 1K6YA 2QKBA 3EEQA 4KRFA 3THWB 4M7YA 4O44A 2O8EB 4CD1A 4DU3A 4FZXC 3MK6A 4MLHA 4FL9A 1Z6RA 2ZGYA 4G7ZA 4U7BA 2D0PA 2NVTK 1X9JA 1BCOA 3GTOA 4P5AA 2GTDA 5IYBC 4AHTA 4BY7K 5KQ8A 3RMCA 3U3YA 1WQHA 3L4KA 4WQ5A 3CI5A 3DXKA 1FKPA 3SQ4A 2V7YA 1RNHA 5C24A 4YOTA 3MAQA 3DXJA 3EN9A 3Q7BA 4J3NA 4Z4GA 4B9MA 2YV0X 3SMSA 3LDLA 2NVYC 2E5LK 3G4AA 2JA5K 3THXB 2E2HA 4AYBL 3GTMA 3TAEA 4B9UA 1U2VA 4NO7A 2B63K 3ERED 3TU5A 4BC3A 3MN9A 3S9HA 3G25A 1ATSA 1YITN 1TKXA 2P51A 4XH1A 2XY7A 2A42A 1IE0A 3I0SA 4AHSA 4ISGA 5C4JK 5MLCQ 2E2OA 5LJWA 1K9MO 3SI6A 4WQ4A 2NVXA 2V6TA 3D7EO 1QSSA 4MQ9A 4N47A 3NH1A 2F9TA 4MO4A 4L8RB 3SJJA 5KGWA 4LF7K 3BUEA 4C8KA 2Q0RA 4YOVA 4B8CA 4BRNA 3SZZA 5F2RA 3N4QA 3LZIA 1HYSA 5F1XA 5M1FA 3THYA 1I94K 4KHSA 2WAQL 4KAWX 1C1CA 2W42A 4DQIA 4KN4A 2VWKA 3OYMA 2P8TA 3CJ9A 1YT3A 4QS9A 3HOYK 3NDKA 4FJNA 1WORA 4WQ5C 2KHOA 4YY3K 4O4GA 2Q1NA 4LD0A 2O8FB 1HJRA 3FFIA 3QEIA 4H0VB 3NF7A 1JCFA 4PY5A 1IG8A 4I2PA 4C1NK 3LDQA 5FRNA 3OVNA 4K43A 4NLCA 3H3OB 1H1VA 1RDDA 3GTMC 5D4DA 3I4MC 3GTLK 3QICA 5JVHL 3PO2K 3S2DK 4GTFA 4XEIA 4FZYA 2PA8L 4QIWD 3J7YP 4KHPK 3S17K 4YHHK 3KVGA 3VQAA 4G9ZA 3RTVA 1JLCA 1Q8IA 2RKIA 4QS8A 2ZUEA 1U6ZA 2Z1JA 1NM1A 1NMDA 2NVXC 1UAXA 3LDSA 3GBTA 5C12A 3HK2A 3C6TA 1U45A 4WFNL 5JICA 4I6MB 4FM0A 4BBRK 3N0BA 2Q2RA 3BDPA 3I33A 1ZBIA 3GTJA 2AJQA 3DI6A 4CHPA 3ENBA 4DTJA 4DG1A 1TKDA 2E1YA 3E01A 2Y1JA 3L3VA 3ZSOA 3V1RA 4E1JA 4DSFA 4CBXA 1VRUA 2O8DA 1WOOA 3RVCA 3RRGA 2VWJA 3BF1A 3TWHA 4GVMA 4BC4A 4C2MC 5HL8A 1IW7A 3KWGA 5FRMA 3LWMA 1TWGC 4X6AK 1X1PA 1K8KB 4LK0A 4H5NA 2E2NA 2XCRB 1I3AA 3HOUK 1JKHA 1R9TA 1NJIO 4WE1A 4ID5A 1L3SA 3OEPA 1RDAA 4DHYA 2HHUA 3H3VD 4WJ3M 5AQGA 5AQZA 3A8YA 5C10A 3CF5L 1IBAA 3DLHA 1TWFA 3OYKA 1B9DA 1K73O 5DM7L 3WEEA 4NXMK 1BGWA 5HOOA 1V4SA 1USMA 3HM9A 3VETA 3DJCA 2JLEA 3MMLB 4FLVA 3ATVA 4CHYA 3A2FA 4WILA 5AQYA 1VSKA 4BVOA 5JS2A 3NAEA 3OHRA 3CCVN 1E4GT 5AQVA 2ASOA 1CZBA 4CF2A 4RCHA 5C3EC 2YHWA 4M45A 3ZYYX 1RTIA 2HHVA 3GTJC 4WF9L 5D3GA 2JA7A 1Q9XA 2KLAA 5HRRA 4BBSK 3O08A 2W40A 3U9ZA 3VQ9A 1VQ6N 2ASPA 3BEXA 4BRLA 3ZEUB 3M1FA 4W5TA 3HSCA 3OREA 4FJ8A 4J2EA 4XSZA 3NE6A 3U8XA 4CJEA 4GTBA 4BRKA 3O9TA 3SYZA 1B9FA 1GLBG 1DT9A 3OYBA 2ZJQL 2YHYA 2KWAA 4FLXA 4KHWA 5HRPA 4IO9L 1Y64A 4IWVA 4DTUA 4WFBL 4JD2B 2KFNA 5HRSA 1TWAA 3AAPA 3GTPA 5JLFA 4PKHA 2P9SA 1HQUA 2PZSA 3ZX2A 4KREA 1WCMK 2HHXA 2G8FA 3AA3A 2NVYK 3AARA 4IFYA 3EE9A 4B1ZA 4Z4HA 3EZ5A 1VLOA 4XLNA 2Y1IA 4R5PA 4Y0WA 4C3JC 5E41A 1W0HA 2YKNA 4CERA 3J80O 4QAGA 4Y52C 3QINA 3OYEA 4DSEA 1BQNA 4KB1A 3PO3C 5JVGL 3SAFA 3RRHA 1S1VA 5C0YA 4IOXA 4JHDB 2WAQD 4BR0A 2JA7C 4FLUA 1VQ9N 2G8KA 4CBWA 4LY7A 4BLAA 4FOIA 1HYZA 2ZE2A 1D8YA 1VQKN 3VQPA 1TV6A 4EZ6A 5I42A 2KFZA 4LC9B 4IXCA 4CEOA 1INNA 3HM8A 4QJVA 4JKDA 4KKOA 5AQUA 3LP2A 4W5QA 3CQZA 4DS4A 3S14C 2A69A 4HVJA 4IJNA 3ULEB 3HPHA 4A93C 3SBTA 5DM6L 3ZT0A 1I50C 2UXBK 2HF4A 1TKTA 1O2AA 5FDLA 3K9JA 4AILC 1TWAC 4A3EC 3GTPC 2DTUA 4B9QA 4H0PA 3WUHA 2ITGA 3TAFA 3JSTA 5M3FK 4ILJA 3CFPA 3MEEA 4CEFA 1X9SA 1TWHA 3QEPA 1SKSA 3THVA 2A41A 3S2HC 1LV5A 3O1BA 2GUPA 3K5OA 3SNNA 3GTMK 1BO5O 3I4MK 3D45A 3SJHA 3LPXA 2E2IA 3AVJA 4A3IC 4DMNA 1Z05A 4OPAA 2GSUA 4DUZK 4M63C 5M1PA 1NGEA 4LF4K 2GAGC 3HOVC 4OPKA 1OH8A 3TPQA 1G15A 2OPPA 5KGXA 1Y97A 1T6CA 1VSDA 5BPLA 3UKRA 4CFDA 1VQPN 4FWKA 4QCLA 1BUPA 4OKKA 3CC4N 2E2JC 3WNEA 5LMNK 3R3LA 4CEDA 2NUBA 1XXAA 3AVGA 3CQZC 3DLRA 4B9VA 1HNWK 3AVMA 1WBDA 4DR3K 4PKIA 3GEIA 2QWQA 3O6WA 4A3JC 1JL1A 3VTHA 2Q97A 5C2DA 3N3YA 1O25A 3SUNA 2NNWA 2YU9C 1A5VA 1BIZA 3I4NC 4EZ9A 3IDHA 4JK1A 4BRIA 4FJ5A 3V9ZA 1KQSM 3SV3A 4JKFA 1UV7A 2PFUA 3O80A 1NJZA 3QFPA 3SCXA 4KMUA 4KN7A 1Z26A 4CJFA 1YTAA 1EX4A 1T8EA 4OGEA 3HL8A 1KTQA 2P1JA 1N6QA 5CR4A 2Q3SA 1TWGK 5CYMA 3ID6A 3VF6A 4JI4K 1WNSA 3S16C 2F7TA 5AQIA 2PYJA 2QWRA 4LK1A 1NOZA 2Q31A 3PUFA 1ISEA 2P9LB 3RZOC 1YVUA 3ZT3A 2IVOA 4FJKA 4ZTJA 1SQKA 1YHQN 4JKGB 5M1NA 4A3GC 1KCFA 2QTDA 5AQRA 1J54A 1UOCA 1DTQA 4OIOA 2VGMA 4DFMA 3NVMA 4RW9A 3FZHA 1TUUA 2O4IA 4CCHA 3KK1A 2PY5A 2ZM6K 5J2QA 4EHTA 3WXKA 1NK6A 1BS2A 5C3EK 1BDFA 1NGIA 3CCEN 3CCSN 3GTJK 4H4MA 3TTCA 5GIPA 3SQ1A 3H1VX 1VQ7N 2B6AA 1NK4A 4NCAA 4FJXA 4FWNA 4CZLA 5FPEA 3HPOA 3H0GC 1RBSA 3DRPA 4F2SA 1I3QC 2FBVA 4M1XA 2R7ZA 5BRFA 3QETA 3H1QA 4R79A 3EQLA 3P5JA 3W3DA 5BRDA 1F9NA 4UY8O 1BQMA 1EQYA 3AD9C 4CK2A 4YFNA 5JLHA 2G8UA 4IO8A 4JRPA 1YCLA 1CLQA 2CW0A 1VSIA 1SKRA 3ZCMA 3H46O 4JAXA 1OKJA 4YFUA 1EI6A 1SL0A 4DQQA 3ZLJA 2R93A 4IKFA 4LH4A 1J5OA 4FM9A 4CHOA 1JOEA 4CVNE 4B3TK 3TFHA 4DFPA 4M3WA 3V9SA 1BI4A 3OJUA 3L8BA 3PSIA 3VA7A 3HOWC 1ATNA 1VH2A 3N0CA 1VHXA 3VEWA 1NJWA 1EO1A 4P5BA 2V6UA 3QO9A 3L6QA 1NGCA 3VQ7A 4CJ3A 1JXBA 4A2BA 3AD8C 4KH5A 3KK2A 5EXWA 1C1BA 1DCHA 3HP9A 2HVHA 4C8LA 2YHAA 2YJFA 3G71N 3PO3K 5EU7A 3AV9A 4GVEA 2CGLA 4BREA 1JCEA 2FSNA 3ENHA 4JI1K 3DMJA 2GX9A 1D9DA 2YNHA 5CYQA 2OZSA 4KHUA 3HKZL 2JA7K 1JVIA 2HNYA 3ZSYA 4RW7A 1YJWN 3AQPA 3CJAA 3DLKA 4CEEA 3V9UA 4V19S 2O8BA 3JAMO 3K57A 5AR0A 1BA0A 1R59O 4FWOA 4UQGA 2R7ZC 1JLQA 2YX6A 4DB3A 4DV6K 4IDHA 2P9LA 4EP5A 1KSPA 3S14K 3L3UA 2RHKA 3AY9A 3R9PA 4KHYA 3H6EA 4G7HA 5J2NA 2Y0SL 3V9WA 4A93K 4YOUA 1VSEA 3CM5A 3H45C 4F8RA 4FJ7A 1I50K 2HVIA 3V81A 2R93C 4CK3A 3GIRA 3LM9A 3D2EA 1OH5A 4H5VA 2D0AA 2NVQC 3MN6A 4A3EK 1U2VB 4KDDA 1RBTA 3AO5A 3GTPK 2RF2A 1C6VA 1KLNA 4E7HA 1WOQA 1ZBSA 3AO2A 4HUEA 3S2HK 1OVYA 4KTZA 3HXMA 4BR7A 1TL1A 1YIJN 3AH5A 4A3IK 2Q36A 1T6DA 3ZETA 3WXJA 3NF8A 3Q7CA 1WQFA 3HOVK 3ZX3A 1KFDA 2VG7A 3DRRA 1LAWA 3O8MA 3PX4A 2A1SA 3THYB 1GOAA 1BDGA 4LR2A 4YOXA 4BRCA 4W5RA 1TK5A 2E2JK 1RT7A 5AQPA 3FZLA 4GTLA 4DFJA 4EFHA 3MXMA 2VG6A 3HRGA 2VUMC 3DAWA 3S1QC 4XH4A 2A5XA 4JI6K 3V9XA 1RU0A 2CFAA 3S1NK 1XC9A 4WJ4A 5HROA 3DWLA 3P39A 4JS4A 4A3JK 1Y1VA 5GAGP 3GEEA 4X62K 1WOSA 2FF3B 5AFUH 1X9MA 5HLFA 2YU9K 3I4NK 1SZ2A 4KFBA 5HL7L 4CIEA 4BWJA 2WB1D 2GELA 3M3ZA 3R1XA 3C95A 3VESA 3DXMA 1CZ9A 4DF8A 2ASMA 3S1RC 1NGFA 4LF8K 3ALYA 3M8SA 4W5NA 3V1OA 4CZMA 1UA1A 1IBMK 4AHRA 2FSKA 3KWIA 2F8TA 3GE1A 3S16K 1KRPA 1NKEA 1JJ2M 4CJPA 1Y1WC 3RZOK 2P9KA 4MEYA 4EHUA 3GTGA 4C8OA 4FK2A 2BTFA 4DSIA 3AVCA 3HBTA 3LP3A 4C23A 1WB9A 4PWDA 4A3GK 1C0MA 4H0OA 4MDBA 4ELVA 3C7NA 4Y7NC 5AQMA 4J2BA 2Z1GA 2P9NA 1VRTA 3IG1A 4ZH4A 3ZSVA 5BRHA 4AHUA 4BC5A 4BXXC 1JLFA 3LWLA 3J7AP 3L2RA 4HTUA 2YJEA 2HBLA 3M5RA 3T19A 4YOYA 3CCJN 2O8DB 2EX3A 1MU2A 4OIQA 2D5RA 2QXFA 3C6HA 4DDQA 4YORA 3VGKA 1IKXA 3H0GK 4CZGA 3V6DA 4EAHD 3VQ4A 1I3QK 4AH9A 1Y1VC 1QS4A 3DLLL 4Z4IA 4A3FC 5M3MK 3O4WA 2GWKA 5B8HA 1PJ6A 1KAZA 4JI3K 4BRGA 3KLEA 3BP8A 1X31C 3MXIA 3CIPA 4DTSA 1IQ0A 1WSRA 2RE2A 4BR4A 3CQ8A 1VSMA 3AO1A 1RTJA 2V6SA 1DEJA 2LSNA 2YNIA 2ZQBA 5BN9A 4FPAA 5AQQA 4N56A 3NBPA 3B8AX 4FLTA 4MFBA 3A0IX 3WEEB 3A8KA 3GTOC 4IZ9A 1T7PA 2X6SA 4BKWA 4CHZA 4DV1K 4FWPA 1SS6A 3HOWK 3HKZD 3E9LA 3T01A 4A2AA 3GTGC 1NGBA 5HBMA 1XUPO 1WQGA 2XCQA 3M6GA 3JXUA 1DLOA 3EE8A 3GTKK 1VSFA 2QWLA 1F7UA 3SQ2A 4AQYK 2KKZA 1NJXA 4DV5K 1L3TA 2HHTA 3CJBA 3GOIA 3VA3A 4GTCA 4DR1K 4A57A 3C94A 2E2HC 2E2PA 2IAJA 2O5IA 4FWRA 4H5RA 3SUPA 3HJFA 3KTQA 4KASA 3A8IA 3L2VA 3WXIA 1XZPA 1RT1A 1S9GA 4AM7A 1R0AA 3HXAA 2OZMA 2DFFA 4B1VA 4MDAA 3U9DA 5IP9C 3C6UA 3BUZB 2G8WA 3OYGA 4M3TA 1WSJA 4Z4FA 3C6AA 4WQ4C 4CGJA 3ASMA 3BP8C 3ZSXA 1CZAN 1GLAG 1O28A 1N36K 3M3YC 3VQBA 5IORA 1WUAA 5ELZA 1YAGA 4CESA 2P9SB 1BISA 4LOWA 4O5FA 2OTJN 2R93K 3O3HA 3E1YA 5AZJA 1S5JA 3HOSA 3J81O 1V4TA 3OYIA 4K8ZA 4IOAL 4LJZA 3LDOA 2KTQA 1SV5A 4DQRA 4JK7A 4CHNA 3ZT2A 3MWTA 4FK4A 4JKHA 2GV9A 4CJLA 4BRHA 1FJGK 1K83A 4CBUA 5LJVA 1NGAA 4B1YB 2V52B 1MA9B 2GSNA 1NK7A 4KM8A 3RR7A 4M41A 1DD5A 4CEZA 1RBRA 3T1HK 3VN5A 4QJVB 2ZJPL 4JI8K 2OANA 1XNRK 1U49A 3G6EN 1NWKA 2X74A 1M90O 4FW2A 5KPRA 2OTLN 3MCAB 2WOMA 2WFBA 4A59A 3K58A 2D6FC 4WYBA 4LF6K 2JWKA 5EVZA 2VUMK 3S1QK 4FVMA 5M1OA 4IOCL 3QBXA 3E66A 3NF9A 5FPNA 3SBGA 4BDPA 4KH4A 3HVRA 3HO1A 3L2UA 3PY8A 5C2FA 1NK0A 4NLBA 1U4BA 1BA1A 3FLCO 4J2AA 2A6EA 1I6VA 5AQXA 5FLMC 4RTFD 3BZKA 4BRPA 1NGJA 3PO4A 2KZMA 4IG3A 3ID8A 3A5NC 1JXEA 3GL1A 2FLOA 4X65K 3CMAN 2E8AA 1Q86O 4B1XB 3S1RK 4GMJB 3LL3A 3VENA 1RT2A 5K14A 3T1AA 5CHPA 1HKGA 3SMPA 3KHYA 4AYBD 2BDPA 2HMPA 1ASUA 3O9UA 3K59A 5IYBK 3O4QA 3ZSZA 4JI0K 3UKRB 1Y1WK 1R9TC 1HPZA 4IG0A 3PX6A 4OPHA 4C1NI 1I6HC 4XCHA 1XMOK 2W6LA 2XY5A 4DV0K 1O2FB 3MN5A 3TR8A 4FYDA 3MXJA 1YNNA 4Y7NK 5TKWA 3VA0A 1TWFC 1WSVA 5KRTA 4BXXK 3SPYA 3QESA 2E20A 2QWMA 2I5JA 3QDKA 5FROA 1C0UA 1UWBA 4DV3K 3ULDA 3ITHA 2UYTA 2XRIA 4C8MA 1TVRA 1NK5A 4X64K 2HMIA 2A6HA 3EL2A 2G8IA 1IBLK 3IPJA 3CQYA 3DM2A 1Y1VK 4A3FK 1B4AA 2IVPA 1YJ9N 4BY9C 5DK5A 3ZT4A 4FOEA 4E7LA 4BQZA 3OYAA 1YI2N 1Q9YA 2O4GA 1JLAA 3SPZA 2RGRA 3HOZC 3EY1A 3A8JA 4EIAA 3UIQA 4KBOA 4ILGB 5JFEA 3D2FA 5C4XC 1SKWA 1XPPA 3CPWM 1C0FA 4CEQA 5C25A 4NXNK 5IP7C 2FSJA 3QEVA 1DCPA 5E26A 1G99A 1NKCA 1J6XA 4JN4A 4FLWA 4M3RA 5EGHA 2Z1IA 1VQNN 3O9QA 4FM2A 3GTOK 1GLJO 3C0BA 3VEZA 2WONA 2A68A 1YJNN 2ZF5O 4N5SA 3KD1E 4KATA 1IKWA 3VMFB 2FQOA 2PA8D 3AVBA 3QX3A 3SZ2A 4DFKA 5BR9A 5LMUK 4RG8A 3OTOK 4NYFA 1QHTA 3JS6A 4B3MK 4FW1A 1TK0A 3IKMA 4KTWA 4IFEA 3LAKA 1ZBLA 4BQLA 4CECA 3G4CA 2OA8A 4GV3A 1LAVA 2E2HK 3HT3A 2ATQA 4CJRA 3RR8A 4OKJA 1L3VA 1A5WA 4JEPA 5KTQA 3IS9A 2OYQA 1T3VA 3OYCA 4ID1A 1DGKN 1TYQA 4PA1A 3CG7A 5IOSA 5AQFA 1QQNA 5IP9K 4DSLA 3OYHA 3HOXC 1RDWX 3NVKA 4F3TA 3VOVA 1HKCA 2NVXK 1Z25A 1GOCA 4LFCK 4YDUA 1BI4B 3M3YK 3NHGA 4FJLA 3OY9A 5TKYA 4DU1A 3OYFA 3TFJA 4BR9A 4M3UA 3F5TA 4IBNA 2IC3A 2W41A 4CJKA
chains in the Genus database with same CATH topology
2A3ZA 4IDHA 2P9LA 3EZWA 4Z94A 5KPZA 4ISGA 2AA4A 2RHKA 3AY9A 3CHWA 3R9PA 2E2OA 3H6EA 5LJWA 1X3MA 3F9MA 5MLCQ 1K9MO 1AB4A 2JA5A 1J6ZA 1BU6O 1C0GA 4FO0A 4WQ4A 1TWCA 1TYQB 4YOUA 3H45C 2NVXA 1LOTB 1YF5L 3D7EO 4BGAA 5AFUA 4CZHA 2F9TA 4MO4A 2J4RA 4O8UA 1KAXA 2B63A 2CH5A 3ENOA 3BUEA 2Q0RA 3FZFA 4DCHA 4YOVA 3LM9A 4BRNA 3A5OC 3D2EA 4H5VA 2VCPA 5F2RA 3SAGA 4CZEA 3MN6A 1U2VB 3N4QA 4KDDA 5F1XA 3UKUA 5M1FA 4FWMA 4B1UB 3F2KA 3OPFA 4KAWX 5CJ9A 2A6AA 3CJ9A 3HOTA 4QS9A 5JVOA 1WOQA 3KZBA 1ZBSA 2NZTA 3VEVA 1I50A 5CHIA 5LY3A 4WQ5C 1OVYA 2KHOA 2HSTA 3T7ZA 2Q1NA 1EH1A 4FWLA 1VQON 4H0VB 3TSUA 1JCFA 4RWTA 3QMLA 1NGDA 4C3IC 1O24A 4BR7A 4BR5A 1YIJN 2IVNA 3J8AA 4I6MA 3O9RA 3C65A 3CD6N 1IG8A 4K25A 3AH5A 3SAHA 2Q36A 4C1NK 1T6DA 3LDQA 3ZETA 2P9IB 3WXMB 2XCOA 3WXJA 3Q7CA 4K43A 4NLCA 1RFQA 3H3OB 1WQFA 3ZX3A 1H1VA 4IEIA 4YDUC 1K8AO 3D2EB 3O8MA 3ATUA 3QICA 3UKUB 2NRZA 3P4IA 5JVHL 4GTFA 1BDGA 4LR2A 4YOXA 4XEIA 4BRCA 3OA9A 1VQ8N 3FOEA 5AQPA 4O8KA 3FZLA 3E9PA 3AGKA 3HI0A 5KQDA 4GTLA 4EFHA 3KVGA 3MN7A 3HRGA 4G9ZA 3DAWA 4QS8A 4XH4A 2A5XA 2CFAA 2CH6A 1U6ZA 1E4FT 1NLVA 3Q3QA 1NM1A 1NMDA 3CC2N 1ESVA 3O5BA 3U4LA 3DWLA 3P39A 1NGHA 3GBTA 2ZGZA 5C12A 5GAGP 1Y1VA 4WFNL 5JICA 4BLBA 4I6MB 2FF3B 1K8KA 3SMPA 3GTLA 5AFUH 2Q2RA 3N0BA 1BG3A 1O27A 3ZETB 3I33A 2E88A 4NB4A 3GTJA 1SZ2A 5HL7L 1W97L 5AQJA 1VQLN 3PIOL 3ENBA 5AQSA 2A40A 4JKEA 2GELA 1RDUA 3M3ZA 3VF4A 3R1XA 4ISFA 3VESA 4LQYA 3DXMA 4KC6A 4GFQA 3G4SN 2E1YA 3O9SA 2ASMA 5EX5A 1NGFA 2ZFZA 3EKUA 5AQTA 4KARA 3K9KA 4CZMA 4E1JA 2D1KA 5EOYA 2FSKA 3KWIA 4CBXA 3R8EA 4ILDA 3GDQA 3HTVA 4GTAA 3GE1A 2CFAB 3CCUN 4HTLA 2YU9A 3ZX0A 3PLAA 3L0QA 3RVCA 3VERA 1ZVUA 1JJ2M 1DKGD 3E9OA 4GTEA 4GV6A 3BF1A 4BC4A 4C2MC 2P9KA 4BC2A 3GTGA 4EHUA 1GE9A 1HLUA 3KWGA 2BTFA 5AZIA 3HBTA 1K8KB 2ZJRL 4H5NA 2E2NA 4C23A 4A5AA 2XCRB 4BROA 3CJ1A 1R9TA 2CGKA 4MDBA 4H0OA 3D6RA 3CCLN 3C7NA 1NJIO 5AQMA 2P9NA 3OEPA 4U67L 4DHYA 1KAYA 4G0VA 4A5BA 3DXMB 4KMAA 2QEXN 5BRHA 5AQGA 1S22A 4FPBA 5AQZA 3ZEUA 3A8YA 5GIOA 5C10A 4BC5A 3CF5L 1ZC6A 5AQWA 3VPZA 5GAEP 1JCGA 2QM1A 2YJEA 1YUWA 2HBLA 3M5RA 4DKWA 3IUCA 1K73O 2WC9A 5DM7L 4YOYA 1O29A 3WEEA 3CCJN 5IOQA 1BGWA 3L4IA 3S41A 5HOOA 1V4SA 1HPMA 5F0XA 3VETA 3DJCA 1VQ5N 3CQXA 3OW2M 3C6HA 3MMLB 4JKAA 3ATVA 4YORA 3VGKA 4DDQA 2YCHA 4J8FA 5AQYA 4CZGA 4BVOA 3R6MA 4EAHD 2YHXA 2P9KB 3OHRA 3CCVN 1E4GT 5AQVA 3GTQA 3DLLL 2ASOA 4RCHA 5AZIB 3O4WA 2GWKA 1Q86O 1EK8A 2YHWA 5B8HA 4KB4A 1KAZA 2GEMA 3ZYYX 3KK7A 4BRGA 4WF9L 4KMHA 3BP8A 3TTFA 3NMUA 2JA7A 4JD2A 3C7NB 3CIPA 4C3HC 2RE2A 4BR4A 2KLAA 4BRDA 2P9NB 4FVUA 1WIHA 2P9IA 3O08A 2W40A 4BGBA 1DEJA 3FR0A 4JKBA 2ASPA 3BEXA 3U9ZA 4BRLA 3ZEUB 4CD3A 3M1FA 5BN9A 3UB5A 3WQTA 1O2BA 2P5MA 4FPAA 5AQQA 3HSCA 3OREA 2Q0UA 2GWJA 2NRWA 3B8AX 4BRAA 4AM6A 4CZFA 3FFKB 3H0GA 3U8XA 5ADXH 2QW9A 4BRKA 2HOEA 4GTBA 3O9TA 1I3QA 1GLBG 3A0IX 3WEEB 1DT9A 4GNIA 5GADP 2ZJQL 4IZ9A 3SK3A 5AQNA 4BKWA 3CERA 2VYPA 2YHYA 3QFUA 5JMVA 4FWPA 1SS6A 2KWAA 3E9LA 5AQKA 4A2AA 1Q82O 1NGBA 1WQGA 1XUPO 4H0TB 2D0OA 4IO9L 4JHDA 2XCQA 3M6GA 3JXUA 1P90A 1Y64A 3EE8A 4IWVA 2QWLA 4ISEA 4WFBL 3VGMA 3I55N 2KKZA 2BH1A 5GAHP 4JD2B 4A61A 3CJBA 4H0XB 2GSOA 3GOIA 3W0LA 1TWAA 3AAPA 4AF1A 1M1KO 4GTCA 1HKBA 3GTPA 5JLFA 4PKHA 4PHTX 2P9SA 3VEYA 4A57A 1QZ6A 3ZX2A 2P9PA 2E2PA 3S0XA 4CZIA 4FWRA 4H5RA 3AARA 5KPTA 3EE9A 4B1ZA 1B4BA 2V51B 4KASA 3SLCA 5GINA 4Y0WA 1GLLO 3WXIA 4WFAL 4C3JC 1W2BM 2PBDA 3MCPA 4M7XA 4AM7A 3LM2A 3ULEA 3GTKA 1YXQA 3VEXA 3A5LC 3WXLA 4MDAA 4B1VA 5JVGL 3U9DA 3SAFA 1SFOA 3BUZB 5C0YA 2HBKA 4IOXA 4JHDB 3EO3A 3C6AA 4WQ4C 5H1SQ 4BR0A 1WCMA 1CZAN 4KMDA 1GLAG 3IMXA 1VQ9N 2QWNA 1O28A 2NRHA 2NVYA 4CBWA 4BRQA 4BLAA 4FOIA 5CE3A 2D4WA 5IORA 4BRMA 3CXCM 3PIPL 1WUAA 5ELZA 1VQKN 1YAGA 3NUHA 2P9SB 4PL7A 3MWPA 2VGNA 4LC9B 2P9PB 4IXCA 4O5FA 3CMEN 2OTJN 3HM8A 4JKDA 5AQUA 3CQZA 3E1YA 5AZJA 2PHCB 2FF6A 2HBJA 3HOSA 3H3NO 4IOAL 1V4TA 4IJNA 4CJ7A 3ULEB 4ILHA 3LDOA 3SBTA 3FKIA 5BPMA 5DM6L 1Q18A 2NLXA 4JK7A 1TWFA 3MWTA 4G0UA 2VWBA 3L4JA 4JKCA 3RSEA 4JKHA 5FPMA 2HBMA 2HF4A 3GG4A 4BRHA 1K83A 1O2AA 3MX5A 4CBUA 1NGAA 4B1YB 5BREA 2DPNA 2EWSA 2V52B 3K9JA 5LJVA 2P9UA 1KQ4A 1XQSC 2NRTA 1VQ4N 1MA9B 3FE1A 2GSNA 1QZ5A 4H0YB 2FXUA 4H0PA 4B9QA 3CC7N 3WUHA 4KM8A 2NRVA 1HJOA 1DD5A 3IFRA 4ILJA 1TWHA 2ZWHA 2I7PA 1VAZA 1BOTO 2A41A 1IJJA 5AZJB 4BR2A 2ZJPL 4BG8A 2QWPA 2OANA 3WQUA 4DQ8A 5E84A 3O1BA 2GUPA 1Q81O 4H5WA 4IEEA 3G6EN 1NWKA 1BO5O 1ZXOA 1M90O 4FSVA 5KPRA 3SJHA 2OTLN 3LPXA 3MCAB 3OBWA 2E2IA 2WFBA 4BVPA 2V7ZA 1Z05A 4A59A 5M1KA 1GLDG 4OPAA 1QQMA 3RSEB 4M63C 4WYBA 1NGEA 5M1PA 2GSUA 4B1WB 2QA4N 2JWKA 5EVZA 3CPEA 3AAQA 3P31A 3A5MC 5M1OA 3TPQA 1XXBA 2P9UB 4IOCL 4OO1J 2JH3A 1T6CA 4A62A 3V4GA 4IJAA 3QBXA 5BPLA 3E66A 3UKRA 5FPNA 2H3GX 3SBGA 1ATRA 4FWKA 4JNEA 4KH4A 1BUPA 3CC4N 1VQPN 1NBWA 2RH6A 5C2FA 3R3LA 3LAJA 4NLBA 3VF2A 1BA1A 3FLCO 5I9EB 1IS1A 1XXAA 5IOTA 3CETA 5AQXA 4RTFD 5AQOA 4BRPA 1NGJA 5M1QA 5BN8A 4MO5A 4PKIA 4BG9A 3CCQN 3ID8A 3A5NC 5TJ3A 2QWQA 2HF3A 1O26A 3O6WA 4CZJA 2VUMA 3GL1A 5AQLA 2FLOA 1BJTA 3VTHA 2Q97A 1X3NA 2E8AA 5C2DA 3DXKB 4B1XB 3CMAN 3LL3A 1D4XA 3CCRN 1O25A 3N3YA 3VENA 4KB2A 2NNWA 3AGRA 3BF3A 1GLCG 2JA6A 1S72N 4JKGA 3IDHA 3LDPA 4BRIA 1MDUB 2NRXA 5CHPA 4PKGA 1HKGA 1KQSM 4JKFA 3KHYA 3L4QA 4JK8A 2PFUA 1O13A 3O80A 3QFPA 2HMPA 1YVNA 2E2QA 3O9UA 1XC3A 2WBNA 3TSQA 4G0WA 1S3XA 3FZMA 1VQ6N 4JK9A 3J7ZO 3UKRB 2WUSA 1ILYA 3TTDA 2CGJA 5CR4A 4GY2B 4OPHA 4C1NI 3ID6A 3VF6A 4GV9A 2AP1A 2QWOA 3QB0A 2E1ZA 3MN5A 4XH5A 4KM9A 2F7TA 5TKWA 5AQIA 1P8ZA 2QWRA 3OBYA 1KD1O 2Q31A 1ISEA 3MMVA 3WT0A 2P9LB 1LCUA 1N8RO 2IVOA 1QVGM 2IIRA 2YI1A 4BRFA 4FWSA 1SQKA 1GLEG 4K41A 2E20A 1YHQN 1VQMN 1HX1A 1MWKA 4JKGB 5M1NA 2QWMA 4HWIA 1Y1WA 2QXLA 2QTDA 3QDKA 3EKSA 4L3QA 1TWGA 5AQRA 2I7NA 2UYTA 4PL8A 4F9OA 3QBWA 2VGMA 3EL2A 3NVMA 1RGIA 3FZHA 1TUUA 5EY4A 3CQYA 4GTDA 4EHTA 3WXKA 1B4AA 1XXCA 2IVPA 1YJ9N 3T69A 4BY9C 3HZ6A 4FOEA 1KXPA 1NGIA 3FZKA 4H5TA 4BQZA 1QQOA 1SAZA 3CCSN 3CCEN 5EGEA 3TTCA 1YI2N 1TUYA 3O1WA 3UE5A 5GIPA 2Y3PA 3H1VX 1VQ7N 3LAPA 4FWNA 3VGLA 2RGRA 5BPNA 4CZLA 4EIAA 4KBOA 1MWMA 3N4PA 4FWQA 4ILGB 5FPEA 3D2FA 5JFEA 3AQOA 1T44A 2NRRA 4FZBA 4M1XA 3P38A 5BRFA 2R7ZA 2R92A 3CPWM 3H1QA 1C0FA 4R79A 2FSJA 3W3DA 5E26A 1G99A 5BRDA 2F9WA 1Q7YO 1F9NA 3TSPA 4JN4A 4H03B 2PAVA 1EQYA 4UY8O 5EGHA 3CJCA 1VQNN 5JLHA 3O9QA 3MX2A 3VEOA 1GLJO 4IO8A 2BUPA 4CI6A 3C0BA 3VEZA 3FOFA 1GLFO 1KC8O 3VTIA 1YJNN 3LDNA 3CJ7A 2ZF5O 4KATA 5FPDA 4YOWA 1QHAA 3H46O 3VMFB 4JAXA 1OKJA 5AQHA 2ITMA 3QX3A 2R93A 5BR9A 4FM9A 4KH6A 3FHZA 4M7YA 3JS6A 3VA7A 5ADXA 3IKMA 1HUXA 4CD1A 4IFEA 3MK6A 4K42A 4MLHA 3FGUA 1ATNA 1Z6RA 2ZGYA 4FL9A 4BQLA 3D2FB 3VEWA 2D0PA 4U7BA 1EO1A 4GV3A 1X9JA 3G4CA 3N0CA 4P5BA 3CCMN 3GTOA 4P5AA 2GTDA 4GT9A 1BWFO 1NGCA 3L6QA 4CZKA 5KQ8A 1WQHA 3L4KA 4A2BA 3I8BA 4KH5A 3MDQA 4JEPA 5EXWA 4WQ5A 3CI5A 3DXKA 2V7YA 1NGGA 1T3VA 3CAGA 1DGKN 1TYQA 2YJFA 4YOTA 3G71N 5IOSA 4WCEL 5AQFA 4MLEA 2QI2A 3EN9A 3Q7BA 1QQNA 4J3NA 4GVEA 2CGLA 4BREA 3SMSA 3G4AA 1JCEA 2FSNA 3ENHA 1RDWX 3LDLA 3NVKA 3VOVA 2GX9A 1HKCA 5C15A 2E2HA 4YDUA 3I56N 3GTMA 1YJWN 3AQPA 3CJAA 1U2VA 4NO7A 1QVFM 5TKYA 3TU5A 3ERED 4BC3A 5AR0A 3MN9A 4QS7A 1BA0A 3F5TA 3G25A 1R59O 2JWLA 4BR9A 4FWOA 1ATSA 1YITN 4XH1A 2YX6A 2W41A 2A42A 4DB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3Z A;  4Z94 A;  2P9L A;  3EZW A;  5KPZ A;  4ISG A;  2AA4 A;  3AY9 A;  3CHW A;  3R9P A;  2E2O A;  3H6E A;  5LJW A;  1X3M A;  3F9M A;  1J6Z A;  1BU6 O;  1C0G A;  4FO0 A;  4WQ4 A;  1TYQ B;  3H45 C;  1LOT B;  3D7E O;  4BGA A;  5AFU A;  4CZH A;  2F9T A;  4MO4 A;  2J4R A;  1KAX A;  2CH5 A;  3ENO A;  2Q0R A;  3FZF A;  4DCH A;  3LM9 A;  4BRN A;  3A5O C;  3D2E A;  4H5V A;  2VCP A;  5F2R A;  4CZE A;  3MN6 A;  1U2V B;  5F1X A;  3UKU A;  4FWM A;  4B1U B;  2A6A A;  3CJ9 A;  4QS9 A;  1WOQ A;  3KZB A;  1ZBS A;  2NZT A;  3VEV A;  5LY3 A;  4WQ5 C;  2KHO A;  2Q1N A;  4FWL A;  4H0V B;  1JCF A;  4RWT A;  3QML A;  1NGD A;  4BR7 A;  4BR5 A;  2IVN A;  3J8A A;  4I6M A;  1IG8 A;  4K25 A;  2Q36 A;  1T6D A;  3LDQ A;  3ZET A;  2P9I B;  3WXJ A;  4K43 A;  1RFQ A;  3H3O B;  3ZX3 A;  1H1V A;  4YDU C;  3D2E B;  3O8M A;  3ATU A;  3QIC A;  3UKU B;  3P4I A;  1BDG A;  4XEI A;  4BRC A;  5AQP A;  4O8K A;  3FZL A;  5KQD A;  3HI0 A;  4EFH A;  3KVG A;  3MN7 A;  3DAW A;  4QS8 A;  4XH4 A;  2A5X A;  2CH6 A;  1U6Z A;  1E4F T;  1NLV A;  1NM1 A;  1NMD A;  1ESV A;  3O5B A;  3U4L A;  3DWL A;  1NGH A;  3GBT A;  2ZGZ A;  5JIC A;  4I6M B;  2FF3 B;  1K8K A;  5AFU H;  2Q2R A;  1BG3 A;  3ZET B;  3I33 A;  2E88 A;  4NB4 A;  1SZ2 A;  5AQJ A;  3VF4 A;  5AQS A;  2A40 A;  2GEL A;  3M3Z A;  3VES A;  4ISF A;  3DXM A;  2E1Y A;  5EX5 A;  2ASM A;  1NGF A;  3EKU A;  5AQT A;  4CZM A;  4E1J A;  2D1K A;  5EOY A;  2FSK A;  4CBX A;  3R8E A;  3GDQ A;  3HTV A;  3GE1 A;  4HTL A;  3ZX0 A;  3L0Q A;  3VER A;  1DKG D;  3BF1 A;  4BC4 A;  2P9K A;  4BC2 A;  4EHU A;  1HLU A;  2BTF A;  5AZI A;  3HBT A;  1K8K B;  4H5N A;  2E2N A;  4C23 A;  4BRO A;  3CJ1 A;  2CGK A;  4H0O A;  3C7N A;  5AQM A;  2P9N A;  4DHY A;  1KAY A;  3DXM B;  5BRH A;  5AQG A;  1S22 A;  4FPB A;  5AQZ A;  3ZEU A;  3A8Y A;  4BC5 A;  1ZC6 A;  5AQW A;  3VPZ A;  1JCG A;  2QM1 A;  2YJE A;  1YUW A;  3IUC A;  3WEE A;  3L4I A;  3S41 A;  1V4S A;  1HPM A;  5F0X A;  3VET A;  3DJC A;  3CQX A;  3ATV A;  3VGK A;  2YCH A;  4J8F A;  5AQY A;  4CZG A;  4BVO A;  3R6M A;  4EAH D;  2YHX A;  2P9K B;  3OHR A;  1E4G T;  5AQV A;  2ASO A;  4RCH A;  5AZI B;  3O4W A;  2GWK A;  2YHW A;  5B8H A;  1KAZ A;  2GEM A;  4BRG A;  3BP8 A;  4JD2 A;  3C7N B;  3CIP A;  4BR4 A;  4BRD A;  2P9N B;  2P9I A;  3O08 A;  2W40 A;  4BGB A;  1DEJ A;  3FR0 A;  3U9Z A;  2ASP A;  3BEX A;  4BRL A;  3ZEU B;  4CD3 A;  3M1F A;  5BN9 A;  3UB5 A;  3WQT A;  4FPA A;  5AQQ A;  3HSC A;  2Q0U A;  2GWJ A;  3B8A X;  4BRA A;  4CZF A;  3FFK B;  3U8X A;  5ADX H;  2QW9 A;  4BRK A;  2HOE A;  1GLB G;  3A0I X;  3WEE B;  4GNI A;  4IZ9 A;  3SK3 A;  5AQN A;  3CER A;  2VYP A;  2YHY A;  3QFU A;  5JMV A;  4FWP A;  5AQK A;  4A2A A;  1NGB A;  1XUP O;  4H0T B;  2D0O A;  4JHD A;  3M6G A;  3JXU A;  1Y64 A;  4IWV A;  2QWL A;  4ISE A;  3VGM A;  4JD2 B;  4A61 A;  3CJB A;  4H0X B;  3GOI A;  3W0L A;  3AAP A;  1HKB A;  5JLF A;  4PKH A;  2P9S A;  3VEY A;  1QZ6 A;  3ZX2 A;  2P9P A;  2E2P A;  4CZI A;  4FWR A;  4H5R A;  3AAR A;  5KPT A;  4B1Z A;  2V51 B;  3SLC A;  4Y0W A;  1GLL O;  3WXI A;  2PBD A;  3MCP A;  4M7X A;  4AM7 A;  3LM2 A;  3ULE A;  1YXQ A;  3VEX A;  3A5L C;  3WXL A;  4B1V A;  3U9D A;  3BUZ B;  4JHD B;  3EO3 A;  4WQ4 C;  4BR0 A;  1CZA N;  1GLA G;  3IMX A;  2QWN A;  2NRH A;  4CBW A;  4BRQ A;  4FOI A;  5CE3 A;  2D4W A;  4BRM A;  1WUA A;  5ELZ A;  1YAG A;  2P9S B;  4PL7 A;  4LC9 B;  2P9P B;  4IXC A;  4O5F A;  3HM8 A;  5AQU A;  5AZJ A;  2FF6 A;  3H3N O;  1V4T A;  4IJN A;  4CJ7 A;  3ULE B;  3LDO A;  5BPM A;  1Q18 A;  2NLX A;  2VWB A;  3RSE A;  5FPM A;  2HF4 A;  3GG4 A;  4BRH A;  4CBU A;  5LJV A;  1NGA A;  4B1Y B;  5BRE A;  2DPN A;  2EWS A;  2V52 B;  2P9U A;  1XQS C;  1MA9 B;  3FE1 A;  1QZ5 A;  4H0Y B;  2FXU A;  4H0P A;  4B9Q A;  3WUH A;  1HJO A;  3IFR A;  2ZWH A;  2I7P A;  1BOT O;  2A41 A;  1IJJ A;  5AZJ B;  4BR2 A;  4BG8 A;  2QWP A;  2OAN A;  3WQU A;  4DQ8 A;  5E84 A;  3O1B A;  2GUP A;  4H5W A;  1NWK A;  1BO5 O;  1ZXO A;  4FSV A;  5KPR A;  3SJH A;  4BVP A;  2V7Z A;  1Z05 A;  1GLD G;  1QQM A;  3RSE B;  4M63 C;  4WYB A;  1NGE A;  4B1W B;  5EVZ A;  3AAQ A;  3A5M C;  3TPQ A;  2P9U B;  1T6C A;  4A62 A;  4IJA A;  3QBX A;  5BPL A;  3UKR A;  5FPN A;  2H3G X;  1ATR A;  4FWK A;  4JNE A;  1BUP A;  1NBW A;  3VF2 A;  5I9E B;  1BA1 A;  3FLC O;  3CET A;  5AQX A;  4RTF D;  5AQO A;  4BRP A;  1NGJ A;  5BN8 A;  4MO5 A;  4PKI A;  4BG9 A;  3ID8 A;  3A5N C;  2QWQ A;  2HF3 A;  3O6W A;  4CZJ A;  3GL1 A;  5AQL A;  2FLO A;  2Q97 A;  1X3N A;  2E8A A;  3DXK B;  4B1X B;  3LL3 A;  1D4X A;  3VEN A;  3BF3 A;  1GLC G;  3IDH A;  3LDP A;  4BRI A;  1MDU B;  4PKG A;  1HKG A;  3SMP A;  3KHY A;  4AM6 A;  3O80 A;  3QFP A;  2HMP A;  1YVN A;  2E2Q A;  1XC3 A;  1S3X A;  3FZM A;  3UKR B;  2WUS A;  2CGJ A;  4GY2 B;  3VF6 A;  2AP1 A;  2QWO A;  3QB0 A;  2E1Z A;  3MN5 A;  4XH5 A;  5AQI A;  1P8Z A;  2QWR A;  2Q31 A;  3MMV A;  3WT0 A;  2P9L B;  1LCU A;  2IVO A;  2IIR A;  2YI1 A;  4BRF A;  4FWS A;  1SQK A;  1GLE G;  4K41 A;  2E20 A;  1HX1 A;  1MWK A;  2QWM A;  4HWI A;  2QXL A;  3QDK A;  3EKS A;  4L3Q A;  5AQR A;  2I7N A;  2UYT A;  4PL8 A;  4F9O A;  3QBW A;  3EL2 A;  1RGI A;  3FZH A;  1TUU A;  5EY4 A;  3CQY A;  4EHT A;  3WXK A;  2IVP A;  3HZ6 A;  4FOE A;  1KXP A;  1NGI A;  3FZK A;  4H5T A;  4BQZ A;  1QQO A;  1SAZ A;  1TUY A;  3O1W A;  3UE5 A;  3H1V X;  4FWN A;  3VGL A;  5BPN A;  4CZL A;  4EIA A;  4KBO A;  1MWM A;  4FWQ A;  5FPE A;  3D2F A;  1T44 A;  5BRF A;  3H1Q A;  1C0F A;  2FSJ A;  3W3D A;  5E26 A;  1G99 A;  5BRD A;  2F9W A;  4JN4 A;  4H03 B;  2PAV A;  1EQY A;  3CJC A;  5JLH A;  3VEO A;  4CI6 A;  1GLJ O;  4IO8 A;  2BUP A;  3C0B A;  3VEZ A;  1GLF O;  3LDN A;  3CJ7 A;  2ZF5 O;  5FPD A;  1QHA A;  3H46 O;  4JAX A;  1OKJ A;  5AQH A;  2ITM A;  5BR9 A;  4M7Y A;  3JS6 A;  5ADX A;  1HUX A;  4CD1 A;  4K42 A;  3MK6 A;  4MLH A;  3FGU A;  1ATN A;  1Z6R A;  2ZGY A;  4FL9 A;  4BQL A;  3D2F B;  3VEW A;  2D0P A;  1X9J A;  2GTD A;  1BWF O;  1NGC A;  3L6Q A;  4CZK A;  5KQ8 A;  4A2B A;  3I8B A;  3MDQ A;  5EXW A;  4WQ5 A;  3CI5 A;  3DXK A;  2V7Y A;  1NGG A;  1DGK N;  1TYQ A;  2YJF A;  5AQF A;  4MLE A;  3EN9 A;  1QQN A;  2CGL A;  4BRE A;  3SMS A;  1JCE A;  2FSN A;  3ENH A;  1RDW X;  3LDL A;  3VOV A;  1HKC A;  4YDU A;  3CJA A;  1U2V A;  4NO7 A;  5TKY A;  3TU5 A;  4BC3 A;  5AR0 A;  3MN9 A;  4QS7 A;  1BA0 A;  3G25 A;  4BR9 A;  1R59 O;  4FWO A;  1ATS A;  4XH1 A;  2W41 A;  2A42 A;  4DB3 A; 
#chains in the Genus database with same CATH topology
 2A3Z A;  3QLH A;  4Z94 A;  4CF9 A;  5KPZ A;  2AA4 A;  3CHW A;  4CGD A;  3NGZ A;  4OLB A;  1AB4 A;  2JA5 A;  4OIR A;  4CFB A;  4FO0 A;  1KVB A;  3CYM A;  4FLZ A;  1GOB A;  2J4R A;  4O8U A;  2B63 A;  1HNX K;  2XY8 A;  1F7V A;  4A3C C;  3FZF A;  4C2M K;  4DCH A;  3SAG A;  2JGU A;  2O8B B;  1TWH C;  3UKU A;  4FWM A;  1QE1 A;  4B1U B;  3F2K A;  1RT5 A;  4CEB A;  2A6A A;  3NGY A;  1LWE A;  2NZT A;  3TAP A;  5L46 A;  3T7Z A;  4B9N A;  4EP4 A;  2HST A;  3WOD A;  2E2I C;  1EH1 A;  4FWL A;  1EXQ A;  1ZBH A;  4A3M C;  1NGD A;  1O24 A;  4BR5 A;  3TAQ A;  3J8A A;  4LSN A;  3CD6 N;  3O9R A;  3C65 A;  4OJR A;  4K25 A;  1PJ5 A;  3OS2 A;  5M5X K;  3DLB A;  1VK0 A;  4GKK K;  3WXM B;  4B08 A;  4Z4C A;  2UUB K;  3HST B;  1RFQ A;  1BGX T;  4YDU C;  5AJ3 K;  4CF8 A;  4E3S A;  3D2E B;  5J2M A;  3QEX A;  3S3M A;  2D0C A;  3OA9 A;  3FOE A;  3AA5 X;  4NYN A;  4M3X A;  3S1M C;  4DV2 K;  3E9P A;  3HI0 A;  5FLM K;  2CH6 A;  2JA5 C;  3Q3Q A;  3O5B A;  1NGH A;  4CW7 B;  4BLB A;  3BZC A;  3GTL A;  5LL6 Z;  3AO4 A;  1BG3 A;  3VQ6 A;  3ZET B;  3K7A C;  1SL1 A;  1W97 L;  5AQJ A;  1VQL N;  1D9F A;  1QTM A;  3AVH A;  3O4N A;  3PIO L;  3VF4 A;  5AQS A;  3QNN A;  3S15 C;  4Q5S A;  4KC6 A;  4GFQ A;  4GZY A;  5EX5 A;  4GW6 A;  1R9T K;  1NG9 A;  3ZSR A;  5AQT A;  1OVQ A;  4W5O A;  3K9K A;  2D1K A;  2R7Y A;  4FJJ A;  1KFS A;  1HYV A;  3GDQ A;  5IYC C;  3TTG A;  2CFA B;  4HTL A;  4DSK A;  3PLA A;  3VER A;  1TWF K;  4C3J K;  4BC2 A;  1T05 A;  1GE9 A;  5AZI A;  5I3U A;  4DR2 K;  4Y52 K;  1O1W A;  3AVN A;  4BRO A;  2CGK A;  3D6R A;  5HP1 A;  3CCL N;  4Q5V A;  3TAM A;  4FZZ A;  4Q4Z A;  2YKM A;  1RDC A;  4BAC A;  3HOY C;  1USO A;  4JI2 K;  3DXM B;  4JI5 K;  2QEX N;  1S22 A;  4BDY A;  1NU0 A;  4FJH A;  3AVK A;  4LLG A;  1J53 A;  3VQE A;  1ZC6 A;  5IYD C;  5GAE P;  1JCG A;  4DKW A;  1O29 A;  3IUC A;  2WC9 A;  4O0J A;  4JLH A;  1V5V A;  5F0X A;  3BY5 A;  4JKA A;  3PX0 A;  4M3Z A;  3HOZ K;  2YCH A;  3NH2 A;  4M3Y A;  5C4X K;  2YHX A;  2P9K B;  4CHQ A;  2HNZ A;  3G0Z A;  5IP7 K;  4KMH A;  3TTF A;  3AVF A;  4DV7 K;  4DR5 K;  4ZHR A;  2XO7 A;  3C7N B;  4CIF A;  3ISN C;  4X66 K;  5IT9 O;  4C3H C;  4O5B A;  4BRD A;  3NCI A;  2P9N B;  1WIH A;  4P9S A;  4BGB A;  4JKB A;  3UB5 A;  2Q0U A;  1FK9 A;  4E1M A;  4BRA A;  1TWA K;  5ADX H;  1IKV A;  3WNF A;  4LSL A;  1RIL A;  4GNI A;  5GAD P;  5CZ2 A;  3U3G A;  1J6V A;  3CER A;  2VYP A;  3QFU A;  5JMV A;  4B9L A;  1Q82 O;  2PPB A;  4NCB A;  2D0O A;  3KJV A;  4GKJ K;  4ISE A;  3VGM A;  3I55 N;  5GAH P;  1D5A A;  3OYJ A;  2GSO A;  1M1K O;  3JSM A;  5KI6 A;  4CJ4 A;  3LPU A;  3VEY A;  1QZ6 A;  1VGX A;  2P9P A;  2ZD1 A;  4CZI A;  1CXQ A;  3RMB A;  1B4B A;  1DCO A;  5GIN A;  3RMD A;  4DU4 A;  1GLL O;  4WFA L;  3GSI A;  1S9E A;  2PBD A;  4M7X A;  4HUF A;  3K2P A;  3ZT1 A;  4YNQ A;  1YXQ A;  1KVC A;  3WXL A;  1E3M A;  2YNG A;  3CQZ K;  3LZJ A;  1SFO A;  3EYZ A;  4Z0U A;  3SQ0 A;  3EO3 A;  3TAG A;  1WCM A;  3IMX A;  2QWN A;  3F73 A;  2NVY A;  4BRQ A;  5CE3 A;  2D4W A;  3TFI A;  3SV4 A;  3NUH A;  1RT4 A;  4PL7 A;  3MWP A;  2VGN A;  2D0B A;  1BIU A;  1IH7 A;  4E7K A;  1FW6 A;  2PHC B;  4A3C K;  1WSH A;  2FF6 A;  2HBJ A;  1XZP B;  3M8Q A;  1F93 A;  2HB5 A;  4CJ7 A;  4O2D A;  5HRN A;  3KLH A;  4DLE A;  3FKI A;  4DQP A;  1TWH K;  2X6N A;  1Q18 A;  1IV0 A;  2VWB A;  3L4J A;  3B6O A;  2FC0 A;  3RSE A;  5FPM A;  1WAF A;  2JA8 C;  2VQF K;  5BRE A;  4CJV A;  1KQ4 A;  2P9U A;  3L2W A;  2E2I K;  1XQS C;  4FM1 A;  1SUQ A;  3D0P A;  3FE1 A;  4A3M K;  3CC7 N;  2NRV A;  4IDK A;  1HJO A;  4A3B C;  2UUA K;  1WSF A;  4OKE A;  4TSX A;  1W9H A;  2I7P A;  1W7A A;  1N32 K;  1BOT O;  4CFC A;  1IJJ A;  5AZJ B;  3WNH A;  4BR2 A;  2QWP A;  4DQ8 A;  3WQU A;  1FXX A;  2IGI A;  5E84 A;  4HCB A;  2E6M A;  3WNG A;  4FSV A;  1SFO C;  1J6W A;  1S1T A;  5M1K A;  3S1M K;  1JLG A;  1QQM A;  4PUO A;  4AHV A;  3NFA A;  3CPE A;  4O55 A;  2BGG A;  1WCM C;  4RW4 A;  3P31 A;  3A5M C;  3KLI A;  4OO1 J;  2JH3 A;  4B8A B;  4A62 A;  4IJA A;  2FBX A;  1ATR A;  2RH6 A;  1S6Q A;  3VF2 A;  5I9E B;  3K7A K;  5IOT A;  5M1Q A;  5BN8 A;  4DUY K;  4BG9 A;  3CCQ N;  1LW2 A;  3QIP A;  3S15 K;  5TJ3 A;  3FKI C;  2UXD K;  3B6P A;  5AQL A;  3ZSW A;  1BJT A;  3F9K A;  4E0D A;  1GLC G;  2JA6 A;  1S72 N;  1XMQ K;  3LDP A;  4K8X A;  1MDU B;  1RBU A;  2NRX A;  1ZQ1 C;  5IYC K;  3O3F A;  3KD5 E;  2WBN A;  3TSQ A;  4F2R A;  1S3X A;  3FZM A;  4OGC A;  2O8C B;  4F4K A;  2X78 A;  3J7Z O;  2WUS A;  2CGJ A;  1IO2 A;  4N41 A;  2IS3 A;  1YTU A;  4GV9 A;  4BY1 C;  1VSL A;  3SUO A;  3KLG A;  2QWO A;  3H08 A;  3QB0 A;  1NKB A;  4XH5 A;  4YFK A;  2Y0S D;  5DMR A;  4HUG A;  1SMY A;  1P8Z A;  4HCC A;  3AO3 A;  1RDB A;  3OBY A;  3L2Q A;  1WAJ A;  1OH6 A;  4E7J A;  4KB0 A;  4KV8 A;  2YI1 A;  4BRF A;  3LAL A;  1XNQ K;  5IYD K;  4A3L C;  1VQM N;  1MWK A;  1TKZ A;  4HWI A;  2QXL A;  1UA0 A;  3ADA C;  1TWG A;  2UXC K;  2I7N A;  4F9O A;  4PL8 A;  4KTQ A;  2R7Z K;  1XZQ A;  1RGI A;  1L3U A;  3CFO A;  1ZYR A;  1RTD A;  3OS0 A;  3DRS A;  1WSE A;  2EBB A;  3HZ6 A;  1IBK K;  1KXP A;  2XHB A;  4H5T A;  1LWC A;  1QQO A;  3THW A;  5EGE A;  4Z4E A;  1TUY A;  3O1W A;  3QNO A;  1HR0 K;  2O8E A;  4C3H K;  3LAP A;  3M8R A;  3M8P A;  4JYA K;  3VGL A;  4DTX A;  1MWM A;  3N4P A;  4FWQ A;  3LP1 A;  3AQO A;  4FZB A;  1ZBU A;  4A3D C;  2R92 A;  2RPI A;  3VQC A;  2JA6 C;  2NVQ K;  5SWM A;  1Q7Y O;  5C44 C;  4Y1C A;  2DFH A;  2PAV A;  3CJC A;  5M5W K;  3MX2 A;  1GLF O;  5FLX O;  1G51 A;  1FKO A;  2DFE A;  5SZT A;  4YOW A;  1RT6 A;  1KLM A;  3I0R A;  3OYN A;  3AD7 C;  5AQH A;  3QER A;  4KH6 A;  3FHZ A;  4CF1 A;  3THX A;  2FQT A;  4N76 A;  3DLE A;  5ADX A;  4DR7 K;  2FBT A;  1HUX A;  4FJG A;  2W6K A;  4K42 A;  3FGU A;  4JV5 K;  3D2F B;  1WBB A;  3CCM N;  4PAA A;  4GT9 A;  1BWF O;  4BE0 A;  4CZK A;  4C45 A;  3KIO A;  1L0W A;  1N5Y A;  3I8B A;  1NOY A;  3MDQ A;  4JS5 A;  1U04 A;  4PQU A;  2GUI A;  1TAQ A;  1NGG A;  3CAG A;  2HHW A;  4WCE L;  4MLE A;  2QI2 A;  4XIU A;  4KHQ A;  3NH0 A;  1S6P A;  3AVI A;  4CJU A;  2O8C A;  5C15 A;  4H8K A;  3I56 N;  1QQC A;  4LFB K;  5J1E A;  1QVF M;  4DTN A;  1EFW A;  1EWR A;  4QS7 A;  2JWL A;  2ETJ A;  1HQE A;  1HNV A;  5BR8 K;  2R92 C;  3VQ8 A;  3AVA A;  2PYL A;  3EZW A;  1ZBF A;  3NF6 A;  3GTQ A;  4FK0 A;  1X3M A;  3F9M A;  2O8F A;  1J6Z A;  2VQE K;  1BU6 O;  2DY4 A;  1RT3 A;  1C0G A;  1TWC A;  1TYQ B;  4CEA A;  4DSJ A;  1LOT B;  2PMZ L;  1YF5 L;  4CGF A;  4E89 A;  4BGA A;  5AFU A;  1NJY A;  4CZH A;  3K5M A;  5CY4 A;  2HHS A;  1K83 C;  1KAX A;  4RW6 A;  1EP4 A;  2CH5 A;  3ENO A;  4B9S A;  2JA8 K;  1C1A A;  5IWA K;  3A5O C;  4LF5 K;  2VCP A;  4CZE A;  3OPF A;  2HND A;  5CJ9 A;  4CGG A;  1T03 A;  3AA2 A;  1PJ7 A;  4A3B K;  3HOT A;  3DYA A;  3KZB A;  3VEV A;  3IRX A;  1N34 K;  1I50 A;  1J9A A;  5CHI A;  5LY3 A;  4CF0 A;  1VQO N;  3TSU A;  2BE5 A;  4FJM A;  4RWT A;  3QML A;  4C3I C;  1IKY A;  4QOZ B;  2IVN A;  4CK1 A;  4I6M A;  1SFO K;  4DWI A;  3SAH A;  2W7V A;  4B3O A;  2P9I B;  2XCO A;  3HVT A;  3DOK A;  3T02 A;  4OPJ A;  4IEI A;  1K8A O;  2F4V K;  4RMF A;  4BE2 A;  3ATU A;  1DTT A;  1ASW A;  3UKU B;  2NRZ A;  3P4I A;  3OS1 A;  1HRH A;  1VQ8 N;  4O8K A;  5KQD A;  3AGK A;  1S1W A;  4AH6 A;  3MN7 A;  1HMV A;  3GTQ C;  2HW3 A;  4BDZ A;  1QSL A;  1E4F T;  4FLY A;  1NLV A;  4FJI A;  2QK9 A;  3CC2 N;  1ESV A;  1TWC C;  4I2Q A;  3U4L A;  3FKI K;  1EET A;  2ZGZ A;  2E6L A;  3K5N A;  3PSF A;  4C8N A;  2UUC K;  1K8K A;  1XHZ A;  1O27 A;  5FJ8 K;  2E88 A;  4NB4 A;  3K5L A;  1RTH A;  3GTG K;  3OJS A;  4B9T A;  2A40 A;  4JKE A;  1RDU A;  3QEW A;  4KHN A;  4LQY A;  4ISF A;  1HNZ K;  4MEX A;  2OPQ A;  3G4S N;  3O9S A;  2ZFZ A;  5M5Y K;  3EKU A;  4KAR A;  4DTR A;  5EOY A;  3R8E A;  1J98 A;  4ILD A;  4BY1 K;  3HTV A;  4GTA A;  1ASV A;  3T00 A;  1J5E K;  3CCU N;  4ELU A;  2YU9 A;  3ZX0 A;  2BAN A;  3L0Q A;  2XY6 A;  1ZVU A;  3DLG A;  4DS5 A;  1DKG D;  3E9O A;  2OCE A;  4GV6 A;  4GTE A;  4A3K C;  1YNJ A;  4FXD A;  1HLU A;  2P5G A;  2ZJR L;  4E1N A;  4A5A A;  4A3L K;  1BL3 A;  3CJ1 A;  4OVL A;  3KK3 A;  4DLG A;  2G8H A;  3AA4 A;  3KLF A;  4U67 L;  1KAY A;  4G0V A;  4A5B A;  4J2D A;  2Z1H A;  4KMA A;  1WSG A;  4FPB A;  3ZEU A;  5KRS A;  5GIO A;  4B3R K;  4G1Q A;  3VPZ A;  5AQW A;  5CZ1 A;  4E19 A;  2QM1 A;  1YUW A;  4H4O A;  3DOL A;  4F3O A;  5IOQ A;  1LWF A;  3L4I A;  3S41 A;  1HPM A;  1CXU A;  3K0S A;  1U48 A;  1VQ5 N;  3CQX A;  3OW2 M;  1RCH A;  4J8F A;  4MQ3 A;  3R6M A;  3MEG A;  4HHT A;  1IG9 A;  2BE2 A;  5AZI B;  1EK8 A;  4A3D K;  4KB4 A;  3M4O C;  2GEM A;  2JA6 K;  3KK7 A;  3NMU A;  5C44 K;  4CFA A;  4JD2 A;  4CGI A;  4FVU A;  2P9I A;  3BP3 A;  3FR0 A;  5JVO A;  4CD3 A;  3RZD C;  1O2B A;  3WQT A;  2P5M A;  3S1N C;  2GWJ A;  2NRW A;  3I8D A;  2KQ2 A;  4CZF A;  1ZYQ A;  3FFK B;  2F8S A;  3H0G A;  2QW9 A;  2HOE A;  1I3Q A;  1KVA A;  1EQR A;  1NNE A;  3SK3 A;  5AQN A;  3RWU A;  4KPY A;  4O0I A;  1XHX A;  5AQK A;  4H0T B;  4JHD A;  1P90 A;  4CGH A;  2BH1 A;  4A61 A;  4H0X B;  4CIG A;  3W0L A;  4ELT A;  1HI9 A;  2RN2 A;  4AF1 A;  3S3O A;  1HKB A;  2HHH K;  1WSI A;  2E4L A;  4PHT X;  4LF9 K;  2NVT C;  3S0X A;  4BY7 C;  5KPT A;  3P1G A;  2V51 B;  4OX9 K;  2PMZ D;  3SLC A;  2B4J A;  1W2B M;  3MCP A;  4YG2 A;  3LM2 A;  3ULE A;  2WB1 L;  2EHG A;  3GTK A;  2FBY A;  3A5L C;  3VEX A;  2KW4 A;  1HNI A;  3KKS A;  4DR6 K;  4CE9 A;  5JS1 A;  2HBK A;  2R92 K;  2YHB A;  5H1S Q;  4DTO A;  3HYF A;  4KMD A;  4OLA A;  2NRH A;  4FJ9 A;  1YX2 A;  2B5J A;  3V1Q A;  5E68 A;  2B63 C;  3PV8 A;  1VSH A;  4BRM A;  3CXC M;  3PIP L;  1TK8 A;  2KZZ A;  1K83 K;  2P9P B;  3JYT A;  3T1Y K;  3CME N;  3GEH A;  3ZSQ A;  3GDZ A;  1WOP A;  4XLP A;  1LW0 A;  5C4J C;  3H3N O;  4RW8 A;  1S1X A;  4ILH A;  1I6H K;  3IAY A;  3T3F A;  5BPM A;  4E7I A;  2NLX A;  4OIP A;  4G0U A;  1VJE A;  3HPG A;  4JKC A;  2GAH C;  2HBM A;  4NOI A;  3GG4 A;  3OYL A;  5TMC A;  3MX5 A;  3NGI A;  3FOF A;  2DPN A;  2EWS A;  2NRT A;  4CJQ A;  1VQ4 N;  3LP0 A;  1QZ5 A;  4H0Y B;  2FXU A;  1VSJ A;  1WLJ A;  4C3I K;  2P5O A;  3P83 D;  4IFV A;  2A1R A;  3IFR A;  2ZUF A;  1XWL A;  2IOC A;  4CJ5 A;  5A2Q O;  4CJW A;  2ZWH A;  1TGO A;  1VAZ A;  3RMA A;  4BG8 A;  1Q81 O;  4H5W A;  4IEE A;  3GTK C;  1ZXO A;  3KKR A;  2UU9 K;  5TMF A;  3SZY A;  4KI4 A;  3OBW A;  2YNF A;  4BVP A;  2V7Z A;  1GLD G;  3RSE B;  1S1U A;  4I7F A;  4B1W B;  1RBV A;  2QA4 N;  2QKK A;  4OIN A;  3AAQ A;  2O5J A;  3GTQ K;  1XXB A;  2P9U B;  1L5U A;  3V4G A;  3GTL C;  1JQW A;  1TWC K;  3PO2 C;  3S2D C;  2H3G X;  4JNE A;  1NBW A;  1TAU A;  1NMN A;  3LAJ A;  1IS1 A;  3S17 C;  3CET A;  4Y1D A;  4JRQ A;  4I9Q A;  5AQO A;  1EKE A;  4MO5 A;  3VQ5 A;  2HF3 A;  3AVL A;  1O26 A;  4CZJ A;  1NK9 A;  2VUM A;  5C42 A;  3CCR N;  1X3N A;  4ICL A;  4M42 A;  3DXK B;  4KO0 A;  1D4X A;  1JL2 A;  4KB2 A;  4BBR C;  3AGR A;  3BF3 A;  3O3G A;  4DTM A;  4JKG A;  4NCG A;  4DQS A;  3CM6 A;  4PKG A;  3L4Q A;  4AM6 A;  4JK8 A;  4AHC A;  1O13 A;  2WTU A;  1HQM A;  2GBZ A;  1YVN A;  2E2Q A;  1VRQ C;  1XC3 A;  4YFX A;  1WN7 A;  2VG5 A;  4QIW L;  4G0W A;  4K0K K;  3LPT A;  3TAB A;  4JK9 A;  4G7O A;  4A3K K;  1N33 K;  3TAN A;  1BCM A;  1EWQ A;  1ILY A;  3TTD A;  4GY2 B;  1BHL A;  2AP1 A;  3MEC A;  3CFR A;  3PO5 A;  3U6F A;  4KAZ A;  3S3N A;  2E1Z A;  3VQQ A;  1JLE A;  4DV4 K;  4KM9 A;  4BWM A;  4DF4 A;  1B92 A;  1KD1 O;  3HOX K;  1XI1 A;  3MMV A;  3WT0 A;  3V4I A;  4BE1 A;  1LCU A;  1U47 A;  1N8R O;  4CJT A;  3HP6 A;  3BGR A;  1QVG M;  4X6A C;  2IIR A;  1IL2 A;  4FWS A;  4Q0B A;  1TL3 A;  1GLE G;  4K41 A;  4XSX A;  3HOU C;  1HX1 A;  1QSY A;  1Y1W A;  3EKS A;  4L3Q A;  4B3S K;  2G8V A;  5T7B A;  3QBW A;  3QIO A;  4JI7 K;  5EY4 A;  4GTD A;  4CJS A;  4PAB A;  1XXC A;  3T69 A;  3M4O K;  3FZK A;  1I39 A;  1SAZ A;  3G10 A;  3LAM A;  3UE5 A;  2Y3P A;  3OYD A;  5BPN A;  1JLB A;  4I9L A;  1NK8 A;  4ZTF A;  2F96 A;  2IDO A;  5J2P A;  1T44 A;  2NRR A;  2HHQ A;  1OH7 A;  3RZD K;  4FCY A;  3P38 A;  1REV A;  4LH5 A;  1C0A A;  1C0T A;  3SUQ A;  3H3V L;  1A5X A;  2F9W A;  3TSP A;  2OPS A;  4H03 B;  3TI0 A;  3VEO A;  1ITG A;  4CI6 A;  4DR4 K;  4KI6 A;  2BUP A;  2OPR A;  4BBS C;  1KC8 O;  3VTI A;  1XZQ B;  3LDN A;  1SL2 A;  3LAN A;  3CJ7 A;  3MED A;  3VQD A;  5FPD A;  1X9W A;  4LFA K;  1QHA A;  2ITM A;  4DTP A;  3TAR A;  1F21 A;  1K6Y A;  2QKB A;  3EEQ A;  4KRF A;  3THW B;  4M7Y A;  4O44 A;  2O8E B;  4CD1 A;  4DU3 A;  4FZX C;  3MK6 A;  4MLH A;  4FL9 A;  1Z6R A;  2ZGY A;  4G7Z A;  4U7B A;  2D0P A;  2NVT K;  1X9J A;  1BCO A;  3GTO A;  4P5A A;  2GTD A;  5IYB C;  4AHT A;  4BY7 K;  5KQ8 A;  3RMC A;  3U3Y A;  1WQH A;  3L4K A;  4WQ5 A;  3CI5 A;  3DXK A;  1FKP A;  3SQ4 A;  2V7Y A;  1RNH A;  5C24 A;  4YOT A;  3MAQ A;  3DXJ A;  3EN9 A;  3Q7B A;  4J3N A;  4Z4G A;  4B9M A;  2YV0 X;  3SMS A;  3LDL A;  2NVY C;  2E5L K;  3G4A A;  2JA5 K;  3THX B;  2E2H A;  4AYB L;  3GTM A;  3TAE A;  4B9U A;  1U2V A;  4NO7 A;  2B63 K;  3ERE D;  3TU5 A;  4BC3 A;  3MN9 A;  3S9H A;  3G25 A;  1ATS A;  1YIT N;  1TKX A;  2P51 A;  4XH1 A;  2XY7 A;  2A42 A;  1IE0 A;  3I0S A;  4AHS A;  4ISG A;  5C4J K;  5MLC Q;  2E2O A;  5LJW A;  1K9M O;  3SI6 A;  4WQ4 A;  2NVX A;  2V6T A;  3D7E O;  1QSS A;  4MQ9 A;  4N47 A;  3NH1 A;  2F9T A;  4MO4 A;  4L8R B;  3SJJ A;  5KGW A;  4LF7 K;  3BUE A;  4C8K A;  2Q0R A;  4YOV A;  4B8C A;  4BRN A;  3SZZ A;  5F2R A;  3N4Q A;  3LZI A;  1HYS A;  5F1X A;  5M1F A;  3THY A;  1I94 K;  4KHS A;  2WAQ L;  4KAW X;  1C1C A;  2W42 A;  4DQI A;  4KN4 A;  2VWK A;  3OYM A;  2P8T A;  3CJ9 A;  1YT3 A;  4QS9 A;  3HOY K;  3NDK A;  4FJN A;  1WOR A;  4WQ5 C;  2KHO A;  4YY3 K;  4O4G A;  2Q1N A;  4LD0 A;  2O8F B;  1HJR A;  3FFI A;  3QEI A;  4H0V B;  3NF7 A;  1JCF A;  4PY5 A;  1IG8 A;  4I2P A;  4C1N K;  3LDQ A;  5FRN A;  3OVN A;  4K43 A;  4NLC A;  3H3O B;  1H1V A;  1RDD A;  3GTM C;  5D4D A;  3I4M C;  3GTL K;  3QIC A;  5JVH L;  3PO2 K;  3S2D K;  4GTF A;  4XEI A;  4FZY A;  2PA8 L;  4QIW D;  3J7Y P;  4KHP K;  3S17 K;  4YHH K;  3KVG A;  3VQA A;  4G9Z A;  3RTV A;  1JLC A;  1Q8I A;  2RKI A;  4QS8 A;  2ZUE A;  1U6Z A;  2Z1J A;  1NM1 A;  1NMD A;  2NVX C;  1UAX A;  3LDS A;  3GBT A;  5C12 A;  3HK2 A;  3C6T A;  1U45 A;  4WFN L;  5JIC A;  4I6M B;  4FM0 A;  4BBR K;  3N0B A;  2Q2R A;  3BDP A;  3I33 A;  1ZBI A;  3GTJ A;  2AJQ A;  3DI6 A;  4CHP A;  3ENB A;  4DTJ A;  4DG1 A;  1TKD A;  2E1Y A;  3E01 A;  2Y1J A;  3L3V A;  3ZSO A;  3V1R A;  4E1J A;  4DSF A;  4CBX A;  1VRU A;  2O8D A;  1WOO A;  3RVC A;  3RRG A;  2VWJ A;  3BF1 A;  3TWH A;  4GVM A;  4BC4 A;  4C2M C;  5HL8 A;  1IW7 A;  3KWG A;  5FRM A;  3LWM A;  1TWG C;  4X6A K;  1X1P A;  1K8K B;  4LK0 A;  4H5N A;  2E2N A;  2XCR B;  1I3A A;  3HOU K;  1JKH A;  1R9T A;  1NJI O;  4WE1 A;  4ID5 A;  1L3S A;  3OEP A;  1RDA A;  4DHY A;  2HHU A;  3H3V D;  4WJ3 M;  5AQG A;  5AQZ A;  3A8Y A;  5C10 A;  3CF5 L;  1IBA A;  3DLH A;  1TWF A;  3OYK A;  1B9D A;  1K73 O;  5DM7 L;  3WEE A;  4NXM K;  1BGW A;  5HOO A;  1V4S A;  1USM A;  3HM9 A;  3VET A;  3DJC A;  2JLE A;  3MML B;  4FLV A;  3ATV A;  4CHY A;  3A2F A;  4WIL A;  5AQY A;  1VSK A;  4BVO A;  5JS2 A;  3NAE A;  3OHR A;  3CCV N;  1E4G T;  5AQV A;  2ASO A;  1CZB A;  4CF2 A;  4RCH A;  5C3E C;  2YHW A;  4M45 A;  3ZYY X;  1RTI A;  2HHV A;  3GTJ C;  4WF9 L;  5D3G A;  2JA7 A;  1Q9X A;  2KLA A;  5HRR A;  4BBS K;  3O08 A;  2W40 A;  3U9Z A;  3VQ9 A;  1VQ6 N;  2ASP A;  3BEX A;  4BRL A;  3ZEU B;  3M1F A;  4W5T A;  3HSC A;  3ORE A;  4FJ8 A;  4J2E A;  4XSZ A;  3NE6 A;  3U8X A;  4CJE A;  4GTB A;  4BRK A;  3O9T A;  3SYZ A;  1B9F A;  1GLB G;  1DT9 A;  3OYB A;  2ZJQ L;  2YHY A;  2KWA A;  4FLX A;  4KHW A;  5HRP A;  4IO9 L;  1Y64 A;  4IWV A;  4DTU A;  4WFB L;  4JD2 B;  2KFN A;  5HRS A;  1TWA A;  3AAP A;  3GTP A;  5JLF A;  4PKH A;  2P9S A;  1HQU A;  2PZS A;  3ZX2 A;  4KRE A;  1WCM K;  2HHX A;  2G8F A;  3AA3 A;  2NVY K;  3AAR A;  4IFY A;  3EE9 A;  4B1Z A;  4Z4H A;  3EZ5 A;  1VLO A;  4XLN A;  2Y1I A;  4R5P A;  4Y0W A;  4C3J C;  5E41 A;  1W0H A;  2YKN A;  4CER A;  3J80 O;  4QAG A;  4Y52 C;  3QIN A;  3OYE A;  4DSE A;  1BQN A;  4KB1 A;  3PO3 C;  5JVG L;  3SAF A;  3RRH A;  1S1V A;  5C0Y A;  4IOX A;  4JHD B;  2WAQ D;  4BR0 A;  2JA7 C;  4FLU A;  1VQ9 N;  2G8K A;  4CBW A;  4LY7 A;  4BLA A;  4FOI A;  1HYZ A;  2ZE2 A;  1D8Y A;  1VQK N;  3VQP A;  1TV6 A;  4EZ6 A;  5I42 A;  2KFZ A;  4LC9 B;  4IXC A;  4CEO A;  1INN A;  3HM8 A;  4QJV A;  4JKD A;  4KKO A;  5AQU A;  3LP2 A;  4W5Q A;  3CQZ A;  4DS4 A;  3S14 C;  2A69 A;  4HVJ A;  4IJN A;  3ULE B;  3HPH A;  4A93 C;  3SBT A;  5DM6 L;  3ZT0 A;  1I50 C;  2UXB K;  2HF4 A;  1TKT A;  1O2A A;  5FDL A;  3K9J A;  4AIL C;  1TWA C;  4A3E C;  3GTP C;  2DTU A;  4B9Q A;  4H0P A;  3WUH A;  2ITG A;  3TAF A;  3JST A;  5M3F K;  4ILJ A;  3CFP A;  3MEE A;  4CEF A;  1X9S A;  1TWH A;  3QEP A;  1SKS A;  3THV A;  2A41 A;  3S2H C;  1LV5 A;  3O1B A;  2GUP A;  3K5O A;  3SNN A;  3GTM K;  1BO5 O;  3I4M K;  3D45 A;  3SJH A;  3LPX A;  2E2I A;  3AVJ A;  4A3I C;  4DMN A;  1Z05 A;  4OPA A;  2GSU A;  4DUZ K;  4M63 C;  5M1P A;  1NGE A;  4LF4 K;  2GAG C;  3HOV C;  4OPK A;  1OH8 A;  3TPQ A;  1G15 A;  2OPP A;  5KGX A;  1Y97 A;  1T6C A;  1VSD A;  5BPL A;  3UKR A;  4CFD A;  1VQP N;  4FWK A;  4QCL A;  1BUP A;  4OKK A;  3CC4 N;  2E2J C;  3WNE A;  5LMN K;  3R3L A;  4CED A;  2NUB A;  1XXA A;  3AVG A;  3CQZ C;  3DLR A;  4B9V A;  1HNW K;  3AVM A;  1WBD A;  4DR3 K;  4PKI A;  3GEI A;  2QWQ A;  3O6W A;  4A3J C;  1JL1 A;  3VTH A;  2Q97 A;  5C2D A;  3N3Y A;  1O25 A;  3SUN A;  2NNW A;  2YU9 C;  1A5V A;  1BIZ A;  3I4N C;  4EZ9 A;  3IDH A;  4JK1 A;  4BRI A;  4FJ5 A;  3V9Z A;  1KQS M;  3SV3 A;  4JKF A;  1UV7 A;  2PFU A;  3O80 A;  1NJZ A;  3QFP A;  3SCX A;  4KMU A;  4KN7 A;  1Z26 A;  4CJF A;  1YTA A;  1EX4 A;  1T8E A;  4OGE A;  3HL8 A;  1KTQ A;  2P1J A;  1N6Q A;  5CR4 A;  2Q3S A;  1TWG K;  5CYM A;  3ID6 A;  3VF6 A;  4JI4 K;  1WNS A;  3S16 C;  2F7T A;  5AQI A;  2PYJ A;  2QWR A;  4LK1 A;  1NOZ A;  2Q31 A;  3PUF A;  1ISE A;  2P9L B;  3RZO C;  1YVU A;  3ZT3 A;  2IVO A;  4FJK A;  4ZTJ A;  1SQK A;  1YHQ N;  4JKG B;  5M1N A;  4A3G C;  1KCF A;  2QTD A;  5AQR A;  1J54 A;  1UOC A;  1DTQ A;  4OIO A;  2VGM A;  4DFM A;  3NVM A;  4RW9 A;  3FZH A;  1TUU A;  2O4I A;  4CCH A;  3KK1 A;  2PY5 A;  2ZM6 K;  5J2Q A;  4EHT A;  3WXK A;  1NK6 A;  1BS2 A;  5C3E K;  1BDF A;  1NGI A;  3CCE N;  3CCS N;  3GTJ K;  4H4M A;  3TTC A;  5GIP A;  3SQ1 A;  3H1V X;  1VQ7 N;  2B6A A;  1NK4 A;  4NCA A;  4FJX A;  4FWN A;  4CZL A;  5FPE A;  3HPO A;  3H0G C;  1RBS A;  3DRP A;  4F2S A;  1I3Q C;  2FBV A;  4M1X A;  2R7Z A;  5BRF A;  3QET A;  3H1Q A;  4R79 A;  3EQL A;  3P5J A;  3W3D A;  5BRD A;  1F9N A;  4UY8 O;  1BQM A;  1EQY A;  3AD9 C;  4CK2 A;  4YFN A;  5JLH A;  2G8U A;  4IO8 A;  4JRP A;  1YCL A;  1CLQ A;  2CW0 A;  1VSI A;  1SKR A;  3ZCM A;  3H46 O;  4JAX A;  1OKJ A;  4YFU A;  1EI6 A;  1SL0 A;  4DQQ A;  3ZLJ A;  2R93 A;  4IKF A;  4LH4 A;  1J5O A;  4FM9 A;  4CHO A;  1JOE A;  4CVN E;  4B3T K;  3TFH A;  4DFP A;  4M3W A;  3V9S A;  1BI4 A;  3OJU A;  3L8B A;  3PSI A;  3VA7 A;  3HOW C;  1ATN A;  1VH2 A;  3N0C A;  1VHX A;  3VEW A;  1NJW A;  1EO1 A;  4P5B A;  2V6U A;  3QO9 A;  3L6Q A;  1NGC A;  3VQ7 A;  4CJ3 A;  1JXB A;  4A2B A;  3AD8 C;  4KH5 A;  3KK2 A;  5EXW A;  1C1B A;  1DCH A;  3HP9 A;  2HVH A;  4C8L A;  2YHA A;  2YJF A;  3G71 N;  3PO3 K;  5EU7 A;  3AV9 A;  4GVE A;  2CGL A;  4BRE A;  1JCE A;  2FSN A;  3ENH A;  4JI1 K;  3DMJ A;  2GX9 A;  1D9D A;  2YNH A;  5CYQ A;  2OZS A;  4KHU A;  3HKZ L;  2JA7 K;  1JVI A;  2HNY A;  3ZSY A;  4RW7 A;  1YJW N;  3AQP A;  3CJA A;  3DLK A;  4CEE A;  3V9U A;  4V19 S;  2O8B A;  3JAM O;  3K57 A;  5AR0 A;  1BA0 A;  1R59 O;  4FWO A;  4UQG A;  2R7Z C;  1JLQ A;  2YX6 A;  4DB3 A;  4DV6 K;  4IDH A;  2P9L A;  4EP5 A;  1KSP A;  3S14 K;  3L3U A;  2RHK A;  3AY9 A;  3R9P A;  4KHY A;  3H6E A;  4G7H A;  5J2N A;  2Y0S L;  3V9W A;  4A93 K;  4YOU A;  1VSE A;  3CM5 A;  3H45 C;  4F8R A;  4FJ7 A;  1I50 K;  2HVI A;  3V81 A;  2R93 C;  4CK3 A;  3GIR A;  3LM9 A;  3D2E A;  1OH5 A;  4H5V A;  2D0A A;  2NVQ C;  3MN6 A;  4A3E K;  1U2V B;  4KDD A;  1RBT A;  3AO5 A;  3GTP K;  2RF2 A;  1C6V A;  1KLN A;  4E7H A;  1WOQ A;  1ZBS A;  3AO2 A;  4HUE A;  3S2H K;  1OVY A;  4KTZ A;  3HXM A;  4BR7 A;  1TL1 A;  1YIJ N;  3AH5 A;  4A3I K;  2Q36 A;  1T6D A;  3ZET A;  3WXJ A;  3NF8 A;  3Q7C A;  1WQF A;  3HOV K;  3ZX3 A;  1KFD A;  2VG7 A;  3DRR A;  1LAW A;  3O8M A;  3PX4 A;  2A1S A;  3THY B;  1GOA A;  1BDG A;  4LR2 A;  4YOX A;  4BRC A;  4W5R A;  1TK5 A;  2E2J K;  1RT7 A;  5AQP A;  3FZL A;  4GTL A;  4DFJ A;  4EFH A;  3MXM A;  2VG6 A;  3HRG A;  2VUM C;  3DAW A;  3S1Q C;  4XH4 A;  2A5X A;  4JI6 K;  3V9X A;  1RU0 A;  2CFA A;  3S1N K;  1XC9 A;  4WJ4 A;  5HRO A;  3DWL A;  3P39 A;  4JS4 A;  4A3J K;  1Y1V A;  5GAG P;  3GEE A;  4X62 K;  1WOS A;  2FF3 B;  5AFU H;  1X9M A;  5HLF A;  2YU9 K;  3I4N K;  1SZ2 A;  4KFB A;  5HL7 L;  4CIE A;  4BWJ A;  2WB1 D;  2GEL A;  3M3Z A;  3R1X A;  3C95 A;  3VES A;  3DXM A;  1CZ9 A;  4DF8 A;  2ASM A;  3S1R C;  1NGF A;  4LF8 K;  3ALY A;  3M8S A;  4W5N A;  3V1O A;  4CZM A;  1UA1 A;  1IBM K;  4AHR A;  2FSK A;  3KWI A;  2F8T A;  3GE1 A;  3S16 K;  1KRP A;  1NKE A;  1JJ2 M;  4CJP A;  1Y1W C;  3RZO K;  2P9K A;  4MEY A;  4EHU A;  3GTG A;  4C8O A;  4FK2 A;  2BTF A;  4DSI A;  3AVC A;  3HBT A;  3LP3 A;  4C23 A;  1WB9 A;  4PWD A;  4A3G K;  1C0M A;  4H0O A;  4MDB A;  4ELV A;  3C7N A;  4Y7N C;  5AQM A;  4J2B A;  2Z1G A;  2P9N A;  1VRT A;  3IG1 A;  4ZH4 A;  3ZSV A;  5BRH A;  4AHU A;  4BC5 A;  4BXX C;  1JLF A;  3LWL A;  3J7A P;  3L2R A;  4HTU A;  2YJE A;  2HBL A;  3M5R A;  3T19 A;  4YOY A;  3CCJ N;  2O8D B;  2EX3 A;  1MU2 A;  4OIQ A;  2D5R A;  2QXF A;  3C6H A;  4DDQ A;  4YOR A;  3VGK A;  1IKX A;  3H0G K;  4CZG A;  3V6D A;  4EAH D;  3VQ4 A;  1I3Q K;  4AH9 A;  1Y1V C;  1QS4 A;  3DLL L;  4Z4I A;  4A3F C;  5M3M K;  3O4W A;  2GWK A;  5B8H A;  1PJ6 A;  1KAZ A;  4JI3 K;  4BRG A;  3KLE A;  3BP8 A;  1X31 C;  3MXI A;  3CIP A;  4DTS A;  1IQ0 A;  1WSR A;  2RE2 A;  4BR4 A;  3CQ8 A;  1VSM A;  3AO1 A;  1RTJ A;  2V6S A;  1DEJ A;  2LSN A;  2YNI A;  2ZQB A;  5BN9 A;  4FPA A;  5AQQ A;  4N56 A;  3NBP A;  3B8A X;  4FLT A;  4MFB A;  3A0I X;  3WEE B;  3A8K A;  3GTO C;  4IZ9 A;  1T7P A;  2X6S A;  4BKW A;  4CHZ A;  4DV1 K;  4FWP A;  1SS6 A;  3HOW K;  3HKZ D;  3E9L A;  3T01 A;  4A2A A;  3GTG C;  1NGB A;  5HBM A;  1XUP O;  1WQG A;  2XCQ A;  3M6G A;  3JXU A;  1DLO A;  3EE8 A;  3GTK K;  1VSF A;  2QWL A;  1F7U A;  3SQ2 A;  4AQY K;  2KKZ A;  1NJX A;  4DV5 K;  1L3T A;  2HHT A;  3CJB A;  3GOI A;  3VA3 A;  4GTC A;  4DR1 K;  4A57 A;  3C94 A;  2E2H C;  2E2P A;  2IAJ A;  2O5I A;  4FWR A;  4H5R A;  3SUP A;  3HJF A;  3KTQ A;  4KAS A;  3A8I A;  3L2V A;  3WXI A;  1XZP A;  1RT1 A;  1S9G A;  4AM7 A;  1R0A A;  3HXA A;  2OZM A;  2DFF A;  4B1V A;  4MDA A;  3U9D A;  5IP9 C;  3C6U A;  3BUZ B;  2G8W A;  3OYG A;  4M3T A;  1WSJ A;  4Z4F A;  3C6A A;  4WQ4 C;  4CGJ A;  3ASM A;  3BP8 C;  3ZSX A;  1CZA N;  1GLA G;  1O28 A;  1N36 K;  3M3Y C;  3VQB A;  5IOR A;  1WUA A;  5ELZ A;  1YAG A;  4CES A;  2P9S B;  1BIS A;  4LOW A;  4O5F A;  2OTJ N;  2R93 K;  3O3H A;  3E1Y A;  5AZJ A;  1S5J A;  3HOS A;  3J81 O;  1V4T A;  3OYI A;  4K8Z A;  4IOA L;  4LJZ A;  3LDO A;  2KTQ A;  1SV5 A;  4DQR A;  4JK7 A;  4CHN A;  3ZT2 A;  3MWT A;  4FK4 A;  4JKH A;  2GV9 A;  4CJL A;  4BRH A;  1FJG K;  1K83 A;  4CBU A;  5LJV A;  1NGA A;  4B1Y B;  2V52 B;  1MA9 B;  2GSN A;  1NK7 A;  4KM8 A;  3RR7 A;  4M41 A;  1DD5 A;  4CEZ A;  1RBR A;  3T1H K;  3VN5 A;  4QJV B;  2ZJP L;  4JI8 K;  2OAN A;  1XNR K;  1U49 A;  3G6E N;  1NWK A;  2X74 A;  1M90 O;  4FW2 A;  5KPR A;  2OTL N;  3MCA B;  2WOM A;  2WFB A;  4A59 A;  3K58 A;  2D6F C;  4WYB A;  4LF6 K;  2JWK A;  5EVZ A;  2VUM K;  3S1Q K;  4FVM A;  5M1O A;  4IOC L;  3QBX A;  3E66 A;  3NF9 A;  5FPN A;  3SBG A;  4BDP A;  4KH4 A;  3HVR A;  3HO1 A;  3L2U A;  3PY8 A;  5C2F A;  1NK0 A;  4NLB A;  1U4B A;  1BA1 A;  3FLC O;  4J2A A;  2A6E A;  1I6V A;  5AQX A;  5FLM C;  4RTF D;  3BZK A;  4BRP A;  1NGJ A;  3PO4 A;  2KZM A;  4IG3 A;  3ID8 A;  3A5N C;  1JXE A;  3GL1 A;  2FLO A;  4X65 K;  3CMA N;  2E8A A;  1Q86 O;  4B1X B;  3S1R K;  4GMJ B;  3LL3 A;  3VEN A;  1RT2 A;  5K14 A;  3T1A A;  5CHP A;  1HKG A;  3SMP A;  3KHY A;  4AYB D;  2BDP A;  2HMP A;  1ASU A;  3O9U A;  3K59 A;  5IYB K;  3O4Q A;  3ZSZ A;  4JI0 K;  3UKR B;  1Y1W K;  1R9T C;  1HPZ A;  4IG0 A;  3PX6 A;  4OPH A;  4C1N I;  1I6H C;  4XCH A;  1XMO K;  2W6L A;  2XY5 A;  4DV0 K;  1O2F B;  3MN5 A;  3TR8 A;  4FYD A;  3MXJ A;  1YNN A;  4Y7N K;  5TKW A;  3VA0 A;  1TWF C;  1WSV A;  5KRT A;  4BXX K;  3SPY A;  3QES A;  2E20 A;  2QWM A;  2I5J A;  3QDK A;  5FRO A;  1C0U A;  1UWB A;  4DV3 K;  3ULD A;  3ITH A;  2UYT A;  2XRI A;  4C8M A;  1TVR A;  1NK5 A;  4X64 K;  2HMI A;  2A6H A;  3EL2 A;  2G8I A;  1IBL K;  3IPJ A;  3CQY A;  3DM2 A;  1Y1V K;  4A3F K;  1B4A A;  2IVP A;  1YJ9 N;  4BY9 C;  5DK5 A;  3ZT4 A;  4FOE A;  4E7L A;  4BQZ A;  3OYA A;  1YI2 N;  1Q9Y A;  2O4G A;  1JLA A;  3SPZ A;  2RGR A;  3HOZ C;  3EY1 A;  3A8J A;  4EIA A;  3UIQ A;  4KBO A;  4ILG B;  5JFE A;  3D2F A;  5C4X C;  1SKW A;  1XPP A;  3CPW M;  1C0F A;  4CEQ A;  5C25 A;  4NXN K;  5IP7 C;  2FSJ A;  3QEV A;  1DCP A;  5E26 A;  1G99 A;  1NKC A;  1J6X A;  4JN4 A;  4FLW A;  4M3R A;  5EGH A;  2Z1I A;  1VQN N;  3O9Q A;  4FM2 A;  3GTO K;  1GLJ O;  3C0B A;  3VEZ A;  2WON A;  2A68 A;  1YJN N;  2ZF5 O;  4N5S A;  3KD1 E;  4KAT A;  1IKW A;  3VMF B;  2FQO A;  2PA8 D;  3AVB A;  3QX3 A;  3SZ2 A;  4DFK A;  5BR9 A;  5LMU K;  4RG8 A;  3OTO K;  4NYF A;  1QHT A;  3JS6 A;  4B3M K;  4FW1 A;  1TK0 A;  3IKM A;  4KTW A;  4IFE A;  3LAK A;  1ZBL A;  4BQL A;  4CEC A;  3G4C A;  2OA8 A;  4GV3 A;  1LAV A;  2E2H K;  3HT3 A;  2ATQ A;  4CJR A;  3RR8 A;  4OKJ A;  1L3V A;  1A5W A;  4JEP A;  5KTQ A;  3IS9 A;  2OYQ A;  1T3V A;  3OYC A;  4ID1 A;  1DGK N;  1TYQ A;  4PA1 A;  3CG7 A;  5IOS A;  5AQF A;  1QQN A;  5IP9 K;  4DSL A;  3OYH A;  3HOX C;  1RDW X;  3NVK A;  4F3T A;  3VOV A;  1HKC A;  2NVX K;  1Z25 A;  1GOC A;  4LFC K;  4YDU A;  1BI4 B;  3M3Y K;  3NHG A;  4FJL A;  3OY9 A;  5TKY A;  4DU1 A;  3OYF A;  3TFJ A;  4BR9 A;  4M3U A;  3F5T A;  4IBN A;  2IC3 A;  2W41 A;  4CJK A; 
#chains in the Genus database with same CATH homology
 2A3Z A;  4IDH A;  2P9L A;  3EZW A;  4Z94 A;  5KPZ A;  4ISG A;  2AA4 A;  2RHK A;  3AY9 A;  3CHW A;  3R9P A;  2E2O A;  3H6E A;  5LJW A;  1X3M A;  3F9M A;  5MLC Q;  1K9M O;  1AB4 A;  2JA5 A;  1J6Z A;  1BU6 O;  1C0G A;  4FO0 A;  4WQ4 A;  1TWC A;  1TYQ B;  4YOU A;  3H45 C;  2NVX A;  1LOT B;  1YF5 L;  3D7E O;  4BGA A;  5AFU A;  4CZH A;  2F9T A;  4MO4 A;  2J4R A;  4O8U A;  1KAX A;  2B63 A;  2CH5 A;  3ENO A;  3BUE A;  2Q0R A;  3FZF A;  4DCH A;  4YOV A;  3LM9 A;  4BRN A;  3A5O C;  3D2E A;  4H5V A;  2VCP A;  5F2R A;  3SAG A;  4CZE A;  3MN6 A;  1U2V B;  3N4Q A;  4KDD A;  5F1X A;  3UKU A;  5M1F A;  4FWM A;  4B1U B;  3F2K A;  3OPF A;  4KAW X;  5CJ9 A;  2A6A A;  3CJ9 A;  3HOT A;  4QS9 A;  5JVO A;  1WOQ A;  3KZB A;  1ZBS A;  2NZT A;  3VEV A;  1I50 A;  5CHI A;  5LY3 A;  4WQ5 C;  1OVY A;  2KHO A;  2HST A;  3T7Z A;  2Q1N A;  1EH1 A;  4FWL A;  1VQO N;  4H0V B;  3TSU A;  1JCF A;  4RWT A;  3QML A;  1NGD A;  4C3I C;  1O24 A;  4BR7 A;  4BR5 A;  1YIJ N;  2IVN A;  3J8A A;  4I6M A;  3O9R A;  3C65 A;  3CD6 N;  1IG8 A;  4K25 A;  3AH5 A;  3SAH A;  2Q36 A;  4C1N K;  1T6D A;  3LDQ A;  3ZET A;  2P9I B;  3WXM B;  2XCO A;  3WXJ A;  3Q7C A;  4K43 A;  4NLC A;  1RFQ A;  3H3O B;  1WQF A;  3ZX3 A;  1H1V A;  4IEI A;  4YDU C;  1K8A O;  3D2E B;  3O8M A;  3ATU A;  3QIC A;  3UKU B;  2NRZ A;  3P4I A;  5JVH L;  4GTF A;  1BDG A;  4LR2 A;  4YOX A;  4XEI A;  4BRC A;  3OA9 A;  1VQ8 N;  3FOE A;  5AQP A;  4O8K A;  3FZL A;  3E9P A;  3AGK A;  3HI0 A;  5KQD A;  4GTL A;  4EFH A;  3KVG A;  3MN7 A;  3HRG A;  4G9Z A;  3DAW A;  4QS8 A;  4XH4 A;  2A5X A;  2CFA A;  2CH6 A;  1U6Z A;  1E4F T;  1NLV A;  3Q3Q A;  1NM1 A;  1NMD A;  3CC2 N;  1ESV A;  3O5B A;  3U4L A;  3DWL A;  3P39 A;  1NGH A;  3GBT A;  2ZGZ A;  5C12 A;  5GAG P;  1Y1V A;  4WFN L;  5JIC A;  4BLB A;  4I6M B;  2FF3 B;  1K8K A;  3SMP A;  3GTL A;  5AFU H;  2Q2R A;  3N0B A;  1BG3 A;  1O27 A;  3ZET B;  3I33 A;  2E88 A;  4NB4 A;  3GTJ A;  1SZ2 A;  5HL7 L;  1W97 L;  5AQJ A;  1VQL N;  3PIO L;  3ENB A;  5AQS A;  2A40 A;  4JKE A;  2GEL A;  1RDU A;  3M3Z A;  3VF4 A;  3R1X A;  4ISF A;  3VES A;  4LQY A;  3DXM A;  4KC6 A;  4GFQ A;  3G4S N;  2E1Y A;  3O9S A;  2ASM A;  5EX5 A;  1NGF A;  2ZFZ A;  3EKU A;  5AQT A;  4KAR A;  3K9K A;  4CZM A;  4E1J A;  2D1K A;  5EOY A;  2FSK A;  3KWI A;  4CBX A;  3R8E A;  4ILD A;  3GDQ A;  3HTV A;  4GTA A;  3GE1 A;  2CFA B;  3CCU N;  4HTL A;  2YU9 A;  3ZX0 A;  3PLA A;  3L0Q A;  3RVC A;  3VER A;  1ZVU A;  1JJ2 M;  1DKG D;  3E9O A;  4GTE A;  4GV6 A;  3BF1 A;  4BC4 A;  4C2M C;  2P9K A;  4BC2 A;  3GTG A;  4EHU A;  1GE9 A;  1HLU A;  3KWG A;  2BTF A;  5AZI A;  3HBT A;  1K8K B;  2ZJR L;  4H5N A;  2E2N A;  4C23 A;  4A5A A;  2XCR B;  4BRO A;  3CJ1 A;  1R9T A;  2CGK A;  4MDB A;  4H0O A;  3D6R A;  3CCL N;  3C7N A;  1NJI O;  5AQM A;  2P9N A;  3OEP A;  4U67 L;  4DHY A;  1KAY A;  4G0V A;  4A5B A;  3DXM B;  4KMA A;  2QEX N;  5BRH A;  5AQG A;  1S22 A;  4FPB A;  5AQZ A;  3ZEU A;  3A8Y A;  5GIO A;  5C10 A;  4BC5 A;  3CF5 L;  1ZC6 A;  5AQW A;  3VPZ A;  5GAE P;  1JCG A;  2QM1 A;  2YJE A;  1YUW A;  2HBL A;  3M5R A;  4DKW A;  3IUC A;  1K73 O;  2WC9 A;  5DM7 L;  4YOY A;  1O29 A;  3WEE A;  3CCJ N;  5IOQ A;  1BGW A;  3L4I A;  3S41 A;  5HOO A;  1V4S A;  1HPM A;  5F0X A;  3VET A;  3DJC A;  1VQ5 N;  3CQX A;  3OW2 M;  3C6H A;  3MML B;  4JKA A;  3ATV A;  4YOR A;  3VGK A;  4DDQ A;  2YCH A;  4J8F A;  5AQY A;  4CZG A;  4BVO A;  3R6M A;  4EAH D;  2YHX A;  2P9K B;  3OHR A;  3CCV N;  1E4G T;  5AQV A;  3GTQ A;  3DLL L;  2ASO A;  4RCH A;  5AZI B;  3O4W A;  2GWK A;  1Q86 O;  1EK8 A;  2YHW A;  5B8H A;  4KB4 A;  1KAZ A;  2GEM A;  3ZYY X;  3KK7 A;  4BRG A;  4WF9 L;  4KMH A;  3BP8 A;  3TTF A;  3NMU A;  2JA7 A;  4JD2 A;  3C7N B;  3CIP A;  4C3H C;  2RE2 A;  4BR4 A;  2KLA A;  4BRD A;  2P9N B;  4FVU A;  1WIH A;  2P9I A;  3O08 A;  2W40 A;  4BGB A;  1DEJ A;  3FR0 A;  4JKB A;  2ASP A;  3BEX A;  3U9Z A;  4BRL A;  3ZEU B;  4CD3 A;  3M1F A;  5BN9 A;  3UB5 A;  3WQT A;  1O2B A;  2P5M A;  4FPA A;  5AQQ A;  3HSC A;  3ORE A;  2Q0U A;  2GWJ A;  2NRW A;  3B8A X;  4BRA A;  4AM6 A;  4CZF A;  3FFK B;  3H0G A;  3U8X A;  5ADX H;  2QW9 A;  4BRK A;  2HOE A;  4GTB A;  3O9T A;  1I3Q A;  1GLB G;  3A0I X;  3WEE B;  1DT9 A;  4GNI A;  5GAD P;  2ZJQ L;  4IZ9 A;  3SK3 A;  5AQN A;  4BKW A;  3CER A;  2VYP A;  2YHY A;  3QFU A;  5JMV A;  4FWP A;  1SS6 A;  2KWA A;  3E9L A;  5AQK A;  4A2A A;  1Q82 O;  1NGB A;  1WQG A;  1XUP O;  4H0T B;  2D0O A;  4IO9 L;  4JHD A;  2XCQ A;  3M6G A;  3JXU A;  1P90 A;  1Y64 A;  3EE8 A;  4IWV A;  2QWL A;  4ISE A;  4WFB L;  3VGM A;  3I55 N;  2KKZ A;  2BH1 A;  5GAH P;  4JD2 B;  4A61 A;  3CJB A;  4H0X B;  2GSO A;  3GOI A;  3W0L A;  1TWA A;  3AAP A;  4AF1 A;  1M1K O;  4GTC A;  1HKB A;  3GTP A;  5JLF A;  4PKH A;  4PHT X;  2P9S A;  3VEY A;  4A57 A;  1QZ6 A;  3ZX2 A;  2P9P A;  2E2P A;  3S0X A;  4CZI A;  4FWR A;  4H5R A;  3AAR A;  5KPT A;  3EE9 A;  4B1Z A;  1B4B A;  2V51 B;  4KAS A;  3SLC A;  5GIN A;  4Y0W A;  1GLL O;  3WXI A;  4WFA L;  4C3J C;  1W2B M;  2PBD A;  3MCP A;  4M7X A;  4AM7 A;  3LM2 A;  3ULE A;  3GTK A;  1YXQ A;  3VEX A;  3A5L C;  3WXL A;  4MDA A;  4B1V A;  5JVG L;  3U9D A;  3SAF A;  1SFO A;  3BUZ B;  5C0Y A;  2HBK A;  4IOX A;  4JHD B;  3EO3 A;  3C6A A;  4WQ4 C;  5H1S Q;  4BR0 A;  1WCM A;  1CZA N;  4KMD A;  1GLA G;  3IMX A;  1VQ9 N;  2QWN A;  1O28 A;  2NRH A;  2NVY A;  4CBW A;  4BRQ A;  4BLA A;  4FOI A;  5CE3 A;  2D4W A;  5IOR A;  4BRM A;  3CXC M;  3PIP L;  1WUA A;  5ELZ A;  1VQK N;  1YAG A;  3NUH A;  2P9S B;  4PL7 A;  3MWP A;  2VGN A;  4LC9 B;  2P9P B;  4IXC A;  4O5F A;  3CME N;  2OTJ N;  3HM8 A;  4JKD A;  5AQU A;  3CQZ A;  3E1Y A;  5AZJ A;  2PHC B;  2FF6 A;  2HBJ A;  3HOS A;  3H3N O;  4IOA L;  1V4T A;  4IJN A;  4CJ7 A;  3ULE B;  4ILH A;  3LDO A;  3SBT A;  3FKI A;  5BPM A;  5DM6 L;  1Q18 A;  2NLX A;  4JK7 A;  1TWF A;  3MWT A;  4G0U A;  2VWB A;  3L4J A;  4JKC A;  3RSE A;  4JKH A;  5FPM A;  2HBM A;  2HF4 A;  3GG4 A;  4BRH A;  1K83 A;  1O2A A;  3MX5 A;  4CBU A;  1NGA A;  4B1Y B;  5BRE A;  2DPN A;  2EWS A;  2V52 B;  3K9J A;  5LJV A;  2P9U A;  1KQ4 A;  1XQS C;  2NRT A;  1VQ4 N;  1MA9 B;  3FE1 A;  2GSN A;  1QZ5 A;  4H0Y B;  2FXU A;  4H0P A;  4B9Q A;  3CC7 N;  3WUH A;  4KM8 A;  2NRV A;  1HJO A;  1DD5 A;  3IFR A;  4ILJ A;  1TWH A;  2ZWH A;  2I7P A;  1VAZ A;  1BOT O;  2A41 A;  1IJJ A;  5AZJ B;  4BR2 A;  2ZJP L;  4BG8 A;  2QWP A;  2OAN A;  3WQU A;  4DQ8 A;  5E84 A;  3O1B A;  2GUP A;  1Q81 O;  4H5W A;  4IEE A;  3G6E N;  1NWK A;  1BO5 O;  1ZXO A;  1M90 O;  4FSV A;  5KPR A;  3SJH A;  2OTL N;  3LPX A;  3MCA B;  3OBW A;  2E2I A;  2WFB A;  4BVP A;  2V7Z A;  1Z05 A;  4A59 A;  5M1K A;  1GLD G;  4OPA A;  1QQM A;  3RSE B;  4M63 C;  4WYB A;  1NGE A;  5M1P A;  2GSU A;  4B1W B;  2QA4 N;  2JWK A;  5EVZ A;  3CPE A;  3AAQ A;  3P31 A;  3A5M C;  5M1O A;  3TPQ A;  1XXB A;  2P9U B;  4IOC L;  4OO1 J;  2JH3 A;  1T6C A;  4A62 A;  3V4G A;  4IJA A;  3QBX A;  5BPL A;  3E66 A;  3UKR A;  5FPN A;  2H3G X;  3SBG A;  1ATR A;  4FWK A;  4JNE A;  4KH4 A;  1BUP A;  3CC4 N;  1VQP N;  1NBW A;  2RH6 A;  5C2F A;  3R3L A;  3LAJ A;  4NLB A;  3VF2 A;  1BA1 A;  3FLC O;  5I9E B;  1IS1 A;  1XXA A;  5IOT A;  3CET A;  5AQX A;  4RTF D;  5AQO A;  4BRP A;  1NGJ A;  5M1Q A;  5BN8 A;  4MO5 A;  4PKI A;  4BG9 A;  3CCQ N;  3ID8 A;  3A5N C;  5TJ3 A;  2QWQ A;  2HF3 A;  1O26 A;  3O6W A;  4CZJ A;  2VUM A;  3GL1 A;  5AQL A;  2FLO A;  1BJT A;  3VTH A;  2Q97 A;  1X3N A;  2E8A A;  5C2D A;  3DXK B;  4B1X B;  3CMA N;  3LL3 A;  1D4X A;  3CCR N;  1O25 A;  3N3Y A;  3VEN A;  4KB2 A;  2NNW A;  3AGR A;  3BF3 A;  1GLC G;  2JA6 A;  1S72 N;  4JKG A;  3IDH A;  3LDP A;  4BRI A;  1MDU B;  2NRX A;  5CHP A;  4PKG A;  1HKG A;  1KQS M;  4JKF A;  3KHY A;  3L4Q A;  4JK8 A;  2PFU A;  1O13 A;  3O80 A;  3QFP A;  2HMP A;  1YVN A;  2E2Q A;  3O9U A;  1XC3 A;  2WBN A;  3TSQ A;  4G0W A;  1S3X A;  3FZM A;  1VQ6 N;  4JK9 A;  3J7Z O;  3UKR B;  2WUS A;  1ILY A;  3TTD A;  2CGJ A;  5CR4 A;  4GY2 B;  4OPH A;  4C1N I;  3ID6 A;  3VF6 A;  4GV9 A;  2AP1 A;  2QWO A;  3QB0 A;  2E1Z A;  3MN5 A;  4XH5 A;  4KM9 A;  2F7T A;  5TKW A;  5AQI A;  1P8Z A;  2QWR A;  3OBY A;  1KD1 O;  2Q31 A;  1ISE A;  3MMV A;  3WT0 A;  2P9L B;  1LCU A;  1N8R O;  2IVO A;  1QVG M;  2IIR A;  2YI1 A;  4BRF A;  4FWS A;  1SQK A;  1GLE G;  4K41 A;  2E20 A;  1YHQ N;  1VQM N;  1HX1 A;  1MWK A;  4JKG B;  5M1N A;  2QWM A;  4HWI A;  1Y1W A;  2QXL A;  2QTD A;  3QDK A;  3EKS A;  4L3Q A;  1TWG A;  5AQR A;  2I7N A;  2UYT A;  4PL8 A;  4F9O A;  3QBW A;  2VGM A;  3EL2 A;  3NVM A;  1RGI A;  3FZH A;  1TUU A;  5EY4 A;  3CQY A;  4GTD A;  4EHT A;  3WXK A;  1B4A A;  1XXC A;  2IVP A;  1YJ9 N;  3T69 A;  4BY9 C;  3HZ6 A;  4FOE A;  1KXP A;  1NGI A;  3FZK A;  4H5T A;  4BQZ A;  1QQO A;  1SAZ A;  3CCS N;  3CCE N;  5EGE A;  3TTC A;  1YI2 N;  1TUY A;  3O1W A;  3UE5 A;  5GIP A;  2Y3P A;  3H1V X;  1VQ7 N;  3LAP A;  4FWN A;  3VGL A;  2RGR A;  5BPN A;  4CZL A;  4EIA A;  4KBO A;  1MWM A;  3N4P A;  4FWQ A;  4ILG B;  5FPE A;  3D2F A;  5JFE A;  3AQO A;  1T44 A;  2NRR A;  4FZB A;  4M1X A;  3P38 A;  5BRF A;  2R7Z A;  2R92 A;  3CPW M;  3H1Q A;  1C0F A;  4R79 A;  2FSJ A;  3W3D A;  5E26 A;  1G99 A;  5BRD A;  2F9W A;  1Q7Y O;  1F9N A;  3TSP A;  4JN4 A;  4H03 B;  2PAV A;  1EQY A;  4UY8 O;  5EGH A;  3CJC A;  1VQN N;  5JLH A;  3O9Q A;  3MX2 A;  3VEO A;  1GLJ O;  4IO8 A;  2BUP A;  4CI6 A;  3C0B A;  3VEZ A;  3FOF A;  1GLF O;  1KC8 O;  3VTI A;  1YJN N;  3LDN A;  3CJ7 A;  2ZF5 O;  4KAT A;  5FPD A;  4YOW A;  1QHA A;  3H46 O;  3VMF B;  4JAX A;  1OKJ A;  5AQH A;  2ITM A;  3QX3 A;  2R93 A;  5BR9 A;  4FM9 A;  4KH6 A;  3FHZ A;  4M7Y A;  3JS6 A;  3VA7 A;  5ADX A;  3IKM A;  1HUX A;  4CD1 A;  4IFE A;  3MK6 A;  4K42 A;  4MLH A;  3FGU A;  1ATN A;  1Z6R A;  2ZGY A;  4FL9 A;  4BQL A;  3D2F B;  3VEW A;  2D0P A;  4U7B A;  1EO1 A;  4GV3 A;  1X9J A;  3G4C A;  3N0C A;  4P5B A;  3CCM N;  3GTO A;  4P5A A;  2GTD A;  4GT9 A;  1BWF O;  1NGC A;  3L6Q A;  4CZK A;  5KQ8 A;  1WQH A;  3L4K A;  4A2B A;  3I8B A;  4KH5 A;  3MDQ A;  4JEP A;  5EXW A;  4WQ5 A;  3CI5 A;  3DXK A;  2V7Y A;  1NGG A;  1T3V A;  3CAG A;  1DGK N;  1TYQ A;  2YJF A;  4YOT A;  3G71 N;  5IOS A;  4WCE L;  5AQF A;  4MLE A;  2QI2 A;  3EN9 A;  3Q7B A;  1QQN A;  4J3N A;  4GVE A;  2CGL A;  4BRE A;  3SMS A;  3G4A A;  1JCE A;  2FSN A;  3ENH A;  1RDW X;  3LDL A;  3NVK A;  3VOV A;  2GX9 A;  1HKC A;  5C15 A;  2E2H A;  4YDU A;  3I56 N;  3GTM A;  1YJW N;  3AQP A;  3CJA A;  1U2V A;  4NO7 A;  1QVF M;  5TKY A;  3TU5 A;  3ERE D;  4BC3 A;  5AR0 A;  3MN9 A;  4QS7 A;  1BA0 A;  3F5T A;  3G25 A;  1R59 O;  2JWL A;  4BR9 A;  4FWO A;  1ATS A;  1YIT N;  4XH1 A;  2YX6 A;  2W41 A;  2A42 A;  4DB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...