3V4GA

1.60 angstrom resolution crystal structure of an arginine repressor from vibrio vulnificus cmcp6
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
151
structure length
145
Chain Sequence
KQDNLVRAFKALLKEERFGSQGEIVEALKQEGFENINQSKVSRMLTKFGAVRTRNAKMEMVYCLPTVSSSLRELVLDVDHNQALVVIHTGPGAAQLIARMLDSLGKSEGILGVVAGDDTIFITPTLTITTEQLFKSVCELFEYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.60 Angstrom resolution crystal structure of an arginine repressor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Dna binding protein
molecule keywords Arginine repressor
total genus 51
structure length 145
sequence length 151
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v4gA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3v4gA02
4DQ2A 3ZPLA 3SZTA 3KP5A 4WCGA 2D1VA 4HA8A 4I01A 3DF8A 3WTUC 2P7VB 1U3EM 4EJUA 5CVVA 1WQGA 4U0YA 1WI9A 2ISZA 2XCQA 4HBLA 1F4KA 3EYYA 4WXHA 1LDDA 2DPUA 1W7PA 3M8EA 2CG4A 2FMLA 4FT8A 2P6SA 2FBHA 2LKPA 3W6JB 2GA2A 2XV4S 3K1MA 4EV0A 3WTXC 4KT5C 2JTVA 1PUEE 4L0YB 3ECHA 1HXDA 1LDKB 1W7PB 3GUDA 5DD8A 1XMAA 5K5OA 2R7DA 4XLNF 3R61A 2W24A 1ZRCA 4LLNA 3KEOA 1O57A 2QUFA 1YO5C 5CVJA 4R79A 2OD5A 1TNSA 4EJOA 5L3GA 2CW0F 3LAJA 3P7NA 3J81K 4Q4ZF 1EH7A 4HV5A 5J6XA 2Z5UA 2BEOA 2PBIA 3MAJA 2NNYA 5JVOA 1YS6A 4G7HF 2ZFWA 5JVTA 5TJJA 1G3TA 1BI1A 1IXSB 4BXUA 5LRRA 3ROUA 4OU0A 2K86A 3JSPA 3HRMA 5DUKA 4OMYA 2MH9A 1Z6RA 4IRGA 4HQMA 3DQVC 2EA2A 2HQNA 4BHBA 5F1RA 1XD7A 2YSRA 4AIJA 3RYRA 2EFPA 1D8JA 4GYGA 3F8NA 1XN7A 2FF4A 3ZMSA 2FBIA 3QPTA 1I6XA 3CLOA 3W6KB 3I54A 3E6MA 3R0AA 5HDGA 1BJAA 1JE8A 5CVUA 4H0EA 4A6DA 3JAMK 3K1PA 4UV8A 3GZ5A 4FHTA 2VE8A 4A5NA 2HTSA 3LA3A 5CVRA 2QWWA 5HLGA 3GW2A 4G7OF 4PCQA 2FRHA 3G73A 2CWEA 2NNNA 3O3KA 3QP5A 3OEPA 2TDXA 4LFUA 1S29A 3C3WA 2J5PA 3T1BA 2F5FA 3FZVA 3FHZA 2GIVA 2EK5A 2IRFG 5D5VB 3WU0A 3HIFA 1T2KA 1R36A 5H6RA 4FM9A 2RDPA 2GWRA 2HFHA 3F8BA 3E6BA 3GVAA 5TRDA 4YFXF 4DDQA 3HHGA 3NRVA 3GYHX 2LNBA 4M72A 4RGSA 3ZMDA 1ODDA 2JRTA 1KU2A 1G4DA 1IN5A 5K1YA 5CJ9A 4I0BA 2FBKA 1EH6A 1RIOH 5D6EA 1EH8A 1J75A 1FWZA 5HVQC 4KNYA 1IRFA 3F22A 2HWVA 1K7AA 5DD4A 1IN6A 3IWFA 2PMUA 2K7LA 2EV6A 2XVCA 2L4MA 3KP7A 1WQFA 1XSXA 1ZG5A 2W25A 5LLQA 3OPFA 1FSEA 3DEUA 4EQQA 2OZUA 2YPRA 3U2RA 2V9VA 1HBXG 4WF2A 1FSHA 2F5CA 3RDIA 1LEBA 3EETA 1U2WA 4HF2A 3NQOA 4KB4A 2XROA 1XGMA 3L9FA 2QM3A 3SFZA 3T8RA 3E5QA 4RAZA 3SXYA 4JK1X 2DU9A 1HSJA 2O61A 3H92A 3CJNA 1UFMA 1R22A 3FWEA 5ICEA 4GGGA 3S2WA 3CAGA 2CO5A 2F5EA 3WE3A 4I2OA 1U8RA 1MGTA 3CTAA 2RGRA 1XCVA 1YW8A 1F1ZA 2A07F 4WWCA 5ILVA 4UVAA 3NUHA 3FOEA 5J8CA 2ZBKA 3HOSA 3F3XA 3C18A 5E8GA 2IT0A 1WQ2A 1Q1HA 4R1HA 2G7HA 2R7FA 4UVCA 2STTA 2DFIA 3DPLC 3E5XA 3ELKA 2K02A 3BOQA 1KU9A 2OA4A 1OYYA 3VOEA 3WE2A 2HEOA 1MJAA 1XSDA 1DP7P 2X4HA 3E97A 2D1HA 1Z1DA 1ULYA 1ZYRF 2XCOA 1OPCA 3VB2A 2VBZA 1FBSA 3K2ZA 2GAUA 3F8MA 5IT3A 3ABUA 3GWZA 2GZWA 1QZYA 1YW7A 4MNUA 2E1CA 4XSXF 1B6AA 1TLHB 2FE3A 1GHCA 1XXAA 2A3SA 4MQ9F 2Z99A 1MJ9A 4EM0B 4GO1A 5E1XA 4ENMA 1SMTA 1BC8C 3TOAA 3RTRA 3MMLB 1XSVA 3HYIA 3GF2A 4M71A 4O5VA 2P5KA 4CHUA 3WTYC 4CGZA 2MLKA 1YTYA 2XCRB 2Y3PA 2VT2A 3D0SA 3TKYA 2ZMEB 3QU3A 4WXDA 3LA7A 2G9WA 2FMYA 3DPTA 1T38A 5A2QK 1IRGA 3BJAA 4MGRA 3SHFA 1O7LA 3R60A 3K69A 1HSTA 2DI3A 4N9IA 3EDPA 5FLXK 1JGSA 3BROA 4EM1A 1BIAA 5EEGA 1SD5A 3OV8A 2XAFA 1H9TA 1E2XA 1GXPA 2M1BA 3BPXA 1B59A 5DCMB 2GQQA 3NEUA 3JTHA 1W7PD 4L0ZB 4P5OA 5KK1A 2QQBA 2QQ9A 3RKXA 2QZ8A 1XB4A 4BAYA 4LG0A 2KJCA 1QGPA 4HDUA 2Z33A 1JHHA 4O3MA 1USSA 2JT1A 4G0UA 3KP2A 5FD6A 2P5MA 2JPCA 5ICCA 5L3DA 1RI7A 4ZH4F 3HOTA 1RZ4A 2AXLA 2JSCA 1DPRA 2EWNA 4AD9A 3EUHA 2V1UA 1ZGAA 1BI2A 4UUVA 5D5WB 3KFWX 3HRTA 3RKYA 2XKOA 3DV8A 4A0XA 1FP2A 2L3DA 3L7WA 5LGTA 5E1ZB 2PI0A 3GXOA 1IN7A 3GFIA 4A12A 4DNCA 1J9IA 2KIMA 2P4WA 4M74A 2WWYA 2CQKA 5K5RA 4KIBA 3F23A 1FZPB 2V79A 2XAHA 5BMZA 5JFRA 2DT5A 4WK8F 4F7ZA 4Q5SF 1YQAA 4A0ZA 3FMQA 1K6OA 4L18B 2FU4A 5ICGA 2VONA 3P9KA 3RKWA 4HX4A 3GO5A 1F9NA 5BQTA 2HYFA 4CICA 2HR3A 1T0FA 1P4XA 1ZAOA 3JSOA 1S7OA 4OIOF 1ON1A 3QAHA 2CYYA 3VA7A 4ESJA 4GXOA 3EYIA 2F2EA 1RNLA 4HW0A 1S8NA 2KIUA 4QWQA 3RPUA 3Q9VA 4UHTA 5KVRA 3ERED 3T8TA 2M87A 3HUGA 3PFIA 3V8LA 2STWA 3BDDA 1HKQA 3F21A 3MZYA 3SZPA 2PQ8A 5FLXZ 5HOOA 3WG9A 1FC3A 1WSUA 5E17F 2IA2A 4XBFA 3MZHA 2XRNA 3F8FA 3VEPA 3KZZA 5E20A 4RB3C 5EEHA 4HYEA 1O3RA 4NB5A 3TO6A 2FEZA 1I1SA 2ETHA 3F72A 1U5TB 4HLXA 4FX4A 4GFQA 2M30A 2FNAA 3DKWA 2XUBA 4XRFA 2OZ6A 2ZJ2A 4KMFA 4KAWX 4HLYA 4KICA 1WIHA 1ZRFA 4BQAA 2RVCA 3ML6A 4KDDA 2W84A 1BC7C 1KQ8A 5FFXA 3CUOA 1L3LA 1O3SA 3WU1B 3BPVA 5FB2A 4CZZA 2Z9OA 2DTRA 1NHAA 4I02A 4P96A 5LGUA 1BI0A 3ABTA 2RV8A 2OQGA 4LG0B 3M7GA 4KDPA 1D8KA 2ZXJA 2OQRA 4G7ZF 1K79A 4PGHA 1R5GA 1USTA 2ZCWA 2EV0A 1OYWA 5BS6A 1J0RA 2DK5A 4IPAA 1E17A 1R1VA 3LPXA 2C6YA 2HOEA 2Q0OA 2J5OA 2BE5F 5K5QA 1J5YA 1FT9A 2DK8A 1S6LA 1W5TA 5ICFA 2H94A 3QX3A 3B73A 1D3YA 1RUOA 1BI3A 1R5HA 2CSOA 3IHUA 3V4GA 1T6SA 3WTWC 3QRFF 4LLGF 2JZYA 2VXZA 1FP1D 5D4RA 4ZYEA 2KIFA 3KETA 3L09A 2D45A 2P5LC 2UXXA 1XDSA 3L00A 4OIQF 3LFKA 3RIRA 3I53A 4R8HA 1FYMA 2FOKA 4HZFA 1HW2A 4KB2A 3T5XA 2HS5A 1G3YA 3KLOA 3F6VA 3RPQA 1KGSA 4YIFA 4LK0F 1DDNA 4MHGA 4G8XA 4D0PA 1IZ1A 2B0LA 3CUQA 1OYIA 3HTUA 1UB9A 2EA4A 2DQLA 1FY7A 1ZG3A 1K78A 1KQ9A 3I0TA 4ESFA 1WKMA 4YG2F 3C7JA 2V6CA 3BWGA 4KUMA 4UXNA 4HQEA 2A5YB 2YX7A 2QLZA 2PJPA 1ZH5A 1ON2A 1EV7A 1BM9A 6PAXA 4U88A 2HKXA 1B9NA 4K2EA 2ELHA 5IT9Z 5FGMA 1KU3A 1FYKA 3BUEA 5HLIA 1ZLKA 1G3WA 4GYIA 2BYVE 4RGRA 3H3UA 5L3BA 5D4SA 1J7KA 2KJBA 2A61A 4CDGA 4E70A 3ECOA 2H6CA 4I98B 3ZMZA 4AVPA 1FYLA 4CO8A 2E7WA 1B4BA 1TQMA 2P5VA 4OIPF 5ED4A 5H20A 1LQ1A 1ZARA 5A2QZ 5D8LB 5L3EA 4XLPF 2UWMA 4ZYDA 4HX8A 2IP2A 4OMZA 1XXCA 3LAPA 2ESNA 2IW5A 4A6EA 5DCMA 1YS7A 2AS5F 1G3SA 2ZFZA 3KEQA 1S3JA 5ILSA 3HSFA 3TGNA 4M73A 1IUYA 4A5MA 3KP6A 4RGXA 4HAMA 4RB1A 4BHPA 3OOPA 5LEKA 3BJ6A 2UXNA 4UV9A 2P6TA 2ZNYA 1P4WA 2VBWA 2O03A 4Z2YA 3FXUA 3REOA 3TQNA 5E18F 1TW2A 3QU6A 3HRSA 4IXAA 3RI4A 2MLGA 1DD5A 3FM5A 3LSTA 5AIPA 3O2PE 5DV5A 1U5TC 2ZMEA 3E5UA 2VC1A 3J80Z 1OR7A 4ENNA 4HX7A 2PFBA 1SD6A 2HTJA 2M8EA 2ZO4A 3L4KA 2FXAA 1U6GA 1T39A 3O6BB 3WODF 1RUNA 1Z9CA 1AWCA 4YFKF 5FO5A 1ZREA 2IA1A 2E7XA 4EMSA 1AOYA 4IRIA 4OINF 4JBAA 2H27A 4G6QA 2LF8A 4UNOA 4IF4A 3ZN1A 3KP3A 4LMYA 1SAXA 1FBQA 4S04A 1K78B 1GXQA 2LF7A 2FQ3A 2LDUA 2X0LA 2O6GE 4BH9A 5BPIA 1R58A 2A6HF 4O6JA 1LJ9A 4ENJA 1LVAA 3J7AO 4EGYA 2GA1A 3R6SA 1P2FA 3LQRA 3JTGA 2MBFA 1YIOA 1ZGJA 1JXSA 3M1EA 4AIKA 2L01A 2XAGA 1U78A 2ISYA 2GXBA 2IJLA 2Q2EA 4A2UA 1XDUA 3P9CA 5HS7A 4HV6A 2QYOA 1KA8A 4LB6B 4KMUX 1FNNA 2RQPA 2XAJA 4I09A 5E8IA 3KLNA 1UHMA 4EJWA 2DO7A 2BBYA 4AIHA 1FX7A 2HKOA 3QP6A 4EVIA 1IN4A 1P4AA 1PDNC 2JPBA 5F64A 3H3ZA 1AB4A 4ZYGA 2HZTA 4KFCA 1G6NA 4ENKA 5JR3A 2NRAC 4ZZLA 1T98A 1ZLJA 3V8KA 3T0YA 1XXBA 3PQJA 1WWXA 3FM3A 4G9YA 3KZYA 1KQ0A 4QLCU 1ZVUA 2QBYB 2PLYA 1S7AA 3WGIA 1TNTA 2M45A 2M5WA 3GFLA 2QVOA 2MD5A 1LNWA 3V7SA 1O3QA 5DYMA 3ZMUA 2RNJA 1MJBA 4HOBA 4LD5A 4A0YA 5FD5A 1SFUA 2YU3A 2OAZA 3SQNA 2G7UA 4OIRF 2DQRA 3IKVA 1U5TA 4TV7A 3E6DA 1DPUA 1QQIA 2MH2A 4M9ZA 3F6OA 5L3FA 2H6BA 1STZA 5DUIA 2XGXA 5HS8A 2L4AA 4M9SA 4LJZF 3AAFA 2YX4A 2O0YA 4YIIA 4KA4A 3KE2A 4BYYA 2HQRA 2V1DA 1UHWA 1YW9A 3M8FA 4Y17A 2EFQA 2PEXA 2EFNA 1KYZA 3CDHA 4M6XA 2DW4A 5LHGA 4MQVA 3FXRA 2PG4A 1MKMA 1SD7A 3K9TA 1R00A 4G0VA 1BBYA 4CXFA 2QBYA 1REPC 1IAWA 5AONA 4EJVA 1BOAA 1BIBA 4L9VA 4L9TA 3I4PA 3Q9SA 4G6DA 1H0MA 1EK8A 1J2XA 3BY6A 2OU2A 3C1DA 3QOPA 3ZN0A 4IHTA 3MEXA 4ASNA 4ZZDA 3V8JA 4N0BA 2PHCB 2IPQX 3V7CA 2PN6A 3KP4A 1B9MA 4IJAA 3RYPA 2Y48A 1DUXC 2VODA 1EH1A 2V1XA 1MDMA 4ESBA 1X3UA 1XMKA 2IVMA 1LDJA 2RC4A 3HHHA 1QPMA 3N4MA 1Z7UA 2A69F 1FOKA 3IRRA 1L0OC 1P92A 5HLHA 3TDUC 2ESHA 2KRFA 1ONVA 3DXJF 2XIGA 4J3NA 4KIGA 4P55A 2K4BA 1KYWA 2VN2A 1H9GA 2WC2A 1GVJA 1UCRA 1ZRDA 3GX4X 4BHCA 4UVBA 3MWMA 2L02A 5IT9K 3D5LA 4KN7X 5HDNA 5CLSA 4LK1F 2IA0A 4I7HA 3ISPA 2O3FA 4EJTA 1YFHA 1OMIA 3E6CC 1CGPA 3GFMA 1I1GA 3IWZA 4HF1A 2ADUA 3ZMTA 1Z91A 3HRUA 1JHFA 3GLXA 4RS8A 5LHHA 4Y13A 2DPDA 2VBYA 2DBBA 1QZZA 3TDZC 3TO7A 1I27A 1Z6TA 5L3CA 1GE9A 2Z3YA 1SD4A 3WGHA 4ETSA 5D8KB 3R0JA 1R7JA 3JAMZ 2COMA 1HW5A 2R3SA 1C0WA 1WQHA 1QNTA 2CFXA 2ACJA 3E3VA 2EFWA 5D5UB 2BGCA 2Y0MA 4U7DA 1O7FA 1ZN2A 2VOPA 1WRJA 4RB0A 3FMSA 1IF1A 4NQWA 3CO7C 1KU7A 2HYGD 2F5DA 1HW1A 5ILUA 3MFKA 3P9IA 3JW4A 1A04A 3J80K 4IRHA 3CO6C 2KKOA 5DEQA 3PQKA 4GCVA 3IC7A 2VE9A 2LSOA 3J81Z 4L9NA 1D5VA 2DLLA 3COAC 3TO9A 3DFGA 3Q5FA 3CUQB 1LB2A 4XSZF 4LLLA 1YYVA 3DP7A 4MTDA 5BPDA 1TBXA 2RKHA 1VTNC 1HKTA 2H09A 1I5ZA 5HS9A 1IN8A 3KCCA 2UZKA 4OOIA 5D5XB 1YG2A 5FFZA 4KIFA 1FBUA 1P6RA 1J59A 2K27A 3I64A 5J8FA 2EV5A 3WGGA 4RAYA 2A6EF 1QO0D 2P7CB 4NHJA 3CUQC 3U9GA 2OBPA 3OREA 3IRQA 5BOXA 3IL2A 4PDKA 1CF7A 3GZ6A 4HF0A 1FPQA 1B1BA 2WV0A 4JQFA 4YFNF 2FNPA 1LEAA 5LGNA 1ZHFA 3LQQA 2D2WA 1IXRC 1IW7F 3WTZA 4L5JA 3GEZA 1HQCA 4MEXF 4LB5A 4M6YA 5H6QA 1O3TA 5LBQA 2FA5A 5E1WA 2DAOA 3FOFA 1R1TA 3ZQ7A 2A68F 3ZP5A 4ZYHA 4FX0A 2PMHA 4CYDA 2W57A 4EGZA 1OKRA 5DCFA 5CYVA 2NS0A 2MA3A 3BP8A 3F8CA 4B8XA 2VOOA 1TQPA 4Y15A 1ZG1A 4HDVA 1PP7U 3I71A 1Z05A 3EQLF 2CGPA 1TQIA 4ON0A 4P9FA 1MDMB 4KC6A 5JI6A 4RB2C 2EB7A 3HTSB 3IKTA 3HSEA 2Y75A 3ULQB 4L9JA 3WTVC 3GFJA 1W4MA 1R1UA 3B02A 1Y0UA 3N97A 5JHUA 1ISEA 3HSRA 2EJRA 3VFZA 5HDKA 4U0WA 4EM2A 2RGVA 2E1NA 4G94A 4P9UA 3MQ0A 2FSWA 2NAZA 2ZKZA 1BGWA 4L5IA 3WTSC 1TTYA 1HKSA 1SMYF 2P8TA 4G0WA 3MCZA 2WTEA 2RN7A 2Q8KA 3U1DA 4B09A 5ERIA 4RGUA 2YR2A 4M9XA 1R23A 3VODA 5LEJA 1F5TA 5LRSA 1W5SA 2XAQA 3G3ZA 1V3FA 4Q47A 4MTEA 2QQAA 1MD0A 4N9HA 4LGWA 2XASA 2QENA 3L4JA 4WX9A 2VC0A 3FMRA 2KWAA 3I59B 5AIQA 2EFOA 2MC3A 1FLIA 3I58A 2BV6A 5CVIA 4IHSA 2NYXA 2HGCA 1QBJA 5D6FA 4AWXB 3FX3A 4Q48A 3FF5A 1BN5A 5F6FA 1YLFA 3BJOA 2ZNZA 4MEYF 3M9AA 3WTTC 1B4AA 4S05A 1V4RA 4WXCA 1XCBA 3K0LA 2O8XA 3QPHA 1XGSA 3L2CA 4U0VA 1XGOA 2VBXA 1PP8F 3TOBA 1XGNA 3ZMVA 4KN4X 5LHIA 4I0AA 1CF7B 2XHKA 5DDGA 3FXQA 1IXCA 3R4KA 1BJTA 2K4JA 3K1NA 4KYWA 2W85A 1SFXA 3LWFA 3I59A 3RJPA 1TW3A 4U7BA 1SFEA 3BZ6A 2L54A 4IVNA 4PGGA 1MZBA 2VT3A 4PZJA 2HDCA 4BNCA 3V7RA 2XKPA 1IS1A 3I5UA 3LA2A 2GXGA
chains in the Genus database with same CATH superfamily
4DQ2A 3ZPLA 3ESWB 5F0HA 3SZTA 2Z1DA 3KP5A 3CMMA 1O2AA 2HVRA 1TWCC 4WCGA 2D1VA 4HA8A 4I01A 3DF8A 3WTUC 2DT6A 4MFEA 2P7VB 1U3EM 4IEJA 2HVSA 3CC4I 1P9QC 2UUZA 4D5CA 3S3MA 4KMHA 4EJUA 3K4MA 4UUSA 1WI3A 5CVVA 1WQGA 4U0YA 2MW8A 1MBKA 1WI9A 1GDTA 2ISZA 2XCQA 4HBLA 1F4KA 3BTCA 4C2MC 3ONQA 3EYYA 3OOUA 4WXHA 4YRVA 1LDDA 2DPUA 1W7PA 3M8EA 2CG4A 2FMLA 4P5AA 4FT8A 2P6SA 2EPFA 2FBHA 2L7KA 1BS2A 4AH6A 2LKPA 3AG3H 2YU9C 1OCZH 3W6JB 2GA2A 2XV4S 3K1MA 3A03A 3HOVK 1IL2A 4EV0A 3WTXC 4ZYAA 3JRGA 4KT5C 4A3LC 1FIAA 2JTVA 1Y56A 2ZUEA 1PUEE 2BHYA 4L0YB 1RKTA 4D7NA 3ECHA 3A0BC 2XF6A 4KASA 1J6VA 3HB9A 1HXDA 4N4OB 1Y39A 1ETXA 1LDKB 1W7PB 3GUDA 5DD8A 4XCHA 1XMAA 3IH4A 5K5OA 2P0WA 2R7DA 4BE0A 1MH3A 2QSHX 3RPUD 4XLNF 3R61A 2W24A 1WJFA 3VYRB 3HZJA 1ZRCA 4E7SA 4MQ9A 5JHFA 2HOAA 3B6CA 4LLNA 4FE4A 1O24A 1A5JA 3KEOA 1O57A 4C3IJ 2CV0A 2QUFA 4E7IA 3L2VA 1YO5C 3E1SA 2W7VA 5CVJA 4R79A 3ZQQA 1UMQA 3K70C 2R7OA 1VQ9I 3HOWC 2JA2A 2OD5A 3BG7A 4Y7NJ 1TNSA 3EPZA 2F4IA 4ZJZA 2ELJA 3S2DJ 3OYGA 2E60A 4KJZA 4EJOA 5L3GA 2CW0F 3M3YJ 2OCCH 3LAJA 5EDNA 3P7NA 1YRNB 3J81K 4Q4ZF 4AYBA 1EH7A 4HV5A 5J6XA 1I6VA 2Z5UA 4G7HA 2BEOA 2PBIA 3MAJA 2NNYA 2FUG2 4E7KA 5JVOA 4BEHB 2B63K 3OYJA 2LBFB 1YS6A 2R5ZA 4G7HF 2ZFWA 5JVTA 4BXXC 2IGMA 2IS6A 2FOWA 4BBSK 4A3FJ 4Z6YA 5TJJA 2NVTC 3ZQIA 4XICA 1G3TA 5FLMK 1BI1A 3W2VA 1IXSB 1TWFK 4BXUA 1H89C 4BUPA 5LRRA 3ROUA 4OU0A 2K86A 3JSPA 3HRMA 5DUKA 2BVLA 4XRSG 2MH9A 4OMYA 3RZOJ 1Z6RA 4IRGA 4W1UA 1G8XA 1TT5B 4HQMA 3PO3J 1LPQA 2ZSIB 3DQVC 2EA2A 2HQNA 1UV7A 2GSOA 4BL0B 3HOVC 2XAUA 3A1YA 4BHBA 5F1RA 1XD7A 2YSRA 1X2NA 4AIJA 3RYRA 2EFPA 1D8JA 2XRLA 4GYGA 3F8NA 4CZCA 4HSRA 4XL9A 1LE8A 2R92J 1ITYA 3HUGB 4CYCA 3HPGA 3HGGA 1XN7A 2A69A 3S1RC 1ZBSA 2DFFA 2FF4A 3SJMA 3ZMSA 2FBIA 3BQZA 2E2JJ 3MKLA 1SANA 3CLQA 2X51A 2L9SA 3QPTA 1I6XA 3CLOA 2E2IA 3W6KB 4BY1K 3S2HK 1IBAA 2E19A 5J4VA 4JK1A 3I54A 3BR2A 3E6MA 5C44K 1WCMC 3KZIC 2E1OA 1O25A 3R0AA 5HDGA 3M4OJ 3RZDJ 1BJAA 1JE8A 5CVUA 2K9MA 2LR8A 3DBLB 3EUAA 2VI6A 1XG1A 1BJZA 4H0EA 4A3KJ 3SEQA 2VJ5A 2DMPA 4A6DA 1F7UA 3OS1A 1DCOA 3JAMK 1ENHA 2X6WA 3GZ5A 1MMDA 2DFHA 2JWTA 3A02A 3K1PA 2VE8A 4FHTA 4A5NA 2PPBA 1D0ZA 1FMVA 2HTSA 2IEKA 3LA3A 5IP7J 3CJRB 3IH3A 5CVRA 1SFOA 2E35A 2YS9A 2DMUA 2QWWA 3HC7A 2M8GX 4KT6A 5HLGA 3GW2A 4G7OF 1ZQ3P 2JN6A 2FRHA 4PCQA 5F1JA 1R4MB 3G73A 1VLOA 1S9HA 2CWEA 2NNNA 3O3KA 3QP5A 5J3LA 3OEPA 3CCYA 3IH2A 2TDXA 5EEAA 4LFUA 2QGUA 3MKWB 1SMYA 1S29A 3C3WA 2ZMEC 1FEXA 4ILDA 5KNLA 3GTLA 3EQLA 5BNGA 3H3VL 3GTMA 2J5PA 3T1BA 2LLKA 2HQAA 3QODA 3LSKA 2F5FA 3FZVA 3FHZA 4Q4ZA 2GIVA 2EK5A 1IJWC 2IRFG 1VQ4I 5D5VB 3WU0A 3HIFA 1T2KA 1R36A 5H6RA 2DOAA 3PM1A 4FM9A 2RDPA 3F9KA 4BY7J 1A35A 3S0XA 2GWRA 2HFHA 3F8BA 3E6BA 3GVAA 5TRDA 4YFXF 2DA2A 4DDQA 2JSPA 2G0EA 3HHGA 3NRVA 5CQEA 3GYHX 1RU0A 1GLNA 4LK1A 2LNBA 1D1BA 4M72A 4RGSA 3ZMDA 1IG7A 2KFDA 3L2QA 2A5WA 1ODDA 1ORKA 2JRTA 3QYFA 5FKNA 4CCOA 1KU2A 4QSHA 1G4DA 2JA6K 2L7ZA 2E2IC 2K9QA 4DW6A 2W82A 3OSGA 2E2HJ 1IN5A 5K1YA 5CJ9A 4E7LA 2MGQA 3C2GA 3ABKH 4I0BA 4RA2A 2XPWA 3M8JA 1L0WA 1FOWA 4A3CK 2FBKA 1EH6A 1RIOH 5D6EA 1WH5A 1Y0NA 3CZ6A 5EGHA 4BJ5C 1EH8A 1WPKA 1J75A 2ZUFA 3PSIA 1FWZA 1BA5A 5HVQC 2FQ4A 2DA1A 4B47A 4KNYA 1IRFA 2O5JA 3F22A 1OCRH 2HWVA 1K7AA 3S1NK 5DD4A 1IN6A 3IWFA 2PMUA 2DA5A 4E6KG 2K7LA 2KHMA 4XKWA 2EV6A 2XVCA 5B1AH 4FCYA 1IE0A 1TWHC 1XPXA 2WB1D 1MSEC 2NVYK 3G71I 2M4GA 2L4MA 2XPVA 2MABA 1BR1A 2RREA 3KP7A 1WQFA 3HKZN 2WB1A 3JRCA 1RESA 1YJ9I 1XSXA 3WHCA 5HNFA 1X31C 5DM7F 2JVGA 4BQQA 3S1MC 1ZG5A 2W25A 5LLQA 3OPFA 1FSEA 3DEUA 1J6XA 2GAHC 2BY0A 4EQQA 2OZUA 2YPRA 3UKGA 2A68A 3S17C 4OAZA 1PJRA 3U2RA 3A01A 2V9VA 2M2EA 3OYNA 1YIJI 1HBXG 4WF2A 5DS9A 1TWFJ 2VPRA 1FSHA 1EF4A 4JP0A 2F5CA 5M3FK 4BXFA 4XLHA 4KM8A 3RDIA 2O5IA 3OYCA 5C4JK 1LEBA 2ZSHB 2RH6A 3EETA 1U2WA 4HF2A 3NQOA 4XIDA 4KB4A 3S8PA 4CSWA 5TMFA 2D5VA 3GTQJ 2XROA 3GTPC 1XGMA 3L9FA 2QM3A 3SFZA 3T8RA 3E5QA 4RAZA 3SXYA 2HOTA 4JK1X 4V19K 2DU9A 2V6TA 2OJED 1HSJA 5LD2C 2O61A 3H92A 2R7XA 3CJNA 1UFMA 2Z16A 1K4TA 1R22A 3FWEA 5ICEA 2L7MP 4RLQA 3S1QC 4GGGA 2JRMA 3S2WA 3CAGA 2CO5A 1WJCA 2F5EA 2QSFX 3VSLA 3WE3A 2QA4I 5CKTA 2IXSA 3M4OK 3K4KA 1Y1VA 3H9GA 4BY7K 4I2OA 4E7HA 3AH5A 1K6YA 1U8RA 3CTAA 1MGTA 2V1NA 3HJEA 2RGRA 1XCVA 1YW8A 1USMA 3FXOA 2CUZA 1F1ZA 1NK2P 4WWCA 2DYSH 5ILVA 2A07F 2L0KA 5IYCK 1QZEA 4UVAA 3NUHA 5C3EK 2WAQN 3FOEA 5J8CA 2ZBKA 3BR1A 3HOSA 3F3XA 1PJ5A 4A3KK 1POGA 4YFNA 2O8KA 3C18A 5E8GA 3HGYA 2IT0A 1WQ2A 1Q1HA 4R1HA 2G7HA 2R7FA 4UVCA 2STTA 2LFBA 2KDOA 2ZXWH 1D0XA 2BVMA 3BR5A 1V5GA 2DFIA 3DPLC 3KYCB 3VYSB 3W2AA 4A3IC 2CFAB 3E5XA 3S2HC 3ELKA 4XLAA 1WOSA 2E5NA 2K02A 1SVLA 2LRDA 3BOQA 1KU9A 2OA4A 4OINA 4BXXK 1OYYA 3SZZA 1JT6A 3VOEA 1P7IA 5CQGA 4AYBL 3WE2A 1H88C 2HEOA 1MJAA 5FJ8J 2ZXIA 1XSDA 2EIJH 2Q2EB 1Y1WA 2QKLB 5KAIC 3SZGA 4DGWB 3GTJJ 4RBOA 1NH3A 1DP7P 1F7VA 5J40A 2X4HA 1AA7A 3DWLE 2BY3A 3E97A 2D1HA 2V26A 1Z1DA 1ULYA 1ZYRF 1GT0C 1DCHA 4M6VA 2XCOA 1MBGA 2X6YA 3I4NK 1OPCA 3VB2A 2VBZA 5E3OA 5B3SH 1FBSA 4CCLA 3K2ZA 2GAUA 3F8MA 5IT3A 3ABUA 3GWZA 2GZWA 2PJRB 2NVQJ 3K7AK 1QZYA 1YW7A 1WJDA 4NC8A 2JA6J 2E2JK 2HXIA 2R93J 2OTJI 2VJJA 5EZGA 5FLMC 1EFWA 4MNUA 1APLC 1WSRA 2PMZD 2E1CA 4AIDA 4XSXF 3WU2C 1B6AA 1TLHB 2FE3A 3T02A 4MEXA 3E0JB 3OIOA 1WSVA 3S17J 4C2UA 1GHCA 3TW6A 3AG1H 1XXAA 3JCUC 3AD7C 4IOAF 5FKLA 3V42A 3GTMJ 2A3SA 1YX3A 4A3LK 3JRHA 1BW5A 2CS3A 4AYBN 2MG4A 2IGNA 2Z99A 4MQ9F 5EF6A 1MJ9A 4EM0B 4A3MJ 1D1AA 4GO1A 2LY2A 3QYBA 5E1XA 2DT7B 4ENMA 1SMTA 1BC8C 3TOAA 3RTRA 3MMLB 1ZR4A 3HOWK 1VQPI 1XSVA 4HG2A 1R9TK 3FK6A 3HYIA 3GF2A 1TWHJ 3FXKA 1ETYA 4LLGA 2K9SA 4BBRK 3S16C 2D6FC 3S1NJ 1Z3YA 4M71A 4O5VA 3ZQHA 2P5KA 4CHUA 1JTXA 2JVHA 3WTYC 4GTDA 2VJ4A 4CGZA 3VPRA 2MLKA 4QPOA 3DTIA 3S1MJ 2R5YB 1YTYA 2KP6A 2XCRB 2WAQL 3GTGC 2NVYJ 1UG0A 3ABLH 3GMEA 5M5XJ 1JJ6C 4A3GK 2Y3PA 2VT2A 1YI2I 3D0SA 1PJ6A 3TMOA 3TKYA 2ZMEB 3QU3A 4WXDA 4D7MA 4LQYA 1XC5A 2FD5A 3NAUA 1J98A 3JRAA 3LA7A 4IL6C 4QJVB 2JA5K 3GTGK 1I3QJ 2G9WA 5GTIC 2FMYA 3DPTA 1T38A 5A2QK 1IRGA 2A6TA 1R49A 3S15C 3BJAA 4MGRA 3SHFA 3W3CA 1O7LA 3R60A 3K69A 1HSTA 2DI3A 4N9IA 2GXAA 3HOYK 4NC6A 4ANJA 3EDPA 5IYBC 2WAFA 3I56I 5FLXK 4BEHA 1JGSA 3CC7I 3RQIA 1HDPA 3G1LA 3BROA 5IOQA 4EM1A 1XMXA 1XS9A 1BIAA 5C4JJ 5EEGA 1SD5A 1R71A 1GV2A 5FJ8K 2GBYA 2XAFA 3OV8A 5HODA 1H9TA 4XNFA 3K4CA 3LSHA 1E2XA 2DDBA 2DA6A 1GXPA 2M1BA 2EZLA 1B59A 3BPXA 2VKHA 1D1CA 4BS9A 4XORA 5DCMB 2GQQA 3F0CA 3NEUA 5EG0B 3JTHA 1LKXA 1W7PD 4L0ZB 4P5OA 3GCMA 1WJAA 1FTZA 3HOVJ 5KK1A 3PO3C 2QQBA 2QQ9A 2VLAA 5C3EJ 3RKXA 2R7UA 2QZ8A 1PJ7A 3S3OA 3J7YJ 1XB4A 4BAYA 2M0MA 4BKXA 4LG0A 5GAEJ 4BKWA 4XRMA 3IV5A 5M3MK 5JLXA 2KJCA 3H5AA 1TT0A 1QGPA 2QCOA 4UV8A 2Z33A 4HDUA 1JHHA 3HPHA 3HBLA 2B9SA 1ETKA 3DBHB 2OUMA 2NVTJ 1FMWA 4ITVA 4O3MA 2LH9A 1USSA 2JT1A 5TJ3A 4G0UA 3A8KA 3CD6I 3KP2A 5FD6A 2P5MA 3AD9C 1TWHA 3JRFA 2JPCA 5ICCA 3H3VK 3AQPA 3GTMK 4ZH4A 1HA8A 1WCMJ 4H4KC 3TFIA 1TP4A 5L3DA 1RI7A 4ZH4F 4KITB 2Y0SA 3HOTA 3SFIA 5IYCC 4A3EJ 3TP0A 4FE7A 4A3IK 1RZ4A 4OIRA 3IP4B 2AXLA 2JSCA 4Y7NK 1DPRA 2I8DA 2IS1A 3LSMA 2EWNA 4AD9A 2Y0SD 3K4BA 3GTJK 1I6HK 3EUHA 1JT0A 2V1UA 1ZGAA 1BI2A 4IQJA 4UUVA 5D5WB 3GTQK 3KFWX 4LG3A 4V2FA 1YNNA 1VQLI 4OIPA 3HRTA 3RKYA 2XKOA 3DV8A 3G1OA 4A0XA 1HI9A 4P9SA 5C3EC 1FP2A 4NQWB 2L3DA 2EZHA 3L7WA 4XKCA 5LGTA 3AG4H 1D0YA 4MO7A 3GXOA 5E1ZB 2PI0A 4M3EA 1IN7A 3PFYA 3GFIA 4A12A 3HDDA 4XLPA 3GLLA 4G7ZA 4DNCA 1J9IA 4LITA 2KIMA 3CC2I 3NWSA 3K7AJ 4UY8I 3SEZA 2P4WA 2JA8K 3S1QK 5FRMA 2LMDA 4Y52C 4M74A 2WWYA 2CQKA 2FX0A 2LVSA 3ADAC 5K5RA 3KX2A 4KIBA 3F23A 1FZPB 2V79A 2XAHA 5BMZA 1IDYA 4PFPA 2GLOA 4G6TB 2PMZA 5JFRA 2DT5A 4WK8F 4F7ZA 3KEYA 1N77A 4Q5SF 2V6UA 1YQAA 5IYBJ 5EGEA 1SFOJ 1W0UA 4A0ZA 1TWFA 3FMQA 1K6OA 4L18B 1I39A 4XR6A 2FU4A 5ICGA 1IDZA 1JUSA 2BZTA 4KMAA 3JRBA 2VONA 3P9KA 3RKWA 2X9DA 4HX4A 3GO5A 4XKVA 1F9NA 5BQTA 3GTOJ 1I3QC 4A93J 4PSWA 1V5FA 2M0CA 3OL3A 4XM3A 2HYFA 5E3LA 4CICA 5E3NA 2HR3A 1IV6A 2KMUA 1T0FA 4IZZA 1P4XA 1DU6A 1ZAOA 2RQQA 4X1EA 3JSOA 2XPUA 1B72A 1IRXA 1S7OA 3GTGJ 4JOMA 4OIOF 1ON1A 3LMMA 3QAHA 2CYYA 2JA7A 3VA7A 2K40A 4ESJA 4GXOA 1WZ2A 3EYIA 2F2EA 1RNLA 4HW0A 4DBRA 1S8NA 4Y33A 1X1BA 3LSPA 3I4NJ 1YCLA 2KIUA 4QWQA 3ABMH 3RPUA 1HQMA 3Q9VA 4UHTA 5IP7K 5KVRA 3ERED 4OIQA 2R92A 4GTLA 3FK7A 4AVZA 1SC7A 4LIUA 3T8TA 2M87A 3HUGA 5J4YA 3AKZA 3PFIA 3V8LA 1I50J 2IS2A 4A3MC 2DN0A 1P7JA 1G59A 4DYRA 2STWA 3BDDA 1YHQI 1HKQA 3PIPF 3F21A 3GTMC 3EUHC 3MZYA 3SZPA 1MSFC 2LYCA 3HOZC 5IP9K 1B8IB 2PQ8A 5FLXZ 3I4MC 1N78A 5HOOA 4RM3A 2E2HA 3WG9A 1FC3A 1WSUA 5KCMA 2AO9A 3A01B 4RMFA 5E17F 3OIQA 2IA2A 3SZYA 4XBFA 4B48A 2XRNA 3MZHA 1R4NB 3F8FA 3VEPA 2MYSA 2H8WA 3KZZA 5E20A 4X0GA 4RB3C 1ZQ1C 5EEHA 5H2FC 2R93C 3K70D 4AM3A 4FISA 4FQGA 2HYJA 4IX7A 2ZFUA 4HYEA 1O3RA 3T01A 4EEFG 1TWAA 4NB5A 3A2KA 2FQTA 1Z21A 3TO6A 4RM2A 2FEZA 1I1SA 2ETHA 3F72A 4IHYA 3UNGC 1U5TB 3FBNB 1R9TJ 4HLXA 2KISA 3W2WA 3LL7A 3NWTA 4FX4A 3ASNH 2LY9A 3BG5A 4CA0A 2NVTK 4GFQA 4X6AJ 2M30A 2FNAA 3DKWA 4WJ3M 2XUBA 2V7FA 4XRFA 2OZ6A 2ZJ2A 2CRGA 4A3DC 3A8IA 4KMFA 2F4OB 3FDYA 4I99C 4KAWX 2KIQA 4HLYA 4KICA 4AC0A 3MKZA 2DMTA 1OCOH 1WIHA 1ZRFA 1Y6IA 4BQAA 4C45A 2RVCA 3ML6A 4KDDA 2AQEA 2A6HA 2W84A 2ZJRF 1I3QK 2VL8A 1BC7C 2CFAA 2Z2SB 1KQ8A 2DYRH 5FFXA 3JREA 3CUOA 1SFOK 1L3LA 3RZOK 2MC4A 1I6HJ 1O3SA 2Y30A 3OYMA 3BPVA 3WU1B 5FB2A 4CZZA 2Z9OA 3QPSA 4C3JK 2DTRA 1NHAA 2K5CA 4I02A 1HF0A 4BBRC 1YE9A 2DMNA 4P96A 5LGUA 1TL8A 1BI0A 3EUKL 3ABTA 2RV8A 4I76A 4V2GA 2OQGA 1JKOC 1XZQA 1ZELA 4DZJA 4LG0B 3BZKA 3M7GA 4KDPA 1D8KA 4PJJA 2ZXJA 2OQRA 4LOCA 3GTKJ 4G7ZF 3ZQGA 1K79A 4PGHA 1R6RA 2KRHA 1U9NA 3RQ4A 3S1QJ 3BP8C 1IW7A 1R5GA 4BY1J 1USTA 1X4OA 2W7NA 3N05A 2ZCWA 2EV0A 3GTPA 1AU7A 1EJ9A 1OYWA 5BS6A 2OC6A 1YX2A 2NS7A 1J0RA 2DK5A 5E79C 4IPAA 3S1RK 2VKVA 1MH4A 1R1VA 1E17A 4XSXA 5GTHC 2M4KA 3LPXA 4S0HB 3GTQC 2C6YA 4CCKA 2HOEA 2WY7Q 4LR2A 2Q0OA 3BR6A 2J5OA 1NG6A 4I6ZA 2BE5F 5K5QA 2JUGA 2R5YA 2E2HK 2EIMH 1J5YA 1MMAA 2ICWG 1FT9A 2DK8A 2EINH 1S6LA 1W5TA 4NBQA 5ICFA 2H94A 1IV8A 2ID3A 4XN3A 3QX3A 1GV5A 4JYKA 3B73A 4CYCB 2ECBA 4C2MK 1D3YA 1BI3A 1RUOA 4XSZA 2F6CA 1R5HA 1XPPA 3BTLA 1WCMK 3FKIC 2CSOA 3JSTA 3LSGA 3IHUA 3V4GA 4KISA 1T6SA 2LK2A 3WTWC 3QRFF 4LLGF 1TWGK 3DEEA 2JZYA 1NTCA 1FP1D 2VXZA 5F0CA 3D5RC 2KIFA 4ZDLA 4ZYEA 5D4RA 3KETA 3S16K 2CW0A 3L09A 4OAYA 2D45A 1W36D 2P5LC 3LSJA 3OYIA 4B3AA 2UXXA 1BDFA 1TWGC 1W0TA 2KZGA 1XDSA 3L00A 1XZPA 2GIZA 3KPHA 2XGEA 4HSTA 4OIQF 3LFKA 3RIRA 4P1WA 4DYQA 4XLCA 4GDFA 1Y1WC 3I53A 4R8HA 1FYMA 2WBMA 1MBFA 2FOKA 3IUOA 4QIWD 4HZFA 1HW2A 4KB2A 3T5XA 2HS5A 1G3YA 3KLOA 1I50K 3CCUI 3F6VA 3GTLC 3RPQA 1KGSA 4CCNA 4YIFA 4Y52J 5F08A 3WG7H 5IP9J 2NVUB 1SVOA 4LK0F 2CH0A 3K7AC 4CH7A 1DDNA 4MHGA 4G8XA 4D0PA 2K9LA 1TWAJ 2DA7A 3G4AA 1IZ1A 2B0LA 2NOGA 4MLOA 3CUQA 2VUMJ 2NOJB 1OYIA 3A4CA 2DCEA 3HTUA 1UB9A 3HXLA 2EA4A 2DQLA 2GOXB 3TP3A 4RDUA 3BCAA 1X58A 2CW8A 1FY7A 1ZG3A 2KQRA 1K78A 1AHDP 2VUMA 3A0HC 4YFXA 3CQZA 1KQ9A 1Q1VA 2HI3A 3I0TA 4ESFA 1WKMA 4YG2F 3C7JA 5FKOA 1HCRA 3GTOK 2V6CA 3BWGA 4KUMA 3PNYA 4UXNA 2A5YB 2LP0A 2YX7A 2QLZA 4XLEA 4HQEA 4NOIA 5EZHA 2L7FP 4A3EC 2M7BA 2PJPA 5FLVA 3OR2C 3S14J 2ECCA 1ZH5A 3LFUA 1ON2A 1EV7A 1BM9A 2PMZL 6PAXA 1ZXOA 4A3JJ 1M1EB 4U88A 3A8JA 2HKXA 1B9NA 4K2EA 1VRQC 2ELHA 4A3MK 3SDBA 1V5EA 4ZTJA 3CQZK 1T0FC 2HU9A 1Y8RB 5IOZA 1WH7A 5IT9Z 5FGMA 1KU3A 1FYKA 3BUEA 2JA7C 4PJ0C 2N8GA 1TWHK 5HLIA 2IGOA 1ZLKA 1G3WA 3AG2H 4GYIA 2DFEA 2BYVE 4RGRA 4A3KC 3H3UA 5L3BA 2PX9A 3PO2J 3TTGA 5D4SA 2YU9A 1SAUA 1J7KA 2KJBA 2A61A 3BLYA 4CDGA 2VQGA 3OYDA 4E70A 3ECOA 2CFOA 1UHSA 1D5YA 3QWLA 2H6CA 3BG9A 3ZGKA 2JA6A 4I98B 3ZMZA 4M1XA 2JMWA 4AVPA 1FYLA 4CO8A 1VGXA 1DP3A 4QIWN 2E7WA 2CUEA 4BU2A 1MBEA 1B4BA 1TQMA 2LREA 2RNGA 3IAM2 2P5VA 3I3LA 2R7ZK 4OIPF 5ED4A 1E3HA 1J6WA 2M34A 4BE2A 4L5EA 5H20A 5FROA 1LQ1A 3S1RJ 1ZARA 3CMEI 5A2QZ 3K4JA 3FBIB 5D8LB 5L3EA 3CCVI 3HOYJ 4XLPF 2UWMA 5C4JC 1VI0A 4ZYDA 4HX8A 2IP2A 4OMZA 3OS2A 2IS4A 2WADA 3DTKA 3D1NI 3CJQB 1XXCA 4X6AK 4PABA 3LAPA 2XGCA 2DTZA 2HDDA 1Y1WJ 2ESNA 2IW5A 4A6EA 5DCMA 5F27A 1YS7A 2AS5F 5TMCA 2R7ZA 1G3SA 2ZFZA 3KEQA 1S3JA 5ILSA 1T33A 3HSFA 2B7EA 1W5CC 3TGNA 5K7FA 4HNUA 3NARA 4M73A 1IUYA 3P5JA 4A5MA 3KP6A 2NVXA 4RGXA 1F93A 2M3AA 4HAMA 4C3JC 2CQQA 4RB1A 4BHPA 3OOPA 4AU7A 2NVYC 5LEKA 2R7WA 3BJ6A 2UXNA 4UV9A 4E4HA 4KM9A 2P6TA 5GP9A 2ZNYA 1P4WA 4A3JC 1XZPB 3C2BA 4KN4A 2CU7A 1TWGJ 2HVQA 1XX5A 2O03A 2VBWA 1FIPA 3FXUA 3K6GA 4Z2YA 3REOA 1TW2A 2DMQA 3TQNA 5E18F 3QU6A 4JX5A 4BJ6C 3C2HA 4UUSB 2R7QA 4DJAA 3HRSA 4IXAA 4IO9F 2MLGA 3RI4A 1UAAA 1DD5A 4BJTA 3FM5A 2QF7A 1SEUA 3LSTA 4M3DA 4A3FK 2PA8D 5AIPA 3O2PE 5HL8A 3N3YA 2NVQK 5DV5A 1K61A 1U5TC 2ZMEA 3H35A 2EILH 3E5UA 2VC1A 1ETWA 1OCPA 1MNDA 1O2BA 3J80Z 4NUBA 4B4CA 1OR7A 3K10A 4ENNA 1XTAA 4HX7A 3FXLA 2PFBA 2VUMC 3VDXA 1SD6A 2VQCA 2HTJA 2M8EA 2QKMB 3PNVA 1TWAC 2EZKA 2ZO4A 2LD5A 3WODA 3GSIA 3MN2A 3L4KA 3HOZK 2FXAA 4D9JA 3S3NA 3ZQCA 3GTKC 1U6GA 1T39A 3O6BB 3WODF 2Y9YA 3DTEA 3CCLI 1AKHA 2E71A 3AD8C 3PJRA 4HPQA 1Z9CA 1RUNA 2LOOA 3WHBA 1AWCA 4YFKF 4BLAA 3CCJI 5FO5A 1ZREA 1MW7A 2IA1A 2YU9J 2DDAA 3H0DA 2E7XA 2KRCA 4EMSA 1AOYA 4IRIA 4OINF 3I55I 4JBAA 2H27A 4G6QA 3GEIA 2LF8A 4G12A 2VKDA 3M07A 4IF4A 3KP3A 3ZN1A 3OYFA 4UNOA 3HM5A 1QU3A 5C44C 4LMYA 1SAXA 1FBQA 4S04A 2Y9ZA 3OYKA 1K78B 3LSIA 3BTIA 1GXQA 3CP2A 2LF7A 3CESA 2FQ3A 2DA4A 2LDUA 2X0LA 1I3QA 2O6GE 4HNVA 4A3JK 4BH9A 5BPIA 1ZR2A 3M3YK 1Y1WK 1H8AC 1RKWA 1R58A 2LTPA 3SYTA 2A6HF 1T08B 4O6JA 3CCRI 4A3DJ 2DA3A 2IBDA 1LJ9A 3HG9A 5IYDJ 4ENJA 1LVAA 3H0GA 3J7AO 4EGYA 2VXDA 3VSKA 2GA1A 2A6EA 3D5SC 2XDVA 1S7EA 3R6SA 1TWGA 5JFEA 2Y0SL 1P2FA 3LQRA 3JTGA 2KLOA 2BY2A 2ELKA 2MBFA 3AL0B 1W1WE 1YIOA 3DU5A 1ZGJA 2KZVA 5K7ZA 1JXSA 4MEYA 2NS8A 2L9NA 4XOTA 3M1EA 4AIKA 5M5WJ 2L01A 2WA0A 1PUFA 3L1PA 2NVXJ 1TWAK 2XAGA 3G4SI 1U78A 2ISYA 2GXBA 1WJBA 1Z7LA 2IJLA 1MMGA 1XDUA 2Q2EA 3P9CA 4A2UA 3L2RA 1VZ0A 5HS7A 4HV6A 2X6XA 1CQTA 2R7ZJ 2QYOA 1KA8A 4FTHA 2R92K 4LB6B 4OWRB 3LSRA 3I4MJ 2JA8C 4KMUX 1FNNA 2FJ1A 2RQPA 3ZQLA 2XAJA 4I09A 5E8IA 3GDZA 1BL0A 1TZLA 3KLNA 1UHMA 4EJWA 2DO7A 1HC8A 2JQ7A 1TWFC 2BBYA 1VH2A 3BC8A 3OL4A 4AIHA 3MVPA 2JK3A 4KATA 1FX7A 4HNTA 2HKOA 3QP6A 4EVIA 4A3CJ 1IN4A 1P4AA 1YNJA 3FKIA 1PDNC 2JPBA 3CQZC 1EKEA 5F64A 3HOZJ 3H3ZA 2O7OA 1AB4A 1I6HC 5B5EC 5IOTA 4GZYA 3KYDB 4BQNA 3HOXK 4J19A 4ZYGA 3GTLK 2R4GA 4PSXA 2HZTA 4KFCA 1G6NA 3RCOA 4ENKA 4F55A 3KYLA 5JR3A 4M3BA 2NRAC 3DLAA 4B44A 5M5YK 2EIKH 4ZZLA 1T98A 3H1CA 4ZTFA 4A93K 2YU9K 1ZLJA 3V8KA 3T0YA 2DJNA 1XXBA 3PQJA 1WWXA 3FM3A 4YELA 3M1CA 2GSNA 3FKIK 4G9YA 3KZYA 3AFHA 3DXJA 1KQ0A 4QLCU 1ZVUA 1PVEA 2QBYB 4UUTA 2PLYA 3CDIA 1S7AA 2LKSA 2KT0A 3OIPA 4M3GA 3WGIA 4PJMA 5JVGF 4X6AC 2XC7A 1TNTA 1SFOC 4EATA 2M45A 2M5WA 2BXYA 3GFLA 2QVOA 2DJIA 2MD5A 4B1RA 1K83C 1LNWA 3V7SA 1O3QA 5DYMA 3ZMUA 5IY5H 2RNJA 5GPCA 1JUPA 3Q0VA 1WHUA 1MJBA 4HOBA 5M3FJ 4LD5A 2EZIA 2P81A 4XOPA 4A0YA 2DXIA 5FD5A 1INNA 3OY9A 1SFUA 4ZC3A 2YU3A 2OAZA 4XONA 3SQNA 2G7UA 4OIRF 5IYDK 1Y1VJ 3BZCA 2X85A 2DQRA 5C4XK 3IKVA 1U5TA 4TV7A 3E6DA 1DPUA 2JH3A 1QQIA 2MH2A 1B8IA 3JRIA 5IP6A 4M9ZA 3F6OA 3UR3C 5FRNA 5L3FA 1FTTA 1WJ5A 2H6BA 1STZA 4C3HJ 2XGXA 5DUIA 3GEHA 5IOSA 5HS8A 1I50C 2L4AA 3GTKK 3U21A 3PUBA 4GFBA 4M9SA 2EBBA 4O2DA 2JA5C 4LJZF 5GADJ 3AAFA 2YX4A 1Z0XA 2M9HA 2ZXHA 3GTJA 5K7HA 5KHDA 2O0YA 4YIIA 2GOMA 4KA4A 4XN0A 1A36A 4A3GC 3BT9A 3KE2A 4BYYA 5F04A 3HOXC 2LBFA 2HQRA 4FASD 2PA8L 2V1DA 3AQOA 1UHWA 1YW9A 3CF5F 1WVRA 2HOSA 2X1DA 2WB1N 3M8FA 5J47A 4Y17A 3H0GK 3T00A 2EFQA 2PEXA 2UV1A 2EFNA 1KYZA 3CDHA 4M6XA 4BGDA 1FOXA 2DW4A 1KONA 1S72I 5LHGA 4MQVA 3FXRA 5IORA 2E34A 2R7VA 4A93C 3TEDA 2PG4A 3GTOC 1MKMA 1TWCK 2R0QC 1SD7A 3K9TA 1R00A 4G0VA 1BBYA 1W36C 4CXFA 3IPJA 2QBYA 3MD2A 1REPC 1IAWA 5AONA 4EJVA 1BOAA 1BIBA 4F91B 5B1BH 4L9VA 4L9TA 2K3FA 3I4PA 1BR4A 3CCSI 3Q9SA 3ZOBA 1U9OA 4G6DA 4B43A 1LFBA 1H0MA 5GAHJ 1J2XA 1EK8A 3HOXJ 4FETA 1Z3XA 3DU6A 2ME6A 3S16J 3BY6A 1V54H 2BY1A 4LK0A 4WJ4A 2E5ZA 2GAGC 2W00A 2OU2A 1DGWY 1LVKA 3C1DA 3QOPA 4DBQA 1HDDC 3CP8A 5GAGJ 2R7RA 2X48A 3ZN0A 3H36A 4IHTA 3MEXA 3S32A 2R92C 2LC2A 4ASNA 4D1QA 4ZZDA 4NC7A 1VQKI 3V8JA 4N0BA 3VYUB 2PHCB 2IPQX 1VF9A 3V7CA 3I9V2 2MD0A 3RSNA 2PN6A 1V55H 2R93K 3KP4A 4UB6C 2WB1L 1NK3P 3I4MK 1B9MA 4IJAA 3GBGA 3RYPA 2Y48A 4XKBA 1VQ7I 1DUXC 1ETOA 1WOOA 2VODA 3S17K 4MIMA 2OV7A 1EH1A 2ME0A 2V1XA 1IO2A 1MDMA 3H5NA 3S15J 4ESBA 1X3UA 2CQ7A 1YX5A 1XMKA 2R93A 2IVMA 2IGKA 5HLTA 1DU0A 4QPQA 4BDYA 4Q5SA 1K4SA 5IYCJ 1LDJA 1QA6A 2VJIA 2ZB9A 1LE8B 1N75A 1IC8A 3GTGA 2RC4A 3HHHA 1QPMA 2OPTA 3N4MA 3GIRA 1Z7UA 1RR8C 2A69F 2BHZA 4YG2A 4J00A 4PJNA 1ZKGA 3ZR8X 1FOKA 1VFCA 3IRRA 1L0OC 2WAQA 1P92A 3S2DC 1OJLA 5HLHA 3TDUC 3TFHA 2ESHA 3L2UA 4IHXA 2B63A 2KRFA 4M3FA 1ONVA 3DXJF 2XIGA 1LFUP 1T56A 2YUSA 4DZPA 4J3NA 4KIGA 4P55A 2K4BA 1KYWA 2VN2A 4BDZA 3K2AA 1VQMI 3H5RA 3G6EI 1OR7C 3OSFA 3L2WA 1H9GA 2WC2A 2NVXK 2ID6A 3LOCA 1GVJA 1UCRA 1ZRDA 3GX4X 4BHCA 4GT9A 3S1NC 4UVBA 3FKJA 4FZBA 2MFZA 3CQZJ 2AQFA 3OYBA 3MWMA 2L02A 4DYCA 2K3PA 5IT9K 2LG4A 3D5LA 4KN7X 2OTLI 4XMYA 4HEA2 5B66C 3QPLA 4CCMA 2KPMA 1F36A 5FLMJ 2JA6C 3RKQA 5HDNA 1O26A 5DTDA 5CLSA 4LK1F 1BW6A 2IA0A 4I7HA 3ISPA 2O3FA 4EJTA 2F4MB 1YFHA 3BR3A 2R5ZB 3ZCOA 1OMIA 1OISA 3E6CC 1CGPA 3ERMA 4XLNA 3GFMA 1I1GA 3IWZA 1JGGA 4HF1A 3DEWA 1MBHA 2CJJA 3TW7A 2ADUA 3ZMTA 2XF7A 1Z91A 1LFPA 3HRUA 4C2MJ 4B3XA 4KN7A 2WV1A 1JHFA 4JX4A 2V6SA 1OFCX 4ZDPA 3GLXA 3HXAA 4RS8A 5LHHA 4Y13A 2DPDA 2VBYA 5FKMA 5IPAA 3MMYB 4PAAA 5M5YJ 3H0GJ 1WORA 2DBBA 1K83J 1QZZA 3TDZC 3TO7A 1MNMC 1OLTA 1I27A 1Z6TA 2QSGX 3TFJA 2VPLA 5L3CA 4D5FA 3S2HJ 3Q0UA 1GE9A 3U1KA 4Y4RA 1ZYRA 1YOVB 2Z3YA 1UJ8A 5EJCA 1EQRA 1Z77A 3OWTA 3CF2A 5J1RA 1SD4A 1WGXA 3WGHA 4QJVA 4ETSA 4KMDA 5D8KB 3R0JA 1VJEA 1MIJA 1SVMA 1R7JA 3JAMZ 4UB8C 4LOWA 2COMA 1HW5A 2CQNA 5EG0A 4A3IJ 2R3SA 1YITI 4XRSA 1C0WA 1VQ6I 5C44J 1WQHA 1QNTA 2CFXA 2E2IK 2ACJA 3E3VA 1JUMA 3FIWA 2EFWA 1N25A 5D5UB 2BGCA 1Y1VK 3PO2K 4A3BC 3GTOA 5C4XJ 2Y0MA 4U7DA 1O7FA 1ZN2A 1VQNI 4A3CC 1QVTA 2VOPA 4AUXA 5LFAA 1WRJA 3ZXSA 1PYVA 2OF7A 2XGDA 3HEFA 4RB0A 3CMYA 3CCEI 3FMSA 1JOEA 4E7ZA 1USOA 1IF1A 1O27A 4NQWA 1VQ5I 1GUUA 3CO7C 3GTPJ 1R5ID 1KU7A 3TL4X 2GM4A 2BOLA 1QRYA 2HYGD 3DPUA 2NVQC 2F5DA 2KDZA 2JA8J 1HW1A 1UELB 2A05A 3HOUJ 5ILUA 1RC9A 3MFKA 3P9IA 1G2HA 2DODA 3JW4A 3ASOH 2R7ZC 1OQYA 1A04A 1QHGA 3J80K 2L5QA 4IRHA 2COBA 3CO6C 4C30A 2AXTC 4PFOA 2KKOA 4CCJA 1KQ4A 4BBSC 5DEQA 2F48A 3PQKA 4GCVA 1I50A 3IC7A 2VE9A 5IYDC 2LSOA 1ZTRA 3ZQFA 3J81Z 4L9NA 5IYBK 3GTJC 5TGTA 4GTAA 1D5VA 2WAEA 3K4LA 2DLLA 3COAC 3TO9A 1X1PA 2IAIA 3PSFA 3DFGA 2HNHA 4KARA 3Q5FA 5KAFC 3CUQB 4XK4A 1LB2A 2H1LA 2HPMA 4C9YA 1TC3C 4KMUA 4G7OA 3G1MA 2CW7A 4XSZF 4LLLA 4F92B 1YYVA 2H8RA 3OYAA 2NXNB 1X19A 3DP7A 3QOEA 4MTDA 2AHQA 5BPDA 3CCQI 5E68A 4DIQA 1TBXA 2RKHA 3DCFA 1VTNC 1HKTA 2H09A 1I5ZA 3GZNB 5HS9A 2HQ5A 1QHHD 3IAS2 1IN8A 2H1KA 2HXOA 4BE1A 3KCCA 3K4NA 2UZKA 4OOIA 5D5XB 1YG2A 5FFZA 3J7AY 3H9QA 3GEEA 4KIFA 2HPIA 1FBUA 1ZGWA 1P6RA 3H3VD 4NDLA 1J59A 3TBIA 2K27A 1IUFA 4A69C 3H0GC 3I64A 5J8FA 2EV5A 1JKPC 3WGGA 2X1EA 4RAYA 1VQ8I 2A6EF 1QO0D 2P7CB 4NHJA 2E2HC 3CUQC 4HRIA 4IQ4A 3U9GA 2OBPA 1T95A 3OREA 2VASA 5EGOB 4RMNA 1JTYA 1Y8QB 3GTKA 3IRQA 5BOXA 4P5BA 2JJ7A 3IL2A 4PUSA 2OCEA 4PDKA 3X2QH 1CF7A 5EYRA 3GZ6A 4IOCF 3HKZL 3HOYC 4HF0A 5L46A 1FPQA 1B1BA 2WV0A 3FXMA 1O4XA 4BY7C 1OCCH 2E2IJ 1DCPA 4BACA 1DQUA 4JQFA 3CDLA 2I10A 2Y31A 4XLFA 3OYHA 1MBJA 4YEJA 4YFNF 2FNPA 2V4JC 5EGOA 1LEAA 5LGNA 1ZHFA 5IOYA 5TISC 3LQQA 1K83K 2D2WA 4W97A 4GRIA 1IXRC 1IW7F 2E36A 3WTZA 4L5JA 4RLFA 1I3AA 3GEZA 1A6QA 1HQCA 2ZC2A 4MEXF 4E7JA 4LB5A 4RAGA 4M6YA 5H6QA 1RR7A 1MMSA 1Z67A 5LBQA 1O3TA 2FA5A 5IP7C 4ZDOA 5E1WA 2DAOA 1JQWA 3G4CA 3E7LA 1V5VA 3FOFA 1R1TA 3CCMI 3ZQ7A 2A68F 3ZP5A 1ACIA 3OMYA 1QPIA 4ZYHA 1X3WB 4FX0A 1WJEA 2PMHA 4QIWL 2CQXA 3B6AA 4CYDA 1R9TA 1EA3A 4A3DK 1ETVA 2W57A 2LY1A 3CJTB 4EGZA 1OKRA 1YJWI 4C3JJ 5DCFA 2VQLA 5CYVA 3HKZA 4F93B 2NS0A 3N0CA 1X1CA 2RAEA 3DKYA 4MFDA 2Y69H 2MA3A 3HL2A 2XF5A 3BP8A 3F8CA 4B8XA 2VOOA 2R7TA 1TQPA 4Y15A 1ZG1A 4HDVA 3LNQA 4PK4A 2M7AA 2FQOA 1PP7U 3I71A 3AL0C 1K83A 1Z05A 2BW3B 3EQLF 2CGPA 1TQIA 4ON0A 3M4OC 4P9FA 2L9RA 5M5WK 2XB0X 1MDMB 4KC6A 5JI6A 2V6EA 2TCTA 2EBIA 3HOUK 4RB2C 2XSJC 1WOPA 2EB7A 1X3ZB 3HTSB 3IKTA 2K9NA 4LJZA 3HSEA 2Y75A 2O9LA 3ULQB 4L9JA 3WTVC 3PO2C 4A3BK 5IP9C 3GFJA 1W4MA 1NG7A 1R1UA 4IHVA 2LKXA 1JKRC 3B02A 1Y0UA 3BCBA 2JA7J 3N97A 5JHUA 3DLLF 1MNEA 5J1YA 2W1OA 2O5RA 2PMZN 1ISEA 3HSRA 2EJRA 3VFZA 5HDKA 1XZQB 2BE5A 2V9KA 1TWCA 4U0WA 4BQOA 4RAFA 1ETQA 4EM2A 4XQFA 1OCTC 4NNJA 2RGVA 2E1NA 3BG6A 4G94A 4P9UA 3QYEA 1AKHB 3MQ0A 2FSWA 4YIRX 1ZK8A 2NAZA 4YFKA 1IRZA 3H9JA 4F3QA 4ABZA 2ZKZA 1WCMA 3BTJA 3S14C 1T8IA 1BGWA 4L5IA 5E3MA 3WTSC 1TTYA 2L2OA 2BXZA 3HOWJ 4N4NB 1HKSA 1X2MA 3BR0A 2WAQD 1SMYF 2P8TA 4G0WA 3PUFA 4J01A 3S2DK 2HDWA 3MCZA 3FKIJ 1JI8A 2DOFA 3MZ8A 3OYEA 1E3OC 5DM6F 3RZDC 2WTEA 3Q0WA 3M3YC 4U87A 2RN7A 3FHNA 2Q8KA 3JRDA 2V9PA 2VKEA 3U1DA 4A3GJ 5M5XK 2VIXA 4B09A 2XSDC 1VNDA 4GTCA 2E2JC 1VQOI 5JLWA 4QTRA 5ERIA 4RGUA 2YR2A 2JA5J 3GTPK 4M9XA 3Q3QA 1R23A 3VODA 2HZDA 5LEJA 1F5TA 5LRSA 2W48A 1JKQC 1U0JA 3Q3SA 3VYTB 1W5SA 2XAQA 3G3ZA 3BP3A 1MMNA 1V3FA 4Q47A 4C3HC 2VQHA 4MTEA 2QQAA 1MD0A 2QQ8A 4N9HA 4LGWA 2XASA 2QENA 3L4JA 4WX9A 4PJLA 1X1DA 4IKFA 2K85A 2VC0A 3W6VA 3FMRA 1JVIA 2KWAA 3FXJA 4BY1C 5J1UA 2VUMK 4LIVA 4C2TA 3I59B 5AIQA 2EFOA 2MC3A 3OR1C 1Y1VC 3RZOC 1FLIA 1BOBA 3I58A 2BV6A 1X4PA 3GTLJ 3FISA 5CVIA 4IHSA 5GPAA 1GVDA 1IGNA 2NYXA 2HGCA 3GTQA 2F5VA 1QBJA 1F43A 1LUJB 1X1AA 2GSUA 4A3FC 5D6FA 4AWXB 3S93A 4BXXJ 2I5UA 1C0AA 3FX3A 4Q48A 3PIOF 5HNHA 1WFXA 2Y0SN 4F52A 1YJNI 1HOMA 3FF5A 1ERDA 1BN5A 2CUJA 3S14K 3S1MK 3PNTA 3VWBA 4C3IK 4Y3OA 5FKKA 5F6FA 2Q1ZB 1YLFA 3BJOA 3J7ZI 2ZNZA 1O2FB 4MEYF 4GTFA 3M9AA 3ZRGA 2NVYA 5F0FA 3WTTC 1B4AA 1FJLA 4S05A 4Y7NC 1BR2A 3QQAA 2L9VA 1V4RA 1B72B 2E1MB 5CHPA 4WXCA 1E3PA 1HLVA 1XCBA 4IHWA 3K0LA 1SFKA 1TWCJ 1O29A 4C3IC 4GTEA 2CUFA 2B63C 2O8XA 3QPHA 2W4SA 1KZHA 1XGSA 3G2BA 3L2CA 2EH3A 3DKXA 4BBSJ 3HKZD 4U0VA 1XGOA 5CPRB 4JX6A 2VBXA 1PP8F 3PO3K 3MKYB 1PUFB 3TOBA 2KL4A 2XB5A 4A3EK 4OIOA 1XGNA 1R9TC 3ZMVA 1RRJA 2DOEA 2PJRA 3HOUC 4Y52K 1UZCA 2MSYA 4KN4X 3BQYA 4GTBA 4C3HK 3BG3A 5LHIA 4I0AA 1CF7B 2XHKA 4A3LJ 1EI6A 5DDGA 1O28A 3O8HA 3FXQA 2EQRA 1IXCA 2E1MC 3R4KA 4WILA 1U8BA 1BJTA 2CV1A 1UG2A 2K4JA 3K1NA 4KYWA 4BLBA 2W85A 1SFXA 3LWFA 2R7SA 1S5LC 3I59A 3RJPA 4DOZA 1TW3A 4BBRJ 4U7BA 2QEXI 5C4XC 3CMAI 4A3BJ 1SFEA 3SDGA 2X6OA 2Y2ZA 1IQ0A 2CV2A 2TRTA 2VB6A 3BZ6A 5M3MJ 1G51A 3OS0A 1JJ8C 2NVXC 2L54A 4IVNA 2CMPA 1RETA 3KIOA 5D4DA 1DGRM 4PGGA 2JUCA 2JA7K 3S15K 1A6IA 2B63J 1MZBA 1FOYA 1YRNA 2VT3A 3JR9A 3O8GA 1QVUA 9ANTA 4PZJA 4II3A 3N0BA 3I4NC 3PL8A 2X1CA 1E0EA 2ZJQF 4CUGA 1J09A 1A31A 3DBRB 3RZDK 2JA5A 2WY8Q 2HDCA 4BNCA 2BW3A 1RPWA 3V7RA 2XKPA 2ZJPF 4AYBD 3OYLA 1IS1A 4II2A 3I5UA 3LA2A 2GXGA
chains in the Genus database with same CATH topology
4DQ2A 3ZPLA 3SZTA 3KP5A 1O2AA 4WCGA 2D1VA 4HA8A 4I01A 3DF8A 3WTUC 2P7VB 1U3EM 4KMHA 4EJUA 5CVVA 1WQGA 4U0YA 1WI9A 2ISZA 2XCQA 4HBLA 1F4KA 4C2MC 3EYYA 4WXHA 1LDDA 2DPUA 1W7PA 3M8EA 2CG4A 2FMLA 4P5AA 4FT8A 2P6SA 2FBHA 2LKPA 3W6JB 2GA2A 2XV4S 3K1MA 4EV0A 3WTXC 4KT5C 2JTVA 1PUEE 4L0YB 3ECHA 4KASA 1HXDA 1LDKB 1W7PB 3GUDA 5DD8A 1XMAA 5K5OA 2R7DA 4XLNF 3R61A 2W24A 1ZRCA 4LLNA 1O24A 3KEOA 1O57A 2QUFA 1YO5C 5CVJA 4R79A 2OD5A 1TNSA 4EJOA 5L3GA 2CW0F 3LAJA 3P7NA 3J81K 4Q4ZF 1EH7A 4HV5A 5J6XA 2Z5UA 2BEOA 2PBIA 3MAJA 2NNYA 5JVOA 1YS6A 4G7HF 2ZFWA 5JVTA 5TJJA 1G3TA 1BI1A 1IXSB 4BXUA 5LRRA 3ROUA 4OU0A 2K86A 3JSPA 3HRMA 5DUKA 4OMYA 2MH9A 1Z6RA 4IRGA 4HQMA 2GSOA 3DQVC 2EA2A 2HQNA 4BHBA 5F1RA 1XD7A 2YSRA 4AIJA 3RYRA 2EFPA 1D8JA 4GYGA 3F8NA 1XN7A 1ZBSA 2FF4A 3ZMSA 2FBIA 2E2IA 3QPTA 1I6XA 3CLOA 3W6KB 3I54A 3E6MA 1O25A 3R0AA 5HDGA 1BJAA 1JE8A 5CVUA 4H0EA 4A6DA 3JAMK 3K1PA 4UV8A 3GZ5A 4FHTA 2VE8A 4A5NA 2HTSA 3LA3A 5CVRA 1SFOA 2QWWA 5HLGA 3GW2A 4G7OF 4PCQA 2FRHA 3G73A 2CWEA 2NNNA 3O3KA 3QP5A 3OEPA 2TDXA 4LFUA 1S29A 3C3WA 4ILDA 3GTLA 3GTMA 2J5PA 3T1BA 2F5FA 3FZVA 3FHZA 2GIVA 2EK5A 2IRFG 5D5VB 3WU0A 3HIFA 1T2KA 1R36A 5H6RA 4FM9A 2RDPA 3S0XA 2GWRA 2HFHA 3F8BA 3E6BA 3GVAA 5TRDA 4YFXF 4DDQA 3HHGA 3NRVA 3GYHX 2LNBA 4M72A 4RGSA 3ZMDA 1ODDA 2JRTA 1KU2A 1G4DA 1IN5A 5K1YA 5CJ9A 4I0BA 2FBKA 1EH6A 1RIOH 5D6EA 5EGHA 1EH8A 1J75A 1FWZA 5HVQC 4KNYA 1IRFA 3F22A 2HWVA 1K7AA 5DD4A 1IN6A 3IWFA 2PMUA 2K7LA 2EV6A 2XVCA 2L4MA 3KP7A 1WQFA 1XSXA 1ZG5A 2W25A 5LLQA 3OPFA 1FSEA 3DEUA 4EQQA 2OZUA 2YPRA 3U2RA 2V9VA 1HBXG 4WF2A 1FSHA 2F5CA 4KM8A 3RDIA 1LEBA 2RH6A 3EETA 1U2WA 4HF2A 3NQOA 4KB4A 2XROA 1XGMA 3L9FA 2QM3A 3SFZA 3T8RA 3E5QA 4RAZA 3SXYA 4JK1X 2DU9A 1HSJA 2O61A 3H92A 3CJNA 1UFMA 1R22A 3FWEA 5ICEA 4GGGA 3S2WA 3CAGA 2CO5A 2F5EA 3WE3A 1Y1VA 4I2OA 3AH5A 1U8RA 1MGTA 3CTAA 2RGRA 1XCVA 1YW8A 1F1ZA 2A07F 4WWCA 5ILVA 4UVAA 3NUHA 3FOEA 5J8CA 2ZBKA 3HOSA 3F3XA 3C18A 5E8GA 2IT0A 1WQ2A 1Q1HA 4R1HA 2G7HA 2R7FA 4UVCA 2STTA 2DFIA 3DPLC 2CFAB 3E5XA 3ELKA 2K02A 3BOQA 1KU9A 2OA4A 1OYYA 3VOEA 3WE2A 2HEOA 1MJAA 1XSDA 1Y1WA 1DP7P 2X4HA 3E97A 2D1HA 1Z1DA 1ULYA 1ZYRF 2XCOA 1OPCA 3VB2A 2VBZA 1FBSA 3K2ZA 2GAUA 3F8MA 5IT3A 3ABUA 3GWZA 2GZWA 1QZYA 1YW7A 4MNUA 2E1CA 4XSXF 1B6AA 1TLHB 2FE3A 1GHCA 1XXAA 2A3SA 4MQ9F 2Z99A 1MJ9A 4EM0B 4GO1A 5E1XA 4ENMA 1SMTA 1BC8C 3TOAA 3RTRA 3MMLB 1XSVA 3HYIA 3GF2A 4M71A 4O5VA 2P5KA 4CHUA 3WTYC 4GTDA 4CGZA 2MLKA 1YTYA 2XCRB 2Y3PA 2VT2A 3D0SA 3TKYA 2ZMEB 3QU3A 4WXDA 4LQYA 3LA7A 2G9WA 2FMYA 3DPTA 1T38A 5A2QK 1IRGA 3BJAA 4MGRA 3SHFA 1O7LA 3R60A 3K69A 1HSTA 2DI3A 4N9IA 3EDPA 5FLXK 1JGSA 5IOQA 3BROA 4EM1A 1BIAA 5EEGA 1SD5A 3OV8A 2XAFA 1H9TA 1E2XA 1GXPA 2M1BA 3BPXA 1B59A 5DCMB 2GQQA 3NEUA 3JTHA 1W7PD 4L0ZB 4P5OA 5KK1A 2QQBA 2QQ9A 3RKXA 2QZ8A 1XB4A 4BAYA 4LG0A 4BKWA 2KJCA 1QGPA 4HDUA 2Z33A 1JHHA 4O3MA 1USSA 2JT1A 5TJ3A 4G0UA 3KP2A 5FD6A 2P5MA 1TWHA 2JPCA 5ICCA 3AQPA 5L3DA 1RI7A 4ZH4F 3HOTA 1RZ4A 2AXLA 2JSCA 1DPRA 2EWNA 4AD9A 3EUHA 2V1UA 1ZGAA 1BI2A 4UUVA 5D5WB 3KFWX 3HRTA 3RKYA 2XKOA 3DV8A 4A0XA 1FP2A 2L3DA 3L7WA 5LGTA 5E1ZB 2PI0A 3GXOA 1IN7A 3GFIA 4A12A 4DNCA 1J9IA 2KIMA 2P4WA 4M74A 2WWYA 2CQKA 5K5RA 4KIBA 3F23A 1FZPB 2V79A 2XAHA 5BMZA 5JFRA 2DT5A 4WK8F 4F7ZA 4Q5SF 1YQAA 5EGEA 4A0ZA 1TWFA 3FMQA 1K6OA 4L18B 2FU4A 5ICGA 4KMAA 2VONA 3P9KA 3RKWA 4HX4A 3GO5A 1F9NA 5BQTA 2HYFA 4CICA 2HR3A 1T0FA 1P4XA 1ZAOA 3JSOA 1S7OA 4OIOF 1ON1A 3QAHA 2CYYA 2JA7A 3VA7A 4ESJA 4GXOA 3EYIA 2F2EA 1RNLA 4HW0A 1S8NA 2KIUA 4QWQA 3RPUA 3Q9VA 4UHTA 5KVRA 3ERED 2R92A 4GTLA 3T8TA 2M87A 3HUGA 3PFIA 3V8LA 2STWA 3BDDA 1HKQA 3F21A 3MZYA 3SZPA 2PQ8A 5FLXZ 2E2HA 5HOOA 3WG9A 1FC3A 1WSUA 5E17F 2IA2A 4XBFA 3MZHA 2XRNA 3F8FA 3VEPA 3KZZA 5E20A 4RB3C 5EEHA 4HYEA 1O3RA 1TWAA 4NB5A 3TO6A 2FEZA 1I1SA 2ETHA 3F72A 1U5TB 4HLXA 4FX4A 4GFQA 2M30A 2FNAA 3DKWA 2XUBA 4XRFA 2OZ6A 2ZJ2A 4KMFA 4KAWX 4HLYA 4KICA 1WIHA 1ZRFA 4BQAA 2RVCA 3ML6A 4KDDA 2W84A 1BC7C 2CFAA 1KQ8A 5FFXA 3CUOA 1L3LA 1O3SA 3WU1B 3BPVA 5FB2A 4CZZA 2Z9OA 2DTRA 1NHAA 4I02A 4P96A 5LGUA 1BI0A 3ABTA 2RV8A 2OQGA 4LG0B 3M7GA 4KDPA 1D8KA 2ZXJA 2OQRA 4G7ZF 1K79A 4PGHA 1R5GA 1USTA 2ZCWA 2EV0A 3GTPA 1OYWA 5BS6A 1J0RA 2DK5A 4IPAA 1E17A 1R1VA 3LPXA 2C6YA 2HOEA 4LR2A 2Q0OA 2J5OA 2BE5F 5K5QA 1J5YA 1FT9A 2DK8A 1S6LA 1W5TA 5ICFA 2H94A 3QX3A 3B73A 1D3YA 1RUOA 1BI3A 1R5HA 2CSOA 3IHUA 3V4GA 1T6SA 3WTWC 3QRFF 4LLGF 2JZYA 2VXZA 1FP1D 5D4RA 4ZYEA 2KIFA 3KETA 3L09A 2D45A 2P5LC 2UXXA 1XDSA 3L00A 4OIQF 3LFKA 3RIRA 3I53A 4R8HA 1FYMA 2FOKA 4HZFA 1HW2A 4KB2A 3T5XA 2HS5A 1G3YA 3KLOA 3F6VA 3RPQA 1KGSA 4YIFA 4LK0F 1DDNA 4MHGA 4G8XA 4D0PA 3G4AA 1IZ1A 2B0LA 3CUQA 1OYIA 3HTUA 1UB9A 2EA4A 2DQLA 1FY7A 1ZG3A 1K78A 2VUMA 3CQZA 1KQ9A 3I0TA 4ESFA 1WKMA 4YG2F 3C7JA 2V6CA 3BWGA 4KUMA 4UXNA 4HQEA 2A5YB 2YX7A 2QLZA 2PJPA 1ZH5A 1ON2A 1EV7A 1BM9A 6PAXA 1ZXOA 4U88A 2HKXA 1B9NA 4K2EA 2ELHA 5IT9Z 5FGMA 1KU3A 1FYKA 3BUEA 5HLIA 1ZLKA 1G3WA 4GYIA 2BYVE 4RGRA 3H3UA 5L3BA 2YU9A 5D4SA 1J7KA 2KJBA 2A61A 4CDGA 4E70A 3ECOA 2H6CA 2JA6A 4I98B 3ZMZA 4M1XA 4AVPA 1FYLA 4CO8A 2E7WA 1B4BA 1TQMA 2P5VA 4OIPF 5ED4A 5H20A 1LQ1A 1ZARA 5A2QZ 5D8LB 5L3EA 4XLPF 2UWMA 4ZYDA 4HX8A 2IP2A 4OMZA 1XXCA 3LAPA 2ESNA 2IW5A 4A6EA 5DCMA 1YS7A 2AS5F 2R7ZA 1G3SA 2ZFZA 3KEQA 1S3JA 5ILSA 3HSFA 3TGNA 4M73A 1IUYA 4A5MA 3KP6A 2NVXA 4RGXA 4HAMA 4C3JC 4RB1A 4BHPA 3OOPA 5LEKA 3BJ6A 2UXNA 4UV9A 4KM9A 2P6TA 2ZNYA 1P4WA 2VBWA 2O03A 4Z2YA 3FXUA 3REOA 3TQNA 5E18F 1TW2A 3QU6A 3HRSA 4IXAA 3RI4A 2MLGA 1DD5A 3FM5A 3LSTA 5AIPA 3O2PE 3N3YA 5DV5A 1U5TC 2ZMEA 3E5UA 2VC1A 1O2BA 3J80Z 1OR7A 4ENNA 4HX7A 2PFBA 1SD6A 2HTJA 2M8EA 2ZO4A 3L4KA 2FXAA 1U6GA 1T39A 3O6BB 3WODF 1RUNA 1Z9CA 1AWCA 4YFKF 4BLAA 5FO5A 1ZREA 2IA1A 2E7XA 4EMSA 1AOYA 4IRIA 4OINF 4JBAA 2H27A 4G6QA 2LF8A 4UNOA 4IF4A 3ZN1A 3KP3A 4LMYA 1SAXA 1FBQA 4S04A 1K78B 1GXQA 2LF7A 2FQ3A 2LDUA 2X0LA 1I3QA 2O6GE 4BH9A 5BPIA 1R58A 2A6HF 4O6JA 1LJ9A 4ENJA 1LVAA 3H0GA 3J7AO 4EGYA 2GA1A 3R6SA 1TWGA 5JFEA 1P2FA 3LQRA 3JTGA 2MBFA 1YIOA 1ZGJA 1JXSA 3M1EA 4AIKA 2L01A 2XAGA 1U78A 2ISYA 2GXBA 2IJLA 2Q2EA 4A2UA 1XDUA 3P9CA 5HS7A 4HV6A 2QYOA 1KA8A 4LB6B 4KMUX 1FNNA 2RQPA 2XAJA 4I09A 5E8IA 3KLNA 1UHMA 4EJWA 2DO7A 2BBYA 4AIHA 4KATA 1FX7A 2HKOA 3QP6A 4EVIA 1IN4A 1P4AA 3FKIA 1PDNC 2JPBA 5F64A 3H3ZA 1AB4A 5IOTA 4ZYGA 2HZTA 4KFCA 1G6NA 4ENKA 5JR3A 2NRAC 4ZZLA 1T98A 1ZLJA 3V8KA 3T0YA 1XXBA 3PQJA 1WWXA 3FM3A 2GSNA 4G9YA 3KZYA 1KQ0A 4QLCU 1ZVUA 2QBYB 2PLYA 1S7AA 3WGIA 1TNTA 2M45A 2M5WA 3GFLA 2QVOA 2MD5A 1LNWA 3V7SA 1O3QA 5DYMA 3ZMUA 2RNJA 1MJBA 4HOBA 4LD5A 4A0YA 5FD5A 1SFUA 2YU3A 2OAZA 3SQNA 2G7UA 4OIRF 2DQRA 3IKVA 1U5TA 4TV7A 3E6DA 1DPUA 2JH3A 1QQIA 2MH2A 4M9ZA 3F6OA 5L3FA 2H6BA 5IOSA 1STZA 5DUIA 2XGXA 5HS8A 2L4AA 4M9SA 4LJZF 3AAFA 2YX4A 3GTJA 2O0YA 4YIIA 4KA4A 3KE2A 4BYYA 2HQRA 2V1DA 3AQOA 1UHWA 1YW9A 3M8FA 4Y17A 2EFQA 2PEXA 2EFNA 1KYZA 3CDHA 4M6XA 2DW4A 5LHGA 4MQVA 3FXRA 5IORA 2PG4A 1MKMA 1SD7A 3K9TA 1R00A 4G0VA 1BBYA 4CXFA 2QBYA 1REPC 1IAWA 5AONA 4EJVA 1BOAA 1BIBA 4L9VA 4L9TA 3I4PA 3Q9SA 4G6DA 1H0MA 1EK8A 1J2XA 3BY6A 2OU2A 3C1DA 3QOPA 3ZN0A 4IHTA 3MEXA 4ASNA 4ZZDA 3V8JA 4N0BA 2PHCB 2IPQX 3V7CA 2PN6A 3KP4A 1B9MA 4IJAA 3RYPA 2Y48A 1DUXC 2VODA 1EH1A 2V1XA 1MDMA 4ESBA 1X3UA 2R93A 1XMKA 2IVMA 1LDJA 3GTGA 2RC4A 3HHHA 1QPMA 3N4MA 1Z7UA 2A69F 1FOKA 3IRRA 1L0OC 1P92A 5HLHA 3TDUC 2ESHA 2B63A 2KRFA 1ONVA 3DXJF 2XIGA 4J3NA 4KIGA 4P55A 2K4BA 1KYWA 2VN2A 1H9GA 2WC2A 1GVJA 1UCRA 1ZRDA 3GX4X 4BHCA 4GT9A 4UVBA 4FZBA 3MWMA 2L02A 5IT9K 3D5LA 4KN7X 5HDNA 1O26A 5CLSA 4LK1F 2IA0A 4I7HA 3ISPA 2O3FA 4EJTA 1YFHA 1OMIA 3E6CC 1CGPA 3GFMA 1I1GA 3IWZA 4HF1A 2ADUA 3ZMTA 1Z91A 3HRUA 1JHFA 3GLXA 4RS8A 5LHHA 4Y13A 2DPDA 2VBYA 2DBBA 1QZZA 3TDZC 3TO7A 1I27A 1Z6TA 5L3CA 1GE9A 2Z3YA 1SD4A 3WGHA 4ETSA 4KMDA 5D8KB 3R0JA 1R7JA 3JAMZ 2COMA 1HW5A 2R3SA 1C0WA 1WQHA 1QNTA 2CFXA 2ACJA 3E3VA 2EFWA 5D5UB 3GTOA 2BGCA 2Y0MA 4U7DA 1O7FA 1ZN2A 2VOPA 1WRJA 4RB0A 3FMSA 1IF1A 1O27A 4NQWA 3CO7C 1KU7A 2HYGD 2F5DA 1HW1A 5ILUA 3MFKA 3P9IA 3JW4A 1A04A 3J80K 4IRHA 3CO6C 2KKOA 1KQ4A 5DEQA 3PQKA 4GCVA 1I50A 3IC7A 2VE9A 2LSOA 3J81Z 4L9NA 4GTAA 1D5VA 2DLLA 3COAC 3TO9A 3DFGA 4KARA 3Q5FA 3CUQB 1LB2A 4XSZF 4LLLA 1YYVA 3DP7A 4MTDA 5BPDA 1TBXA 2RKHA 1VTNC 1HKTA 2H09A 1I5ZA 5HS9A 1IN8A 3KCCA 2UZKA 4OOIA 5D5XB 1YG2A 5FFZA 4KIFA 1FBUA 1P6RA 1J59A 2K27A 3I64A 5J8FA 2EV5A 3WGGA 4RAYA 2A6EF 1QO0D 2P7CB 4NHJA 3CUQC 3U9GA 2OBPA