1ZBSA

Crystal structure of the putative n-acetylglucosamine kinase (pg1100) from porphyromonas gingivalis, northeast structural genomics target pgr18
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
283
structure length
283
Chain Sequence
MILIGDSGSTKTDWCIAKEGKSLGRFQTSGINPFQQDRNEIDTALRSEVLPAIGQKASSIRAVYFYGAGCTPAKAPMLNEALDSMLPHCDRIEVAGDMLGAARALCGDSEGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQMPEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNSFDDFLVRNVLRYNRPDLPLHFIGSVAFHYREVLSSVIKKRGLTLGSVLQSPMEGLIQYHHNNHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PG1100
total genus 82
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1zbsA01
3.30.1360.250 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 1zbsA03
3G25A 2WUSA 4H0OA 2QWOA 3J8AA 3VF6A 1K8KB 4FWQA 1YXQA 4BR5A 5FPDA 3MCPA 3D2FB 2CGLA 3UKRA 4QS9A 3VGLA 5JICA 4CZHA 1BG3A 5F1XA 1YUWA 2V7ZA 3H45C 4BR9A 1SAZA 4CI6A 1BUPA 2E1ZA 3MN7A 4PKIA 4BC3A 3HBTA 5AQXA 2E2QA 1QZ6A 3IDHA 1U2VA 4H0VB 3SMSA 3VF4A 4BC5A 1S3XA 2ASPA 2IVNA 3IMXA 3VEVA 5AQQA 3U9DA 5EOYA 4C23A 3ZEUA 5AQFA 1RFQA 1U2VB 3WXIA 4RCHA 2QWLA 4FPAA 2GWKA 3VERA 4BR4A 4EHTA 5AQSA 2P9UA 5JLHA 3LM9A 5EVZA 2V52B 4A62A 1NGGA 4JD2B 5AQRA 3ULEA 2ZWHA 3QFPA 3D2EA 5AFUH 4FWMA 3CIPA 3HTVA 4Z94A 3O8MA 3VENA 3CJBA 4B1UB 3ZETA 4H03B 4HTLA 5AQVA 1MWMA 3QFUA 3VEYA 2W41A 2P9PA 4DCHA 4NO7A 4BRNA 1BU6O 1YVNA 2HMPA 2DPNA 5KQDA 2Q0UA 4IXCA 4B1WB 2YJFA 4BC2A 2QWNA 2F9TA 1HKGA 4YDUA 4BQZA 4F9OA 1BOTO 5BPMA 1K8KA 3U8XA 4BGBA 5CE3A 1OKJA 3IUCA 2Q2RA 1HX1A 2AP1A 1EQYA 3FGUA 4PKGA 4BRMA 3VEZA 4IJNA 3UE5A 4BR2A 1BWFO 1GLCG 2PBDA 2YHYA 4BRAA 1NGJA 1SZ2A 2IVOA 3D7EO 5AQLA 2NLXA 1ATNA 3H6EA 3CJCA 1C0FA 1NGEA 2P9KA 5LJVA 3BUZB 1LOTB 4MLHA 4BRCA 1WUAA 5AQJA 4H5TA 2P9LA 3KVGA 1E4GT 4GY2B 4JAXA 3O08A 4CZKA 3UB5A 4BG9A 4JN4A 4ISEA 1KAYA 2ASMA 1KXPA 3L0QA 3EN9A 2HOEA 4WYBA 4FWRA 3FLCO 4A2BA 3WXLA 2FXUA 2P9SB 5BPLA 4CD3A 1NGIA 3R9PA 2QWPA 4L3QA 4JD2A 4RWTA 3VGMA 3B8AX 2A40A 5AZIB 3FE1A 1NMDA 3LDLA 1HLUA 3H1QA 4MLEA 2VWBA 3C7NB 3DJCA 2P9IA 4BRFA 4FO0A 4GNIA 4XH4A 3I33A 2V51B 1DKGD 1U6ZA 2CGJA 2YJEA 4H0TB 3CJ1A 4FOEA 3C7NA 3SJHA 3RSEA 4BRPA 1XUPO 2VYPA 4AM7A 4BVPA 3MN9A 2CGKA 3M3ZA 2CH5A 3ZEUB 3WQUA 4HWIA 3O4WA 2IVPA 1KAZA 5F0XA 4O5FA 5AZJA 3H46O 3GG4A 2E1YA 3VESA 5JMVA 5BN9A 2P9UB 4H5NA 3TPQA 3VOVA 4WQ5C 5AR0A 3EL2A 2OANA 2NZTA 1Q18A 4XH5A 4K43A 3FZFA 4FWPA 1KAXA 3EKSA 5JLFA 4YDUC 3GBTA 1BA0A 5AQGA 4BREA 2F9WA 4B1VA 5BREA 3RSEB 3A5LC 3SLCA 2Q31A 5AQWA 1V4TA 4B9QA 2ITMA 1HUXA 2W40A 3ATUA 4WQ5A 1NM1A 3GDQA 3GOIA 4CZJA 1SQKA 3ZX3A 1TYQB 1GLLO 4NB4A 1TUYA 1NGHA 4IZ9A 3BP8A 2E2NA 1DEJA 2D4WA 5BRDA 1HKBA 5EY4A 1H1VA 4WQ4A 1J6ZA 2QM1A 3A5NC 3LDOA 4BVOA 4IO8A 1NGAA 2H3GX 5E84A 3OHRA 3VEWA 3VETA 5AQMA 3ZX2A 4LC9B 3BF1A 1X9JA 3ENOA 2Q36A 3AARA 4CBUA 4PL7A 1C0GA 2J4RA 1ATRA 2GELA 3UKUB 3GL1A 3O5BA 3CJAA 4EIAA 1NGBA 3FZHA 5BR9A 3SMPA 5B8HA 1MA9B 2P9NB 2ASOA 4CZMA 2QW9A 3R6MA 3AAPA 1ZC6A 4BG8A 2AA4A 3KHYA 1MWKA 1NLVA 4EAHD 5AQYA 2E88A 3VF2A 2YI1A 3P4IA 1GLJO 3HI0A 1BDGA 4DHYA 4FWOA 5AQUA 5ELZA 3MMVA 5AFUA 3LDPA 1NBWA 4AM6A 3DXMA 1ESVA 5BPNA 3LDQA 3ULEB 5FPNA 3I8BA 5LY3A 1GLAG 2PAVA 4FWKA 4PKHA 4BRQA 4I6MA 5BRFA 5EX5A 4DQ8A 3W0LA 1T6DA 4CZGA 3CERA 4IJAA 1QQMA 4BRDA 2A5XA 1X3NA 1QZ5A 5AZJB 4BR7A 4BR0A 3HM8A 1QQNA 4BROA 4JNEA 5AQZA 5AQNA 2VCPA 1BA1A 2D1KA 4KBOA 2CH6A 5BRHA 4CZLA 2IIRA 5AQTA 4K42A 2YCHA 3AY9A 3A8YA 1IG8A 4A61A 4B1YB 3DXMB 2Q97A 4BGAA 5KPZA 4QS7A 3CJ9A 2YHXA 3H3NO 5EXWA 4M7XA 4Y0WA 4BRHA 2UYTA 4CZFA 1HKCA 4CZIA 3C0BA 4A2AA 2E20A 2P9KB 2P9IB 3D2FA 3WQTA 2ZF5O 3D2EB 4B1XB 1RGIA 3QMLA 1Y64A 3VEOA 4FWLA 3DWLA 2P9LB 2A6AA 4XH1A 3LDNA 5AQPA 4DB3A 2GTDA 1XC3A 2E8AA 2P9NA 4M7YA 2Q0RA 3O1BA 2EWSA 4ISGA 2QWMA 5FPMA 5FPEA 1NGFA 2GWJA 3FZMA 4RTFD 2E2OA 4H5RA 5F2RA 3QB0A 3MN6A 1GLEG 3H1VX 2KHOA 1V4SA 3DXKA 1ATSA 3L4IA 3O1WA 4EHUA 2GEMA 3BF3A 3VEXA 1HPMA 2QWQA 4K41A 3ENHA 2BUPA 3M6GA 3U9ZA 3FFKB 3QBXA 1T6CA 4FPBA 4I6MB 5I9EB 3SK3A 5ADXA 3EO3A 1Z05A 1NGCA 1G99A 3O80A 3UKUA 1JCGA 4FSVA 4J8FA 2FSKA 3WUHA 3WXKA 3WEEA 5ADXH 5LJWA 4CJ7A 1R59O 5AQOA 1S22A 2A42A 5KPTA 1ZXOA 1TYQA 3VGKA 4H5WA 2BTFA 1IJJA 1YAGA 3IFRA 3MDQA 3R8EA 4E1JA 2A41A 1HJOA 3LM2A 3ZX0A 1QQOA 3KZBA 2GUPA 1LCUA 2A3ZA 4MO4A 1CZAN 1GLDG 4K25A 4BRLA 2ZGZA 2E2PA 2D0OA 3TU5A 1X3MA 3WT0A 3ATVA 3UKRB 3S41A 3QICA 4XEIA 3EZWA 1Z6RA 4BRIA 1P8ZA 1XQSC 3H3OB 4CZEA 2HF4A 4ISFA 3F9MA 3A5MC 4H5VA 3JS6A 5BN8A 2D0PA 1JCEA 2I7NA 2Q1NA 4IWVA 2YHWA 1TUUA 4O8KA 4WQ4C 2I7PA 3JXUA 3ZETB 2NRHA 3WXJA 1NGDA 4FWNA 3LL3A 5AQKA 3HZ6A 3DXKB 4H0PA 5TKYA 3GE1A 3CQYA 3HSCA 4JHDA 4M63C 3A0IX 3M1FA 2QXLA 2FF3B 5E26A 2P9SA 3A5OC 1NWKA 4B1ZA 2FSNA 4BRGA 3BEXA 1WOQA 4JHDB 3CETA 5AZIA 2FF6A 2HF3A 4BQLA 5AQHA 4EFHA 1GLBG 1JCFA 1ZBSA 2QWRA 3WEEB 3U4LA 4CBWA 3MN5A 3CJ7A 5KPRA 3QDKA 1T44A 3FZLA 3MK6A 3FZKA 4PL8A 3DAWA 3CHWA 1E4FT 3L6QA 3O6WA 4FWSA 4BC4A 3W3DA 1QHAA 3AAQA 3ID8A 4CD1A 4H0YB 1DGKN 5AQIA 1RDWX 4FL9A 2FLOA 2P9PB 2ZGYA 1BO5O 3FR0A 1D4XA 1MDUB 1GLFO 3CI5A 3EKUA 4CBXA 4H0XB 3VPZA 4BRKA 3CQXA 4QS8A 5KQ8A 2V7YA 4MO5A 4FOIA 3QBWA 2FSJA
chains in the Genus database with same CATH superfamily
3G25A 4H0OA 3PO3C 3K5NA 3QEPA 1WQGA 5DM6L 2D0BA 3VA0A 1K8KB 3AO5A 4JI7K 1YXQA 2GSUA 4FLTA 1HRHA 2E2JC 5FPDA 3NF9A 3THYA 3D2FB 5C42A 3J80O 1I39A 2YNIA 4QS9A 3VGLA 4YFXA 3MCAB 4CZHA 3HOXC 2V7ZA 3LAMA 5IYDC 4A3EK 3CYMA 2E1ZA 2Q3SA 5JS2A 5FRMA 4BC3A 3K2PA 2VUMC 1TWFK 4CJLA 4FLUA 1ZBHA 4BC5A 1SFOC 4LF6K 3VEVA 1FKOA 5EOYA 3U9DA 2G8IA 3OYEA 3K9KA 1QHTA 1RNHA 3O4QA 4FPAA 4K8ZA 1U45A 4CVNE 4Z4GA 4WF9L 4AYBD 2NRXA 3LM9A 3EY1A 4A62A 4C45A 4DSEA 4QIWD 3G71N 4DV2K 3VQBA 3ULEA 1TGOA 3GIRA 4FVMA 4C2MK 2F96A 3CQ8A 1I50A 4FJ5A 1T3VA 1EK8A 3ZETA 4CF1A 5AQVA 4N5SA 4C8OA 2CW0A 2VG7A 4PQUA 3CQZA 5FROA 4DCHA 3GTQK 3OYCA 3KLFA 4BRNA 5SWMA 1BU6O 5J2QA 4ILDA 1WSEA 3N0BA 4KHUA 1L5UA 2F4VK 4IXCA 3GTPK 1YCLA 3GTOC 1HYZA 2G8WA 1K8AO 2F9TA 3EYZA 1BOTO 1W0HA 5BPMA 3LANA 2E2IC 1DCOA 5H1SQ 1J6XA 4IJNA 3HOZC 4W5QA 1K9MO 4PWDA 2YHYA 4NXNK 5LL6Z 1VSDA 1SZ2A 4Z0UA 2DFEA 4ZTFA 3ZT4A 4AQYK 1HYSA 4FW1A 4DF8A 1PJ6A 4MLHA 3VQ6A 1WUAA 1VSEA 2P9LA 4CJ5A 2VWJA 2YU9K 4B8CA 1HR0K 4HCBA 2PHCB 3EN9A 2HOEA 4CJRA 2W6LA 4WYBA 3K5LA 1WORA 1XZQA 3CFOA 2UXCK 5J2NA 3TSUA 2FXUA 4CJQA 3SAGA 1IV0A 4BWJA 5BPLA 5IYCK 4JI5K 1NGIA 2E6MA 1SL1A 4P9SA 2A6EA 3EQLA 4G9ZA 4L3QA 4IEEA 2WONA 2HBJA 2VGNA 2A40A 1BL3A 2ZUFA 1VSKA 1DCHA 3FE1A 1NMDA 3LDLA 1Q82O 1WCMC 4I9LA 3H1QA 1TWCA 4P5AA 2VWBA 3SQ4A 3KK7A 4GNIA 4E7IA 1DKGD 2YJEA 4B9LA 3IRXA 4H0TB 3CJ1A 4FOEA 4LF9K 3RSEA 3OS2A 1XUPO 1U49A 4GV3A 3JSMA 4AM7A 2PA8L 5IOTA 2GV9A 1TWFA 2R92A 2F8SA 3DOKA 3I0SA 3NF7A 1NJYA 1WSIA 4CEAA 4DV5K 1ZYQA 1QSSA 3H46O 3DLHA 3BZKA 3OA9A 4KB2A 4Z4IA 3VESA 5JMVA 3GEEA 4C8MA 3TPQA 4DSJA 4CEQA 3SUQA 3AVBA 2OANA 1VRTA 3NAEA 4K43A 4JI2K 2KZMA 2OYQA 3EKSA 4KV8A 5HL7L 5JLFA 4HCCA 4IBNA 1G51A 3GTQA 2RPIA 4YDUC 3GBTA 4NCGA 5AQGA 4BREA 4CJ4A 4FM9A 3S1NC 3GTOA 3N4PA 4MDBA 3ZT1A 3TSPA 3NFAA 4CHZA 4Y7NK 3SV4A 1NMNA 3A5LC 5IP9C 4DLGA 3T02A 4Q4ZA 3LP0A 1V5VA 5FJ8K 1V4TA 3CPEA 3DRSA 4B9QA 2ITMA 1HUXA 3SQ1A 3GOIA 3GDQA 1INNA 3KLIA 3LPUA 3WNHA 1WB9A 4E7HA 3V4GA 4BACA 3N0CA 3ZLJA 3AH5A 5IORA 3M8QA 4BY7K 3P38A 4IFEA 2WTUA 3K7AK 2GX9A 1RTIA 4E1MA 3ZT2A 4BE1A 1JQWA 4RW4A 2QM1A 3A5NC 1K6YA 1O2FB 3LDOA 3OYDA 4Z4HA 1I3QA 4A57A 2E2JK 5E84A 5CHPA 3VEWA 2YV0X 3NF6A 3C6UA 2E6LA 4A3JC 5CYMA 3ZX2A 3BF1A 3ENOA 2KWAA 2JA6C 4CBUA 2XY5A 3NVMA 4AILC 1TKDA 1C0GA 1SKRA 4LH4A 3KLEA 4DTXA 4G7HA 4EIAA 5HROA 5TJ3A 4JK9A 5HRRA 1L3VA 2VUMA 3QLHA 3TARA 2ZJPL 1NKBA 2GAHC 5C12A 5C0YA 3OJUA 2ASOA 4CZMA 1J5OA 4YG2A 1RBVA 3RZDK 3NH1A 3WNFA 1TWAA 4KHSA 3PLAA 3P4IA 3AVAA 5ELZA 3F2KA 1XC9A 3MMVA 3OREA 3LDPA 4AM6A 4OO1J 3DXMA 1M1KO 5LY3A 3HRGA 3LP3A 2QEXN 4XLNA 1O1WA 2B63C 1DLOA 1RBRA 2KW4A 4DQ8A 3CERA 4IJAA 4N56A 4IOAL 2X6NA 3S2HK 4KTWA 4YFUA 4Z4EA 2A5XA 1X3NA 2YNHA 1HMVA 3NBPA 4NOIA 4BR7A 2ZE2A 1C0MA 1ZBIA 1QQNA 3SNNA 1S1VA 2D1KA 4KBOA 1TWCK 2NRVA 2IIRA 3DM2A 4DUZK 2YCHA 4OPAA 3LWLA 4BGAA 4CJSA 4E1NA 3CQZC 4G1QA 1YJ9N 2HHUA 1NK0A 2KKZA 3O9TA 2RF2A 5C25A 3S1NK 3AA3A 1I50C 4IG0A 1S1TA 3U3GA 3HOWC 4CZFA 2HHHK 2P9KB 3WQTA 3RMBA 1KFDA 3AVNA 4KHWA 4FJNA 3ZT3A 3BY5A 3VEOA 4FWLA 3DWLA 2R7ZK 3LDNA 5AQPA 4DB3A 2GTDA 1S5JA 2E8AA 3O1BA 2EWSA 3MWPA 4RW9A 4PABA 4AH9A 5FPEA 3HSTB 3Q7BA 4GTDA 2E2OA 2Y1JA 1NJZA 4FJ7A 3S2DC 4JKFA 3MN6A 4CHQA 5DMRA 3SUOA 2A6HA 1ATSA 3OPFA 3V9SA 2GEMA 3V4IA 2FQOA 4AYBL 3CCEN 4JYAK 1ISEA 3AVLA 3ENHA 3I4MK 1HNWK 4OIPA 3AO1A 4N47A 3QBXA 4JKGA 4JK1A 1YX2A 4FPBA 1D9DA 4A59A 4B9UA 3SK3A 4CCHA 2P5OA 3S14K 4W5OA 5EGHA 4A3MC 4KMAA 4CFBA 3WUHA 3WEEA 1IBKK 3CC7N 4AHRA 4CJ7A 2O5JA 1REVA 1XMOK 1SS6A 3VQEA 5T7BA 4FJMA 5C44K 2O8EB 3HOVK 2YKMA 3C6TA 3DLGA 4E1JA 4Q5SA 3AA5X 5JS1A 1I3AA 1HJOA 3U6FA 2QK9A 4CJVA 3TWHA 4QJVB 4LY7A 3H0GC 5M1OA 3TAMA 4X66K 5JVHL 4A93C 2A3ZA 3D6RA 1KRPA 2ZFZA 1GLDG 1Q81O 4M1XA 4CIFA 3E9OA 2KQ2A 2E2PA 3TU5A 1X3MA 4MFBA 3R1XA 4DDQA 3ASMA 4XEIA 1P8ZA 2Z1JA 3G0ZA 1Y1WA 3QIPA 1T05A 2GAGC 5BN8A 1JCEA 2YHAA 3HL8A 4O4GA 3S17K 3AD8C 4IWVA 5CHIA 3LZJA 4O8KA 4WQ4C 5C44C 2I7PA 3JXUA 2OTLN 1SV5A 2NRHA 4FWNA 1HJRA 1N33K 1XNQK 3FOFA 4H0PA 5TKYA 4BBRK 4DQRA 4CGFA 4JS5A 1C0AA 2GBZA 3M1FA 4CJKA 3ZSQA 2G8VA 4DFKA 4GVEA 4B1ZA 1VGXA 4BRGA 3BEXA 3AA4A 3LAKA 3CETA 5AZIA 1TK5A 4A3FC 3AQOA 3NUHA 2EHGA 4EP4A 1GLBG 3I55N 1ZBSA 4JRQA 3SAFA 5IYBK 4JS4A 3TFJA 2Y0SL 4YFNA 1RDAA 1NJXA 1KVBA 3MN5A 1Y1WC 4CK1A 3L2QA 1O25A 3L4QA 3AVJA 3DAWA 4GV9A 3GEIA 3KK2A 3P31A 1VQ7N 1XZPB 5CR4A 2A68A 4CEEA 3QERA 1QHAA 5M3FK 3ID8A 4YORA 1VQ5N 3FR0A 4O5BA 1GLFO 2RGRA 4CESA 3EKUA 1TWGK 3GTMA 3TFIA 3B6PA 3K5OA 3H0GK 4DR1K 4GTLA 3TI0A 5KQ8A 3SAHA 2XY7A 4ID5A 3LP1A 1J9AA 3UKRA 2FSJA 2FF3B 3QINA 3G4AA 2R92K 4U67L 4WFNL 1YITN 3J8AA 2D0CA 4B3MK 3L2WA 4BR5A 1XXCA 3P83D 3SQ2A 5JICA 2JGUA 3H45C 1KTQA 3TR8A 5C2FA 2OZSA 3RRHA 1F7UA 4BXXC 1NOZA 1BISA 4PKIA 3ENBA 1X9MA 3SMSA 4H0VB 4MQ3A 3VF4A 4IFVA 1RDDA 1S3XA 4EP5A 2ASPA 1HNVA 3T01A 3VQPA 1L0WA 5AQFA 3AO4A 3WXIA 1IKYA 5M5WK 3LZIA 4KDDA 4B9NA 3PO2K 2CFAB 1RU0A 2QWLA 1K83A 4BY1K 3VERA 4EHTA 3WNEA 5C24A 4O0IA 2HHTA 3SPZA 2V52B 2Y1IA 1VQON 1FK9A 1BI4B 1VAZA 1S1XA 2NVXC 4MEXA 4KFBA 4ICLA 4YOXA 4BWMA 1TL3A 1YT3A 3KD5E 4A3GC 4ILJA 3O9QA 4GTBA 1X9SA 1WSGA 4GT9A 3HTVA 2B4JA 1VQ6N 4B1UB 1TWGA 4KHYA 1YJWN 1MWMA 4DQIA 3TABA 3HKZL 3KKSA 1TK8A 4JKHA 2ZUEA 4HUFA 2HMPA 3FHZA 5AJ3K 3SCXA 5TMCA 4B1WB 3KK1A 2OA8A 3R3LA 4BC2A 4I9QA 4CFCA 4FZBA 4CEOA 2QWNA 3IS9A 4BQZA 3PX4A 4F9OA 4M41A 1K8KA 2IAJA 4BGBA 5CE3A 3BZCA 4CJWA 4NXMK 1OKJA 3A8IA 4BLBA 3DRRA 3IUCA 2R93A 1WBDA 1W2BM 2AP1A 4PKGA 3FGUA 1EWQA 3VEZA 4XSXA 4CF8A 1RDUA 2VG5A 4GKJK 1GLCG 3T00A 2HB5A 2IVOA 1IBMK 1BCMA 1ATNA 4Z4FA 4CIGA 3T1HK 1NGEA 4JKDA 4P5BA 5LJVA 3OBWA 3SZZA 1LOTB 1XWLA 3PV8A 4BBRC 4GY2B 1N34K 3ZSXA 4GTAA 4JN4A 4LF4K 4PUOA 1BGWA 4ISEA 3TTDA 3GDZA 2ASMA 2F8TA 4AH6A 4U7BA 4FWRA 3TANA 4Y1CA 4NCBA 3WXMB 3NVKA 3WXLA 4KHQA 1UOCA 2P9SB 4KMHA 3NGIA 1SL0A 2O8DB 4KTQA 2O4GA 4J3NA 4G0UA 4Y1DA 4DTJA 1ZYRA 4JD2A 3CC2N 4JI4K 1J6VA 1C1AA 4LR2A 1BGXT 1GOBA 4BLAA 1YF5L 4KTZA 1NK5A 1VLOA 4MLEA 2P9IA 4XH4A 2EX3A 1FW6A 2P5GA 3D0PA 2DFFA 4A3KC 3M4OC 2XHBA 1U6ZA 3CXCM 4RW8A 2XCRB 1R9TK 1I3QC 3S2DK 2VYPA 4E7KA 4E3SA 4RW7A 4LOWA 2CGKA 4HWIA 4RMFA 5E68A 2IVPA 1KQ4A 5F0XA 3MXMA 3K7AC 4O5FA 2E1YA 1HNZK 4A3BC 4H5NA 4G0VA 1WOPA 2JA7K 4IFYA 4WQ5C 3VOVA 4K8XA 5AR0A 4M45A 5GIOA 2O8FB 1ZBFA 2NZTA 4BE2A 4DQQA 1WNSA 5FLMK 3IAYA 3TAFA 3N3YA 3RR7A 2F9WA 5BREA 5KI6A 4A3DK 4N76A 3CD6N 1Y1VA 2Q31A 3GTQC 1NJIO 3CCVN 3G6EN 3LP2A 1C1CA 3KLGA 4IO9L 4CZJA 4KHPK 4OGCA 3ZX3A 2O8BA 4F4KA 1GLLO 1WLJA 4NB4A 3QNNA 1Y97A 2D6FC 1HPZA 4IZ9A 1KQSM 1EFWA 4AHTA 3QEXA 3C6HA 2D4WA 5BRDA 4CW7B 1HKBA 1WQHA 1HQMA 3LALA 5JVGL 4DKWA 3ZSWA 1NOYA 5AQMA 3QESA 3GTKC 1VSHA 1VSMA 1SKWA 4LC9B 5LMNK 2HW3A 5FLMC 1XMQK 2Q36A 3NMUA 3GTPC 4CEDA 1UA1A 3UKUB 1JLBA 4C1NI 3CJAA 5M1PA 4DU1A 1NGBA 3VTIA 4ELUA 3FZHA 3DYAA 5BR9A 2JA6A 3MMLB 5B8HA 2O8DA 1EQRA 2P9NB 3H0GA 2QW9A 3P39A 1JVIA 2W6KA 4X65K 2ZQBA 4V19S 3VF2A 1SFOK 5HRNA 3PO4A 1BDGA 1B4BA 3EE8A 1BQMA 4KB0A 3ZYYX 5AFUA 2VUMK 4OX9K 5FRNA 1JXBA 3GTKK 1I6HK 5BPNA 3LDQA 5C15A 3ULEB 1N8RO 5C4XC 3DRPA 2GSOA 3RWUA 4I6MA 1LW0A 5GAHP 4FJLA 5BRFA 4C3JC 5EX5A 3SBTA 3AVHA 5K14A 3TSQA 4R5PA 4AHCA 1QQMA 4MDAA 3P5JA 1PJ7A 3AO2A 3ID6A 1NK9A 4B3SK 4F8RA 4BROA 2HHWA 1JOEA 4WJ3M 4RG8A 4DFMA 5AQZA 2YNFA 2UXDK 4LFAK 4IOXA 3ULDA 4FJKA 1Q8IA 1EI6A 5I3UA 3AY9A 2OTJN 4OKKA 4Y7NC 4PY5A 4QS7A 3IPJA 3CJ9A 4GW6A 4MQ9A 2HHQA 2Y0SD 1IQ0A 4M7XA 1NU0A 4BRHA 1HKCA 4LSLA 5IP9K 3C0BA 4A2AA 3ZSRA 2E20A 3CM6A 4OKJA 1U47A 3AD9C 4OPJA 4LK1A 3CPWM 1S6PA 1RGIA 1QE1A 4CERA 1Y64A 3GTOK 2PMZD 4B9MA 4M7YA 4M3XA 3H3VL 3RMAA 3N4QA 1EWRA 2G8KA 2QWMA 3MX2A 2YU9A 2GWJA 3FZMA 2BH1A 2PY5A 1VK0A 3V6DA 4KMUA 1T03A 5F2RA 1TK0A 3P1GA 4LSNA 1UV7A 4C3HC 1WCMA 4CJEA 4HVJA 3K9JA 4CGDA 4LFBK 1T7PA 4EHUA 4K0KK 2QI2A 3HVRA 1HPMA 3MECA 2BUPA 3KIOA 1T6CA 1I6HC 1IO2A 3SYZA 2UXBK 2HHXA 5ADXA 4HHTA 3O9UA 1Z05A 3KWIA 1BJTA 1NGCA 4XLPA 4CJUA 3UKUA 4JKGB 4LFCK 5LJWA 4CJ3A 3JAMO 4FK4A 1S22A 4ZH4A 2R7ZA 2D5RA 4FM2A 4WE1A 4CF9A 1IJJA 1YAGA 2OPQA 3R8EA 4B9SA 4DU3A 4A3CC 2OPPA 1C0TA 1LCUA 4FXDA 1CZAN 1WSFA 4DSFA 4DS5A 3AGRA 5FDLA 5M1QA 2P1JA 4BRLA 5BR8K 2ZGZA 4JKBA 5C3EK 3HOWK 3MX5A 4FJ9A 5C10A 3CFPA 4Q0BA 3S41A 2EBBA 3QICA 3PY8A 3GTJK 3EZWA 1Z6RA 3PO3K 1XQSC 3T69A 2HHVA 4DMNA 3F9MA 4XCHA 3GTLK 3A5MC 3OYAA 3KWGA 4J2EA 4H5VA 2XY8A 3JS6A 3GTKA 1LWCA 4BY7C 3QETA 3NH0A 1CXQA 4FCYA 2I7NA 2Q1NA 3QEVA 1VRUA 1TUUA 5HRPA 1TWGC 4FLXA 3A2FA 4JI3K 5AQKA 3HZ6A 1XHZA 3DXKB 5HOOA 2R7YA 3AVGA 3FOEA 2PFUA 3V1QA 1XZPA 3HSCA 3GTMK 4ZTJA 3TFHA 4M63C 3A0IX 4BDPA 5CZ1A 1S9GA 2QXLA 4AHSA 2P9SA 3K0SA 2O8CB 2E2HK 1NWKA 3SJJA 3K57A 2RKIA 3V9WA 1X31C 3M4OK 3O9RA 4BQLA 4C8NA 4M3WA 3RMCA 1NNEA 4GZYA 1WAJA 3ZSVA 3DXJA 2IDOA 2FBYA 2VG6A 2FQTA 3I4NC 1UWBA 3NE6A 5KPRA 1JLEA 3QDKA 2YHBA 5KRTA 3FZLA 3VQ5A 4DR7K 3MK6A 1IBAA 2WBNA 3CHWA 4B3RK 1EX4A 4BC4A 3AGKA 4CD1A 1RBUA 1DGKN 5AQIA 4GMJB 3F5TA 2ZGYA 4KKOA 1D4XA 4CBXA 4KM8A 3T3FA 3CQXA 3HT3A 2I5JA 3ZCMA 1Y1WK 1S1UA 3CCMN 5JVOA 3CAGA 1LV5A 3QBWA 3S17C 4LF5K 1WOOA 2QWOA 1OH6A 4FWQA 4CF0A 2NRZA 2PYLA 4X6AC 2CGLA 4KB4A 3DI6A 5F1XA 1YUWA 1WSHA 1BI4A 4BR9A 2JLEA 1BUPA 1KD1O 2R93K 3V9ZA 3HBTA 5AQXA 4DR2K 4CF2A 4OJRA 3IDHA 3OW2M 1TV6A 4M3YA 3AVIA 2PMZL 5AQQA 4CECA 1FKPA 3ZEUA 2ZD1A 1J53A 3BUEA 1WBBA 2LSNA 4RCHA 3HVTA 5FLXO 3LWMA 3HOUC 2B63K 5AQSA 2P9UA 5JLHA 5EVZA 2KFZA 4EZ6A 2ZWHA 3QFPA 3QX3A 5AFUH 4I2QA 3TTCA 1XI1A 1P90A 4FWMA 4OPHA 1B9FA 4DUYK 4CEFA 3F73A 1EH1A 3RZOK 1IL2A 4Z94A 3VENA 3CJBA 5CY4A 2QXFA 1JL2A 2JA5C 4FYDA 2V6UA 1LW2A 2P9PA 3L8BA 1ZVUA 1F7VA 4NO7A 1BDFA 2OPSA 1N5YA 4F3OA 3HJFA 1YVNA 2NVYC 5D3GA 2E2IA 2DTUA 1WSRA 1FJGK 2Q0UA 1YJNN 1JJ2M 2RH6A 2YJFA 3PX6A 4JRPA 1BS2A 3OS0A 5A2QO 3JYTA 2HNZA 1HKGA 2D0AA 4BBSC 1ASWA 4DR6K 2Q2RA 4BRMA 4W5TA 3SBGA 3UE5A 4BR2A 1BWFO 2PBDA 3ISNC 1ZBLA 4BRAA 1TKXA 1NGJA 4FZZA 5HP1A 3H6EA 4LJZA 1O2BA 1XXBA 1W97L 2P9KA 2NVXA 3BUZB 3E9LA 2QA4N 5AQJA 4JAXA 1E4GT 2E2IK 4BG9A 3M8SA 1XNRK 3C6AA 3ALYA 3I8DA 3CFRA 4H4OA 3THWB 1WN7A 3FLCO 3M8PA 2JA8C 3OS1A 5HL8A 1JKHA 4DR3K 1Y1VK 5GAEP 2QWPA 4DV6K 3OBYA 4RWTA 3I4NK 3VGMA 4DTPA 3PUFA 3ZSYA 1U4BA 1QSYA 1ASVA 4KM9A 4DU4A 1EKEA 1WOSA 1F93A 4AHUA 4DV3K 3C7NB 2RHKA 3DJCA 4FO0A 4DV4K 2P5MA 3I33A 2V51B 4KHNA 1USOA 2CGJA 5J2MA 4DTMA 3RRGA 1WIHA 4KARA 3T19A 3SI6A 5IT9O 1HYVA 4BVPA 3H3VD 1KC8O 5L46A 1KAZA 4WFAL 1IKWA 4NLBA 5E41A 1ILYA 3RMDA 3GG4A 3TTFA 3OYLA 5IYBC 3HOYC 1J98A 2NVXK 4NCAA 2HNYA 2P9UB 4QJVA 3G4SN 4C2MC 3LPTA 2JWLA 4CHOA 1AB4A 3TTGA 1I3QK 1QVFM 4CEBA 3S1MC 3EL2A 5KTQA 2YKNA 4E19A 1N6QA 3FZFA 4QOZB 3HK2A 4NLCA 2F7TA 1KVAA 3DLEA 1C0UA 2BGGA 1YI2N 2V6SA 4F2RA 3SLCA 1RT2A 3TAGA 4KPYA 3PSIA 2W42A 3SZYA 1NK8A 1TWHK 2G8HA 1N36K 3ATUA 1EP4A 3LAJA 1NM1A 1RDCA 4QCLA 1RDBA 1KLMA 2WB1L 1TYQB 4KI4A 4B8AB 4CJPA 3ZSOA 1DCPA 4DTRA 2G8FA 2A1SA 1JLCA 4FLWA 1DEJA 2O8CA 1H1VA 4WQ4A 1J6ZA 1DTTA 1VQKN 3RR8A 4IO8A 1NGAA 4YNQA 1K83C 4CFAA 3OHRA 1TWAC 3HP9A 3EEQA 3S16K 3NCIA 1O13A 1M90O 1DD5A 2Z1IA 1D5AA 1TVRA 4LK0A 1TL1A 2UUAK 3IG1A 1X9JA 1VJEA 2WAQD 1TKZA 2VWKA 3AARA 4PL7A 4L8RB 2J4RA 1ATRA 3PIOL 2GELA 4IEIA 4B9TA 3GL1A 3VQCA 1VRQC 5HLFA 2X74A 3ZT0A 5GINA 1XHXA 1BHLA 1A5VA 3SMPA 4DR5K 1MA9B 4LH5A 3THXA 3QO9A 4A5AA 4JEPA 4BG8A 5KGWA 4A3GK 2AA4A 3S3MA 2PZSA 1NLVA 2E88A 2P51A 2VQEK 3AVFA 4GKKK 1TWHA 4CGJA 3U3YA 1OH5A 3O3HA 4KREA 1ESVA 1HNIA 1B92A 5FPNA 1S72N 3BP8C 3I8BA 4CK2A 3PO2C 1GLAG 1K83K 4FWKA 4PKHA 4BRQA 1IG9A 3C94A 1CZBA 1T6DA 2A1RA 2JWKA 4FJ8A 3THWA 1VQNN 3S3NA 1D8YA 1RT3A 2ETJA 4W5NA 4FVUA 3HM8A 3H08A 4JNEA 3KJVA 5AQNA 1BA1A 1N32K 1L3SA 2CH6A 4YHHK 1U04A 5LMUK 5BRHA 3THVA 2ZM6K 1Z26A 5AQTA 2CFAA 4GFQA 4JI1K 3A8YA 1IG8A 4O44A 2Q97A 5KPZA 1JLGA 1T8EA 3AVKA 4JKAA 2KTQA 2YHXA 5EXWA 3NGZA 4Y0WA 3E66A 2UYTA 4M3TA 4CZIA 2AJQA 4JV5K 1C1BA 2HVIA 4B1XB 1IBLK 4Q5VA 3CC4N 3HOZK 3HPOA 3QMLA 2P9LB 2R92C 3T1YK 4XH1A 3GTGA 4O8UA 1XC3A 2Q0RA 2JH3A 2WC9A 5FPMA 4KI6A 4C3IC 1NGFA 4OGEA 4Y52C 1OH7A 4A3IC 4H5RA 1PJ5A 3QB0A 3DLLL 3H1VX 1V4SA 4AF1A 4B08A 4HUGA 4X62K 3L4IA 4OLBA 3BF3A 2FC0A 3SV3A 3M6GA 1WAFA 3L2UA 1SL2A 3A8KA 3U9ZA 2ATQA 3FFKB 3NF8A 3MEEA 1ASUA 3EO3A 2OZMA 4PHTX 4NYFA 1JCGA 4FSVA 4C3HK 3WXKA 5ADXH 3HOUK 2NVQK 1LAWA 1R59O 5AQOA 1W7AA 2FBVA 3HO1A 2A42A 5KPTA 3QEWA 1ZXOA 1TYQA 2OPRA 4LLGA 4DV0K 4H5WA 1KVCA 3MDQA 3S1RK 2JA8K 2A41A 2Z1GA 2HSTA 3LM2A 4CGIA 1QTMA 4YFKA 5IOQA 3M3YK 3KZBA 1TAQA 2IC3A 4O55A 1KFSA 3CF5L 5CJ9A 3VQ4A 2GUPA 1W9HA 4IKFA 4JKCA 4FK0A 4DFJA 3BDPA 1EO1A 4G7OA 3WT0A 1ZBUA 2YX6A 3RVCA 3HM9A 1O26A 4KAWX 3O3GA 4X6AK 4CZEA 4JKEA 3H3OB 2HF4A 4Y52K 3M5RA 4TSXA 1Q86O 5GAGP 1XXAA 2D0PA 3V9XA 4DG1A 1FXXA 4JK7A 5KGXA 4J2DA 4M42A 3S1QK 1VSLA 4A3FK 3L4JA 3QEIA 2A69A 2XCQA 3VMFB 4A3LK 1BCOA 2HNDA 4QAGA 3GE1A 3CQYA 2KFNA 4JHDA 1I50K 5MLCQ 4A3EC 5IYDK 4ZHRA 3TAEA 3L3UA 1BIUA 3A5OC 1B4AA 4Z4CA 2FSNA 3S1MK 1WOQA 4JHDB 4R79A 1YTUA 4JLHA 2FF6A 2HF3A 1VSFA 3GTLA 4EFHA 4UY8O 1IW7A 4PA1A 2PYJA 3WEEB 3AVCA 3M3YC 4XSZA 1RT7A 4FJJA 4CBWA 1I94K 4A3BK 1K73O 1BIZA 3CJ7A 4JI0K 4PL8A 4FJGA 3L6QA 3O6WA 4M3ZA 3VQ8A 1RT6A 1O24A 1WSJA 3C95A 2NVYK 3HPHA 4ELVA 4A3IK 2FLOA 3SUPA 1JL1A 1BO5O 3CI5A 2O8BB 1KCFA 2NUBA 4DV7K 2XCOA 3VPZA 5J2PA 4A3LC 4QS8A 4BXXK 4FK2A 1LAVA 3MEDA 2V7YA 1NK4A 4MO5A 2WOMA 4FOIA 4IDHA 1RTHA 3CCLN 3FKIC 2R7ZC 2WUSA 3NDKA 3SQ0A 2JA6K 1HI9A 3FKIA 3VF6A 3I56N 2ZJQL 3OYGA 3S2HC 1I6VA 4B3OA 3MCPA 1GOAA 3CCQN 1J54A 3LAPA 3MWTA 3LDSA 3K59A 3S0XA 1BG3A 3VA7A 4C3IK 1TWCC 1SAZA 3S3OA 2HMIA 4CI6A 3AVMA 3MN7A 4FJXA 5D4DA 5M5XK 4DTNA 1YNNA 5DK5A 2E2QA 1QZ6A 2QTDA 3S1QC 1U2VA 3I4MC 3MAQA 1NK6A 1HNXK 4OVLA 5M1KA 4KAZA 3GTPA 2JA7A 4JI6K 2IVNA 3IMXA 1SKSA 3Q3QA 1NG9A 3VQAA 5EU7A 4C23A 3J7ZO 3EZ5A 1RFQA 1WSVA 1U2VB 1A5WA 3AV9A 2B5JA 4A3MK 3OTOK 2YU9C 3NGYA 3GTLC 1VQMN 2GWKA 4BR4A 1NKEA 2HBMA 4F2SA 2NVQC 5J1EA 3CCSN 1NGGA 4JD2B 5AQRA 4DTUA 3FKIK 3V81A 3VTHA 3HYFA 4M3UA 3D2EA 2BE2A 3L4KA 3AA2A 3CIPA 4IG3A 1VQPN 1VQ4N 3O8MA 4H03B 4HTLA 2WB1D 3QFUA 3VEYA 2W41A 1O2AA 2O5IA 3M8RA 2NRTA 5C4JC 2DPNA 5KQDA 3GEHA 3CCUN 1Y1VC 1GOCA 2P8TA 1KLNA 2E4LA 3S14C 3I0RA 1F21A 4YDUA 4ILHA 3U8XA 5I42A 1HX1A 1TAUA 1EQYA 3VQ9A 1JLFA 4CHPA 4YOVA 2HVHA 4FLVA 4OKEA 4H8KA 3RZDC 3D7EO 1RTDA 5AQLA 3SPYA 2NLXA 1D9FA 5M5YK 3CJCA 3OYKA 1C0FA 2NRRA 4ID1A 3CMEN 1IS1A 4OINA 4BRCA 4CZKA 4H5TA 3KVGA 1X9WA 3O08A 3UB5A 3DLKA 3L2VA 4C1NK 3CQZK 1TWFC 1EXQA 1JXEA 1KAYA 2FBTA 2XRIA 3AQPA 1KXPA 3L0QA 3MXJA 4KH4A 2OCEA 3MEGA 3DLRA 2RE2A 4HUEA 4E7LA 2O8EA 1DTQA 1EETA 5HBMA 4A2BA 3VA3A 4DR4K 1RT1A 2HHSA 2FBXA 4CD3A 3NHGA 5IP7C 3R9PA 4CGHA 1SFOA 1YNJA 3HOVC 4A5BA 2XO7A 5IWAK 3CCJN 3B8AX 1G15A 5AZIB 2IGIA 4A3CK 1VSIA 2QKBA 1HLUA 4KO0A 4BRFA 4DQPA 4BKWA 3MXIA 3HPGA 3VQ7A 1Q9XA 3DLBA 1DT9A 2YNGA 1MU2A 1O29A 4A3JK 1CZ9A 3C7NA 3SJHA 4BRPA 4CJTA 4YOUA 3NH2A 3L3VA 3BGRA 2UU9K 2BE5A 3MN9A 3M3ZA 2CH5A 3ZEUB 3WQUA 1OVQA 4CHNA 3O4WA 1SUQA 4LD0A 4CK3A 1J6WA 5AZJA 1S1WA 1E3MA 4IOCL 4N41A 1ITGA 5BN9A 4FZYA 5JFEA 4ELTA 3EE9A 1VQ8N 3HP6A 3T1AA 1Q18A 4XH5A 4FWPA 2R93C 1IKVA 1KAXA 3K5MA 2HBLA 3OYJA 1BA0A 4DSLA 4B1VA 2RN2A 3RSEB 1UA0A 3J7YP 3E1YA 3KKRA 1A5XA 4B9VA 2NRWA 4O2DA 5AQWA 5IP7K 1S6QA 1UAXA 5C3EC 3RTVA 2BDPA 4J2BA 4C8KA 2BANA 2W40A 4GVMA 4E7JA 4WQ5A 3VQDA 2E2HA 2Z1HA 3CG7A 1SQKA 1QSLA 4CE9A 4CJFA 4DTOA 4FLZA 3G10A 2DFHA 1TUYA 1NGHA 3BP8A 3HOSA 3WODA 3GTJC 4YY3K 1J5EK 4DSIA 2E2NA 3THXB 5EY4A 1TWHC 1VQLN 1JLAA 4OIQA 4BVOA 3OJSA 3KD1E 5C2DA 4H4MA 2H3GX 3VETA 3KK3A 4DTSA 4YOTA 2V6TA 4OLAA 3OYBA 4RW6A 2GUIA 1HQUA 3TAPA 4CEZA 4FJIA 2QKKA 4FJHA 3O5BA 3FFIA 1NK7A 1CLQA 4C8LA 4WCEL 4X64K 4M3RA 4CIEA 3R6MA 3AAPA 3TAQA 1IH7A 4FLYA 5EGEA 1ZC6A 2O8FA 3KHYA 3OY9A 4C3JK 1MWKA 1SMYA 3BP3A 3LPXA 4E89A 5AQYA 4EAHD 2YI1A 1YHQN 1GLJO 3HI0A 4DHYA 1WQFA 4A3KK 4FWOA 3CM5A 5AQUA 1R0AA 1HQEA 4E0DA 2Y3PA 1TKTA 1X1PA 5SZTA 3S16C 1NBWA 4F3TA 5GIPA 3S15C 3GTMC 2KLAA 4XIUA 1YIJN 3S9HA 2PAVA 3DMJA 4YOYA 1VH2A 2GSNA 4FM1A 5IYCC 1F9NA 1CXUA 1GE9A 2WFBA 3W0LA 2E2HC 3J7AP 4CZGA 3VN5A 4BRDA 1QS4A 3A8JA 3HXAA 1R9TA 1QZ5A 2DY4A 2NVTK 5AZJB 4BR0A 1RT4A 5CZ2A 4LF8K 2PA8D 3S1RC 2B6AA 2VCPA 1JLQA 4DS4A 4FZXC 1ZQ1C 3CCRN 4CZLA 4K42A 1U48A 4CHYA 1USMA 3HXMA 4A61A 4B1YB 3DXMB 1YVUA 1TWAK 3GTGC 2JA5A 4DSKA 4IDKA 5IOSA 3H3NO 1OVYA 1RILA 1VQ9N 4KN7A 5TMFA 1RBSA 1RCHA 4UQGA 3C65A 3JSTA 3D2FA 2P9IB 3V1OA 3OYFA 2ZF5O 3D2EB 3V9UA 4A93K 3OVNA 4DLEA 1RTJA 1VHXA 4NYNA 3O3FA 2A6AA 3HKZD 3L2RA 2NNWA 4JK8A 4GTCA 1LWFA 2P9NA 3ITHA 4KH5A 3WNGA 3AD7C 4ISGA 2PPBA 2XY6A 4BDZA 4LQYA 1XPPA 1Z25A 4MEYA 4I7FA 4RTFD 1L3TA 1RT5A 2IOCA 3OYNA 4KC6A 3ERED 3HOYK 5M1NA 3OEPA 4OIOA 3RZOC 1GLEG 2KZZA 4DWIA 2KHOA 3DXKA 3K58A 2WAQL 4QIWL 4BY9C 1QQCA 3E9PA 3F9KA 3O1WA 1R9TC 4CFDA 3Q7CA 3VEXA 2QWQA 4K41A 3V1RA 4GTEA 3QIOA 3ZSZA 4FM0A 2UUCK 1O28A 3O9SA 1YTAA 4I6MB 5I9EB 3OYMA 4O0JA 4DQSA 4J2AA 5M3MK 1G99A 3O80A 4J8FA 2FSKA 3QNOA 2G8UA 2VQFK 1RBTA 5M1FA 1BQNA 4KH6A 3VGKA 2UUBK 4WILA 3AO3A 2BTFA 4KATA 1LWEA 3SZ2A 3IFRA 1B9DA 3ZX0A 3IKMA 2HBKA 1QQOA 3OYHA 3UIQA 3GSIA 4MO4A 2IS3A 1IE0A 4K25A 1NKCA 4DF4A 2D0OA 1NJWA 3GTGK 1C6VA 5CYQA 3ATVA 2X6SA 3UKRB 3T7ZA 4BRIA 4KRFA 3CMAN 4OPKA 4ISFA 3OYIA 4W5RA 4WFBL 3KLHA 3PIPL 3PX0A 3KTQA 2NVYA 2X78A 1S9EA 2ZJRL 2NVTC 2YHWA 4DFPA 3B6OA 1VSJA 5GADP 4DV1K 3ZETB 4KB1A 3WXJA 3HOTA 1NGDA 2VGMA 3LL3A 1L3UA 3G4CA 3GTJA 1XZQB 3HOXK 4JI8K 5C4XK 4OIRA 4YOWA 4BE0A 4PAAA 3S15K 5E26A 1IKXA 3E01A 4A3DC 5DM7L 4BDYA 3DOLA 4LF7K 4KN4A 5AQHA 5HRSA 1JCFA 2QWRA 3D45A 4BBSK 3U4LA 5TKWA 1QVGM 3ADAC 2O4IA 4EZ9A 4G0WA 4WJ4A 1T44A 2JA7C 4KASA 1Q9YA 4BY1C 3FZKA 1WCMK 3J81O 1E4FT 3O4NA 3VQQA 4FWSA 1Q7YO 1KSPA 4GTFA 3W3DA 3AAQA 4FW2A 4H0YB 4B3TK 4AHVA 5C4JK 2JA5K 1RDWX 4FL9A 2P9PB 2ITGA 1OH8A 4KMDA 4I2PA 2B63A 1MDUB 4ILGB 1O27A 4H0XB 2E5LK 3PSFA 4BRKA 3PO5A 4GV6A 2W7VA 3SUNA 3THYB 4CGGA 4G7ZA 5KRSA 4HTUA
chains in the Genus database with same CATH topology
3G4AA 3G25A 2WUSA 4H0OA 4U67L 4WFNL 2QWOA 1YITN 3J8AA 1WQGA 5DM6L 3FKIA 3VF6A 1K8KB 3I56N 4FWQA 1YXQA 2ZJQL 2GSUA 4BR5A 5FPDA 3MCPA 3D2FB 2NRZA 3CCQN 2CGLA 1XXCA 3LAPA 3MWTA 3UKRA 4QS9A 3VGLA 4KB4A 3MCAB 3S0XA 5JICA 4CZHA 1BG3A 3VA7A 5F1XA 1YUWA 2V7ZA 3H45C 4BR9A 5C2FA 1SAZA 4CI6A 1BUPA 2E1ZA 3MN7A 1KD1O 4PKIA 4BC3A 3ENBA 4GTFA 3HBTA 5AQXA 2E2QA 1QZ6A 2QTDA 3IDHA 1U2VA 4H0VB 3SMSA 3VF4A 3OW2M 4BC5A 3GTPA 2JA7A 5M1KA 1S3XA 2ASPA 2IVNA 3IMXA 3VEVA 5AQQA 3Q3QA 3U9DA 5EOYA 4C23A 3ZEUA 3J7ZO 5AQFA 1RFQA 3K9KA 1U2VB 3BUEA 3WXIA 4KDDA 4RCHA 2CFAB 2QWLA 1K83A 4FPAA 2GWKA 1VQMN 3VERA 4BR4A 4EHTA 5AQSA 2P9UA 4WF9L 2NRXA 2HBMA 3LM9A 5JLHA 5EVZA 2V52B 4A62A 3CCSN 1NGGA 1VQON 4JD2B 5AQRA 3G71N 3ULEA 3VTHA 1VAZA 2ZWHA 3QFPA 3D2EA 3QX3A 5AFUH 4YOXA 3L4KA 3TTCA 1P90A 3O9QA 3CIPA 4FWMA 4ILJA 4OPHA 4GTBA 1EH1A 1VQPN 1VQ4N 4GT9A 3HTVA 4Z94A 3O8MA 1T3VA 3CJBA 3VENA 4B1UB 1VQ6N 3ZETA 1EK8A 4H03B 4HTLA 5AQVA 1MWMA 1YJWN 3QFUA 1TWGA 3VEYA 2W41A 2P9PA 1O2AA 3CQZA 4DCHA 1ZVUA 4NO7A 4BRNA 1BU6O 4JKHA 2NRTA 2E2IA 1YVNA 4ILDA 2HMPA 2DPNA 5KQDA 3N0BA 3FHZA 3CCUN 2Q0UA 4IXCA 4B1WB 1YJNN 1JJ2M 2RH6A 2YJFA 3R3LA 4BC2A 4FZBA 2QWNA 1K8AO 2F9TA 1HKGA 4YDUA 4BQZA 4F9OA 1BOTO 5BPMA 1K8KA 4ILHA 3U8XA 4BGBA 5CE3A 4BLBA 1OKJA 2R93A 3IUCA 2Q2RA 1HX1A 2AP1A 1EQYA 3FGUA 4PKGA 4BRMA 3VEZA 4IJNA 5H1SQ 3SBGA 1RDUA 4YOVA 1K9MO 3UE5A 4BR2A 1BWFO 1GLCG 2PBDA 2YHYA 4BRAA 1NGJA 1SZ2A 2IVOA 3D7EO 5AQLA 2NLXA 1ATNA 3H6EA 3CJCA 1O2BA 1XXBA 1C0FA 1NGEA 2NRRA 4JKDA 3CMEN 1IS1A 1W97L 2P9KA 4P5BA 5LJVA 3BUZB 3E9LA 3OBWA 1LOTB 4MLHA 4BRCA 2QA4N 1WUAA 5AQJA 4H5TA 2P9LA 3KVGA 1E4GT 4GY2B 4JAXA 3O08A 4CZKA 3UB5A 4BG9A 4JN4A 4GTAA 4C1NK 1BGWA 4ISEA 3C6AA 3TTDA 4P5AA 1KAYA 2ASMA 2PHCB 1KXPA 3L0QA 3EN9A 4KH4A 2HOEA 4U7BA 4WYBA 3AQPA 2RE2A 4FWRA 3FLCO 3WXMB 3NVKA 3TSUA 4A2BA 3WXLA 2FXUA 2P9SB 4KMHA 3SAGA 5BPLA 4CD3A 1NGIA 5GAEP 3R9PA 4J3NA 4G0UA 2QWPA 4G9ZA 1SFOA 4L3QA 3OBYA 4IEEA 4JD2A 4A5BA 4RWTA 3CC2N 2HBJA 3VGMA 2VGNA 3B8AX 3CCJN 2A40A 4LR2A 5AZIB 4KM9A 3FE1A 1NMDA 1YF5L 3LDLA 1Q82O 4BLAA 1HLUA 3H1QA 1TWCA 4MLEA 2VWBA 2RHKA 3C7NB 2P9IA 3DJCA 3KK7A 4BRFA 4BKWA 4FO0A 4GNIA 2P5MA 1DT9A 4XH4A 3I33A 2V51B 1DKGD 1U6ZA 2CGJA 2YJEA 3CXCM 1O29A 1WIHA 4H0TB 4KARA 3CJ1A 4FOEA 3C7NA 2XCRB 3SJHA 3RSEA 4BRPA 1XUPO 4GV3A 2VYPA 4AM7A 4BVPA 5IOTA 4YOUA 1TWFA 2R92A 3MN9A 2CGKA 3M3ZA 2CH5A 3ZEUB 3WQUA 4HWIA 1KC8O 3O4WA 2IVPA 1KAZA 4WFAL 1KQ4A 5F0XA 3CCLN 4O5FA 4NLBA 5AZJA 4KB2A 3H46O 1ILYA 3GG4A 3OA9A 2E1YA 3TTFA 4IOCL 3VESA 5JMVA 5JFEA 5BN9A 2P9UB 4H5NA 4G0VA 3EE9A 3TPQA 3G4SN 1VQ8N 4C2MC 2JWLA 3VOVA 4WQ5C 1AB4A 1QVFM 5AR0A 3EL2A 2OANA 2NZTA 5GIOA 1Q18A 4XH5A 4K43A 3FZFA 4FWPA 4NLCA 2F7TA 1KAXA 3EKSA 5HL7L 3GTQA 5JLFA 2HBLA 3N3YA 4YDUC 3GBTA 1BA0A 5AQGA 4BREA 2F9WA 4B1VA 5BREA 4FM9A 3GTOA 3RSEB 3N4PA 4MDBA 1YI2N 3TSPA 2NVXA 3E1YA 3A5LC 2NRWA 3SLCA 3CD6N 1I50A 1Y1VA 2Q31A 5AQWA 1NJIO 3CCVN 1V4TA 3CPEA 3G6EN 4B9QA 2ITMA 1HUXA 2W40A 3ATUA 4WQ5A 3LAJA 4IO9L 2E2HA 1NM1A 3GDQA 3GOIA 4CZJA 1SQKA 3ZX3A 1TYQB 1GLLO 4NB4A 1TUYA 3V4GA 1NGHA 4IZ9A 3BP8A 1KQSM 3N0CA 5IORA 3AH5A 3HOSA 3P38A 4IFEA 2E2NA 1DEJA 3C6HA 2D4WA 5BRDA 2GX9A 1HKBA 5EY4A 1H1VA 4WQ4A 1J6ZA 1VQLN 2QM1A 1WQHA 3A5NC 1VQKN 3LDOA 1I3QA 4BVOA 4IO8A 1NGAA 4A57A 5C2DA 2H3GX 5E84A 5CHPA 3OHRA 3VEWA 5JVGL 3VETA 4YOTA 4DKWA 1M90O 1O13A 5AQMA 1DD5A 3ZX2A 4LC9B 3BF1A 1X9JA 3ENOA 2KWAA 2Q36A 3AARA 4CBUA 4PL7A 3NVMA 3NMUA 1C0GA 2J4RA 1ATRA 3PIOL 2GELA 4IEIA 3UKUB 4C1NI 3GL1A 3O5BA 3CJAA 4EIAA 5M1PA 5TJ3A 4JK9A 1NGBA 3GTGA 3VTIA 2VUMA 5GINA 2ZJPL 3FZHA 4WCEL 5BR9A 2JA6A 5C12A 3SMPA 5B8HA 5C0YA 3MMLB 1MA9B 2P9NB 2ASOA 3H0GA 4CZMA 2QW9A 3P39A 3R6MA 3AAPA 5EGEA 4A5AA 1ZC6A 4JEPA 4BG8A 2AA4A 3KHYA 1MWKA 1TWAA 1NLVA 3LPXA 4EAHD 5AQYA 2E88A 3VF2A 2YI1A 3PLAA 3P4IA 1YHQN 1GLJO 3HI0A 1BDGA 4DHYA 1B4BA 4FWOA 3EE8A 5AQUA 1WQFA 1TWHA 5ELZA 3F2KA 2Y3PA 3ZYYX 3MMVA 5AFUA 3OREA 3LDPA 1NBWA 4AM6A 4OO1J 3DXMA 1ESVA 5BPNA 3LDQA 5C15A 3ULEB 5GIPA 1N8RO 1M1KO 5FPNA 1S72N 3I8BA 5LY3A 3HRGA 1W2BM 1GLAG 2KLAA 2QEXN 1YIJN 2PAVA 4YOYA 4FWKA 2GSNA 4PKHA 4BRQA 2GSOA 1F9NA 4I6MA 5GAHP 4C3JC 5BRFA 5EX5A 4DQ8A 1GE9A 2WFBA 3SBTA 3W0LA 1T6DA 4CZGA 2JWKA 3TSQA 3CERA 4IJAA 1VQNN 4IOAL 1QQMA 4MDAA 4BRDA 2A5XA 1X3NA 1R9TA 1QZ5A 5AZJB 4BR7A 4FVUA 4BR0A 3HM8A 3ID6A 1QQNA 4BROA 4JNEA 5AQZA 5AQNA 2VCPA 1BA1A 2D1KA 4KBOA 2CH6A 5BRHA 3CCRN 4CZLA 4IOXA 2NRVA 2IIRA 2CFAA 5AQTA 4K42A 2YCHA 3AY9A 4OPAA 4GFQA 3A8YA 1IG8A 2OTJN 4A61A 4B1YB 3DXMB 2Q97A 4BGAA 5KPZA 4QS7A 3CJ9A 1YJ9N 2JA5A 4JKAA 2YHXA 3H3NO 5EXWA 2KKZA 1OVYA 1VQ9N 3O9TA 4M7XA 5IOSA 4Y0WA 3E66A 4BRHA 2UYTA 4CZFA 1HKCA 4CZIA 3C0BA 3C65A 4A2AA 2E20A 2P9KB 2P9IB 3D2FA 3WQTA 2ZF5O 3D2EB 4B1XB 3CPWM 1RGIA 3CC4N 3QMLA 1Y64A 3VEOA 4FWLA 3DWLA 2P9LB 2A6AA 4XH1A 3LDNA 2NNWA 4JK8A 5AQPA 4DB3A 2GTDA 4O8UA 1XC3A 2E8AA 2P9NA 4M7YA 4GTCA 2Q0RA 3O1BA 4KH5A 2EWSA 3N4QA 4ISGA 2JH3A 2WC9A 3MWPA 4LQYA 2QWMA 3MX2A 5FPMA 2YU9A 4C3IC 5FPEA 1NGFA 2GWJA 3FZMA 4RTFD 2BH1A 4KC6A 3Q7BA 4GTDA 2E2OA 3ERED 4H5RA 5M1NA 5F2RA 3QB0A 3MN6A 4JKFA 1GLEG 3H1VX 3DLLL 3OEPA 4C3HC 2KHOA 1V4SA 3DXKA 4AF1A 1WCMA 4BY9C 1ATSA 3E9PA 3K9JA 3OPFA 3L4IA 3O1WA 4EHUA 2GEMA 3BF3A 2QI2A 3Q7CA 3CCEN 3VEXA 1HPMA 2QWQA 4K41A 3ENHA 1ISEA 2BUPA 3M6GA 4GTEA 3U9ZA 3FFKB 3QBXA 1T6CA 4JKGA 1O28A 3O9SA 4FPBA 4A59A 4I6MB 5I9EB 3SK3A 5ADXA 3EO3A 3O9UA 1Z05A 3KWIA 4PHTX 1BJTA 1NGCA 1G99A 3O80A 3UKUA 5EGHA 1JCGA 4FSVA 4J8FA 2FSKA 4KMAA 4JKGB 3WUHA 3WXKA 3WEEA 5ADXH 5LJWA 3CC7N 4CJ7A 1R59O 5AQOA 5M1FA 1S22A 2A42A 5KPTA 1ZXOA 1SS6A 2R7ZA 1TYQA 3VGKA 4KH6A 4H5WA 4KATA 2BTFA 1IJJA 1YAGA 3IFRA 3MDQA 3R8EA 4E1JA 2A41A 2HSTA 1HJOA 3LM2A 5IOQA 3ZX0A 3IKMA 2HBKA 1QQOA 3KZBA 3CF5L 5M1OA 5CJ9A 5JVHL 2GUPA 1LCUA 2A3ZA 3D6RA 3GTMA 4MO4A 1CZAN 2ZFZA 1GLDG 3AGRA 4K25A 5M1QA 4BRLA 4JKCA 2ZGZA 4JKBA 1Q81O 3E9OA 4M1XA 2E2PA 2D0OA 3TU5A 1EO1A 1X3MA 3MX5A 3R1XA 3WT0A 5C10A 3ATVA 2YX6A 3RVCA 3S41A 3UKRB 1O26A 3T7ZA 4KAWX 4DDQA 3QICA 4XEIA 3EZWA 1Z6RA 4BRIA 1P8ZA 1XQSC 3H3OB 4JKEA 3T69A 2HF4A 4CZEA 3CMAN 1Y1WA 4ISFA 3F9MA 3A5MC 3KWGA 3M5RA 4H5VA 3JS6A 5GAGP 5BN8A 4WFBL 1Q86O 3PIPL 1XXAA 2D0PA 3GTKA 1JCEA 2NVYA 2I7NA 2Q1NA 4JK7A 4IWVA 2ZJRL 5CHIA 2YHWA 5GADP 1TUUA 4O8KA 4WQ4C 2I7PA 3JXUA 2OTLN 3ZETB 3L4JA 2NRHA 3WXJA 3HOTA 1NGDA 2VGMA 4FWNA 3VMFB 3LL3A 2XCQA 5AQKA 3G4CA 3FOFA 3HZ6A 3DXKB 4H0PA 5TKYA 5HOOA 3GE1A 3GTJA 3FOEA 2PFUA 3CQYA 3HSCA 4JHDA 5MLCQ 4M63C 3A0IX 4YOWA 3M1FA 2QXLA 2FF3B 5E26A 2P9SA 4GVEA 3A5OC 1NWKA 4B1ZA 1B4AA 5DM7L 2FSNA 4BRGA 3BEXA 1WOQA 4JHDB 4R79A 3CETA 5AZIA 2FF6A 2HF3A 3O9RA 3AQOA 4BQLA 3GTLA 5AQHA 4EFHA 4UY8O 3NUHA 1GLBG 3I55N 1JCFA 1ZBSA 3SAFA 2QWRA 3WEEB 3U4LA 5TKWA 2RGRA 1QVGM 4CBWA 4G0WA 3MN5A 3CJ7A 5KPRA 1K73O 3QDKA 1O25A 1T44A 4KASA 3FZLA 3L4QA 3MK6A 3FZKA 4PL8A 3DAWA 2WBNA 3CHWA 4GV9A 1E4FT 3L6QA 3P31A 3O6WA 4FWSA 3AGKA 4BC4A 1Q7YO 1VQ7N 5CR4A 3W3DA 1QHAA 1O24A 3AAQA 3ID8A 4CD1A 4H0YB 1DGKN 5AQIA 1RDWX 4FL9A 4YORA 2FLOA 2P9PB 3F5TA 4KMDA 1VQ5N 2ZGYA 1BO5O 2B63A 1D4XA 1MDUB 1GLFO 3CI5A 3EKUA 3FR0A 4ILGB 4CBXA 2XCOA 1O27A 4H0XB 4KM8A 3VPZA 4BRKA 3CQXA 4GTLA 4GV6A 4QS8A 5KQ8A 3SAHA 3CCMN 5JVOA 3CAGA 2V7YA 4MO5A 4FOIA 3QBWA 2FSJA 4IDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G25 A;  2WUS A;  4H0O A;  2QWO A;  3J8A A;  3VF6 A;  1K8K B;  4FWQ A;  1YXQ A;  4BR5 A;  5FPD A;  3MCP A;  3D2F B;  2CGL A;  3UKR A;  4QS9 A;  3VGL A;  5JIC A;  4CZH A;  1BG3 A;  5F1X A;  1YUW A;  2V7Z A;  3H45 C;  4BR9 A;  1SAZ A;  4CI6 A;  1BUP A;  2E1Z A;  3MN7 A;  4PKI A;  4BC3 A;  3HBT A;  5AQX A;  2E2Q A;  1QZ6 A;  3IDH A;  1U2V A;  4H0V B;  3SMS A;  3VF4 A;  4BC5 A;  1S3X A;  2ASP A;  2IVN A;  3IMX A;  3VEV A;  5AQQ A;  3U9D A;  5EOY A;  4C23 A;  3ZEU A;  5AQF A;  1RFQ A;  1U2V B;  3WXI A;  4RCH A;  2QWL A;  4FPA A;  2GWK A;  3VER A;  4BR4 A;  4EHT A;  5AQS A;  2P9U A;  5JLH A;  3LM9 A;  5EVZ A;  2V52 B;  4A62 A;  1NGG A;  4JD2 B;  5AQR A;  3ULE A;  2ZWH A;  3QFP A;  3D2E A;  5AFU H;  4FWM A;  3CIP A;  3HTV A;  4Z94 A;  3O8M A;  3VEN A;  3CJB A;  4B1U B;  3ZET A;  4H03 B;  4HTL A;  5AQV A;  1MWM A;  3QFU A;  3VEY A;  2W41 A;  2P9P A;  4DCH A;  4NO7 A;  4BRN A;  1BU6 O;  1YVN A;  2HMP A;  2DPN A;  5KQD A;  2Q0U A;  4IXC A;  4B1W B;  2YJF A;  4BC2 A;  2QWN A;  2F9T A;  1HKG A;  4YDU A;  4BQZ A;  4F9O A;  1BOT O;  5BPM A;  1K8K A;  3U8X A;  4BGB A;  5CE3 A;  1OKJ A;  3IUC A;  2Q2R A;  1HX1 A;  2AP1 A;  1EQY A;  3FGU A;  4PKG A;  4BRM A;  3VEZ A;  4IJN A;  3UE5 A;  4BR2 A;  1BWF O;  1GLC G;  2PBD A;  2YHY A;  4BRA A;  1NGJ A;  1SZ2 A;  2IVO A;  3D7E O;  5AQL A;  2NLX A;  1ATN A;  3H6E A;  3CJC A;  1C0F A;  1NGE A;  2P9K A;  5LJV A;  3BUZ B;  1LOT B;  4MLH A;  4BRC A;  1WUA A;  5AQJ A;  4H5T A;  2P9L A;  3KVG A;  1E4G T;  4GY2 B;  4JAX A;  3O08 A;  4CZK A;  3UB5 A;  4BG9 A;  4JN4 A;  4ISE A;  1KAY A;  2ASM A;  1KXP A;  3L0Q A;  3EN9 A;  2HOE A;  4WYB A;  4FWR A;  3FLC O;  4A2B A;  3WXL A;  2FXU A;  2P9S B;  5BPL A;  4CD3 A;  1NGI A;  3R9P A;  2QWP A;  4L3Q A;  4JD2 A;  4RWT A;  3VGM A;  3B8A X;  2A40 A;  5AZI B;  3FE1 A;  1NMD A;  3LDL A;  1HLU A;  3H1Q A;  4MLE A;  2VWB A;  3C7N B;  3DJC A;  2P9I A;  4BRF A;  4FO0 A;  4GNI A;  4XH4 A;  3I33 A;  2V51 B;  1DKG D;  1U6Z A;  2CGJ A;  2YJE A;  4H0T B;  3CJ1 A;  4FOE A;  3C7N A;  3SJH A;  3RSE A;  4BRP A;  1XUP O;  2VYP A;  4AM7 A;  4BVP A;  3MN9 A;  2CGK A;  3M3Z A;  2CH5 A;  3ZEU B;  3WQU A;  4HWI A;  3O4W A;  2IVP A;  1KAZ A;  5F0X A;  4O5F A;  5AZJ A;  3H46 O;  3GG4 A;  2E1Y A;  3VES A;  5JMV A;  5BN9 A;  2P9U B;  4H5N A;  3TPQ A;  3VOV A;  4WQ5 C;  5AR0 A;  3EL2 A;  2OAN A;  2NZT A;  1Q18 A;  4XH5 A;  4K43 A;  3FZF A;  4FWP A;  1KAX A;  3EKS A;  5JLF A;  4YDU C;  3GBT A;  1BA0 A;  5AQG A;  4BRE A;  2F9W A;  4B1V A;  5BRE A;  3RSE B;  3A5L C;  3SLC A;  2Q31 A;  5AQW A;  1V4T A;  4B9Q A;  2ITM A;  1HUX A;  2W40 A;  3ATU A;  4WQ5 A;  1NM1 A;  3GDQ A;  3GOI A;  4CZJ A;  1SQK A;  3ZX3 A;  1TYQ B;  1GLL O;  4NB4 A;  1TUY A;  1NGH A;  4IZ9 A;  3BP8 A;  2E2N A;  1DEJ A;  2D4W A;  5BRD A;  1HKB A;  5EY4 A;  1H1V A;  4WQ4 A;  1J6Z A;  2QM1 A;  3A5N C;  3LDO A;  4BVO A;  4IO8 A;  1NGA A;  2H3G X;  5E84 A;  3OHR A;  3VEW A;  3VET A;  5AQM A;  3ZX2 A;  4LC9 B;  3BF1 A;  1X9J A;  3ENO A;  2Q36 A;  3AAR A;  4CBU A;  4PL7 A;  1C0G A;  2J4R A;  1ATR A;  2GEL A;  3UKU B;  3GL1 A;  3O5B A;  3CJA A;  4EIA A;  1NGB A;  3FZH A;  5BR9 A;  3SMP A;  5B8H A;  1MA9 B;  2P9N B;  2ASO A;  4CZM A;  2QW9 A;  3R6M A;  3AAP A;  1ZC6 A;  4BG8 A;  2AA4 A;  3KHY A;  1MWK A;  1NLV A;  4EAH D;  5AQY A;  2E88 A;  3VF2 A;  2YI1 A;  3P4I A;  1GLJ O;  3HI0 A;  1BDG A;  4DHY A;  4FWO A;  5AQU A;  5ELZ A;  3MMV A;  5AFU A;  3LDP A;  1NBW A;  4AM6 A;  3DXM A;  1ESV A;  5BPN A;  3LDQ A;  3ULE B;  5FPN A;  3I8B A;  5LY3 A;  1GLA G;  2PAV A;  4FWK A;  4PKH A;  4BRQ A;  4I6M A;  5BRF A;  5EX5 A;  4DQ8 A;  3W0L A;  1T6D A;  4CZG A;  3CER A;  4IJA A;  1QQM A;  4BRD A;  2A5X A;  1X3N A;  1QZ5 A;  5AZJ B;  4BR7 A;  4BR0 A;  3HM8 A;  1QQN A;  4BRO A;  4JNE A;  5AQZ A;  5AQN A;  2VCP A;  1BA1 A;  2D1K A;  4KBO A;  2CH6 A;  5BRH A;  4CZL A;  2IIR A;  5AQT A;  4K42 A;  2YCH A;  3AY9 A;  3A8Y A;  1IG8 A;  4A61 A;  4B1Y B;  3DXM B;  2Q97 A;  4BGA A;  5KPZ A;  4QS7 A;  3CJ9 A;  2YHX A;  3H3N O;  5EXW A;  4M7X A;  4Y0W A;  4BRH A;  2UYT A;  4CZF A;  1HKC A;  4CZI A;  3C0B A;  4A2A A;  2E20 A;  2P9K B;  2P9I B;  3D2F A;  3WQT A;  2ZF5 O;  3D2E B;  4B1X B;  1RGI A;  3QML A;  1Y64 A;  3VEO A;  4FWL A;  3DWL A;  2P9L B;  2A6A A;  4XH1 A;  3LDN A;  5AQP A;  4DB3 A;  2GTD A;  1XC3 A;  2E8A A;  2P9N A;  4M7Y A;  2Q0R A;  3O1B A;  2EWS A;  4ISG A;  2QWM A;  5FPM A;  5FPE A;  1NGF A;  2GWJ A;  3FZM A;  4RTF D;  2E2O A;  4H5R A;  5F2R A;  3QB0 A;  3MN6 A;  1GLE G;  3H1V X;  2KHO A;  1V4S A;  3DXK A;  1ATS A;  3L4I A;  3O1W A;  4EHU A;  2GEM A;  3BF3 A;  3VEX A;  1HPM A;  2QWQ A;  4K41 A;  3ENH A;  2BUP A;  3M6G A;  3U9Z A;  3FFK B;  3QBX A;  1T6C A;  4FPB A;  4I6M B;  5I9E B;  3SK3 A;  5ADX A;  3EO3 A;  1Z05 A;  1NGC A;  1G99 A;  3O80 A;  3UKU A;  1JCG A;  4FSV A;  4J8F A;  2FSK A;  3WUH A;  3WXK A;  3WEE A;  5ADX H;  5LJW A;  4CJ7 A;  1R59 O;  5AQO A;  1S22 A;  2A42 A;  5KPT A;  1ZXO A;  1TYQ A;  3VGK A;  4H5W A;  2BTF A;  1IJJ A;  1YAG A;  3IFR A;  3MDQ A;  3R8E A;  4E1J A;  2A41 A;  1HJO A;  3LM2 A;  3ZX0 A;  1QQO A;  3KZB A;  2GUP A;  1LCU A;  2A3Z A;  4MO4 A;  1CZA N;  1GLD G;  4K25 A;  4BRL A;  2ZGZ A;  2E2P A;  2D0O A;  3TU5 A;  1X3M A;  3WT0 A;  3ATV A;  3UKR B;  3S41 A;  3QIC A;  4XEI A;  3EZW A;  1Z6R A;  4BRI A;  1P8Z A;  1XQS C;  3H3O B;  4CZE A;  2HF4 A;  4ISF A;  3F9M A;  3A5M C;  4H5V A;  3JS6 A;  5BN8 A;  2D0P A;  1JCE A;  2I7N A;  2Q1N A;  4IWV A;  2YHW A;  1TUU A;  4O8K A;  4WQ4 C;  2I7P A;  3JXU A;  3ZET B;  2NRH A;  3WXJ A;  1NGD A;  4FWN A;  3LL3 A;  5AQK A;  3HZ6 A;  3DXK B;  4H0P A;  5TKY A;  3GE1 A;  3CQY A;  3HSC A;  4JHD A;  4M63 C;  3A0I X;  3M1F A;  2QXL A;  2FF3 B;  5E26 A;  2P9S A;  3A5O C;  1NWK A;  4B1Z A;  2FSN A;  4BRG A;  3BEX A;  1WOQ A;  4JHD B;  3CET A;  5AZI A;  2FF6 A;  2HF3 A;  4BQL A;  5AQH A;  4EFH A;  1GLB G;  1JCF A;  1ZBS A;  2QWR A;  3WEE B;  3U4L A;  4CBW A;  3MN5 A;  3CJ7 A;  5KPR A;  3QDK A;  1T44 A;  3FZL A;  3MK6 A;  3FZK A;  4PL8 A;  3DAW A;  3CHW A;  1E4F T;  3L6Q A;  3O6W A;  4FWS A;  4BC4 A;  3W3D A;  1QHA A;  3AAQ A;  3ID8 A;  4CD1 A;  4H0Y B;  1DGK N;  5AQI A;  1RDW X;  4FL9 A;  2FLO A;  2P9P B;  2ZGY A;  1BO5 O;  3FR0 A;  1D4X A;  1MDU B;  1GLF O;  3CI5 A;  3EKU A;  4CBX A;  4H0X B;  3VPZ A;  4BRK A;  3CQX A;  4QS8 A;  5KQ8 A;  2V7Y A;  4MO5 A;  4FOI A;  3QBW A;  2FSJ A; 
#chains in the Genus database with same CATH topology
 3G25 A;  4H0O A;  3PO3 C;  3K5N A;  3QEP A;  1WQG A;  5DM6 L;  2D0B A;  3VA0 A;  1K8K B;  3AO5 A;  4JI7 K;  1YXQ A;  2GSU A;  4FLT A;  1HRH A;  2E2J C;  5FPD A;  3NF9 A;  3THY A;  3D2F B;  5C42 A;  3J80 O;  1I39 A;  2YNI A;  4QS9 A;  3VGL A;  4YFX A;  3MCA B;  4CZH A;  3HOX C;  2V7Z A;  3LAM A;  5IYD C;  4A3E K;  3CYM A;  2E1Z A;  2Q3S A;  5JS2 A;  5FRM A;  4BC3 A;  3K2P A;  2VUM C;  1TWF K;  4CJL A;  4FLU A;  1ZBH A;  4BC5 A;  1SFO C;  4LF6 K;  3VEV A;  1FKO A;  5EOY A;  3U9D A;  2G8I A;  3OYE A;  3K9K A;  1QHT A;  1RNH A;  3O4Q A;  4FPA A;  4K8Z A;  1U45 A;  4CVN E;  4Z4G A;  4WF9 L;  4AYB D;  2NRX A;  3LM9 A;  3EY1 A;  4A62 A;  4C45 A;  4DSE A;  4QIW D;  3G71 N;  4DV2 K;  3VQB A;  3ULE A;  1TGO A;  3GIR A;  4FVM A;  4C2M K;  2F96 A;  3CQ8 A;  1I50 A;  4FJ5 A;  1T3V A;  1EK8 A;  3ZET A;  4CF1 A;  5AQV A;  4N5S A;  4C8O A;  2CW0 A;  2VG7 A;  4PQU A;  3CQZ A;  5FRO A;  4DCH A;  3GTQ K;  3OYC A;  3KLF A;  4BRN A;  5SWM A;  1BU6 O;  5J2Q A;  4ILD A;  1WSE A;  3N0B A;  4KHU A;  1L5U A;  2F4V K;  4IXC A;  3GTP K;  1YCL A;  3GTO C;  1HYZ A;  2G8W A;  1K8A O;  2F9T A;  3EYZ A;  1BOT O;  1W0H A;  5BPM A;  3LAN A;  2E2I C;  1DCO A;  5H1S Q;  1J6X A;  4IJN A;  3HOZ C;  4W5Q A;  1K9M O;  4PWD A;  2YHY A;  4NXN K;  5LL6 Z;  1VSD A;  1SZ2 A;  4Z0U A;  2DFE A;  4ZTF A;  3ZT4 A;  4AQY K;  1HYS A;  4FW1 A;  4DF8 A;  1PJ6 A;  4MLH A;  3VQ6 A;  1WUA A;  1VSE A;  2P9L A;  4CJ5 A;  2VWJ A;  2YU9 K;  4B8C A;  1HR0 K;  4HCB A;  2PHC B;  3EN9 A;  2HOE A;  4CJR A;  2W6L A;  4WYB A;  3K5L A;  1WOR A;  1XZQ A;  3CFO A;  2UXC K;  5J2N A;  3TSU A;  2FXU A;  4CJQ A;  3SAG A;  1IV0 A;  4BWJ A;  5BPL A;  5IYC K;  4JI5 K;  1NGI A;  2E6M A;  1SL1 A;  4P9S A;  2A6E A;  3EQL A;  4G9Z A;  4L3Q A;  4IEE A;  2WON A;  2HBJ A;  2VGN A;  2A40 A;  1BL3 A;  2ZUF A;  1VSK A;  1DCH A;  3FE1 A;  1NMD A;  3LDL A;  1Q82 O;  1WCM C;  4I9L A;  3H1Q A;  1TWC A;  4P5A A;  2VWB A;  3SQ4 A;  3KK7 A;  4GNI A;  4E7I A;  1DKG D;  2YJE A;  4B9L A;  3IRX A;  4H0T B;  3CJ1 A;  4FOE A;  4LF9 K;  3RSE A;  3OS2 A;  1XUP O;  1U49 A;  4GV3 A;  3JSM A;  4AM7 A;  2PA8 L;  5IOT A;  2GV9 A;  1TWF A;  2R92 A;  2F8S A;  3DOK A;  3I0S A;  3NF7 A;  1NJY A;  1WSI A;  4CEA A;  4DV5 K;  1ZYQ A;  1QSS A;  3H46 O;  3DLH A;  3BZK A;  3OA9 A;  4KB2 A;  4Z4I A;  3VES A;  5JMV A;  3GEE A;  4C8M A;  3TPQ A;  4DSJ A;  4CEQ A;  3SUQ A;  3AVB A;  2OAN A;  1VRT A;  3NAE A;  4K43 A;  4JI2 K;  2KZM A;  2OYQ A;  3EKS A;  4KV8 A;  5HL7 L;  5JLF A;  4HCC A;  4IBN A;  1G51 A;  3GTQ A;  2RPI A;  4YDU C;  3GBT A;  4NCG A;  5AQG A;  4BRE A;  4CJ4 A;  4FM9 A;  3S1N C;  3GTO A;  3N4P A;  4MDB A;  3ZT1 A;  3TSP A;  3NFA A;  4CHZ A;  4Y7N K;  3SV4 A;  1NMN A;  3A5L C;  5IP9 C;  4DLG A;  3T02 A;  4Q4Z A;  3LP0 A;  1V5V A;  5FJ8 K;  1V4T A;  3CPE A;  3DRS A;  4B9Q A;  2ITM A;  1HUX A;  3SQ1 A;  3GOI A;  3GDQ A;  1INN A;  3KLI A;  3LPU A;  3WNH A;  1WB9 A;  4E7H A;  3V4G A;  4BAC A;  3N0C A;  3ZLJ A;  3AH5 A;  5IOR A;  3M8Q A;  4BY7 K;  3P38 A;  4IFE A;  2WTU A;  3K7A K;  2GX9 A;  1RTI A;  4E1M A;  3ZT2 A;  4BE1 A;  1JQW A;  4RW4 A;  2QM1 A;  3A5N C;  1K6Y A;  1O2F B;  3LDO A;  3OYD A;  4Z4H A;  1I3Q A;  4A57 A;  2E2J K;  5E84 A;  5CHP A;  3VEW A;  2YV0 X;  3NF6 A;  3C6U A;  2E6L A;  4A3J C;  5CYM A;  3ZX2 A;  3BF1 A;  3ENO A;  2KWA A;  2JA6 C;  4CBU A;  2XY5 A;  3NVM A;  4AIL C;  1TKD A;  1C0G A;  1SKR A;  4LH4 A;  3KLE A;  4DTX A;  4G7H A;  4EIA A;  5HRO A;  5TJ3 A;  4JK9 A;  5HRR A;  1L3V A;  2VUM A;  3QLH A;  3TAR A;  2ZJP L;  1NKB A;  2GAH C;  5C12 A;  5C0Y A;  3OJU A;  2ASO A;  4CZM A;  1J5O A;  4YG2 A;  1RBV A;  3RZD K;  3NH1 A;  3WNF A;  1TWA A;  4KHS A;  3PLA A;  3P4I A;  3AVA A;  5ELZ A;  3F2K A;  1XC9 A;  3MMV A;  3ORE A;  3LDP A;  4AM6 A;  4OO1 J;  3DXM A;  1M1K O;  5LY3 A;  3HRG A;  3LP3 A;  2QEX N;  4XLN A;  1O1W A;  2B63 C;  1DLO A;  1RBR A;  2KW4 A;  4DQ8 A;  3CER A;  4IJA A;  4N56 A;  4IOA L;  2X6N A;  3S2H K;  4KTW A;  4YFU A;  4Z4E A;  2A5X A;  1X3N A;  2YNH A;  1HMV A;  3NBP A;  4NOI A;  4BR7 A;  2ZE2 A;  1C0M A;  1ZBI A;  1QQN A;  3SNN A;  1S1V A;  2D1K A;  4KBO A;  1TWC K;  2NRV A;  2IIR A;  3DM2 A;  4DUZ K;  2YCH A;  4OPA A;  3LWL A;  4BGA A;  4CJS A;  4E1N A;  3CQZ C;  4G1Q A;  1YJ9 N;  2HHU A;  1NK0 A;  2KKZ A;  3O9T A;  2RF2 A;  5C25 A;  3S1N K;  3AA3 A;  1I50 C;  4IG0 A;  1S1T A;  3U3G A;  3HOW C;  4CZF A;  2HHH K;  2P9K B;  3WQT A;  3RMB A;  1KFD A;  3AVN A;  4KHW A;  4FJN A;  3ZT3 A;  3BY5 A;  3VEO A;  4FWL A;  3DWL A;  2R7Z K;  3LDN A;  5AQP A;  4DB3 A;  2GTD A;  1S5J A;  2E8A A;  3O1B A;  2EWS A;  3MWP A;  4RW9 A;  4PAB A;  4AH9 A;  5FPE A;  3HST B;  3Q7B A;  4GTD A;  2E2O A;  2Y1J A;  1NJZ A;  4FJ7 A;  3S2D C;  4JKF A;  3MN6 A;  4CHQ A;  5DMR A;  3SUO A;  2A6H A;  1ATS A;  3OPF A;  3V9S A;  2GEM A;  3V4I A;  2FQO A;  4AYB L;  3CCE N;  4JYA K;  1ISE A;  3AVL A;  3ENH A;  3I4M K;  1HNW K;  4OIP A;  3AO1 A;  4N47 A;  3QBX A;  4JKG A;  4JK1 A;  1YX2 A;  4FPB A;  1D9D A;  4A59 A;  4B9U A;  3SK3 A;  4CCH A;  2P5O A;  3S14 K;  4W5O A;  5EGH A;  4A3M C;  4KMA A;  4CFB A;  3WUH A;  3WEE A;  1IBK K;  3CC7 N;  4AHR A;  4CJ7 A;  2O5J A;  1REV A;  1XMO K;  1SS6 A;  3VQE A;  5T7B A;  4FJM A;  5C44 K;  2O8E B;  3HOV K;  2YKM A;  3C6T A;  3DLG A;  4E1J A;  4Q5S A;  3AA5 X;  5JS1 A;  1I3A A;  1HJO A;  3U6F A;  2QK9 A;  4CJV A;  3TWH A;  4QJV B;  4LY7 A;  3H0G C;  5M1O A;  3TAM A;  4X66 K;  5JVH L;  4A93 C;  2A3Z A;  3D6R A;  1KRP A;  2ZFZ A;  1GLD G;  1Q81 O;  4M1X A;  4CIF A;  3E9O A;  2KQ2 A;  2E2P A;  3TU5 A;  1X3M A;  4MFB A;  3R1X A;  4DDQ A;  3ASM A;  4XEI A;  1P8Z A;  2Z1J A;  3G0Z A;  1Y1W A;  3QIP A;  1T05 A;  2GAG C;  5BN8 A;  1JCE A;  2YHA A;  3HL8 A;  4O4G A;  3S17 K;  3AD8 C;  4IWV A;  5CHI A;  3LZJ A;  4O8K A;  4WQ4 C;  5C44 C;  2I7P A;  3JXU A;  2OTL N;  1SV5 A;  2NRH A;  4FWN A;  1HJR A;  1N33 K;  1XNQ K;  3FOF A;  4H0P A;  5TKY A;  4BBR K;  4DQR A;  4CGF A;  4JS5 A;  1C0A A;  2GBZ A;  3M1F A;  4CJK A;  3ZSQ A;  2G8V A;  4DFK A;  4GVE A;  4B1Z A;  1VGX A;  4BRG A;  3BEX A;  3AA4 A;  3LAK A;  3CET A;  5AZI A;  1TK5 A;  4A3F C;  3AQO A;  3NUH A;  2EHG A;  4EP4 A;  1GLB G;  3I55 N;  1ZBS A;  4JRQ A;  3SAF A;  5IYB K;  4JS4 A;  3TFJ A;  2Y0S L;  4YFN A;  1RDA A;  1NJX A;  1KVB A;  3MN5 A;  1Y1W C;  4CK1 A;  3L2Q A;  1O25 A;  3L4Q A;  3AVJ A;  3DAW A;  4GV9 A;  3GEI A;  3KK2 A;  3P31 A;  1VQ7 N;  1XZP B;  5CR4 A;  2A68 A;  4CEE A;  3QER A;  1QHA A;  5M3F K;  3ID8 A;  4YOR A;  1VQ5 N;  3FR0 A;  4O5B A;  1GLF O;  2RGR A;  4CES A;  3EKU A;  1TWG K;  3GTM A;  3TFI A;  3B6P A;  3K5O A;  3H0G K;  4DR1 K;  4GTL A;  3TI0 A;  5KQ8 A;  3SAH A;  2XY7 A;  4ID5 A;  3LP1 A;  1J9A A;  3UKR A;  2FSJ A;  2FF3 B;  3QIN A;  3G4A A;  2R92 K;  4U67 L;  4WFN L;  1YIT N;  3J8A A;  2D0C A;  4B3M K;  3L2W A;  4BR5 A;  1XXC A;  3P83 D;  3SQ2 A;  5JIC A;  2JGU A;  3H45 C;  1KTQ A;  3TR8 A;  5C2F A;  2OZS A;  3RRH A;  1F7U A;  4BXX C;  1NOZ A;  1BIS A;  4PKI A;  3ENB A;  1X9M A;  3SMS A;  4H0V B;  4MQ3 A;  3VF4 A;  4IFV A;  1RDD A;  1S3X A;  4EP5 A;  2ASP A;  1HNV A;  3T01 A;  3VQP A;  1L0W A;  5AQF A;  3AO4 A;  3WXI A;  1IKY A;  5M5W K;  3LZI A;  4KDD A;  4B9N A;  3PO2 K;  2CFA B;  1RU0 A;  2QWL A;  1K83 A;  4BY1 K;  3VER A;  4EHT A;  3WNE A;  5C24 A;  4O0I A;  2HHT A;  3SPZ A;  2V52 B;  2Y1I A;  1VQO N;  1FK9 A;  1BI4 B;  1VAZ A;  1S1X A;  2NVX C;  4MEX A;  4KFB A;  4ICL A;  4YOX A;  4BWM A;  1TL3 A;  1YT3 A;  3KD5 E;  4A3G C;  4ILJ A;  3O9Q A;  4GTB A;  1X9S A;  1WSG A;  4GT9 A;  3HTV A;  2B4J A;  1VQ6 N;  4B1U B;  1TWG A;  4KHY A;  1YJW N;  1MWM A;  4DQI A;  3TAB A;  3HKZ L;  3KKS A;  1TK8 A;  4JKH A;  2ZUE A;  4HUF A;  2HMP A;  3FHZ A;  5AJ3 K;  3SCX A;  5TMC A;  4B1W B;  3KK1 A;  2OA8 A;  3R3L A;  4BC2 A;  4I9Q A;  4CFC A;  4FZB A;  4CEO A;  2QWN A;  3IS9 A;  4BQZ A;  3PX4 A;  4F9O A;  4M41 A;  1K8K A;  2IAJ A;  4BGB A;  5CE3 A;  3BZC A;  4CJW A;  4NXM K;  1OKJ A;  3A8I A;  4BLB A;  3DRR A;  3IUC A;  2R93 A;  1WBD A;  1W2B M;  2AP1 A;  4PKG A;  3FGU A;  1EWQ A;  3VEZ A;  4XSX A;  4CF8 A;  1RDU A;  2VG5 A;  4GKJ K;  1GLC G;  3T00 A;  2HB5 A;  2IVO A;  1IBM K;  1BCM A;  1ATN A;  4Z4F A;  4CIG A;  3T1H K;  1NGE A;  4JKD A;  4P5B A;  5LJV A;  3OBW A;  3SZZ A;  1LOT B;  1XWL A;  3PV8 A;  4BBR C;  4GY2 B;  1N34 K;  3ZSX A;  4GTA A;  4JN4 A;  4LF4 K;  4PUO A;  1BGW A;  4ISE A;  3TTD A;  3GDZ A;  2ASM A;  2F8T A;  4AH6 A;  4U7B A;  4FWR A;  3TAN A;  4Y1C A;  4NCB A;  3WXM B;  3NVK A;  3WXL A;  4KHQ A;  1UOC A;  2P9S B;  4KMH A;  3NGI A;  1SL0 A;  2O8D B;  4KTQ A;  2O4G A;  4J3N A;  4G0U A;  4Y1D A;  4DTJ A;  1ZYR A;  4JD2 A;  3CC2 N;  4JI4 K;  1J6V A;  1C1A A;  4LR2 A;  1BGX T;  1GOB A;  4BLA A;  1YF5 L;  4KTZ A;  1NK5 A;  1VLO A;  4MLE A;  2P9I A;  4XH4 A;  2EX3 A;  1FW6 A;  2P5G A;  3D0P A;  2DFF A;  4A3K C;  3M4O C;  2XHB A;  1U6Z A;  3CXC M;  4RW8 A;  2XCR B;  1R9T K;  1I3Q C;  3S2D K;  2VYP A;  4E7K A;  4E3S A;  4RW7 A;  4LOW A;  2CGK A;  4HWI A;  4RMF A;  5E68 A;  2IVP A;  1KQ4 A;  5F0X A;  3MXM A;  3K7A C;  4O5F A;  2E1Y A;  1HNZ K;  4A3B C;  4H5N A;  4G0V A;  1WOP A;  2JA7 K;  4IFY A;  4WQ5 C;  3VOV A;  4K8X A;  5AR0 A;  4M45 A;  5GIO A;  2O8F B;  1ZBF A;  2NZT A;  4BE2 A;  4DQQ A;  1WNS A;  5FLM K;  3IAY A;  3TAF A;  3N3Y A;  3RR7 A;  2F9W A;  5BRE A;  5KI6 A;  4A3D K;  4N76 A;  3CD6 N;  1Y1V A;  2Q31 A;  3GTQ C;  1NJI O;  3CCV N;  3G6E N;  3LP2 A;  1C1C A;  3KLG A;  4IO9 L;  4CZJ A;  4KHP K;  4OGC A;  3ZX3 A;  2O8B A;  4F4K A;  1GLL O;  1WLJ A;  4NB4 A;  3QNN A;  1Y97 A;  2D6F C;  1HPZ A;  4IZ9 A;  1KQS M;  1EFW A;  4AHT A;  3QEX A;  3C6H A;  2D4W A;  5BRD A;  4CW7 B;  1HKB A;  1WQH A;  1HQM A;  3LAL A;  5JVG L;  4DKW A;  3ZSW A;  1NOY A;  5AQM A;  3QES A;  3GTK C;  1VSH A;  1VSM A;  1SKW A;  4LC9 B;  5LMN K;  2HW3 A;  5FLM C;  1XMQ K;  2Q36 A;  3NMU A;  3GTP C;  4CED A;  1UA1 A;  3UKU B;  1JLB A;  4C1N I;  3CJA A;  5M1P A;  4DU1 A;  1NGB A;  3VTI A;  4ELU A;  3FZH A;  3DYA A;  5BR9 A;  2JA6 A;  3MML B;  5B8H A;  2O8D A;  1EQR A;  2P9N B;  3H0G A;  2QW9 A;  3P39 A;  1JVI A;  2W6K A;  4X65 K;  2ZQB A;  4V19 S;  3VF2 A;  1SFO K;  5HRN A;  3PO4 A;  1BDG A;  1B4B A;  3EE8 A;  1BQM A;  4KB0 A;  3ZYY X;  5AFU A;  2VUM K;  4OX9 K;  5FRN A;  1JXB A;  3GTK K;  1I6H K;  5BPN A;  3LDQ A;  5C15 A;  3ULE B;  1N8R O;  5C4X C;  3DRP A;  2GSO A;  3RWU A;  4I6M A;  1LW0 A;  5GAH P;  4FJL A;  5BRF A;  4C3J C;  5EX5 A;  3SBT A;  3AVH A;  5K14 A;  3TSQ A;  4R5P A;  4AHC A;  1QQM A;  4MDA A;  3P5J A;  1PJ7 A;  3AO2 A;  3ID6 A;  1NK9 A;  4B3S K;  4F8R A;  4BRO A;  2HHW A;  1JOE A;  4WJ3 M;  4RG8 A;  4DFM A;  5AQZ A;  2YNF A;  2UXD K;  4LFA K;  4IOX A;  3ULD A;  4FJK A;  1Q8I A;  1EI6 A;  5I3U A;  3AY9 A;  2OTJ N;  4OKK A;  4Y7N C;  4PY5 A;  4QS7 A;  3IPJ A;  3CJ9 A;  4GW6 A;  4MQ9 A;  2HHQ A;  2Y0S D;  1IQ0 A;  4M7X A;  1NU0 A;  4BRH A;  1HKC A;  4LSL A;  5IP9 K;  3C0B A;  4A2A A;  3ZSR A;  2E20 A;  3CM6 A;  4OKJ A;  1U47 A;  3AD9 C;  4OPJ A;  4LK1 A;  3CPW M;  1S6P A;  1RGI A;  1QE1 A;  4CER A;  1Y64 A;  3GTO K;  2PMZ D;  4B9M A;  4M7Y A;  4M3X A;  3H3V L;  3RMA A;  3N4Q A;  1EWR A;  2G8K A;  2QWM A;  3MX2 A;  2YU9 A;  2GWJ A;  3FZM A;  2BH1 A;  2PY5 A;  1VK0 A;  3V6D A;  4KMU A;  1T03 A;  5F2R A;  1TK0 A;  3P1G A;  4LSN A;  1UV7 A;  4C3H C;  1WCM A;  4CJE A;  4HVJ A;  3K9J A;  4CGD A;  4LFB K;  1T7P A;  4EHU A;  4K0K K;  2QI2 A;  3HVR A;  1HPM A;  3MEC A;  2BUP A;  3KIO A;  1T6C A;  1I6H C;  1IO2 A;  3SYZ A;  2UXB K;  2HHX A;  5ADX A;  4HHT A;  3O9U A;  1Z05 A;  3KWI A;  1BJT A;  1NGC A;  4XLP A;  4CJU A;  3UKU A;  4JKG B;  4LFC K;  5LJW A;  4CJ3 A;  3JAM O;  4FK4 A;  1S22 A;  4ZH4 A;  2R7Z A;  2D5R A;  4FM2 A;  4WE1 A;  4CF9 A;  1IJJ A;  1YAG A;  2OPQ A;  3R8E A;  4B9S A;  4DU3 A;  4A3C C;  2OPP A;  1C0T A;  1LCU A;  4FXD A;  1CZA N;  1WSF A;  4DSF A;  4DS5 A;  3AGR A;  5FDL A;  5M1Q A;  2P1J A;  4BRL A;  5BR8 K;  2ZGZ A;  4JKB A;  5C3E K;  3HOW K;  3MX5 A;  4FJ9 A;  5C10 A;  3CFP A;  4Q0B A;  3S41 A;  2EBB A;  3QIC A;  3PY8 A;  3GTJ K;  3EZW A;  1Z6R A;  3PO3 K;  1XQS C;  3T69 A;  2HHV A;  4DMN A;  3F9M A;  4XCH A;  3GTL K;  3A5M C;  3OYA A;  3KWG A;  4J2E A;  4H5V A;  2XY8 A;  3JS6 A;  3GTK A;  1LWC A;  4BY7 C;  3QET A;  3NH0 A;  1CXQ A;  4FCY A;  2I7N A;  2Q1N A;  3QEV A;  1VRU A;  1TUU A;  5HRP A;  1TWG C;  4FLX A;  3A2F A;  4JI3 K;  5AQK A;  3HZ6 A;  1XHZ A;  3DXK B;  5HOO A;  2R7Y A;  3AVG A;  3FOE A;  2PFU A;  3V1Q A;  1XZP A;  3HSC A;  3GTM K;  4ZTJ A;  3TFH A;  4M63 C;  3A0I X;  4BDP A;  5CZ1 A;  1S9G A;  2QXL A;  4AHS A;  2P9S A;  3K0S A;  2O8C B;  2E2H K;  1NWK A;  3SJJ A;  3K57 A;  2RKI A;  3V9W A;  1X31 C;  3M4O K;  3O9R A;  4BQL A;  4C8N A;  4M3W A;  3RMC A;  1NNE A;  4GZY A;  1WAJ A;  3ZSV A;  3DXJ A;  2IDO A;  2FBY A;  2VG6 A;  2FQT A;  3I4N C;  1UWB A;  3NE6 A;  5KPR A;  1JLE A;  3QDK A;  2YHB A;  5KRT A;  3FZL A;  3VQ5 A;  4DR7 K;  3MK6 A;  1IBA A;  2WBN A;  3CHW A;  4B3R K;  1EX4 A;  4BC4 A;  3AGK A;  4CD1 A;  1RBU A;  1DGK N;  5AQI A;  4GMJ B;  3F5T A;  2ZGY A;  4KKO A;  1D4X A;  4CBX A;  4KM8 A;  3T3F A;  3CQX A;  3HT3 A;  2I5J A;  3ZCM A;  1Y1W K;  1S1U A;  3CCM N;  5JVO A;  3CAG A;  1LV5 A;  3QBW A;  3S17 C;  4LF5 K;  1WOO A;  2QWO A;  1OH6 A;  4FWQ A;  4CF0 A;  2NRZ A;  2PYL A;  4X6A C;  2CGL A;  4KB4 A;  3DI6 A;  5F1X A;  1YUW A;  1WSH A;  1BI4 A;  4BR9 A;  2JLE A;  1BUP A;  1KD1 O;  2R93 K;  3V9Z A;  3HBT A;  5AQX A;  4DR2 K;  4CF2 A;  4OJR A;  3IDH A;  3OW2 M;  1TV6 A;  4M3Y A;  3AVI A;  2PMZ L;  5AQQ A;  4CEC A;  1FKP A;  3ZEU A;  2ZD1 A;  1J53 A;  3BUE A;  1WBB A;  2LSN A;  4RCH A;  3HVT A;  5FLX O;  3LWM A;  3HOU C;  2B63 K;  5AQS A;  2P9U A;  5JLH A;  5EVZ A;  2KFZ A;  4EZ6 A;  2ZWH A;  3QFP A;  3QX3 A;  5AFU H;  4I2Q A;  3TTC A;  1XI1 A;  1P90 A;  4FWM A;  4OPH A;  1B9F A;  4DUY K;  4CEF A;  3F73 A;  1EH1 A;  3RZO K;  1IL2 A;  4Z94 A;  3VEN A;  3CJB A;  5CY4 A;  2QXF A;  1JL2 A;  2JA5 C;  4FYD A;  2V6U A;  1LW2 A;  2P9P A;  3L8B A;  1ZVU A;  1F7V A;  4NO7 A;  1BDF A;  2OPS A;  1N5Y A;  4F3O A;  3HJF A;  1YVN A;  2NVY C;  5D3G A;  2E2I A;  2DTU A;  1WSR A;  1FJG K;  2Q0U A;  1YJN N;  1JJ2 M;  2RH6 A;  2YJF A;  3PX6 A;  4JRP A;  1BS2 A;  3OS0 A;  5A2Q O;  3JYT A;  2HNZ A;  1HKG A;  2D0A A;  4BBS C;  1ASW A;  4DR6 K;  2Q2R A;  4BRM A;  4W5T A;  3SBG A;  3UE5 A;  4BR2 A;  1BWF O;  2PBD A;  3ISN C;  1ZBL A;  4BRA A;  1TKX A;  1NGJ A;  4FZZ A;  5HP1 A;  3H6E A;  4LJZ A;  1O2B A;  1XXB A;  1W97 L;  2P9K A;  2NVX A;  3BUZ B;  3E9L A;  2QA4 N;  5AQJ A;  4JAX A;  1E4G T;  2E2I K;  4BG9 A;  3M8S A;  1XNR K;  3C6A A;  3ALY A;  3I8D A;  3CFR A;  4H4O A;  3THW B;  1WN7 A;  3FLC O;  3M8P A;  2JA8 C;  3OS1 A;  5HL8 A;  1JKH A;  4DR3 K;  1Y1V K;  5GAE P;  2QWP A;  4DV6 K;  3OBY A;  4RWT A;  3I4N K;  3VGM A;  4DTP A;  3PUF A;  3ZSY A;  1U4B A;  1QSY A;  1ASV A;  4KM9 A;  4DU4 A;  1EKE A;  1WOS A;  1F93 A;  4AHU A;  4DV3 K;  3C7N B;  2RHK A;  3DJC A;  4FO0 A;  4DV4 K;  2P5M A;  3I33 A;  2V51 B;  4KHN A;  1USO A;  2CGJ A;  5J2M A;  4DTM A;  3RRG A;  1WIH A;  4KAR A;  3T19 A;  3SI6 A;  5IT9 O;  1HYV A;  4BVP A;  3H3V D;  1KC8 O;  5L46 A;  1KAZ A;  4WFA L;  1IKW A;  4NLB A;  5E41 A;  1ILY A;  3RMD A;  3GG4 A;  3TTF A;  3OYL A;  5IYB C;  3HOY C;  1J98 A;  2NVX K;  4NCA A;  2HNY A;  2P9U B;  4QJV A;  3G4S N;  4C2M C;  3LPT A;  2JWL A;  4CHO A;  1AB4 A;  3TTG A;  1I3Q K;  1QVF M;  4CEB A;  3S1M C;  3EL2 A;  5KTQ A;  2YKN A;  4E19 A;  1N6Q A;  3FZF A;  4QOZ B;  3HK2 A;  4NLC A;  2F7T A;  1KVA A;  3DLE A;  1C0U A;  2BGG A;  1YI2 N;  2V6S A;  4F2R A;  3SLC A;  1RT2 A;  3TAG A;  4KPY A;  3PSI A;  2W42 A;  3SZY A;  1NK8 A;  1TWH K;  2G8H A;  1N36 K;  3ATU A;  1EP4 A;  3LAJ A;  1NM1 A;  1RDC A;  4QCL A;  1RDB A;  1KLM A;  2WB1 L;  1TYQ B;  4KI4 A;  4B8A B;  4CJP A;  3ZSO A;  1DCP A;  4DTR A;  2G8F A;  2A1S A;  1JLC A;  4FLW A;  1DEJ A;  2O8C A;  1H1V A;  4WQ4 A;  1J6Z A;  1DTT A;  1VQK N;  3RR8 A;  4IO8 A;  1NGA A;  4YNQ A;  1K83 C;  4CFA A;  3OHR A;  1TWA C;  3HP9 A;  3EEQ A;  3S16 K;  3NCI A;  1O13 A;  1M90 O;  1DD5 A;  2Z1I A;  1D5A A;  1TVR A;  4LK0 A;  1TL1 A;  2UUA K;  3IG1 A;  1X9J A;  1VJE A;  2WAQ D;  1TKZ A;  2VWK A;  3AAR A;  4PL7 A;  4L8R B;  2J4R A;  1ATR A;  3PIO L;  2GEL A;  4IEI A;  4B9T A;  3GL1 A;  3VQC A;  1VRQ C;  5HLF A;  2X74 A;  3ZT0 A;  5GIN A;  1XHX A;  1BHL A;  1A5V A;  3SMP A;  4DR5 K;  1MA9 B;  4LH5 A;  3THX A;  3QO9 A;  4A5A A;  4JEP A;  4BG8 A;  5KGW A;  4A3G K;  2AA4 A;  3S3M A;  2PZS A;  1NLV A;  2E88 A;  2P51 A;  2VQE K;  3AVF A;  4GKK K;  1TWH A;  4CGJ A;  3U3Y A;  1OH5 A;  3O3H A;  4KRE A;  1ESV A;  1HNI A;  1B92 A;  5FPN A;  1S72 N;  3BP8 C;  3I8B A;  4CK2 A;  3PO2 C;  1GLA G;  1K83 K;  4FWK A;  4PKH A;  4BRQ A;  1IG9 A;  3C94 A;  1CZB A;  1T6D A;  2A1R A;  2JWK A;  4FJ8 A;  3THW A;  1VQN N;  3S3N A;  1D8Y A;  1RT3 A;  2ETJ A;  4W5N A;  4FVU A;  3HM8 A;  3H08 A;  4JNE A;  3KJV A;  5AQN A;  1BA1 A;  1N32 K;  1L3S A;  2CH6 A;  4YHH K;  1U04 A;  5LMU K;  5BRH A;  3THV A;  2ZM6 K;  1Z26 A;  5AQT A;  2CFA A;  4GFQ A;  4JI1 K;  3A8Y A;  1IG8 A;  4O44 A;  2Q97 A;  5KPZ A;  1JLG A;  1T8E A;  3AVK A;  4JKA A;  2KTQ A;  2YHX A;  5EXW A;  3NGZ A;  4Y0W A;  3E66 A;  2UYT A;  4M3T A;  4CZI A;  2AJQ A;  4JV5 K;  1C1B A;  2HVI A;  4B1X B;  1IBL K;  4Q5V A;  3CC4 N;  3HOZ K;  3HPO A;  3QML A;  2P9L B;  2R92 C;  3T1Y K;  4XH1 A;  3GTG A;  4O8U A;  1XC3 A;  2Q0R A;  2JH3 A;  2WC9 A;  5FPM A;  4KI6 A;  4C3I C;  1NGF A;  4OGE A;  4Y52 C;  1OH7 A;  4A3I C;  4H5R A;  1PJ5 A;  3QB0 A;  3DLL L;  3H1V X;  1V4S A;  4AF1 A;  4B08 A;  4HUG A;  4X62 K;  3L4I A;  4OLB A;  3BF3 A;  2FC0 A;  3SV3 A;  3M6G A;  1WAF A;  3L2U A;  1SL2 A;  3A8K A;  3U9Z A;  2ATQ A;  3FFK B;  3NF8 A;  3MEE A;  1ASU A;  3EO3 A;  2OZM A;  4PHT X;  4NYF A;  1JCG A;  4FSV A;  4C3H K;  3WXK A;  5ADX H;  3HOU K;  2NVQ K;  1LAW A;  1R59 O;  5AQO A;  1W7A A;  2FBV A;  3HO1 A;  2A42 A;  5KPT A;  3QEW A;  1ZXO A;  1TYQ A;  2OPR A;  4LLG A;  4DV0 K;  4H5W A;  1KVC A;  3MDQ A;  3S1R K;  2JA8 K;  2A41 A;  2Z1G A;  2HST A;  3LM2 A;  4CGI A;  1QTM A;  4YFK A;  5IOQ A;  3M3Y K;  3KZB A;  1TAQ A;  2IC3 A;  4O55 A;  1KFS A;  3CF5 L;  5CJ9 A;  3VQ4 A;  2GUP A;  1W9H A;  4IKF A;  4JKC A;  4FK0 A;  4DFJ A;  3BDP A;  1EO1 A;  4G7O A;  3WT0 A;  1ZBU A;  2YX6 A;  3RVC A;  3HM9 A;  1O26 A;  4KAW X;  3O3G A;  4X6A K;  4CZE A;  4JKE A;  3H3O B;  2HF4 A;  4Y52 K;  3M5R A;  4TSX A;  1Q86 O;  5GAG P;  1XXA A;  2D0P A;  3V9X A;  4DG1 A;  1FXX A;  4JK7 A;  5KGX A;  4J2D A;  4M42 A;  3S1Q K;  1VSL A;  4A3F K;  3L4J A;  3QEI A;  2A69 A;  2XCQ A;  3VMF B;  4A3L K;  1BCO A;  2HND A;  4QAG A;  3GE1 A;  3CQY A;  2KFN A;  4JHD A;  1I50 K;  5MLC Q;  4A3E C;  5IYD K;  4ZHR A;  3TAE A;  3L3U A;  1BIU A;  3A5O C;  1B4A A;  4Z4C A;  2FSN A;  3S1M K;  1WOQ A;  4JHD B;  4R79 A;  1YTU A;  4JLH A;  2FF6 A;  2HF3 A;  1VSF A;  3GTL A;  4EFH A;  4UY8 O;  1IW7 A;  4PA1 A;  2PYJ A;  3WEE B;  3AVC A;  3M3Y C;  4XSZ A;  1RT7 A;  4FJJ A;  4CBW A;  1I94 K;  4A3B K;  1K73 O;  1BIZ A;  3CJ7 A;  4JI0 K;  4PL8 A;  4FJG A;  3L6Q A;  3O6W A;  4M3Z A;  3VQ8 A;  1RT6 A;  1O24 A;  1WSJ A;  3C95 A;  2NVY K;  3HPH A;  4ELV A;  4A3I K;  2FLO A;  3SUP A;  1JL1 A;  1BO5 O;  3CI5 A;  2O8B B;  1KCF A;  2NUB A;  4DV7 K;  2XCO A;  3VPZ A;  5J2P A;  4A3L C;  4QS8 A;  4BXX K;  4FK2 A;  1LAV A;  3MED A;  2V7Y A;  1NK4 A;  4MO5 A;  2WOM A;  4FOI A;  4IDH A;  1RTH A;  3CCL N;  3FKI C;  2R7Z C;  2WUS A;  3NDK A;  3SQ0 A;  2JA6 K;  1HI9 A;  3FKI A;  3VF6 A;  3I56 N;  2ZJQ L;  3OYG A;  3S2H C;  1I6V A;  4B3O A;  3MCP A;  1GOA A;  3CCQ N;  1J54 A;  3LAP A;  3MWT A;  3LDS A;  3K59 A;  3S0X A;  1BG3 A;  3VA7 A;  4C3I K;  1TWC C;  1SAZ A;  3S3O A;  2HMI A;  4CI6 A;  3AVM A;  3MN7 A;  4FJX A;  5D4D A;  5M5X K;  4DTN A;  1YNN A;  5DK5 A;  2E2Q A;  1QZ6 A;  2QTD A;  3S1Q C;  1U2V A;  3I4M C;  3MAQ A;  1NK6 A;  1HNX K;  4OVL A;  5M1K A;  4KAZ A;  3GTP A;  2JA7 A;  4JI6 K;  2IVN A;  3IMX A;  1SKS A;  3Q3Q A;  1NG9 A;  3VQA A;  5EU7 A;  4C23 A;  3J7Z O;  3EZ5 A;  1RFQ A;  1WSV A;  1U2V B;  1A5W A;  3AV9 A;  2B5J A;  4A3M K;  3OTO K;  2YU9 C;  3NGY A;  3GTL C;  1VQM N;  2GWK A;  4BR4 A;  1NKE A;  2HBM A;  4F2S A;  2NVQ C;  5J1E A;  3CCS N;  1NGG A;  4JD2 B;  5AQR A;  4DTU A;  3FKI K;  3V81 A;  3VTH A;  3HYF A;  4M3U A;  3D2E A;  2BE2 A;  3L4K A;  3AA2 A;  3CIP A;  4IG3 A;  1VQP N;  1VQ4 N;  3O8M A;  4H03 B;  4HTL A;  2WB1 D;  3QFU A;  3VEY A;  2W41 A;  1O2A A;  2O5I A;  3M8R A;  2NRT A;  5C4J C;  2DPN A;  5KQD A;  3GEH A;  3CCU N;  1Y1V C;  1GOC A;  2P8T A;  1KLN A;  2E4L A;  3S14 C;  3I0R A;  1F21 A;  4YDU A;  4ILH A;  3U8X A;  5I42 A;  1HX1 A;  1TAU A;  1EQY A;  3VQ9 A;  1JLF A;  4CHP A;  4YOV A;  2HVH A;  4FLV A;  4OKE A;  4H8K A;  3RZD C;  3D7E O;  1RTD A;  5AQL A;  3SPY A;  2NLX A;  1D9F A;  5M5Y K;  3CJC A;  3OYK A;  1C0F A;  2NRR A;  4ID1 A;  3CME N;  1IS1 A;  4OIN A;  4BRC A;  4CZK A;  4H5T A;  3KVG A;  1X9W A;  3O08 A;  3UB5 A;  3DLK A;  3L2V A;  4C1N K;  3CQZ K;  1TWF C;  1EXQ A;  1JXE A;  1KAY A;  2FBT A;  2XRI A;  3AQP A;  1KXP A;  3L0Q A;  3MXJ A;  4KH4 A;  2OCE A;  3MEG A;  3DLR A;  2RE2 A;  4HUE A;  4E7L A;  2O8E A;  1DTQ A;  1EET A;  5HBM A;  4A2B A;  3VA3 A;  4DR4 K;  1RT1 A;  2HHS A;  2FBX A;  4CD3 A;  3NHG A;  5IP7 C;  3R9P A;  4CGH A;  1SFO A;  1YNJ A;  3HOV C;  4A5B A;  2XO7 A;  5IWA K;  3CCJ N;  3B8A X;  1G15 A;  5AZI B;  2IGI A;  4A3C K;  1VSI A;  2QKB A;  1HLU A;  4KO0 A;  4BRF A;  4DQP A;  4BKW A;  3MXI A;  3HPG A;  3VQ7 A;  1Q9X A;  3DLB A;  1DT9 A;  2YNG A;  1MU2 A;  1O29 A;  4A3J K;  1CZ9 A;  3C7N A;  3SJH A;  4BRP A;  4CJT A;  4YOU A;  3NH2 A;  3L3V A;  3BGR A;  2UU9 K;  2BE5 A;  3MN9 A;  3M3Z A;  2CH5 A;  3ZEU B;  3WQU A;  1OVQ A;  4CHN A;  3O4W A;  1SUQ A;  4LD0 A;  4CK3 A;  1J6W A;  5AZJ A;  1S1W A;  1E3M A;  4IOC L;  4N41 A;  1ITG A;  5BN9 A;  4FZY A;  5JFE A;  4ELT A;  3EE9 A;  1VQ8 N;  3HP6 A;  3T1A A;  1Q18 A;  4XH5 A;  4FWP A;  2R93 C;  1IKV A;  1KAX A;  3K5M A;  2HBL A;  3OYJ A;  1BA0 A;  4DSL A;  4B1V A;  2RN2 A;  3RSE B;  1UA0 A;  3J7Y P;  3E1Y A;  3KKR A;  1A5X A;  4B9V A;  2NRW A;  4O2D A;  5AQW A;  5IP7 K;  1S6Q A;  1UAX A;  5C3E C;  3RTV A;  2BDP A;  4J2B A;  4C8K A;  2BAN A;  2W40 A;  4GVM A;  4E7J A;  4WQ5 A;  3VQD A;  2E2H A;  2Z1H A;  3CG7 A;  1SQK A;  1QSL A;  4CE9 A;  4CJF A;  4DTO A;  4FLZ A;  3G10 A;  2DFH A;  1TUY A;  1NGH A;  3BP8 A;  3HOS A;  3WOD A;  3GTJ C;  4YY3 K;  1J5E K;  4DSI A;  2E2N A;  3THX B;  5EY4 A;  1TWH C;  1VQL N;  1JLA A;  4OIQ A;  4BVO A;  3OJS A;  3KD1 E;  5C2D A;  4H4M A;  2H3G X;  3VET A;  3KK3 A;  4DTS A;  4YOT A;  2V6T A;  4OLA A;  3OYB A;  4RW6 A;  2GUI A;  1HQU A;  3TAP A;  4CEZ A;  4FJI A;  2QKK A;  4FJH A;  3O5B A;  3FFI A;  1NK7 A;  1CLQ A;  4C8L A;  4WCE L;  4X64 K;  4M3R A;  4CIE A;  3R6M A;  3AAP A;  3TAQ A;  1IH7 A;  4FLY A;  5EGE A;  1ZC6 A;  2O8F A;  3KHY A;  3OY9 A;  4C3J K;  1MWK A;  1SMY A;  3BP3 A;  3LPX A;  4E89 A;  5AQY A;  4EAH D;  2YI1 A;  1YHQ N;  1GLJ O;  3HI0 A;  4DHY A;  1WQF A;  4A3K K;  4FWO A;  3CM5 A;  5AQU A;  1R0A A;  1HQE A;  4E0D A;  2Y3P A;  1TKT A;  1X1P A;  5SZT A;  3S16 C;  1NBW A;  4F3T A;  5GIP A;  3S15 C;  3GTM C;  2KLA A;  4XIU A;  1YIJ N;  3S9H A;  2PAV A;  3DMJ A;  4YOY A;  1VH2 A;  2GSN A;  4FM1 A;  5IYC C;  1F9N A;  1CXU A;  1GE9 A;  2WFB A;  3W0L A;  2E2H C;  3J7A P;  4CZG A;  3VN5 A;  4BRD A;  1QS4 A;  3A8J A;  3HXA A;  1R9T A;  1QZ5 A;  2DY4 A;  2NVT K;  5AZJ B;  4BR0 A;  1RT4 A;  5CZ2 A;  4LF8 K;  2PA8 D;  3S1R C;  2B6A A;  2VCP A;  1JLQ A;  4DS4 A;  4FZX C;  1ZQ1 C;  3CCR N;  4CZL A;  4K42 A;  1U48 A;  4CHY A;  1USM A;  3HXM A;  4A61 A;  4B1Y B;  3DXM B;  1YVU A;  1TWA K;  3GTG C;  2JA5 A;  4DSK A;  4IDK A;  5IOS A;  3H3N O;  1OVY A;  1RIL A;  1VQ9 N;  4KN7 A;  5TMF A;  1RBS A;  1RCH A;  4UQG A;  3C65 A;  3JST A;  3D2F A;  2P9I B;  3V1O A;  3OYF A;  2ZF5 O;  3D2E B;  3V9U A;  4A93 K;  3OVN A;  4DLE A;  1RTJ A;  1VHX A;  4NYN A;  3O3F A;  2A6A A;  3HKZ D;  3L2R A;  2NNW A;  4JK8 A;  4GTC A;  1LWF A;  2P9N A;  3ITH A;  4KH5 A;  3WNG A;  3AD7 C;  4ISG A;  2PPB A;  2XY6 A;  4BDZ A;  4LQY A;  1XPP A;  1Z25 A;  4MEY A;  4I7F A;  4RTF D;  1L3T A;  1RT5 A;  2IOC A;  3OYN A;  4KC6 A;  3ERE D;  3HOY K;  5M1N A;  3OEP A;  4OIO A;  3RZO C;  1GLE G;  2KZZ A;  4DWI A;  2KHO A;  3DXK A;  3K58 A;  2WAQ L;  4QIW L;  4BY9 C;  1QQC A;  3E9P A;  3F9K A;  3O1W A;  1R9T C;  4CFD A;  3Q7C A;  3VEX A;  2QWQ A;  4K41 A;  3V1R A;  4GTE A;  3QIO A;  3ZSZ A;  4FM0 A;  2UUC K;  1O28 A;  3O9S A;  1YTA A;  4I6M B;  5I9E B;  3OYM A;  4O0J A;  4DQS A;  4J2A A;  5M3M K;  1G99 A;  3O80 A;  4J8F A;  2FSK A;  3QNO A;  2G8U A;  2VQF K;  1RBT A;  5M1F A;  1BQN A;  4KH6 A;  3VGK A;  2UUB K;  4WIL A;  3AO3 A;  2BTF A;  4KAT A;  1LWE A;  3SZ2 A;  3IFR A;  1B9D A;  3ZX0 A;  3IKM A;  2HBK A;  1QQO A;  3OYH A;  3UIQ A;  3GSI A;  4MO4 A;  2IS3 A;  1IE0 A;  4K25 A;  1NKC A;  4DF4 A;  2D0O A;  1NJW A;  3GTG K;  1C6V A;  5CYQ A;  3ATV A;  2X6S A;  3UKR B;  3T7Z A;  4BRI A;  4KRF A;  3CMA N;  4OPK A;  4ISF A;  3OYI A;  4W5R A;  4WFB L;  3KLH A;  3PIP L;  3PX0 A;  3KTQ A;  2NVY A;  2X78 A;  1S9E A;  2ZJR L;  2NVT C;  2YHW A;  4DFP A;  3B6O A;  1VSJ A;  5GAD P;  4DV1 K;  3ZET B;  4KB1 A;  3WXJ A;  3HOT A;  1NGD A;  2VGM A;  3LL3 A;  1L3U A;  3G4C A;  3GTJ A;  1XZQ B;  3HOX K;  4JI8 K;  5C4X K;  4OIR A;  4YOW A;  4BE0 A;  4PAA A;  3S15 K;  5E26 A;  1IKX A;  3E01 A;  4A3D C;  5DM7 L;  4BDY A;  3DOL A;  4LF7 K;  4KN4 A;  5AQH A;  5HRS A;  1JCF A;  2QWR A;  3D45 A;  4BBS K;  3U4L A;  5TKW A;  1QVG M;  3ADA C;  2O4I A;  4EZ9 A;  4G0W A;  4WJ4 A;  1T44 A;  2JA7 C;  4KAS A;  1Q9Y A;  4BY1 C;  3FZK A;  1WCM K;  3J81 O;  1E4F T;  3O4N A;  3VQQ A;  4FWS A;  1Q7Y O;  1KSP A;  4GTF A;  3W3D A;  3AAQ A;  4FW2 A;  4H0Y B;  4B3T K;  4AHV A;  5C4J K;  2JA5 K;  1RDW X;  4FL9 A;  2P9P B;  2ITG A;  1OH8 A;  4KMD A;  4I2P A;  2B63 A;  1MDU B;  4ILG B;  1O27 A;  4H0X B;  2E5L K;  3PSF A;  4BRK A;  3PO5 A;  4GV6 A;  2W7V A;  3SUN A;  3THY B;  4CGG A;  4G7Z A;  5KRS A;  4HTU A; 
#chains in the Genus database with same CATH homology
 3G4A A;  3G25 A;  2WUS A;  4H0O A;  4U67 L;  4WFN L;  2QWO A;  1YIT N;  3J8A A;  1WQG A;  5DM6 L;  3FKI A;  3VF6 A;  1K8K B;  3I56 N;  4FWQ A;  1YXQ A;  2ZJQ L;  2GSU A;  4BR5 A;  5FPD A;  3MCP A;  3D2F B;  2NRZ A;  3CCQ N;  2CGL A;  1XXC A;  3LAP A;  3MWT A;  3UKR A;  4QS9 A;  3VGL A;  4KB4 A;  3MCA B;  3S0X A;  5JIC A;  4CZH A;  1BG3 A;  3VA7 A;  5F1X A;  1YUW A;  2V7Z A;  3H45 C;  4BR9 A;  5C2F A;  1SAZ A;  4CI6 A;  1BUP A;  2E1Z A;  3MN7 A;  1KD1 O;  4PKI A;  4BC3 A;  3ENB A;  4GTF A;  3HBT A;  5AQX A;  2E2Q A;  1QZ6 A;  2QTD A;  3IDH A;  1U2V A;  4H0V B;  3SMS A;  3VF4 A;  3OW2 M;  4BC5 A;  3GTP A;  2JA7 A;  5M1K A;  1S3X A;  2ASP A;  2IVN A;  3IMX A;  3VEV A;  5AQQ A;  3Q3Q A;  3U9D A;  5EOY A;  4C23 A;  3ZEU A;  3J7Z O;  5AQF A;  1RFQ A;  3K9K A;  1U2V B;  3BUE A;  3WXI A;  4KDD A;  4RCH A;  2CFA B;  2QWL A;  1K83 A;  4FPA A;  2GWK A;  1VQM N;  3VER A;  4BR4 A;  4EHT A;  5AQS A;  2P9U A;  4WF9 L;  2NRX A;  2HBM A;  3LM9 A;  5JLH A;  5EVZ A;  2V52 B;  4A62 A;  3CCS N;  1NGG A;  1VQO N;  4JD2 B;  5AQR A;  3G71 N;  3ULE A;  3VTH A;  1VAZ A;  2ZWH A;  3QFP A;  3D2E A;  3QX3 A;  5AFU H;  4YOX A;  3L4K A;  3TTC A;  1P90 A;  3O9Q A;  3CIP A;  4FWM A;  4ILJ A;  4OPH A;  4GTB A;  1EH1 A;  1VQP N;  1VQ4 N;  4GT9 A;  3HTV A;  4Z94 A;  3O8M A;  1T3V A;  3CJB A;  3VEN A;  4B1U B;  1VQ6 N;  3ZET A;  1EK8 A;  4H03 B;  4HTL A;  5AQV A;  1MWM A;  1YJW N;  3QFU A;  1TWG A;  3VEY A;  2W41 A;  2P9P A;  1O2A A;  3CQZ A;  4DCH A;  1ZVU A;  4NO7 A;  4BRN A;  1BU6 O;  4JKH A;  2NRT A;  2E2I A;  1YVN A;  4ILD A;  2HMP A;  2DPN A;  5KQD A;  3N0B A;  3FHZ A;  3CCU N;  2Q0U A;  4IXC A;  4B1W B;  1YJN N;  1JJ2 M;  2RH6 A;  2YJF A;  3R3L A;  4BC2 A;  4FZB A;  2QWN A;  1K8A O;  2F9T A;  1HKG A;  4YDU A;  4BQZ A;  4F9O A;  1BOT O;  5BPM A;  1K8K A;  4ILH A;  3U8X A;  4BGB A;  5CE3 A;  4BLB A;  1OKJ A;  2R93 A;  3IUC A;  2Q2R A;  1HX1 A;  2AP1 A;  1EQY A;  3FGU A;  4PKG A;  4BRM A;  3VEZ A;  4IJN A;  5H1S Q;  3SBG A;  1RDU A;  4YOV A;  1K9M O;  3UE5 A;  4BR2 A;  1BWF O;  1GLC G;  2PBD A;  2YHY A;  4BRA A;  1NGJ A;  1SZ2 A;  2IVO A;  3D7E O;  5AQL A;  2NLX A;  1ATN A;  3H6E A;  3CJC A;  1O2B A;  1XXB A;  1C0F A;  1NGE A;  2NRR A;  4JKD A;  3CME N;  1IS1 A;  1W97 L;  2P9K A;  4P5B A;  5LJV A;  3BUZ B;  3E9L A;  3OBW A;  1LOT B;  4MLH A;  4BRC A;  2QA4 N;  1WUA A;  5AQJ A;  4H5T A;  2P9L A;  3KVG A;  1E4G T;  4GY2 B;  4JAX A;  3O08 A;  4CZK A;  3UB5 A;  4BG9 A;  4JN4 A;  4GTA A;  4C1N K;  1BGW A;  4ISE A;  3C6A A;  3TTD A;  4P5A A;  1KAY A;  2ASM A;  2PHC B;  1KXP A;  3L0Q A;  3EN9 A;  4KH4 A;  2HOE A;  4U7B A;  4WYB A;  3AQP A;  2RE2 A;  4FWR A;  3FLC O;  3WXM B;  3NVK A;  3TSU A;  4A2B A;  3WXL A;  2FXU A;  2P9S B;  4KMH A;  3SAG A;  5BPL A;  4CD3 A;  1NGI A;  5GAE P;  3R9P A;  4J3N A;  4G0U A;  2QWP A;  4G9Z A;  1SFO A;  4L3Q A;  3OBY A;  4IEE A;  4JD2 A;  4A5B A;  4RWT A;  3CC2 N;  2HBJ A;  3VGM A;  2VGN A;  3B8A X;  3CCJ N;  2A40 A;  4LR2 A;  5AZI B;  4KM9 A;  3FE1 A;  1NMD A;  1YF5 L;  3LDL A;  1Q82 O;  4BLA A;  1HLU A;  3H1Q A;  1TWC A;  4MLE A;  2VWB A;  2RHK A;  3C7N B;  2P9I A;  3DJC A;  3KK7 A;  4BRF A;  4BKW A;  4FO0 A;  4GNI A;  2P5M A;  1DT9 A;  4XH4 A;  3I33 A;  2V51 B;  1DKG D;  1U6Z A;  2CGJ A;  2YJE A;  3CXC M;  1O29 A;  1WIH A;  4H0T B;  4KAR A;  3CJ1 A;  4FOE A;  3C7N A;  2XCR B;  3SJH A;  3RSE A;  4BRP A;  1XUP O;  4GV3 A;  2VYP A;  4AM7 A;  4BVP A;  5IOT A;  4YOU A;  1TWF A;  2R92 A;  3MN9 A;  2CGK A;  3M3Z A;  2CH5 A;  3ZEU B;  3WQU A;  4HWI A;  1KC8 O;  3O4W A;  2IVP A;  1KAZ A;  4WFA L;  1KQ4 A;  5F0X A;  3CCL N;  4O5F A;  4NLB A;  5AZJ A;  4KB2 A;  3H46 O;  1ILY A;  3GG4 A;  3OA9 A;  2E1Y A;  3TTF A;  4IOC L;  3VES A;  5JMV A;  5JFE A;  5BN9 A;  2P9U B;  4H5N A;  4G0V A;  3EE9 A;  3TPQ A;  3G4S N;  1VQ8 N;  4C2M C;  2JWL A;  3VOV A;  4WQ5 C;  1AB4 A;  1QVF M;  5AR0 A;  3EL2 A;  2OAN A;  2NZT A;  5GIO A;  1Q18 A;  4XH5 A;  4K43 A;  3FZF A;  4FWP A;  4NLC A;  2F7T A;  1KAX A;  3EKS A;  5HL7 L;  3GTQ A;  5JLF A;  2HBL A;  3N3Y A;  4YDU C;  3GBT A;  1BA0 A;  5AQG A;  4BRE A;  2F9W A;  4B1V A;  5BRE A;  4FM9 A;  3GTO A;  3RSE B;  3N4P A;  4MDB A;  1YI2 N;  3TSP A;  2NVX A;  3E1Y A;  3A5L C;  2NRW A;  3SLC A;  3CD6 N;  1I50 A;  1Y1V A;  2Q31 A;  5AQW A;  1NJI O;  3CCV N;  1V4T A;  3CPE A;  3G6E N;  4B9Q A;  2ITM A;  1HUX A;  2W40 A;  3ATU A;  4WQ5 A;  3LAJ A;  4IO9 L;  2E2H A;  1NM1 A;  3GDQ A;  3GOI A;  4CZJ A;  1SQK A;  3ZX3 A;  1TYQ B;  1GLL O;  4NB4 A;  1TUY A;  3V4G A;  1NGH A;  4IZ9 A;  3BP8 A;  1KQS M;  3N0C A;  5IOR A;  3AH5 A;  3HOS A;  3P38 A;  4IFE A;  2E2N A;  1DEJ A;  3C6H A;  2D4W A;  5BRD A;  2GX9 A;  1HKB A;  5EY4 A;  1H1V A;  4WQ4 A;  1J6Z A;  1VQL N;  2QM1 A;  1WQH A;  3A5N C;  1VQK N;  3LDO A;  1I3Q A;  4BVO A;  4IO8 A;  1NGA A;  4A57 A;  5C2D A;  2H3G X;  5E84 A;  5CHP A;  3OHR A;  3VEW A;  5JVG L;  3VET A;  4YOT A;  4DKW A;  1M90 O;  1O13 A;  5AQM A;  1DD5 A;  3ZX2 A;  4LC9 B;  3BF1 A;  1X9J A;  3ENO A;  2KWA A;  2Q36 A;  3AAR A;  4CBU A;  4PL7 A;  3NVM A;  3NMU A;  1C0G A;  2J4R A;  1ATR A;  3PIO L;  2GEL A;  4IEI A;  3UKU B;  4C1N I;  3GL1 A;  3O5B A;  3CJA A;  4EIA A;  5M1P A;  5TJ3 A;  4JK9 A;  1NGB A;  3GTG A;  3VTI A;  2VUM A;  5GIN A;  2ZJP L;  3FZH A;  4WCE L;  5BR9 A;  2JA6 A;  5C12 A;  3SMP A;  5B8H A;  5C0Y A;  3MML B;  1MA9 B;  2P9N B;  2ASO A;  3H0G A;  4CZM A;  2QW9 A;  3P39 A;  3R6M A;  3AAP A;  5EGE A;  4A5A A;  1ZC6 A;  4JEP A;  4BG8 A;  2AA4 A;  3KHY A;  1MWK A;  1TWA A;  1NLV A;  3LPX A;  4EAH D;  5AQY A;  2E88 A;  3VF2 A;  2YI1 A;  3PLA A;  3P4I A;  1YHQ N;  1GLJ O;  3HI0 A;  1BDG A;  4DHY A;  1B4B A;  4FWO A;  3EE8 A;  5AQU A;  1WQF A;  1TWH A;  5ELZ A;  3F2K A;  2Y3P A;  3ZYY X;  3MMV A;  5AFU A;  3ORE A;  3LDP A;  1NBW A;  4AM6 A;  4OO1 J;  3DXM A;  1ESV A;  5BPN A;  3LDQ A;  5C15 A;  3ULE B;  5GIP A;  1N8R O;  1M1K O;  5FPN A;  1S72 N;  3I8B A;  5LY3 A;  3HRG A;  1W2B M;  1GLA G;  2KLA A;  2QEX N;  1YIJ N;  2PAV A;  4YOY A;  4FWK A;  2GSN A;  4PKH A;  4BRQ A;  2GSO A;  1F9N A;  4I6M A;  5GAH P;  4C3J C;  5BRF A;  5EX5 A;  4DQ8 A;  1GE9 A;  2WFB A;  3SBT A;  3W0L A;  1T6D A;  4CZG A;  2JWK A;  3TSQ A;  3CER A;  4IJA A;  1VQN N;  4IOA L;  1QQM A;  4MDA A;  4BRD A;  2A5X A;  1X3N A;  1R9T A;  1QZ5 A;  5AZJ B;  4BR7 A;  4FVU A;  4BR0 A;  3HM8 A;  3ID6 A;  1QQN A;  4BRO A;  4JNE A;  5AQZ A;  5AQN A;  2VCP A;  1BA1 A;  2D1K A;  4KBO A;  2CH6 A;  5BRH A;  3CCR N;  4CZL A;  4IOX A;  2NRV A;  2IIR A;  2CFA A;  5AQT A;  4K42 A;  2YCH A;  3AY9 A;  4OPA A;  4GFQ A;  3A8Y A;  1IG8 A;  2OTJ N;  4A61 A;  4B1Y B;  3DXM B;  2Q97 A;  4BGA A;  5KPZ A;  4QS7 A;  3CJ9 A;  1YJ9 N;  2JA5 A;  4JKA A;  2YHX A;  3H3N O;  5EXW A;  2KKZ A;  1OVY A;  1VQ9 N;  3O9T A;  4M7X A;  5IOS A;  4Y0W A;  3E66 A;  4BRH A;  2UYT A;  4CZF A;  1HKC A;  4CZI A;  3C0B A;  3C65 A;  4A2A A;  2E20 A;  2P9K B;  2P9I B;  3D2F A;  3WQT A;  2ZF5 O;  3D2E B;  4B1X B;  3CPW M;  1RGI A;  3CC4 N;  3QML A;  1Y64 A;  3VEO A;  4FWL A;  3DWL A;  2P9L B;  2A6A A;  4XH1 A;  3LDN A;  2NNW A;  4JK8 A;  5AQP A;  4DB3 A;  2GTD A;  4O8U A;  1XC3 A;  2E8A A;  2P9N A;  4M7Y A;  4GTC A;  2Q0R A;  3O1B A;  4KH5 A;  2EWS A;  3N4Q A;  4ISG A;  2JH3 A;  2WC9 A;  3MWP A;  4LQY A;  2QWM A;  3MX2 A;  5FPM A;  2YU9 A;  4C3I C;  5FPE A;  1NGF A;  2GWJ A;  3FZM A;  4RTF D;  2BH1 A;  4KC6 A;  3Q7B A;  4GTD A;  2E2O A;  3ERE D;  4H5R A;  5M1N A;  5F2R A;  3QB0 A;  3MN6 A;  4JKF A;  1GLE G;  3H1V X;  3DLL L;  3OEP A;  4C3H C;  2KHO A;  1V4S A;  3DXK A;  4AF1 A;  1WCM A;  4BY9 C;  1ATS A;  3E9P A;  3K9J A;  3OPF A;  3L4I A;  3O1W A;  4EHU A;  2GEM A;  3BF3 A;  2QI2 A;  3Q7C A;  3CCE N;  3VEX A;  1HPM A;  2QWQ A;  4K41 A;  3ENH A;  1ISE A;  2BUP A;  3M6G A;  4GTE A;  3U9Z A;  3FFK B;  3QBX A;  1T6C A;  4JKG A;  1O28 A;  3O9S A;  4FPB A;  4A59 A;  4I6M B;  5I9E B;  3SK3 A;  5ADX A;  3EO3 A;  3O9U A;  1Z05 A;  3KWI A;  4PHT X;  1BJT A;  1NGC A;  1G99 A;  3O80 A;  3UKU A;  5EGH A;  1JCG A;  4FSV A;  4J8F A;  2FSK A;  4KMA A;  4JKG B;  3WUH A;  3WXK A;  3WEE A;  5ADX H;  5LJW A;  3CC7 N;  4CJ7 A;  1R59 O;  5AQO A;  5M1F A;  1S22 A;  2A42 A;  5KPT A;  1ZXO A;  1SS6 A;  2R7Z A;  1TYQ A;  3VGK A;  4KH6 A;  4H5W A;  4KAT A;  2BTF A;  1IJJ A;  1YAG A;  3IFR A;  3MDQ A;  3R8E A;  4E1J A;  2A41 A;  2HST A;  1HJO A;  3LM2 A;  5IOQ A;  3ZX0 A;  3IKM A;  2HBK A;  1QQO A;  3KZB A;  3CF5 L;  5M1O A;  5CJ9 A;  5JVH L;  2GUP A;  1LCU A;  2A3Z A;  3D6R A;  3GTM A;  4MO4 A;  1CZA N;  2ZFZ A;  1GLD G;  3AGR A;  4K25 A;  5M1Q A;  4BRL A;  4JKC A;  2ZGZ A;  4JKB A;  1Q81 O;  3E9O A;  4M1X A;  2E2P A;  2D0O A;  3TU5 A;  1EO1 A;  1X3M A;  3MX5 A;  3R1X A;  3WT0 A;  5C10 A;  3ATV A;  2YX6 A;  3RVC A;  3S41 A;  3UKR B;  1O26 A;  3T7Z A;  4KAW X;  4DDQ A;  3QIC A;  4XEI A;  3EZW A;  1Z6R A;  4BRI A;  1P8Z A;  1XQS C;  3H3O B;  4JKE A;  3T69 A;  2HF4 A;  4CZE A;  3CMA N;  1Y1W A;  4ISF A;  3F9M A;  3A5M C;  3KWG A;  3M5R A;  4H5V A;  3JS6 A;  5GAG P;  5BN8 A;  4WFB L;  1Q86 O;  3PIP L;  1XXA A;  2D0P A;  3GTK A;  1JCE A;  2NVY A;  2I7N A;  2Q1N A;  4JK7 A;  4IWV A;  2ZJR L;  5CHI A;  2YHW A;  5GAD P;  1TUU A;  4O8K A;  4WQ4 C;  2I7P A;  3JXU A;  2OTL N;  3ZET B;  3L4J A;  2NRH A;  3WXJ A;  3HOT A;  1NGD A;  2VGM A;  4FWN A;  3VMF B;  3LL3 A;  2XCQ A;  5AQK A;  3G4C A;  3FOF A;  3HZ6 A;  3DXK B;  4H0P A;  5TKY A;  5HOO A;  3GE1 A;  3GTJ A;  3FOE A;  2PFU A;  3CQY A;  3HSC A;  4JHD A;  5MLC Q;  4M63 C;  3A0I X;  4YOW A;  3M1F A;  2QXL A;  2FF3 B;  5E26 A;  2P9S A;  4GVE A;  3A5O C;  1NWK A;  4B1Z A;  1B4A A;  5DM7 L;  2FSN A;  4BRG A;  3BEX A;  1WOQ A;  4JHD B;  4R79 A;  3CET A;  5AZI A;  2FF6 A;  2HF3 A;  3O9R A;  3AQO A;  4BQL A;  3GTL A;  5AQH A;  4EFH A;  4UY8 O;  3NUH A;  1GLB G;  3I55 N;  1JCF A;  1ZBS A;  3SAF A;  2QWR A;  3WEE B;  3U4L A;  5TKW A;  2RGR A;  1QVG M;  4CBW A;  4G0W A;  3MN5 A;  3CJ7 A;  5KPR A;  1K73 O;  3QDK A;  1O25 A;  1T44 A;  4KAS A;  3FZL A;  3L4Q A;  3MK6 A;  3FZK A;  4PL8 A;  3DAW A;  2WBN A;  3CHW A;  4GV9 A;  1E4F T;  3L6Q A;  3P31 A;  3O6W A;  4FWS A;  3AGK A;  4BC4 A;  1Q7Y O;  1VQ7 N;  5CR4 A;  3W3D A;  1QHA A;  1O24 A;  3AAQ A;  3ID8 A;  4CD1 A;  4H0Y B;  1DGK N;  5AQI A;  1RDW X;  4FL9 A;  4YOR A;  2FLO A;  2P9P B;  3F5T A;  4KMD A;  1VQ5 N;  2ZGY A;  1BO5 O;  2B63 A;  1D4X A;  1MDU B;  1GLF O;  3CI5 A;  3EKU A;  3FR0 A;  4ILG B;  4CBX A;  2XCO A;  1O27 A;  4H0X B;  4KM8 A;  3VPZ A;  4BRK A;  3CQX A;  4GTL A;  4GV6 A;  4QS8 A;  5KQ8 A;  3SAH A;  3CCM N;  5JVO A;  3CAG A;  2V7Y A;  4MO5 A;  4FOI A;  3QBW A;  2FSJ A;  4IDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...