3V4GA

1.60 angstrom resolution crystal structure of an arginine repressor from vibrio vulnificus cmcp6
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
151
structure length
145
Chain Sequence
KQDNLVRAFKALLKEERFGSQGEIVEALKQEGFENINQSKVSRMLTKFGAVRTRNAKMEMVYCLPTVSSSLRELVLDVDHNQALVVIHTGPGAAQLIARMLDSLGKSEGILGVVAGDDTIFITPTLTITTEQLFKSVCELFEYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.60 Angstrom resolution crystal structure of an arginine repressor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Dna binding protein
molecule keywords Arginine repressor
total genus 51
structure length 145
sequence length 151
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v4gA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3v4gA02
4EJVA 3RTRA 1S29A 4XLPF 2UWMA 5LHIA 5E17F 2AXLA 4WX9A 2NRAC 2EFQA 3ML6A 2CW0F 4BH9A 3CJNA 2K86A 5D6EA 5D5VB 2MC3A 1KYZA 4EM0B 5FLXK 5E20A 3O3KA 2JT1A 3F6VA 3HIFA 2RGRA 3GUDA 3ZMVA 1U5TB 3WE3A 4BQAA 1O3QA 4KICA 4BYYA 3F8FA 2P7CB 2LKPA 2M45A 1HSTA 5LRRA 2AS5F 1K79A 2ZBKA 3IWZA 1E17A 1IN5A 3ZMZA 3WODF 5H6RA 5ICEA 1W5TA 4KN7X 4M9XA 3F8MA 1EK8A 1FLIA 2A68F 4R79A 3DPTA 2H6CA 2A61A 4G9YA 5FO5A 5DCMA 2Y0MA 3HTUA 4EQQA 1KQ0A 2DBBA 2H6BA 1BOAA 5DCMB 1TTYA 4G0WA 2DPDA 4MHGA 1E2XA 3WE2A 1XGOA 2G7UA 2ZMEB 5DEQA 1G4DA 3I64A 3N97A 2STWA 1GXQA 3KLOA 2O03A 4HQEA 1SMTA 1Z1DA 5BPIA 4IPAA 2XIGA 5IT9K 1RI7A 3OV8A 1XGMA 2OQRA 3GZ5A 3QPHA 2HR3A 1ODDA 4M6YA 1IS1A 2VXZA 5ERIA 2ESNA 4KIFA 1WQHA 3I59B 4QWQA 3H3UA 4KMFA 2HWVA 4KB2A 2ZNZA 1OR7A 4L18B 4UVAA 3JSPA 5ICGA 1K78A 3TKYA 4IJAA 3IKTA 3HRMA 2D1VA 4UV9A 1K7AA 2ZFWA 4UVCA 2RC4A 2DQRA 1USTA 4ENMA 2VT3A 4YFNF 2M8EA 2VOPA 4HQMA 1K6OA 4R8HA 3VFZA 3CAGA 3HYIA 5E8GA 5DUIA 1J59A 2V1UA 3F23A 1KA8A 1KQ9A 1Z05A 5DD4A 1ZG5A 3FZVA 3MAJA 2HQNA 3V7CA 2UXNA 4R1HA 1P4WA 1YFHA 1ZLJA 4HF0A 2O8XA 1R5GA 3VB2A 1F1ZA 4WXHA 2EFOA 4UXNA 1B6AA 1B59A 2J5PA 2E1NA 3LQQA 4L5JA 1FYMA 2PLYA 4FM9A 4L9VA 3TO6A 4HV6A 1YLFA 3KEQA 4MTDA 1OPCA 2NS0A 3TO9A 3W6KB 3FHZA 3IRRA 3ABUA 5BPDA 3SQNA 5BQTA 2O0YA 2IPQX 3KP7A 1HQCA 2DPUA 4MTEA 3GVAA 5F6FA 1LEAA 4IRGA 2RKHA 1XSXA 4KB4A 1IRFA 5D5WB 2EV5A 1XXCA 4LLGF 1LNWA 3P9CA 4FHTA 3P7NA 5CVJA 5CVIA 1S8NA 3F8NA 2P6SA 1FBSA 1HBXG 1ULYA 1T38A 5L3EA 3W6JB 3T8RA 1HW5A 4UNOA 1FSHA 2ACJA 3FM3A 2H09A 2OD5A 3HSEA 4O5VA 2A3SA 2BE5F 3MQ0A 5ILVA 2LDUA 5CVRA 2XCQA 3GW2A 3NUHA 1BI0A 3LA3A 3K0LA 1TQPA 3GFLA 3SXYA 5K5QA 2XKOA 4Q48A 4PCQA 3KETA 1ON2A 2F5CA 4K2EA 2JZYA 1R23A 2VBXA 3P9KA 1YQAA 3D0SA 3E5UA 4ZYHA 1JXSA 2OQGA 2DU9A 3NQOA 4HV5A 4XLNF 1H9TA 2GA1A 1YW7A 5FFZA 5L3GA 2BEOA 1Z6RA 4HF2A 5E8IA 3VODA 5DV5A 2GA2A 2L54A 4NB5A 4BAYA 2DO7A 3H3ZA 4CXFA 1PDNC 4LD5A 4XSZF 5LGNA 4WXCA 1DPUA 1W7PA 4ENJA 3BZ6A 2X4HA 4A0XA 1R22A 2QBYB 1B4BA 3E97A 4HX7A 3LA2A 3BDDA 4MNUA 2VBYA 2V79A 1XD7A 4YIIA 2RVCA 1JE8A 4IRHA 2YU3A 2V6CA 3HSRA 1R1TA 2EFPA 2FU4A 3MFKA 4WXDA 5HLHA 4KYWA 1WKMA 2L4MA 4M9SA 1DD5A 4M71A 5FGMA 1PP7U 2VC0A 5AONA 4N9IA 3KEOA 3LSTA 2P5LC 4L9NA 2Y48A 4WF2A 3MEXA 4LLNA 5HLGA 1O3TA 4WWCA 4LGWA 1QBJA 2DK8A 3R0AA 1IZ1A 1R00A 3VOEA 1O3SA 4M9ZA 1Y0UA 3R6SA 2M87A 4A12A 4LJZF 4EJUA 3BPXA 4M6XA 1ZG3A 3JW4A 3ZN0A 4CZZA 2QQBA 2M30A 1BI1A 1QZYA 3KCCA 1YS6A 2DFIA 2XGXA 3K1MA 2FF4A 2L02A 3ZMDA 1OYIA 4AD9A 4MQ9F 5CJ9A 3QRFF 4EGZA 3ZQ7A 3IRQA 2KRFA 3FMSA 3GXOA 5J6XA 1R58A 3PQJA 4RGRA 2NNNA 2LF7A 1F5TA 5JHUA 2QUFA 1IN7A 4LLLA 4NHJA 4ETSA 4YIFA 1IN4A 2FEZA 3GFMA 2DT5A 1IXCA 4AVPA 1B9NA 1I6XA 3V7SA 1QZZA 1LDKB 2YSRA 1LJ9A 1SFXA 2Z99A 3V8KA 2ZXJA 4ZH4F 3E3VA 1WQFA 1J9IA 1D5VA 4AIKA 3R60A 3F72A 1ISEA 2H27A 1GXPA 4KAWX 2HKXA 1UHWA 2XV4S 1TNSA 5D8KB 1FX7A 2LNBA 3L09A 1QO0D 3M7GA 1GE9A 1ZREA 3NRVA 3BP8A 4G94A 5HS7A 2OZ6A 1IN6A 1LVAA 4DDQA 3JSOA 1XDSA 3WTVC 1STZA 5K5RA 3B73A 1XXBA 4YFXF 3WU1B 4OINF 1I5ZA 1YO5C 2QM3A 2J5OA 4BHCA 2K4JA 3RKWA 1BC7C 5FLXZ 3GFJA 2FBHA 1BM9A 2XKPA 5JI6A 3BJOA 1SD5A 3ABTA 3OOPA 3M9AA 5FFXA 2MLKA 1RIOH 4IVNA 2CQKA 2QENA 2M1BA 1JHHA 3WG9A 4ZZLA 1FOKA 1T98A 1FZPB 2W24A 3HUGA 5L3BA 2A6HF 2PG4A 2PQ8A 3I54A 1BJAA 3C1DA 5H6QA 1XN7A 3GZ6A 3QU3A 1WRJA 2NAZA 4J3NA 1OYWA 1OMIA 2CSOA 2WWYA 2PHCB 1P92A 3IHUA 3J7AO 3FMQA 2VBZA 1G3TA 2YPRA 1PP8F 3MCZA 1FPQA 3V8JA 1U6GA 2FOKA 5ICCA 3FOFA 5A2QZ 1YIOA 3MZYA 4CGZA 2FNPA 2ZO4A 3J80Z 2ISYA 5CYVA 5D4RA 4L5IA 4WK8F 3ZP5A 5AIPA 2Z33A 2EA2A 5JVTA 2O61A 5HDGA 1RUOA 4RS8A 1HKSA 3LQRA 4KFCA 4U88A 1I1GA 1R5HA 2QVOA 3AAFA 1D8KA 5DYMA 1SMYF 3I58A 2FBKA 4A0ZA 1YYVA 1B4AA 3C7JA 2KIFA 2FMLA 4JQFA 2WC2A 3DF8A 3SFZA 3KE2A 4MGRA 3HHGA 3K1PA 5LEJA 3FOEA 3QX3A 1BIBA 4UV8A 3HTSB 1XXAA 5K5OA 3FXRA 3PQKA 5K1YA 4M73A 3R61A 4ASNA 1MJBA 3KFWX 3ECHA 2VE8A 1Q1HA 4A6EA 3E5QA 4HLYA 1P4AA 1OKRA 2YX7A 1LB2A 2PBIA 1EH8A 2VONA 4S05A 3CO6C 3FXUA 5BS6A 2ZFZA 4XSXF 2XAFA 1LQ1A 4BNCA 3G73A 2QWWA 3U9GA 3ZMTA 3COAC 3U2RA 1S3JA 2RN7A 3RI4A 2GIVA 1SD4A 4GO1A 3IC7A 3M8FA 1LEBA 5JFRA 3E6MA 5E1XA 1AWCA 5D8LB 4LK1F 3GEZA 4BHPA 2CYYA 3WTUC 3EDPA 3MZHA 4CYDA 1WWXA 1L3LA 2FMYA 4ESBA 1FNNA 1TQIA 4A5MA 2JTVA 2ISZA 2CFXA 4U7DA 1P6RA 2FNAA 3MMLB 4N9HA 2UZKA 1FBUA 5FD5A 2XROA 2ELHA 4U7BA 2IA1A 3KP2A 1MDMA 4B8XA 2HYFA 1O3RA 2X0LA 1I27A 2MA3A 1G3YA 4RGUA 5BMZA 2XAHA 2F5EA 1ZRCA 1QGPA 1G6NA 4G7OF 4MEYF 2GXBA 1K78B 3WTXC 2P5MA 5E1ZB 1F4KA 1I1SA 3CTAA 2EWNA 3BROA 3C3WA 1U2WA 2LSOA 2R3SA 3CUQC 3RJPA 1A04A 3KP3A 4EJOA 3LPXA 3LWFA 4FX4A 3I53A 2BV6A 2VBWA 3EYIA 4G8XA 1IXRC 4LG0B 1LDDA 3BJAA 4IXAA 3LAPA 2IVMA 3SZTA 2Q8KA 1S6LA 1MGTA 2P5KA 3L7WA 1V3FA 3BOQA 2E7WA 1FYKA 3EQLF 2Y75A 4HLXA 4D0PA 1HKQA 4GGGA 1SD6A 3EETA 2W57A 2D1HA 3N4MA 1QNTA 1MD0A 3H92A 2HEOA 5J8FA 3V4GA 3FXQA 1XSVA 1KU2A 1DDNA 5EEGA 2RDPA 2H94A 2CO5A 4TV7A 5DD8A 4HAMA 2Y3PA 4Q5SF 5ICFA 2P4WA 2E1CA 1O7FA 4L0YB 1R7JA 1DP7P 1TW2A 4HX8A 4Q4ZF 2CWEA 4CHUA 3OREA 1UFMA 3BJ6A 5ILUA 1ON1A 1BI3A 4HDVA 4KN4X 2K7LA 4LG0A 4FX0A 1FP1D 2K4BA 4AWXB 3CDHA 4RAYA 4UVBA 4KDPA 2XASA 5HOOA 2FE3A 4OMZA 2KIUA 3KP5A 2GZWA 2HFHA 3WGGA 1VTNC 1EV7A 3GLXA 2Q2EA 3ELKA 5DUKA 2B0LA 2GXGA 2LF8A 4WCGA 2ESHA 1P4XA 3DFGA 2L4AA 3FX3A 3RPUA 1SFUA 3ERED 4ZYEA 4H0EA 3EYYA 2PJPA 5CVUA 3HHHA 2F5FA 2HOEA 2EV6A 1LDJA 5JR3A 2DQLA 2A69F 3GFIA 1BIAA 3JTGA 1AB4A 4S04A 2HYGD 1CF7B 3OEPA 2HGCA 4RB2C 4RB3C 3RDIA 4FT8A 2KJBA 1CGPA 1FSEA 4L0ZB 1SD7A 3TO7A 3JAMK 1REPC 1Z91A 2JSCA 3CUQA 4ZYGA 1W7PD 3GO5A 3T1BA 4G0UA 5D5XB 1XB4A 1HW2A 1B1BA 4LB6B 3ISPA 3HRTA 1W7PB 1GHCA 3I4PA 1RUNA 1IAWA 5FD6A 2D45A 1JGSA 4P96A 1YG2A 4GYIA 1R1UA 3DPLC 4A5NA 2P8TA 3WTSC 2ETHA 4PDKA 1ZG1A 3TDUC 2NNYA 5L3DA 5ILSA 3NEUA 1KU9A 2QZ8A 1MZBA 2G7HA 2DK5A 5LRSA 1HXDA 3TDZC 2F5DA 1UB9A 4B09A 1X3UA 4HF1A 3FM5A 2HTSA 3ROUA 1H9GA 3E6BA 3CLOA 1ZLKA 2OU2A 4KIBA 4CO8A 1J7KA 2DLLA 2JPCA 4CDGA 3BY6A 1FC3A 3T0YA 2IRFG 5IT3A 3KP4A 4ZZDA 2IA2A 1D8JA 4KT5C 3OPFA 1W4MA 2IJLA 4HBLA 2QYOA 2F2EA 1YW9A 1IXSB 3ZMSA 2MD5A 1SAXA 2IA0A 4YG2F 4O3MA 3Q5FA 4HZFA 1FBQA 2VC1A 1ONVA 3K1NA 1XCBA 3QAHA 1FT9A 4KMUX 4P9FA 2FBIA 1DPRA 1JHFA 3ZMUA 5JVOA 1AOYA 3BUEA 3V7RA 4HYEA 4HX4A 4L9JA 2QLZA 5LGTA 3KZZA 4DNCA 2ZNYA 4QLCU 4KUMA 2NYXA 1F9NA 2EK5A 1IUYA 2HQRA 5HDKA 4KDDA 2JRTA 1ZN2A 4ENNA 3F8CA 4ENKA 3F6OA 1BI2A 2O3FA 1Z7UA 3K69A 1FWZA 2V1DA 2A6EF 5AIQA 4ESFA 3D5LA 4I09A 4RB0A 4F7ZA 1J2XA 1YW8A 2VOOA 3TQNA 3L9FA 3CO7C 1HKTA 4U0WA 5E18F 2KKOA 3K2ZA 2OA4A 2V1XA 2QQAA 2M5WA 2IT0A 5F64A 2BBYA 4EJWA 5KK1A 1J5YA 1XMKA 3K9TA 2XVCA 3L4JA 4OIQF 3RYRA 1ZHFA 5IT9Z 2DAOA 3GWZA 4KIGA 1U8RA 1T39A 2IW5A 4NQWA 2MLGA 1ZRDA 2XCOA 3WGHA 1WQGA 2W25A 2P7VB 3O6BB 3QP5A 5LHGA 2P6TA 1RZ4A 1U5TA 4HOBA 4MQVA 3V8LA 4AIJA 1L0OC 4OIPF 1ZVUA 3HOTA 3KP6A 2ZKZA 1Z6TA 5L3CA 4IF4A 2EB7A 2KJCA 4EM2A 3I71A 4DQ2A 2BGCA 2PN6A 5LHHA 2OZUA 1XDUA 3F21A 1U78A 5HVQC 2R7DA 1ZARA 1QPMA 3IKVA 3LA7A 3Q9SA 1W5SA 4XBFA 2DI3A 3L00A 3F22A 1CF7A 4EVIA 2XUBA 6PAXA 3HRUA 3QPTA 3I0TA 1BGWA 4G7HF 1XSDA 3L2CA 4LMYA 1QQIA 4G0VA 4A0YA 4ZYDA 4RAZA 3WTWC 2FXAA 4RB1A 2QBYA 5DCFA 3QOPA 3I59A 2VE9A 2KWAA 1TW3A 1ZGJA 3WTTC 1BN5A 2HKOA 1FY7A 3VA7A 3ECOA 3M1EA 3J81K 1SFEA 4HDUA 4EGYA 1XGNA 5CVVA 4G7ZF 1B9MA 3F3XA 3DKWA 4P55A 3KLNA 2ZMEA 3HOSA 3TOBA 1GVJA 2MBFA 3WTZA 1DUXC 4EJTA 2MH9A 2A5YB 1V4RA 2STTA 5LLQA 1NHAA 2A07F 2RV8A 1KU3A 2XAJA 2EA4A 1MKMA 3QU6A 4OIRF 3WTYC 4P9UA 4KC6A 3FWEA 4HW0A 1P2FA 2D2WA 2WTEA 3FF5A 2L01A 4U0YA 2XRNA 1J0RA 4Y15A 3JAMZ 3SZPA 3R4KA 5LEKA 2COMA 4Z2YA 2FSWA 2HDCA 2YX4A 2EFWA 1WSUA 2VODA 1HW1A 3G3ZA 3U1DA 4N0BA 2FQ3A 3IL2A 4UHTA 2XCRB 1RNLA 2Z3YA 1UCRA 2PEXA 2GQQA 3RKYA 3DP7A 3JTHA 3ZPLA 3QP6A 3Q9VA 1WI9A 4AIHA 2CG4A 1MJ9A 4LFUA 1IRGA 4ESJA 1U3EM 3VEPA 3DXJF 3DQVC 3T8TA 4A6DA 2WV0A 2MH2A 1ZAOA 2FA5A 3T5XA 1TQMA 3WU0A 4JK1X 1MDMB 4MEXF 5ED4A 4KA4A 3BPVA 3WGIA 4RGSA 1KGSA 4GFQA 5LGUA 5E1WA 4PGGA 2OBPA 1UHMA 1EH6A 4I7HA 4GYGA 4I2OA 3M8EA 4IHSA 2GWRA 3LFKA 3FMRA 2R7FA 5DDGA 1IN8A 3REOA 1KQ8A 1T2KA 3O2PE 1Z9CA 4PGHA 5HS9A 4I0BA 1J75A 4JBAA 4EV0A 4LK0F 3GYHX 1XCVA 2PFBA 1ZYRF 2XHKA 5CLSA 1C0WA 1S7AA 2YR2A 2FRHA 2Q0OA 4M72A 4L9TA 2L3DA 2E7XA 1KYWA 2K27A 3MWMA 4LB5A 1T0FA 2V9VA 4GCVA 4OU0A 5F1RA 1XGSA 5HDNA 1IF1A 4M74A 2KIMA 2Z9OA 4Y13A 3S2WA 4P5OA 2UXXA 5HS8A 1BBYA 2BYVE 1D3YA 1FYLA 4PZJA 5LBQA 2EV0A 2EFNA 3CUQB 1H0MA 1HSJA 3HSFA 4I98B 4EMSA 1USSA 2GAUA 3LAJA 2Z5UA 3EUHA 5TJJA 1ZH5A 2O6GE 3P9IA 3J81Z 1G3SA 4I0AA 3DEUA 5D4SA 4E70A 1U5TC 4I02A 4OIOF 3GF2A 5H20A 1R36A 2EJRA 4GXOA 2HZTA 2HS5A 5D6FA 2OAZA 1YTYA 3IWFA 3B02A 1YS7A 1BJTA 4IRIA 5KVRA 1S7OA 2HTJA 1BC8C 1ZRFA 1T6SA 5J8CA 4EM1A 2ADUA 1O7LA 1FP2A 4ON0A 3ZN1A 4XRFA 1WQ2A 5BOXA 1G3WA 4G6DA 4Q47A 1XMAA 2PMUA 5FB2A 1EH1A 1WIHA 4HA8A 4BXUA 3R0JA 4YFKF 2ZCWA 5EEHA 2W84A 2PMHA 3RYPA 3KZYA 2DTRA 3TGNA 1EH7A 4UUVA 3ULQB 2RQPA 1KU7A 1O57A 4RGXA 3L4KA 3PFIA 4OOIA 1PUEE 4O6JA 3E5XA 1TNTA 3C18A 3HRSA 4BHBA 2K02A 1ZGAA 3E6CC 2PI0A 3E6DA 3I5UA 5HLIA 3F8BA 3RKXA 1R1VA 2P5VA 2TDXA 4Y17A 3RIRA 1IW7F 4KNYA 1MJAA 5TRDA 2W85A 3GX4X 4A2UA 3BWGA 4CICA 1OYYA 2VT2A 2DW4A 2RGVA 5L3FA 3DV8A 1TLHB 3CUOA 3TOAA 2QQ9A 2ZJ2A 2JPBA 3RPQA 2XAQA 1TBXA 4G6QA 5A2QK 4IHTA 2G9WA 2C6YA 2XAGA 3SHFA 5D5UB 2RNJA 4OMYA 3J80K 2CGPA 2IP2A 4I01A 2VN2A 4U0VA
chains in the Genus database with same CATH superfamily
4EJVA 2DA6A 2WAEA 3RTRA 1FOYA 1DGRM 1S29A 5M5YJ 4XLPF 2UWMA 5LHIA 1A5JA 4GDFA 5E17F 2AXLA 3PUBA 4A93C 3N05A 4WX9A 3FBIB 2EFQA 3ML6A 2NRAC 2K85A 1JOEA 3HOZC 5C3EK 1K83C 2CW0F 4BQOA 4AUXA 3CJNA 4BH9A 2K86A 4HNVA 3MD2A 1IGNA 5FLMJ 5D6EA 3HZJA 1OCPA 2MC3A 5D5VB 3A8KA 1KYZA 4EM0B 3BT9A 2OC6A 5E20A 3O3KA 5FLXK 4A3GC 2JT1A 3F6VA 4A93J 3HIFA 2RGRA 2QSGX 2H1KA 5JFEA 2VIXA 4C3HJ 2ID6A 1I3QA 4BBRJ 1TP4A 3CF2A 3GUDA 1WHUA 3ZMVA 5C4JK 1U5TB 3LSJA 3WE3A 4ZYAA 2M34A 1WZ2A 1D1AA 2FUG2 4BQAA 2VPRA 2E2IK 1O3QA 4KICA 4BYYA 1UG0A 3F8FA 2P7CB 2E5NA 3CCJI 5C3EJ 4IEJA 4OAZA 2LKPA 3TBIA 3OL4A 2M45A 2JUCA 1MBEA 1YJ9I 2XF6A 4XKWA 3JRGA 1TWGJ 2JSPA 1HSTA 2P0WA 1YI2I 3OIPA 1QZEA 3H0DA 1E0EA 1PVEA 1XPPA 5LRRA 2AS5F 1XX5A 1K79A 2ZBKA 3VSKA 3IWZA 2ZXIA 1E17A 3GMEA 1IN5A 1KZHA 1WCMJ 4FTHA 2O7OA 4XLFA 3ZMZA 3WODF 5H6RA 1SFOK 2NVXA 4W1UA 5ICEA 4P1WA 1W5TA 4KN7X 4M9XA 3F8MA 3QYEA 1EK8A 3DLAA 2F4MB 4BE1A 1QU3A 4HG2A 1FLIA 3I4MJ 2A68F 4R79A 3CMYA 2ZB9A 3DPTA 2BXYA 2H6CA 3IAM2 2A61A 3S1QJ 4G9YA 2AHQA 5FO5A 1Y56A 3G1LA 5DCMA 2D6FC 3K7AJ 2Y0MA 3HTUA 2LOOA 4IHVA 2NVXK 4EQQA 1KQ0A 2JA6K 2DBBA 2H6BA 4OIOA 1ITYA 3PNVA 4KN7A 1BOAA 5DCMB 3S2DC 1EJ9A 2R7OA 1N75A 2LY1A 1TTYA 2YU9J 3BR1A 4ZDOA 4G0WA 3JR9A 2DPDA 2K3FA 3E0JB 2DT6A 1E2XA 4MHGA 2B63K 3WE2A 3CQZK 1XGOA 2JJ7A 2NOJB 4FISA 4RAGA 4GTLA 2G7UA 3ASNH 2E36A 2ZMEB 5F0FA 1WOPA 5DEQA 1G4DA 5H2FC 1Y1WA 3I64A 2M4KA 2O8KA 3GTMC 2E34A 2HXOA 3AL0C 2LKXA 3N97A 3FKIA 2MABA 5B1BH 5EGOA 2STWA 2EBBA 1GXQA 3M1CA 3CQZA 5IORA 3KLOA 2VUMJ 3PFYA 2O03A 3BG7A 4UY8I 4HQEA 2IBDA 4XKVA 1SMTA 1Z1DA 2OF7A 3FHNA 3FXMA 3MKLA 5BPIA 1XZQB 4IPAA 1Z3YA 2XIGA 3EUHC 5IT9K 3FK7A 5IP9K 4BUPA 1RI7A 3OV8A 1XGMA 2OQRA 2I10A 1YX3A 3GZ5A 3QPHA 1V5VA 3CP8A 1WCMA 2HOSA 4RLQA 2HR3A 4Z6YA 1SAUA 1R9TC 3BG3A 1ODDA 4M6YA 1IS1A 1UHSA 3A4CA 3HKZA 2VXZA 5B66C 5IYCC 3GTMK 2ICWG 3S3MA 5ERIA 2ESNA 2R4GA 4KIFA 1WQHA 1K83A 3I59B 1MBJA 4QWQA 3H3UA 4KMFA 2HWVA 1UMQA 4KB2A 2ZNZA 4XIDA 2CW8A 3HOXC 1OR7A 1R5ID 1MW7A 1Z0XA 4L18B 1YOVB 2PMZN 4UVAA 3JSPA 3GTQJ 1WJAA 2TCTA 4QPOA 2BY2A 5ICGA 5HODA 3JRHA 1K78A 2FQOA 3TKYA 4P5BA 4IJAA 1I6HK 3IKTA 4E7KA 3U21A 2NS8A 1D1BA 3H0GK 2XB5A 1HI9A 3HRMA 2D1VA 5FKKA 4UV9A 2E2HC 1K7AA 5IYCK 2ZFWA 4UVCA 5IOSA 2RC4A 4PJNA 3PO2J 2DQRA 2M0MA 1WOOA 1USTA 3FIWA 2VT3A 4ENMA 5CHPA 3LFUA 4YFNF 2PMZL 5LFAA 2M8EA 4B43A 3CCLI 2VOPA 4HQMA 1D1CA 4E7ZA 1K6OA 4BLBA 5C44C 4R8HA 3VFZA 3CAGA 3HYIA 4BBSC 3KPHA 3KEYA 4M3DA 5E8GA 2Y0SA 3AD9C 2OTJI 5DUIA 1NK2P 1J59A 2R7UA 1MBFA 1K61A 2V1UA 3BTIA 1KA8A 1KQ9A 1Z05A 3CJTB 4XOPA 5DD4A 3F23A 2MYSA 1U0JA 4JX5A 1ZG5A 5IYDJ 2WA0A 1JKPC 3FZVA 3MAJA 3I4NK 4LOCA 2HQNA 2GOXB 3V7CA 4KM9A 3S15C 1TWAA 3ONQA 2UXNA 1P7JA 1VH2A 4R1HA 4IX7A 1VZ0A 1P4WA 1YFHA 1ZLJA 3K4LA 4HF0A 2K9LA 2V7FA 4AVZA 2O8XA 1R5GA 3VB2A 1VLOA 3RSNA 2GSUA 3HOYC 1F1ZA 4WXHA 5M3MJ 2EFOA 4UXNA 3OOUA 4AIDA 1D0YA 1B6AA 3K4NA 1B59A 1D0XA 4A3CJ 4BU2A 1C0AA 3BTCA 1E3OC 2DMQA 2J5PA 1K83K 2BZTA 2E1NA 3LQQA 5FKNA 5IP9J 2JA6C 1Z21A 4L5JA 3PO3K 1FYMA 2PLYA 4FM9A 3GIRA 4L9VA 1JUMA 5IP7J 3CQZC 5B3SH 3HGYA 1Y6IA 2JA5C 3TO6A 2JMWA 4HV6A 4U87A 2DDAA 5C4JC 4BY7K 1YLFA 1Z77A 3KEQA 2ZXWH 4MTDA 1OPCA 2NS0A 4A3MJ 2ZXHA 3TO9A 3W6KB 3FHZA 3IRRA 3ABUA 5BPDA 3SQNA 5BQTA 1WCMK 1WVRA 2Y9YA 2IGNA 4P9SA 4NBQA 2O0YA 5IOYA 2IPQX 3KP7A 4XICA 4E4HA 1HQCA 1QVUA 2HVRA 1TWAJ 2DPUA 4MTEA 4XLEA 4D1QA 3GVAA 4M3GA 4BACA 2W1OA 3GLLA 3BC8A 4BY7C 3QWLA 5F6FA 1LEAA 1OCZH 2HPIA 5J40A 4IRGA 2IGKA 1TWHJ 3GZNB 2RKHA 4OIRA 1XSXA 4KB4A 1IRFA 5D5WB 2LREA 2EV5A 3GTQA 1XXCA 1F7VA 4LLGF 1ZYRA 3S2DK 4MEXA 1LNWA 3P9CA 4FHTA 3P7NA 4HSTA 5CVJA 5CVIA 1MNDA 2LVSA 2KDZA 1N25A 1S8NA 3F8NA 2Y69H 3UKGA 2NVXC 2P6SA 1MMGA 4UUSA 1FBSA 3CCVI 1YIJI 3H9GA 1HBXG 2ZJQF 4IHYA 2OCEA 4G7ZA 2QQ8A 4NOIA 4BKWA 2FQ4A 4PFOA 1ULYA 4F55A 3E1SA 1T38A 1LPQA 2VJJA 1HCRA 4O2DA 2VUMC 5L3EA 2RNGA 2B63C 4A3DK 3W6JB 1MBHA 3T8RA 2BW3A 1HW5A 4UNOA 1FMVA 1DU0A 1FSHA 2ACJA 4C2MK 1LFBA 2AQEA 2HU9A 3FM3A 2G0EA 4MIMA 2CQNA 2H09A 4XLPA 1PUFA 2OD5A 4QIWD 3HSEA 1S7EA 5GTHC 4O5VA 2A3SA 2EPFA 3A8JA 3OYFA 2BE5F 2K5CA 2CFAB 3LL7A 3MQ0A 1IG7A 1I3QC 2DTZA 3FKIJ 5ILVA 3A1YA 2LDUA 5CVRA 3GTLJ 3S1NJ 2XCQA 3CLQA 4KATA 4BJTA 4B3XA 1VQNI 3GW2A 1BR4A 2NVYJ 2JA7A 1ZGWA 2HDDA 3NUHA 1BI0A 3DXJA 3ZQHA 3S14J 3LA3A 3K0LA 4XSZA 2JA5J 3GFLA 1TQPA 3AKZA 3SXYA 1F36A 1ZQ3P 1GUUA 3LMMA 4IL6C 4IKFA 2X1DA 2X51A 1VGXA 2XF7A 4KM8A 5K5QA 2BXZA 2XKOA 2WB1N 4Q48A 2L7MP 4BGDA 4IOAF 1R9TA 4PCQA 1NG6A 1ON2A 4PJLA 3KETA 2F5CA 3H9QA 4K2EA 2JZYA 1R23A 4I6ZA 3AD8C 2VBXA 2W00A 2Y31A 3P9KA 1YQAA 1XZPA 5IYBK 2CU7A 3D0SA 3E5UA 4ZYHA 1PYVA 4KMHA 2YS9A 4F93B 1JXSA 2VQHA 3ABLH 2OQGA 2DU9A 9ANTA 3JRFA 3NQOA 4HV5A 2OCCH 4GTDA 4XLNA 3H5NA 4XLNF 1H9TA 2GA1A 1V55H 4QJVB 1YW7A 5FFZA 1FTZA 5TJ3A 3OYJA 1YJNI 4FQGA 1TWGA 2ZJPF 5L3GA 2BEOA 2PX9A 1Z6RA 4HF2A 5E8IA 3VODA 1X4OA 2KIQA 2VKEA 3FDYA 5IYDC 1SANA 2GA2A 5DV5A 4BQNA 1SFOA 1J98A 4A93K 4F92B 3BTJA 4OIPA 1JTXA 2L54A 5EYRA 4NB5A 4BAYA 3W2WA 2DO7A 2X1EA 2DA7A 3D5SC 3H3ZA 4ZH4A 2NVXJ 3N3YA 2LH9A 2RAEA 4CXFA 1LFUP 1PDNC 2M7AA 4LD5A 4HNUA 3CF5F 2HVQA 2PMZA 2W4SA 3I4MK 4XSZF 4BDYA 4PK4A 1O25A 5LGNA 4WXCA 1DPUA 5FROA 2K9NA 2K3PA 1W7PA 3Q3SA 4DOZA 3CDIA 4ENJA 1A35A 1O29A 4AYBL 3BZ6A 1P9QC 4RLFA 3SDBA 2X4HA 3BR3A 3GCMA 4A0XA 5J1YA 4RDUA 4LK1A 3GTPC 1R22A 5E3LA 3S2HC 2QBYB 1NK3P 3HOYK 1B4BA 3E97A 2GBYA 4C45A 1Y1WK 4HX7A 4DZJA 1O4XA 2V6SA 1TWAC 4BE2A 1EFWA 3LA2A 4KASA 3BDDA 4MNUA 4G12A 2VBYA 2V79A 1XD7A 3M8JA 4YIIA 2RVCA 2DFFA 2DT7B 2W7NA 1X31C 3G4AA 4C3JJ 4IRHA 5JVGF 3LSKA 4J19A 1JE8A 5M5XJ 3GTPJ 3JRCA 2YU3A 4A3FJ 3J7YJ 3VSLA 3D1NI 3EUKL 2VKDA 2V6CA 3HSRA 1R1TA 1ZR4A 5JHFA 1RU0A 2EFPA 2FU4A 2LG4A 3K4KA 4BBRK 4BY1J 5C4JJ 4AM3A 5J4YA 1AU7A 1ZTRA 2NVUB 1OCTC 3HDDA 1JVIA 2WBMA 1RC9A 3MFKA 4WXDA 5HLHA 3BTLA 1TWCA 4KYWA 3S17J 2LMDA 1WKMA 2L4MA 4M9SA 1DD5A 4BJ6C 4M71A 5FGMA 2GAGC 3H35A 5C4XJ 4PSXA 1PP7U 2L7KA 2VC0A 3D5RC 3DWLE 5AONA 4N9IA 4IO9F 3KEOA 3LSTA 2P5LC 1JUPA 4L9NA 1OFCX 2Y48A 2F4IA 4WF2A 4XSXA 5M3FJ 3QQAA 3MEXA 4LLNA 2KDOA 2ZJRF 2FX0A 5HLGA 3LSMA 1O3TA 2IGMA 3DTEA 3K7AK 4OWRB 4WWCA 4LGWA 1QBJA 2DK8A 3R0AA 1IZ1A 4L5EA 3WHBA 2VJ4A 4D5CA 4M1XA 2PA8D 1R00A 3VOEA 2KT0A 1O3SA 2CJJA 4M9ZA 1Y0UA 4LOWA 5F0CA 3H3VL 4WILA 2YU9C 2LFBA 2M87A 3R6SA 4LJZF 4A12A 2JA7C 4EJUA 3I9V2 5FKLA 3BPXA 3BG9A 3QPLA 3JREA 3S3OA 4M6XA 1M1EB 1ZG3A 5BNGA 1TT5B 3JW4A 2JH3A 1XZQA 2F6CA 3ZN0A 4YG2A 5IYBC 1MSFC 4CZZA 3BR5A 1A36A 3I56I 2MGQA 2IS4A 2K9SA 2MD0A 2QQBA 4AYBD 2M30A 1BI1A 3S15K 1MH4A 1QZYA 2VJIA 3KCCA 1YS6A 1JJ6C 3FXOA 2DFIA 3BZCA 2XGXA 3K1MA 3ZQLA 1RPWA 2FF4A 1GDTA 3IV5A 2L02A 1G59A 2ID3A 3ZMDA 1OYIA 4AD9A 5KCMA 5DS9A 4MQ9F 5CJ9A 3PO2C 1UELB 1WOSA 3CMAI 5JLXA 3QRFF 2NVYC 4X0GA 3RQ4A 5IYDK 1HDDC 4EGZA 3BG6A 3ZQ7A 3IRQA 1TWCJ 2KRFA 2HOAA 3FMSA 3VYTB 3GXOA 2E1MB 1I6HC 2Z1DA 1R58A 5B1AH 3PQJA 5J6XA 1EI6A 4A3CK 3TMOA 4CZCA 3S1MC 4RGRA 2NNNA 1UZCA 1BW6A 2LF7A 2HQAA 1F5TA 5JHUA 2QUFA 1IN7A 4LLLA 5J1RA 4XLAA 4M3FA 1OQYA 4NHJA 4ETSA 3GTPA 5JLWA 3OS1A 4KMDA 1I6VA 3A0BC 4YIFA 1IN4A 2PJRA 2FEZA 3V42A 4QIWL 3GFMA 4GTAA 3ESWB 3AH5A 3HOZK 2DT5A 1IXCA 3Q0WA 4S0HB 4AVPA 2A5WA 2WAQA 1W1WE 1B9NA 1I6XA 4PUSA 3OY9A 3V7SA 2WV1A 1QZZA 1LDKB 2YSRA 1LJ9A 1H89C 2WAFA 2R7QA 3AG1H 1SFXA 5M5XK 2Z99A 3V8KA 2ZXJA 4ZH4F 2KRCA 3E3VA 2R7SA 1WQFA 1J9IA 1D5VA 5IOQA 1TWCK 1BOBA 4AIKA 3R60A 2XGCA 4YEJA 5FJ8K 3F72A 1Y39A 1ISEA 1GLNA 3BCAA 3RZOJ 4XM3A 1VQMI 2H27A 4LQYA 1GXPA 2CH0A 4KAWX 2HKXA 1UHWA 2RQQA 2XV4S 1TNSA 1X1PA 1WH5A 1FX7A 5D8KB 2LK2A 4M3EA 1RKTA 2LNBA 3S32A 4E7IA 3L09A 1R49A 3S2DJ 2GAHC 1QO0D 5EEAA 3M7GA 4GZYA 3VYUB 3RPUD 2NVQJ 1OJLA 1GE9A 1JTYA 1ZREA 3NRVA 3BP8A 4G94A 5HS7A 2OZ6A 2WB1D 1IN6A 2XPWA 3ZQFA 1OLTA 2HDWA 4KMAA 1LVAA 5TMFA 1P7IA 2E60A 4DDQA 1RR8C 3JSOA 4GTFA 4NC7A 4C2MC 1XDSA 3WTVC 1STZA 4RMFA 3HOUJ 5K5RA 1VI0A 1TWAK 2L5QA 2X9DA 2M9HA 3B73A 1EQRA 3DU5A 4CA0A 1T0FC 4I76A 4OINF 1I5ZA 2XAUA 2OV7A 4YFXF 3WU1B 1YO5C 2YU9K 3GTPK 2QM3A 3BQYA 1X1DA 2J5OA 4BHCA 3TL4X 5IYBJ 2R0QC 2K4JA 1Y1VJ 2LP0A 3RKWA 4A3BC 2KISA 4Y3OA 4ABZA 1BC7C 5FLXZ 3HOYJ 3GFJA 2FBHA 1BM9A 3SYTA 4YIRX 2XKPA 5JI6A 2NVYA 3BJOA 1VQLI 3T01A 1D0ZA 1SD5A 4CYCB 1YCLA 3F0CA 1WH7A 3ABTA 5C4XK 3OOPA 3M9AA 5FFXA 2MLKA 1RIOH 3AQOA 1IBAA 3H36A 4IVNA 5D4DA 3GDZA 3HOVC 3IP4B 5CKTA 2QCOA 2CS3A 2CQKA 2QENA 2M1BA 4LJZA 1BDFA 1JHHA 2NVYK 3WG9A 3FISA 4ZZLA 1FOKA 3K4MA 3HM5A 3AL0B 3PIPF 4W97A 1T98A 3KZIC 1FZPB 2W24A 3HOWC 3HUGA 2JK3A 5L3BA 2XGEA 4M6VA 2A6HF 2A69A 4E7HA 2PG4A 2PQ8A 1USMA 1R9TK 3I54A 1BJAA 3C1DA 3ZCOA 2VUMK 3C2GA 5H6QA 1ORKA 1XN7A 3GZ6A 3QU3A 1WRJA 2NAZA 4JOMA 1OYWA 4J3NA 1OMIA 3S1NK 3HOVK 1VQ9I 1O26A 3T02A 2CSOA 2WWYA 2PHCB 1P92A 4MLOA 3IHUA 3CJQB 3A01B 1AHDP 5GPCA 3J7AO 3FMQA 2VBZA 1G3TA 2YPRA 4B4CA 1PP8F 2DXIA 3MCZA 1OCCH 1LE8B 1FPQA 2E2HJ 3V8JA 3J7ZI 5F04A 1U6GA 2FOKA 3QPSA 5ICCA 5GAEJ 1ETQA 2A6HA 3FOFA 1ZXOA 3OYDA 5A2QZ 1NG7A 1YIOA 2IXSA 1VQOI 3CZ6A 3MZYA 2DFEA 5M3MK 3CCUI 3ZQIA 2E2IJ 2FNPA 3CP2A 3MKYB 4CGZA 2R7ZK 5FRNA 2ZO4A 3RZOC 3J80Z 5HL8A 2M4GA 2ISYA 3PL8A 2KPMA 5CYVA 5D4RA 3HOXJ 2HQ5A 3W3CA 4L5IA 4WK8F 3ZP5A 5AIPA 2Z33A 2DN0A 1B8IB 2EA2A 5JVTA 2O61A 2X1CA 3GTJC 2L2OA 2R7RA 5HDGA 1RUOA 4RS8A 1YRNB 1O28A 1HKSA 3AQPA 4P5AA 2XPVA 1JGGA 3CCSI 3LQRA 4IHXA 4KFCA 2EZLA 2L9SA 4U88A 1I1GA 1DQUA 2HZDA 2LY2A 1R5HA 4KISA 2QVOA 3CMEI 3FBNB 3AAFA 1D8KA 3CDLA 5DYMA 1SMYF 3I58A 4A3BJ 4PJ0C 2KQRA 2FBKA 4A0ZA 1YYVA 4IZZA 3GTOC 1B4AA 4XNFA 3C7JA 3BZKA 3OIOA 2KIFA 3S1QK 1ZK8A 3VPRA 2CQXA 2FMLA 4JQFA 2WC2A 3TTGA 2VKHA 3DF8A 1BR1A 3SFZA 2LD5A 2WY7Q 3KE2A 4MGRA 2E1MC 1DP3A 4XCHA 1RESA 3DCFA 1TL8A 3HHGA 3K1PA 5LEJA 5DM7F 3FOEA 4AYBN 4XKBA 3QX3A 4ZDPA 1BIBA 4UV8A 3HTSB 2QSHX 1SFOJ 1Z7LA 4UUSB 2B7EA 1XXAA 5K5OA 1LUJB 5IPAA 3FXRA 1I6HJ 3PQKA 4V2GA 4G7OA 2Y2ZA 5K1YA 4ZTJA 4M73A 1TWCC 3R61A 4ASNA 1MJBA 1SFOC 3KFWX 3UR3C 3I4MC 3ECHA 1T56A 2VE8A 1YRNA 2PMZD 1I39A 1WSVA 4JX4A 1A31A 2HOTA 1Q1HA 2R7VA 4A6EA 3E5QA 4ITVA 4BLAA 4HLYA 1P4AA 3H3VK 1OKRA 2UV1A 2YX7A 1LB2A 2BY1A 2PBIA 1MSEC 2JVGA 3BR2A 2JVHA 5EF6A 2X6OA 2JA7K 1EH8A 2R7ZA 2VONA 4CUGA 1IC8A 4S05A 2KFDA 4AU7A 3CO6C 3FXUA 5BS6A 2ZFZA 4XSXF 2XAFA 1LQ1A 3M07A 4KMUA 4BNCA 4LIVA 2KZGA 3G73A 1MBKA 2QWWA 1Z67A 2LLKA 2MFZA 3DEEA 2CUJA 3U9GA 3ZMTA 3GBGA 4DYQA 2XSDC 4A3JJ 3S16J 3COAC 1Y0NA 1LE8A 3K4CA 2V9PA 2R93J 3U2RA 1S3JA 2RN7A 3GTJJ 2W82A 4KT6A 3RI4A 2GIVA 2O9LA 1SD4A 1F93A 1VJEA 1E3HA 4GO1A 4BY1C 3DTKA 3IC7A 3OWTA 4PAAA 3DKYA 3RCOA 1DCPA 3M8FA 1LEBA 1XS9A 4ZC3A 4A3FC 5JFRA 3E6MA 5E1XA 2PPBA 1AWCA 5F0HA 4BQQA 5D8LB 3CC2I 3S0XA 4LK1F 2A6EA 4LK0A 3NWSA 3GEZA 4BHPA 2JA8K 5EJCA 1K83J 3HUGB 2CYYA 3JSTA 3WTUC 3EDPA 1AA7A 2GM4A 5C4XC 3OYGA 1EF4A 3MZHA 4C3JK 1X58A 4A3DC 5CPRB 3SZGA 4A3KC 3NARA 2R93A 4CYDA 2DMPA 1WWXA 1QPIA 1ERDA 3HOXK 2ZUEA 1L3LA 4FCYA 1W5CC 4BY1K 2FMYA 1MNEA 2VQGA 2V6EA 3EPZA 4ESBA 3BG5A 2IS6A 4DIQA 3PNTA 4C3IC 1FNNA 3ZQQA 2K9MA 1VQ6I 1TQIA 4RM2A 4BY7J 4CYCA 2R92C 3N0BA 4A5MA 1AKHB 2XF5A 1MMNA 2JTVA 2ISZA 2CFXA 4EEFG 4U7DA 3CCQI 1P6RA 3M4OJ 1SEUA 3FKJA 2FNAA 2GSOA 2ME6A 3MMLB 4N9HA 2UZKA 1FBUA 1WI3A 4V19K 4H4KC 5FD5A 4RBOA 3S1MJ 3TP3A 4PABA 2KLOA 2XROA 1BW5A 2ECCA 2ELHA 1N78A 2OJED 1MMSA 4U7BA 2IA1A 2KP6A 3KP2A 3PM1A 1MDMA 1JT6A 4ZTFA 2HI3A 2DYRH 4B8XA 2HYFA 1O3RA 2A68A 3GTKK 2X0LA 1JUSA 2V4JC 1I27A 3KYCB 4D9JA 4Y7NJ 3OS2A 2MA3A 1YX5A 1G3YA 3OYHA 4JP0A 3BP8C 4RGUA 5BMZA 2XAHA 3BR6A 2F5EA 2R7ZJ 3S15J 5M5WK 5CQEA 1ZRCA 1QGPA 1G6NA 4D5FA 3J7AY 4MEYF 3LSHA 2GXBA 4G7OF 1Y1VC 4NUBA 1K78B 4XRSA 2H1LA 2CUEA 3WTXC 3H5RA 3I55I 3L2VA 2P5MA 5E1ZB 1F4KA 1I1SA 4JX6A 3CTAA 3MKZA 3FXLA 2LC2A 2EWNA 3BROA 3C3WA 2R7ZC 4Y52K 2VB6A 3VWBA 3GTMJ 1S5LC 1U2WA 2LSOA 1AKHA 2V6UA 2R3SA 3CUQC 3RJPA 1A04A 2Q2EB 3KP3A 4EJOA 2DA1A 4C2MJ 1MNMC 3LPXA 4DZPA 3LWFA 2DMNA 4FX4A 3BQZA 4HSRA 3S14C 3O8GA 3I53A 2BV6A 5IP7K 5HNHA 1TC3C 1FTTA 2VBWA 4NQWB 3EYIA 1ACIA 2GSNA 4G8XA 1X1CA 1QHGA 1IXRC 3X2QH 4LG0B 4AH6A 1Q1VA 1LDDA 2ELKA 3BJAA 4IXAA 3LAPA 3M3YJ 2DOAA 5FLMK 2IVMA 2QGUA 2TRTA 3E7LA 3SZTA 1YNJA 4QIWN 5EGHA 3RZDK 3S1QC 4Y52C 2NXNB 2Q8KA 1S6LA 1MGTA 5EGOB 2P5KA 3P5JA 1HOMA 2E2IA 1I50J 3S2HJ 3L7WA 1V3FA 3BOQA 3LOCA 3S14K 2E7WA 2B9SA 1FYKA 3EQLF 1WJEA 2V1NA 4F52A 2Y75A 1WCMC 2JRMA 2X48A 4HLXA 3DBHB 1WGXA 3GTOA 2HXIA 4D0PA 1HKQA 2A05A 2EH3A 1SD6A 4GGGA 3EETA 2W57A 3N0CA 4A3FK 3GTOJ 2D1HA 3N4MA 3DKXA 1QNTA 1MD0A 2IEKA 3H92A 2DJIA 2HEOA 5J8FA 2JWTA 3V4GA 3FXQA 4A3DJ 1XSVA 1RR7A 1KU2A 3G71I 1DDNA 3SJMA 1XZPB 5EEGA 2RDPA 2H94A 2CO5A 1FJLA 5K7HA 4TV7A 5FKOA 5DD8A 4HAMA 2Y3PA 1R4MB 5EG0A 2BY3A 2R92A 4Q5SF 5ICFA 3KYLA 1GVDA 2P4WA 2WB1A 2E1CA 1O7FA 4XL9A 4L0YB 1R7JA 2Y0SD 1MH3A 2FJ1A 1DP7P 3WHCA 4XORA 1TW2A 4HX8A 4Q4ZF 1SVLA 2CWEA 1SC7A 4CHUA 2QKMB 2E1OA 2CQQA 3OREA 4J01A 1XXBA 1UFMA 4XLCA 3BJ6A 1X19A 2R93C 4PJMA 4OAYA 1MMDA 5ILUA 1QA6A 1ZQ1C 3DEWA 4IQ4A 1ON1A 1BI3A 4HDVA 3OYBA 4A3LK 4A3BK 4KN4X 2K7LA 3OL3A 4LG0A 4FX0A 1FP1D 2K4BA 4AWXB 2VXDA 3CDHA 4RAYA 2ZMEC 4UVBA 4KDPA 1GV2A 1ETKA 2XASA 5HOOA 3QOEA 2FE3A 1TWHC 4OMZA 5TGTA 2KIUA 3KP5A 2P81A 3L2QA 2GZWA 3ZOBA 3FKIK 2HFHA 2DYSH 5KAIC 3WGGA 1VTNC 1EV7A 2F4OB 3GLXA 2Q2EA 3ELKA 5DUKA 2B0LA 2GXGA 2LF8A 2CRGA 1Y1VA 4WCGA 2ESHA 5FJ8J 4YFXA 4Y7NK 1WJDA 1P4XA 4A3MK 3DFGA 2L4AA 3FX3A 3RPUA 1SFUA 4CCKA 3ERED 4ZYEA 4H0EA 3EYYA 3JRDA 2PJPA 5CVUA 3HHHA 2F5FA 3LSRA 1VF9A 3CC4I 2COBA 2HOEA 2XC7A 2EV6A 4J00A 1Y1VK 2JA8C 1LDJA 5JR3A 2DQLA 2A69F 5FRMA 4E7LA 3GFIA 3GTMA 1BIAA 3S3NA 3JTGA 3FKIC 2ECBA 2N8GA 1RKWA 1AB4A 1X1AA 4BKXA 4S04A 1YE9A 3Q0UA 3M4OK 2HYGD 1CF7B 3OEPA 2JQ7A 2HGCA 4RB2C 4RB3C 3RDIA 3LNQA 1B8IA 4FT8A 2KJBA 2GLOA 1UV7A 1YNNA 1CGPA 2OTLI 4A3IJ 3OIQA 3OYEA 1FSEA 2VASA 1WJBA 2R92K 4L0ZB 2R7WA 1SD7A 2AO9A 2K40A 3C2HA 3TO7A 3JAMK 2BE5A 2AQFA 3A8IA 1REPC 1DCOA 1Z91A 1G2HA 2I8DA 2NOGA 2JSCA 3H0GJ 3CUQA 4ZYGA 1IDZA 3SEQA 1W0UA 1W7PD 5FLMC 4II3A 3GO5A 3T1BA 4DGWB 4G0UA 1IRXA 5D5XB 1IV8A 5GP9A 1XB4A 1HW2A 1B1BA 4LB6B 3ISPA 3H1CA 1O2BA 3HRTA 1ETYA 1O2AA 1W7PB 3S17C 3NAUA 5E68A 1GHCA 3I4PA 3HOUC 2F48A 2O5RA 1I3AA 1RUNA 1IAWA 2ZC2A 4UB8C 5FD6A 2D45A 4YFKA 1JGSA 2EZKA 4P96A 2IGOA 2QF7A 3VYSB 4YFNA 1YG2A 4GYIA 1BA5A 5B5EC 1L0WA 4N4OB 1R1UA 5IP6A 3DPLC 2DA5A 4A5NA 2P8TA 2NVQC 3WTSC 3C2BA 2E2IC 3MMYB 2ETHA 4PDKA 1ZG1A 3HPHA 2H8RA 3TDUC 2NNYA 1NH3A 4XLHA 3FXKA 1CQTA 5L3DA 5C44J 5ILSA 3NEUA 5CQGA 3OYIA 1KU9A 2XRLA 1VQ4I 2LKSA 5LD2C 2QZ8A 1X3WB 1IUFA 1MZBA 3ZR8X 3TFJA 2G7HA 3HKZL 2DK5A 5LRSA 1HXDA 4XOTA 2HNHA 2XB0X 3O8HA 3TDZC 2F5DA 4QSHA 5F1JA 1UB9A 1JKQC 2VUMA 4B09A 2NVQK 1X3UA 4HF1A 4KITB 3EQLA 3FM5A 2WAQL 3SZZA 2DOEA 5IP7C 5M3FK 3A0HC 1U9NA 2HTSA 3ROUA 1H9GA 2L9VA 1V54H 3E6BA 3CLOA 1ZLKA 4ANJA 2OU2A 4KIBA 1J6XA 4CO8A 1J7KA 4G7HA 2DLLA 2JPCA 4F91B 1X3ZB 4CDGA 5KHDA 3HOWJ 3BY6A 1FC3A 3T0YA 2YU9A 3QYBA 2IRFG 1LFPA 3HXLA 5GADJ 5IT3A 3KP4A 4ZZDA 1KONA 2IA2A 2CUZA 3K4JA 2VL8A 5J3LA 4C3IK 1D8JA 3GTKJ 3H3VD 3CMMA 4KT5C 4Y4RA 3OPFA 4BXXJ 2L7ZA 1W4MA 2MW8A 4CCOA 1R9TJ 2IJLA 4NC6A 4HBLA 2HPMA 2QYOA 2F2EA 4CCJA 2VQLA 3S16K 2VI6A 1YW9A 2MC4A 3S1RJ 1IXSB 3ZMSA 2MD5A 1SAXA 2IA0A 5L46A 2EINH 1UAAA 3HG9A 3OYKA 4YG2F 2NS7A 4O3MA 3Q5FA 4HZFA 1FBQA 2VC1A 2VPLA 1YX2A 1ONVA 4C30A 1S72I 2CV1A 2JA2A 5FLVA 1QVTA 2CFAA 1XTAA 3K1NA 3K7AC 3PNYA 1R6RA 3GTGA 1XCBA 3QAHA 1FT9A 4E7JA 1XMXA 4KMUX 3CCRI 4P9FA 3Q3QA 2FBIA 5E79C 3AG2H 2R5YB 1VQ7I 3GTKC 1DPRA 4BL0B 2WAQN 2DA2A 3CJRB 3QODA 1HA8A 1JHFA 3ZMUA 1JT0A 3GEHA 4GT9A 1GV5A 5JVOA 1AOYA 3BUEA 3V7RA 2FOWA 2BOLA 4OINA 3JCUC 4HYEA 4HX4A 4DBQA 4L9JA 2QLZA 3EUAA 5KAFC 3KZZA 4DNCA 5LGTA 4KARA 2ZNYA 1SVOA 2F5VA 4QLCU 1W36D 4KUMA 1PJ5A 3HJEA 1JI8A 2VJ5A 4PJJA 3S1NC 2LR8A 1FIPA 2NYXA 3I3LA 4XONA 2R5ZB 1F9NA 1IQ0A 4RA2A 4A3KK 2EK5A 1IUYA 2HQRA 3GTQC 5HDKA 4KDDA 2JRTA 1SFKA 1ZN2A 3MZ8A 4ENNA 4RM3A 1O2FB 1LVKA 2WAQD 3K6GA 3F8CA 4ENKA 3F6OA 1BI2A 3HOUK 4DJAA 3OR1C 2O3FA 1Z7UA 1FEXA 4C3HC 3CESA 2PA8L 3K69A 1I50C 1B72A 2V6TA 2GXAA 4C2TA 1FWZA 1X2NA 1VFCA 4A3GJ 3K10A 2V1DA 2A6EF 5AIQA 2RREA 4ESFA 1TWHA 2W7VA 2M8GX 4Y52J 1IE0A 5DTDA 3D5LA 4NC8A 4CSWA 4I09A 4RB0A 4IQJA 3AFHA 1XG1A 4F7ZA 2M7BA 5C3EC 3HOZJ 4RAFA 3IAS2 3RZOK 1J2XA 1YW8A 1YITI 2VOOA 2ZSHB 3TQNA 3L9FA 3CO7C 1HKTA 4U0WA 4AC0A 2KKOA 4B47A 4BEHB 5E18F 2H8WA 2EBIA 2IS2A 5E3OA 3DTIA 3GTJK 3K2ZA 4MO7A 1KQ4A 2OA4A 2V1XA 2V26A 2CUFA 2QQAA 4HNTA 2M5WA 2IT0A 3S8PA 1DU6A 5F64A 4MQ9A 2BBYA 2HYJA 4EJWA 2E2JJ 3I4NJ 5KK1A 1J5YA 1ETVA 1XMKA 2BHZA 1J09A 3K9TA 3DU6A 1S9HA 2XVCA 3L4JA 3GTOK 4OIQF 4M3BA 3RYRA 1ZHFA 5IT9Z 2I5UA 2DAOA 1J6VA 3GWZA 4KIGA 1U8RA 5KNLA 3S17K 2XPUA 3FK6A 3OS0A 3W6VA 2M0CA 5GPAA 3GTGJ 1T39A 2IW5A 4NQWA 3VDXA 1JQWA 2MLGA 3ADAC 1ZRDA 3IH4A 2XCOA 3WGHA 2EZHA 1WQGA 2W25A 2P7VB 3O6BB 3QP5A 4MFEA 3W2AA 5LHGA 2P6TA 2WADA 1RZ4A 1WJCA 1U5TA 3A2KA 4HOBA 1USOA 4MQVA 3V8LA 2EIMH 1L0OC 4EATA 4AIJA 4OIPF 2LBFA 1ZVUA 3HOTA 3GEIA 3KP6A 2R93K 2ZKZA 1Z6TA 4C2UA 1MMAA 1HQMA 3CQZJ 5L3CA 2VKVA 4IF4A 2EB7A 2KJCA 5J1UA 2DDBA 4A3LC 3HKZD 4EM2A 3CC7I 3I71A 4DQ2A 2BGCA 2PN6A 1PJRA 1INNA 5LHHA 4QTRA 2OZUA 1XDUA 3F21A 1U78A 5HVQC 1HC8A 2R7DA 1ZARA 1QPMA 3IKVA 3LA7A 3PSFA 3HB9A 2JA7J 3Q9SA 2Y0SN 1A6IA 1PJ6A 1W5SA 4XBFA 1V5FA 3IH3A 2DI3A 4BXFA 2CV0A 3L00A 1VQ8I 3TFHA 2JA6A 3F22A 3L2UA 3SZYA 1CF7A 4EVIA 4KJZA 4B48A 2XUBA 1FIAA 6PAXA 3HRUA 3QPTA 1XC5A 3I0TA 3GTGC 3LSGA 1BGWA 2ZUFA 2DA3A 3OYLA 3G2BA 2CV2A 2Y0SL 4WJ3M 4G7HF 1XSDA 3L2CA 4QPQA 3A02A 4E7SA 5DM6F 3GTKA 4LMYA 4UUTA 1QQIA 1ZBSA 1VQKI 4G0VA 4BBSJ 1WPKA 4A0YA 4ZYDA 1FOWA 1F7UA 3OR2C 4RAZA 3WTWC 2FXAA 4RB1A 2DJNA 2QBYA 5DCFA 3WG7H 3QOPA 2ZFUA 1TWFA 3I59A 1X2MA 2VE9A 2KWAA 4Q4ZA 1TW3A 1ZGJA 3WTTC 3F9KA 4IOCF 1BN5A 3HOWK 2DA4A 2HKOA 1FY7A 3ZQCA 1D5YA 3ECOA 3VA7A 2CW0A 4HRIA 3M1EA 1T33A 3K70D 3RKQA 3S16C 3J81K 1SFEA 4A3EC 2KL4A 3L2WA 2FQTA 4GFBA 1TWFJ 3GTLC 3AG4H 4YELA 4X6AJ 3UNGC 3TW6A 4HDUA 3GTJA 1I3QK 3RZDJ 4LR2A 3L2RA 2MSYA 4V2FA 3OYMA 1FMWA 4EGYA 1XGNA 5CVVA 4G7ZF 2HVSA 1T08B 3CCYA 1B9MA 3F3XA 4XRMA 3DKWA 4P55A 3KLNA 3H0GA 2ZMEA 5TMCA 3HGGA 4XQFA 3HOSA 4DYCA 5IYCJ 4QJVA 1Z3XA 3G4SI 3T00A 3FXJA 5EG0B 2ZSIB 3TOBA 4LLGA 2B63A 4X6AC 4F3QA 2E5ZA 1GVJA 2XGDA 3VYRB 1Y1WJ 2MBFA 3SDGA 3JRIA 2VQCA 1K4SA 1G8XA 3M3YC 4RMNA 5J4VA 3IUOA 4N4NB 2L9RA 4ZDLA 3HEFA 4JK1A 2LRDA 3TW7A 3WTZA 4D7MA 1DUXC 4EJTA 2GOMA 2MH9A 2A5YB 1VRQC 1V4RA 2STTA 5LLQA 4FE7A 4A3GK 1NHAA 1VQPI 1I50K 1IO2A 1ZELA 2A07F 2RV8A 1KU3A 2XAJA 2EA4A 4LG3A 1MKMA 3ZGKA 4XRSG 4G6TB 5K7ZA 3QU6A 4OIRF 3WTYC 2QKLB 4X6AK 4P9UA 1WJ5A 2IS1A 4KC6A 3FWEA 4E6KG 4HW0A 1P2FA 2D2WA 2DCEA 2WTEA 4UB6C 3FF5A 2L01A 4U0YA 2Z16A 1LKXA 3SEZA 3DBRB 3DPUA 2R5ZA 2XRNA 1J0RA 2MG4A 4Y15A 3MKWB 2X6YA 5EZHA 3TEDA 1APLC 4NDLA 3JAMZ 3SZPA 1X1BA 2IAIA 3R4KA 5E3NA 1PJ7A 5LEKA 2COMA 4IHWA 4Z2YA 3H5AA 3BCBA 3LSPA 2FSWA 2HDCA 4Y33A 2YX4A 3PO3C 2E2JK 4WJ4A 3NWTA 2E19A 2EFWA 1WSUA 2VODA 1HW1A 2O5IA 3G3ZA 3U1DA 4N0BA 1BR2A 2ELJA 5TISC 4CCMA 2O5JA 2FQ3A 1OCRH 3IL2A 1FOXA 3OMYA 4B3AA 4UHTA 2R5YA 1MIJA 1R71A 2KRHA 2XCRB 1RNLA 2Z3YA 5J47A 3GSIA 1UCRA 2PEXA 2GQQA 2X6WA 4XKCA 4OIQA 3RKYA 3DP7A 3JTHA 5IOZA 3HL2A 3CCMI 3RZDC 3W2VA 1TWGC 4A3LJ 4A69C 1RRJA 3ZPLA 3QP6A 3Q9VA 3L1PA 1WI9A 4GTCA 1OCOH 4AIHA 2CG4A 1MJ9A 4LFUA 2GIZA 2M2EA 3HBLA 3LSIA 1IRGA 1TWFK 2E35A 1Y1WC 4ESJA 1WFXA 1U3EM 3HC7A 1WJFA 3VEPA 3DXJF 3DQVC 2FD5A 3T8TA 4A6DA 3JRAA 2WV0A 2WY8Q 3OYAA 2MH2A 4ZJZA 1T8IA 1ZAOA 3PUFA 2FA5A 3OSGA 3T5XA 3KX2A 4BS9A 1TQMA 3WU0A 4JK1X 1MDMB 4MEXF 5ED4A 4B44A 4KA4A 3BPVA 3WGIA 5M5YK 4RGSA 1KGSA 2BHYA 4GFQA 4GTEA 1UJ8A 4A3JK 3MN2A 2B63J 5LGUA 5E1WA 1TZLA 3CCEI 4PGGA 2OBPA 3KIOA 1UHMA 1EH6A 2W48A 4I7HA 4GYGA 3GTLK 5GTIC 4I2OA 3M8EA 2LBFB 3BP3A 3S1RK 3K70C 4IHSA 2EIJH 2GWRA 1ZKGA 3BR0A 4MFDA 4X1EA 3LFKA 3FMRA 2R7FA 2NVTC 3K2AA 5DDGA 4XN0A 2Z2SB 1IN8A 4Q5SA 2CW7A 3ERMA 3REOA 3HXAA 1KQ8A 1JKRC 1T2KA 3A01A 3O2PE 1K4TA 1Z9CA 4PGHA 5HS9A 4I0BA 1J75A 4JBAA 3CD6I 4EV0A 4LK0F 2X85A 1XCVA 3GYHX 1IRZA 2E2HA 2PFBA 1ZYRF 4C3JC 1ETWA 2DOFA 2XHKA 5CLSA 1C0WA 3ZQGA 1S7AA 1SVMA 2YR2A 3M3YK 2FRHA 1VNDA 2Q0OA 4M72A 1I50A 3B6CA 4FETA 1TWHK 3BLYA 4B1RA 4L9TA 2DMUA 2L3DA 2E7XA 5IY5H 2NVTK 1KYWA 2K27A 3MWMA 4LB5A 1T0FA 2V9VA 3H9JA 4D7NA 4Y7NC 4GCVA 4OU0A 4A3IC 4A3MC 5F1RA 1XGSA 5HDNA 2EQRA 4LIUA 1IF1A 4XR6A 5EDNA 3OYNA 4BEHA 3JRBA 4M74A 2KIMA 2QEXI 4A3EK 1V5GA 1ZR2A 2Z9OA 4Y13A 3S2WA 1QHHD 3TFIA 4P5OA 2UXXA 5HLTA 3PSIA 4C9YA 5HS8A 1BBYA 2BYVE 1D3YA 1G51A 1FYLA 4PZJA 3ZXSA 1R4NB 2EV0A 5LBQA 3OSFA 2CFOA 2EFNA 4DBRA 1IV6A 2JA8J 2JA6J 5IP9C 3MVPA 3CUQB 4II2A 1H0MA 1HF0A 4MEYA 1HSJA 1IJWC 1IL2A 3HSFA 4I98B 3GTQK 1B72B 4NNJA 4EMSA 3I4NC 1USSA 2GAUA 4BXXK 3K4BA 3LAJA 2Z5UA 2L9NA 3EUHA 4XK4A 5TJJA 1ZH5A 2O6GE 3P9IA 3PO3J 1O24A 3GTLA 2LY9A 4I99C 3B6AA 2Y9ZA 1ENHA 2OUMA 4DW6A 3AG3H 3J81Z 1WORA 4A3KJ 4XN3A 1JKOC 1U9OA 1H8AC 1G3SA 3PIOF 2BY0A 4I0AA 3DEUA 3S93A 5D4SA 4CCLA 4E70A 3AD7C 4FZBA 5F08A 1U5TC 2JN6A 2JA5A 2OPTA 4I02A 4OIOF 3GF2A 3Q0VA 5H20A 1BJZA 1QRYA 4HPQA 2E2HK 2RH6A 1R36A 2EJRA 1PUFB 1POGA 4GXOA 2LYCA 2HZTA 2HS5A 2BVMA 2JA5K 5E3MA 5D6FA 2UUZA 2OAZA 4BJ5C 2BW3B 1YTYA 1ETOA 3ASOH 3U1KA 3IWFA 2Y30A 3B02A 1YS7A 1ETXA 1BJTA 4JYKA 3GTGK 2KZVA 2KHMA 1XPXA 4IRIA 3A03A 5KVRA 1W0TA 4A3JC 1S7OA 2HTJA 5C44K 1BC8C 4PFPA 1ZRFA 1T6SA 3S2HK 3HKZN 5J8CA 1Y8QB 5EGEA 4CCNA 3HPGA 2LTPA 4EM1A 2ADUA 1EKEA 1O7LA 3GEEA 3IPJA 3DLLF 1FP2A 1I3QJ 1NTCA 4ON0A 3ZN1A 4XRFA 4FASD 4GRIA 1WQ2A 1EA3A 1O27A 5BOXA 1G3WA 2DFHA 4G6DA 2L0KA 4Q47A 3ABKH 1XMAA 2PMUA 2EILH 2V9KA 2X6XA 2PJRB 5FB2A 1EH1A 4BBRC 1WIHA 4LITA 4HA8A 4BXUA 4BE0A 1HLVA 3R0JA 1MBGA 2E71A 2EZIA 3RQIA 2ZCWA 2QSFX 4YFKF 5EEHA 1TWFC 2W84A 2PMHA 1DGWY 2EIKH 3RYPA 3KZYA 4XMYA 2DTRA 2Q1ZB 3TGNA 1TWGK 2M3AA 1EH7A 4UUVA 3ULQB 4ILDA 2RQPA 2JUGA 1KU7A 1O57A 1E3PA 4RGXA 1JJ8C 1J6WA 3HOVJ 4BDZA 5IOTA 1WSRA 3ZRGA 3L4KA 2DMTA 1TT0A 3PFIA 4OOIA 4YRVA 1PUEE 4O6JA 3E5XA 5FKMA 1GT0C 3SFIA 1TNTA 3C18A 4CH7A 3HRSA 2XDVA 3ABMH 4BHBA 5GAGJ 2K02A 5K7FA 1ZGAA 4PSWA 1X4PA 1SMYA 1A6QA 3E6CC 1V5EA 2PI0A 3E6DA 3I5UA 5HLIA 3H0GC 4HEA2 3WU2C 3F8BA 3RKXA 1Y8RB 1R1VA 2WB1L 2P5VA 2TDXA 1W36C 2KMUA 2CQ7A 4Y17A 3RIRA 2D5VA 1IW7F 4DYRA 3KYDB 5F27A 1RETA 1YJWI 4KNYA 3S1MK 1MJAA 5TRDA 2VLAA 1VQ5I 3S1RC 1H88C 2W85A 3GX4X 1IDYA 1UG2A 2YUSA 4A2UA 4AYBA 1F43A 3BWGA 3G4CA 1HDPA 4CICA 4KN4A 1OYYA 2VT2A 4BXXC 2DW4A 2RGVA 1YHQI 5L3FA 1U8BA 3DV8A 3DBLB 1TLHB 2R7TA 3CUOA 3G1MA 3TOAA 2QQ9A 5EZGA 2ZJ2A 2QA4I 1BL0A 3PJRA 3PO2K 2R7XA 2L7FP 2JPBA 5M5WJ 3RPQA 3TP0A 2XAQA 1K6YA 1TBXA 4G6QA 5HNFA 3G6EI 1BS2A 5A2QK 4IHTA 2DODA 2G9WA 1IW7A 2BVLA 2C6YA 3M4OC 3G1OA 2XAGA 3SHFA 2K9QA 4A3IK 1OR7C 3IH2A 4BBSK 4A3CC 4A3EJ 5D5UB 2RNJA 4OMYA 3WODA 2R92J 2A6TA 2E2JC 3J80K 4FE4A 2CGPA 1OISA 2ME0A 1T95A 2IP2A 4C3HK 2CMPA 5GAHJ 2XSJC 4C3IJ 1N77A 3OYCA 4GTBA 4I01A 2VN2A 3QYFA 2NVTJ 2AXTC 4U0VA 1DCHA
chains in the Genus database with same CATH topology
4EJVA 3RTRA 1S29A 4XLPF 2UWMA 5LHIA 5E17F 2AXLA 4WX9A 2NRAC 2EFQA 3ML6A 2CW0F 4BH9A 3CJNA 2K86A 5D6EA 5D5VB 2MC3A 1KYZA 4EM0B 5FLXK 5E20A 3O3KA 2JT1A 3F6VA 3HIFA 2RGRA 5JFEA 1I3QA 3GUDA 3ZMVA 1U5TB 3WE3A 4BQAA 1O3QA 4KICA 4BYYA 3F8FA 2P7CB 2LKPA 2M45A 1HSTA 5LRRA 2AS5F 1K79A 2ZBKA 3IWZA 1E17A 1IN5A 3ZMZA 3WODF 5H6RA 2NVXA 5ICEA 1W5TA 4KN7X 4M9XA 3F8MA 1EK8A 1FLIA 2A68F 4R79A 3DPTA 2H6CA 2A61A 4G9YA 5FO5A 5DCMA 2Y0MA 3HTUA 4EQQA 1KQ0A 2DBBA 2H6BA 1BOAA 5DCMB 1TTYA 4G0WA 2DPDA 4MHGA 1E2XA 3WE2A 1XGOA 4GTLA 2G7UA 2ZMEB 5DEQA 1G4DA 1Y1WA 3I64A 3FKIA 3N97A 2STWA 1GXQA 3CQZA 5IORA 3KLOA 2O03A 4HQEA 1SMTA 1Z1DA 5BPIA 4IPAA 2XIGA 5IT9K 1RI7A 3OV8A 1XGMA 2OQRA 3GZ5A 3QPHA 1WCMA 2HR3A 1ODDA 4M6YA 1IS1A 2VXZA 5ERIA 2ESNA 4KIFA 1WQHA 1K83A 3I59B 4QWQA 3H3UA 4KMFA 2HWVA 4KB2A 2ZNZA 1OR7A 4L18B 4UVAA 3JSPA 5ICGA 1K78A 4P5BA 3TKYA 4IJAA 3IKTA 3HRMA 2D1VA 4UV9A 1K7AA 2ZFWA 4UVCA 5IOSA 2RC4A 2DQRA 1USTA 4ENMA 2VT3A 5CHPA 4YFNF 2M8EA 2VOPA 4HQMA 1K6OA 4BLBA 4R8HA 3VFZA 3CAGA 3HYIA 5E8GA 5DUIA 1J59A 2V1UA 3F23A 1KA8A 1KQ9A 1Z05A 5DD4A 1ZG5A 3FZVA 3MAJA 2HQNA 3V7CA 4KM9A 1TWAA 2UXNA 4R1HA 1P4WA 1YFHA 1ZLJA 4HF0A 2O8XA 1R5GA 3VB2A 2GSUA 1F1ZA 4WXHA 2EFOA 4UXNA 1B6AA 1B59A 2J5PA 2E1NA 3LQQA 4L5JA 1FYMA 2PLYA 4FM9A 4L9VA 3TO6A 4HV6A 1YLFA 3KEQA 4MTDA 1OPCA 2NS0A 3TO9A 3W6KB 3FHZA 3IRRA 3ABUA 5BPDA 3SQNA 5BQTA 2O0YA 2IPQX 3KP7A 1HQCA 2DPUA 4MTEA 3GVAA 5F6FA 1LEAA 4IRGA 2RKHA 1XSXA 4KB4A 1IRFA 5D5WB 2EV5A 3GTQA 1XXCA 4LLGF 1LNWA 3P9CA 4FHTA 3P7NA 5CVJA 5CVIA 1S8NA 3F8NA 2P6SA 1FBSA 1HBXG 4BKWA 1ULYA 1T38A 5L3EA 3W6JB 3T8RA 1HW5A 4UNOA 1FSHA 2ACJA 3FM3A 2H09A 2OD5A 3HSEA 4O5VA 2A3SA 2BE5F 2CFAB 3MQ0A 5ILVA 2LDUA 5CVRA 2XCQA 4KATA 3GW2A 2JA7A 3NUHA 1BI0A 3LA3A 3K0LA 1TQPA 3GFLA 3SXYA 4KM8A 5K5QA 2XKOA 4Q48A 1R9TA 4PCQA 3KETA 1ON2A 2F5CA 4K2EA 2JZYA 1R23A 2VBXA 3P9KA 1YQAA 3D0SA 3E5UA 4ZYHA 4KMHA 1JXSA 2OQGA 2DU9A 3NQOA 4HV5A 4GTDA 4XLNF 1H9TA 2GA1A 1YW7A 5FFZA 5TJ3A 1TWGA 5L3GA 2BEOA 1Z6RA 4HF2A 5E8IA 3VODA 5DV5A 2GA2A 1SFOA 2L54A 4NB5A 4BAYA 2DO7A 3H3ZA 3N3YA 4CXFA 1PDNC 4LD5A 4XSZF 1O25A 5LGNA 4WXCA 1DPUA 1W7PA 4ENJA 1O29A 3BZ6A 2X4HA 4A0XA 1R22A 2QBYB 1B4BA 3E97A 4HX7A 3LA2A 4KASA 3BDDA 4MNUA 2VBYA 2V79A 1XD7A 4YIIA 2RVCA 3G4AA 1JE8A 4IRHA 2YU3A 2V6CA 3HSRA 1R1TA 2EFPA 2FU4A 3MFKA 4WXDA 5HLHA 1TWCA 4KYWA 1WKMA 2L4MA 4M9SA 1DD5A 4M71A 5FGMA 1PP7U 2VC0A 5AONA 4N9IA 3KEOA 3LSTA 2P5LC 4L9NA 2Y48A 4WF2A 3MEXA 4LLNA 5HLGA 1O3TA 4WWCA 4LGWA 1QBJA 2DK8A 3R0AA 1IZ1A 4M1XA 1R00A 3VOEA 1O3SA 4M9ZA 1Y0UA 3R6SA 2M87A 4A12A 4LJZF 4EJUA 3BPXA 4M6XA 1ZG3A 3JW4A 2JH3A 3ZN0A 4CZZA 2QQBA 2M30A 1BI1A 1QZYA 3KCCA 1YS6A 2DFIA 2XGXA 3K1MA 2FF4A 2L02A 3ZMDA 1OYIA 4AD9A 4MQ9F 5CJ9A 3QRFF 4EGZA 3ZQ7A 3IRQA 2KRFA 3FMSA 3GXOA 5J6XA 1R58A 3PQJA 4RGRA 2NNNA 2LF7A 1F5TA 5JHUA 2QUFA 1IN7A 4LLLA 4NHJA 3GTPA 4ETSA 4KMDA 4YIFA 1IN4A 2FEZA 3GFMA 4GTAA 3AH5A 2DT5A 1IXCA 4AVPA 1B9NA 1I6XA 3V7SA 1QZZA 1LDKB 2YSRA 1LJ9A 1SFXA 2Z99A 3V8KA 2ZXJA 4ZH4F 3E3VA 1WQFA 1J9IA 1D5VA 5IOQA 4AIKA 3R60A 3F72A 1ISEA 2H27A 4LQYA 1GXPA 4KAWX 2HKXA 1UHWA 2XV4S 1TNSA 5D8KB 1FX7A 2LNBA 3L09A 1QO0D 3M7GA 1GE9A 1ZREA 3NRVA 3BP8A 4G94A 5HS7A 2OZ6A 1IN6A 4KMAA 1LVAA 4DDQA 3JSOA 4GTFA 4C2MC 1XDSA 3WTVC 1STZA 5K5RA 3B73A 1XXBA 4YFXF 3WU1B 4OINF 1I5ZA 1YO5C 2QM3A 2J5OA 4BHCA 2K4JA 3RKWA 1BC7C 5FLXZ 3GFJA 2FBHA 1BM9A 2XKPA 5JI6A 2NVYA 3BJOA 1SD5A 3ABTA 3OOPA 3M9AA 5FFXA 2MLKA 1RIOH 3AQOA 4IVNA 2CQKA 2QENA 2M1BA 1JHHA 3WG9A 4ZZLA 1FOKA 1T98A 1FZPB 2W24A 3HUGA 5L3BA 2A6HF 2PG4A 2PQ8A 3I54A 1BJAA 3C1DA 5H6QA 1XN7A 3GZ6A 3QU3A 1WRJA 2NAZA 4J3NA 1OYWA 1OMIA 1O26A 2CSOA 2WWYA 2PHCB 1P92A 3IHUA 3J7AO 3FMQA 2VBZA 1G3TA 2YPRA 1PP8F 3MCZA 1FPQA 3V8JA 1U6GA 2FOKA 5ICCA 3FOFA 1ZXOA 5A2QZ 1YIOA 3MZYA 4CGZA 2FNPA 2ZO4A 3J80Z 2ISYA 5CYVA 5D4RA 4L5IA 4WK8F 3ZP5A 5AIPA 2Z33A 2EA2A 5JVTA 2O61A 5HDGA 1RUOA 4RS8A 1O28A 1HKSA 3AQPA 4P5AA 3LQRA 4KFCA 4U88A 1I1GA 1R5HA 2QVOA 3AAFA 1D8KA 5DYMA 1SMYF 3I58A 2FBKA 4A0ZA 1YYVA 1B4AA 3C7JA 2KIFA 2FMLA 4JQFA 2WC2A 3DF8A 3SFZA 3KE2A 4MGRA 3HHGA 3K1PA 5LEJA 3FOEA 3QX3A 1BIBA 4UV8A 3HTSB 1XXAA 5K5OA 3FXRA 3PQKA 5K1YA 4M73A 3R61A 4ASNA 1MJBA 3KFWX 3ECHA 2VE8A 1Q1HA 4A6EA 3E5QA 4BLAA 4HLYA 1P4AA 1OKRA 2YX7A 1LB2A 2PBIA 1EH8A 2R7ZA 2VONA 4S05A 3CO6C 3FXUA 5BS6A 2ZFZA 4XSXF 2XAFA 1LQ1A 4BNCA 3G73A 2QWWA 3U9GA 3ZMTA 3COAC 3U2RA 1S3JA 2RN7A 3RI4A 2GIVA 1SD4A 4GO1A 3IC7A 3M8FA 1LEBA 5JFRA 3E6MA 5E1XA 1AWCA 5D8LB 3S0XA 4LK1F 3GEZA 4BHPA 2CYYA 3WTUC 3EDPA 3MZHA 2R93A 4CYDA 1WWXA 1L3LA 2FMYA 4ESBA 4C3IC 1FNNA 1TQIA 3N0BA 4A5MA 2JTVA 2ISZA 2CFXA 4U7DA 2GSOA 1P6RA 2FNAA 3MMLB 4N9HA 2UZKA 1FBUA 5FD5A 2XROA 2ELHA 4U7BA 2IA1A 3KP2A 1MDMA 4B8XA 2HYFA 1O3RA 2X0LA 1I27A 2MA3A 1G3YA 4RGUA 5BMZA 2XAHA 2F5EA 1ZRCA 1QGPA 1G6NA 4G7OF 4MEYF 2GXBA 1K78B 3WTXC 2P5MA 5E1ZB 1F4KA 1I1SA 3CTAA 2EWNA 3BROA 3C3WA 1U2WA 2LSOA 2R3SA 3CUQC 3RJPA 1A04A 3KP3A 4EJOA 3LPXA 3LWFA 4FX4A 3I53A 2BV6A 2VBWA 3EYIA 2GSNA 4G8XA 1IXRC 4LG0B 1LDDA 3BJAA 4IXAA 3LAPA 2IVMA 3SZTA 5EGHA 2Q8KA 1S6LA 1MGTA 2P5KA 2E2IA 3L7WA 1V3FA 3BOQA 2E7WA 1FYKA 3EQLF 2Y75A 4HLXA 3GTOA 4D0PA 1HKQA 3N0CA 4GGGA 1SD6A 3EETA 2W57A 2D1HA 3N4MA 1QNTA 1MD0A 3H92A 2HEOA 5J8FA 3V4GA 3FXQA 1XSVA 1KU2A 1DDNA 5EEGA 2RDPA 2H94A 2CO5A 4TV7A 5DD8A 4HAMA 2Y3PA 2R92A 4Q5SF 5ICFA 2P4WA 2E1CA 1O7FA 4L0YB 1R7JA 1DP7P 1TW2A 4HX8A 4Q4ZF 2CWEA 4CHUA 3OREA 1UFMA 3BJ6A 5ILUA 1ON1A 1BI3A 4HDVA 4KN4X 2K7LA 4LG0A 4FX0A 1FP1D 2K4BA 4AWXB 3CDHA 4RAYA 4UVBA 4KDPA 2XASA 5HOOA 2FE3A 4OMZA 2KIUA 3KP5A 2GZWA 2HFHA 3WGGA 1VTNC 1EV7A 3GLXA 2Q2EA 3ELKA 5DUKA 2B0LA 2GXGA 2LF8A 1Y1VA 4WCGA 2ESHA 1P4XA 3DFGA 2L4AA 3FX3A 3RPUA 1SFUA 3ERED 4ZYEA 4H0EA 3EYYA 2PJPA 5CVUA 3HHHA 2F5FA 2HOEA 2EV6A 1LDJA 5JR3A 2DQLA 2A69F 3GFIA 3GTMA 1BIAA 3JTGA 1AB4A 4S04A 2HYGD 1CF7B 3OEPA 2HGCA 4RB2C 4RB3C 3RDIA 4FT8A 2KJBA 1CGPA 1FSEA 4L0ZB 1SD7A 3TO7A 3JAMK 1REPC 1Z91A 2JSCA 3CUQA 4ZYGA 1W7PD 3GO5A 3T1BA 4G0UA 5D5XB 1XB4A 1HW2A 1B1BA 4LB6B 3ISPA 1O2BA 3HRTA 1O2AA 1W7PB 1GHCA 3I4PA 1RUNA 1IAWA 5FD6A 2D45A 1JGSA 4P96A 1YG2A 4GYIA 1R1UA 3DPLC 4A5NA 2P8TA 3WTSC 2ETHA 4PDKA 1ZG1A 3TDUC 2NNYA 5L3DA 5ILSA 3NEUA 1KU9A 2QZ8A 1MZBA 2G7HA 2DK5A 5LRSA 1HXDA 3TDZC 2F5DA 1UB9A 2VUMA 4B09A 1X3UA 4HF1A 3FM5A 2HTSA 3ROUA 1H9GA 3E6BA 3CLOA 1ZLKA 2OU2A 4KIBA 4CO8A 1J7KA 2DLLA 2JPCA 4CDGA 3BY6A 1FC3A 3T0YA 2YU9A 2IRFG 5IT3A 3KP4A 4ZZDA 2IA2A 1D8JA 4KT5C 3OPFA 1W4MA 2IJLA 4HBLA 2QYOA 2F2EA 1YW9A 1IXSB 3ZMSA 2MD5A 1SAXA 2IA0A 4YG2F 4O3MA 3Q5FA 4HZFA 1FBQA 2VC1A 1ONVA 2CFAA 3K1NA 3GTGA 1XCBA 3QAHA 1FT9A 4KMUX 4P9FA 3Q3QA 2FBIA 1DPRA 1JHFA 3ZMUA 4GT9A 5JVOA 1AOYA 3BUEA 3V7RA 4HYEA 4HX4A 4L9JA 2QLZA 4KARA 5LGTA 3KZZA 4DNCA 2ZNYA 4QLCU 4KUMA 2NYXA 1F9NA 2EK5A 1IUYA 2HQRA 5HDKA 4KDDA 2JRTA 1ZN2A 4ENNA 3F8CA 4ENKA 3F6OA 1BI2A 2O3FA 1Z7UA 4C3HC 3K69A 1FWZA 2V1DA 2A6EF 5AIQA 4ESFA 1TWHA 3D5LA 4I09A 4RB0A 4F7ZA 1J2XA 1YW8A 2VOOA 3TQNA 3L9FA 3CO7C 1HKTA 4U0WA 5E18F 2KKOA 3K2ZA 1KQ4A 2OA4A 2V1XA 2QQAA 2M5WA 2IT0A 5F64A 2BBYA 4EJWA 5KK1A 1J5YA 1XMKA 3K9TA 2XVCA 3L4JA 4OIQF 3RYRA 1ZHFA 5IT9Z 2DAOA 3GWZA 4KIGA 1U8RA 1T39A 2IW5A 4NQWA 2MLGA 1ZRDA 2XCOA 3WGHA 1WQGA 2W25A 2P7VB 3O6BB 3QP5A 5LHGA 2P6TA 1RZ4A 1U5TA 4HOBA 4MQVA 3V8LA 4AIJA 1L0OC 4OIPF 1ZVUA 3HOTA 3KP6A 2ZKZA 1Z6TA 5L3CA 4IF4A 2EB7A 2KJCA 4EM2A 3I71A 4DQ2A 2BGCA 2PN6A 5LHHA 2OZUA 1XDUA 3F21A 1U78A 5HVQC 2R7DA 1ZARA 1QPMA 3IKVA 3LA7A 3Q9SA 1W5SA 4XBFA 2DI3A 3L00A 2JA6A 3F22A 1CF7A 4EVIA 2XUBA 6PAXA 3HRUA 3QPTA 3I0TA 1BGWA 4G7HF 1XSDA 3L2CA 3GTKA 4LMYA 1QQIA 1ZBSA 4G0VA 4A0YA 4ZYDA 4RAZA 3WTWC 2FXAA 4RB1A 2QBYA 5DCFA 3QOPA 1TWFA 3I59A 2VE9A 2KWAA 1TW3A 1ZGJA 3WTTC 1BN5A 2HKOA 1FY7A 3VA7A 3ECOA 3M1EA 3J81K 1SFEA 4HDUA 3GTJA 4LR2A 4EGYA 1XGNA 5CVVA 4G7ZF 1B9MA 3F3XA 3DKWA 4P55A 3KLNA 3H0GA 2ZMEA 3HOSA 3TOBA 2B63A 1GVJA 2MBFA 3WTZA 1DUXC 4EJTA 2MH9A 2A5YB 1V4RA 2STTA 5LLQA 1NHAA 2A07F 2RV8A 1KU3A 2XAJA 2EA4A 1MKMA 3QU6A 4OIRF 3WTYC 4P9UA 4KC6A 3FWEA 4HW0A 1P2FA 2D2WA 2WTEA 3FF5A 2L01A 4U0YA 2XRNA 1J0RA 4Y15A 3JAMZ 3SZPA 3R4KA 5LEKA 2COMA 4Z2YA 2FSWA 2HDCA 2YX4A 2EFWA 1WSUA 2VODA 1HW1A 3G3ZA 3U1DA 4N0BA 2FQ3A 3IL2A 4UHTA 2XCRB 1RNLA 2Z3YA 1UCRA 2PEXA 2GQQA 3RKYA 3DP7A 3JTHA 3ZPLA 3QP6A 3Q9VA 4GTCA 1WI9A 4AIHA 2CG4A 1MJ9A 4LFUA 1IRGA 4ESJA 1U3EM 3VEPA 3DXJF 3DQVC 3T8TA 4A6DA 2WV0A 2MH2A 1ZAOA 2FA5A 3T5XA 1TQMA 3WU0A 4JK1X