3V4GA

1.60 angstrom resolution crystal structure of an arginine repressor from vibrio vulnificus cmcp6
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
151
structure length
145
Chain Sequence
b'KQDNLVRAFKALLKEERFGSQGEIVEALKQEGFENINQSKVSRMLTKFGAVRTRNAKMEMVYCLPTVSSSLRELVLDVDHNQALVVIHTGPGAAQLIARMLDSLGKSEGILGVVAGDDTIFITPTLTITTEQLFKSVCELFEYAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title 1.60 Angstrom resolution crystal structure of an arginine repressor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Dna binding protein
total genus 51
structure length 145
sequence length 151
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v4gA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3v4gA02
4BNCA 1K78B 1IUYA 4EJOA 5CVVA 2EFNA 1T98A 4OIPF 1HKTA 3ABUA 2CW0F 2GXBA 4UV8A 3K69A 2OU2A 3WTTC 4HX8A 3KLNA 3K9TA 4XSXF 3FM5A 2K27A 5ICCA 4AIJA 4LFUA 4NHJA 3FMSA 1Z91A 1D8KA 3F8NA 5H6RA 1ZAOA 3GUDA 4I09A 2ZFZA 1MJ9A 1F1ZA 3VOEA 4A6DA 3L09A 3BROA 3VODA 3F22A 4U7DA 1REPC 1T6SA 2MA3A 3G73A 2NS0A 5HS7A 1G3WA 3CO6C 4EM0B 1W5SA 1BC7C 1EH6A 4A12A 3CAGA 1ZN2A 4M9XA 2X0LA 4CO8A 3K2ZA 5KVRA 3TO6A 1IN6A 2A07F 3ABTA 4IJAA 2XASA 3M1EA 3ULQB 3CTAA 2OZUA 3J7AO 1ONVA 4WCGA 5K5OA 1U2WA 3WTWC 2M8EA 3I59A 2HTJA 3DP7A 2IT0A 1YQAA 3K1PA 2OAZA 4WK8F 4F7ZA 3GWZA 1BOAA 3CO7C 5LHHA 2L3DA 2XIGA 4HA8A 5LGTA 3E97A 4O3MA 3WODF 5LEJA 5A2QZ 5L3CA 2F5DA 1E2XA 4AIHA 4FHTA 2K4JA 4AD9A 1SAXA 4LK0F 3S2WA 1BN5A 1ZREA 1XCBA 2HKOA 3L4KA 5FB2A 4KDPA 1STZA 2Z5UA 4A5MA 2EWNA 1TQPA 2JT1A 4GFQA 4FX0A 3CUQA 1MKMA 3P9KA 4KIFA 3ZP5A 3TO7A 2QVOA 2XROA 3F6OA 2Y75A 4Y17A 3SZPA 4I0BA 1SD4A 5CVUA 4L9NA 1HSTA 5JHUA 3HHGA 4M6XA 2GZWA 1ODDA 2WTEA 1WQHA 2XCRB 2E7WA 4G8XA 2P5MA 2KIFA 4G0VA 2CGPA 2FBHA 2PI0A 1BJAA 1TTYA 2V1XA 2BE5F 2XV4S 3WU0A 3CUQC 4P55A 1TBXA 5CLSA 1RUNA 1USTA 4QWQA 4EJTA 2KIUA 5LEKA 4AIKA 1XGMA 3ZQ7A 3JTHA 5LHGA 2DFIA 4P5OA 4HYEA 1O3TA 2H94A 3MWMA 1WQ2A 3HSEA 1PUEE 2P7VB 5HLIA 2VE8A 1WQGA 2Q2EA 1R36A 3M9AA 1LDKB 2DPUA 2EA2A 1ZYRF 3LA2A 2ISZA 2XAHA 5E8IA 3DV8A 2DO7A 2XRNA 1O3RA 4Q48A 2WWYA 2YPRA 4G9YA 2EA4A 2XUBA 2OZ6A 2VC1A 3HTUA 1HQCA 3IC7A 4M72A 2ZKZA 1S29A 2DPDA 4KYWA 3QAHA 3TDZC 1KYWA 4MQVA 2YX4A 4E70A 4OU0A 4HF2A 2IA2A 4MHGA 5CVIA 3U2RA 2QQBA 4KMUX 5FFZA 5K5RA 3DFGA 4KIGA 1QNTA 1WQFA 2ZFWA 4EVIA 4ZH4F 1WI9A 1YG2A 3KE2A 1R5HA 4N9HA 5D6EA 2QQAA 2ISYA 4XRFA 5FFXA 2XAJA 1R1UA 5IT9Z 3WU1B 1J59A 4LB6B 4BHBA 2FNAA 4RGSA 1D8JA 2Y0MA 1D3YA 2VT3A 3C1DA 4ZZDA 4S04A 4KC6A 3ML6A 3R60A 3IHUA 1CF7A 3RJPA 1MDMA 3M8FA 3L4JA 2O6GE 3HSFA 1ZLJA 5DUIA 2Y3PA 3LA7A 1YIOA 3W6JB 2ZMEB 2RQPA 3LFKA 2UXXA 4AVPA 2FQ3A 3I53A 3BY6A 3RKYA 4UVCA 1RUOA 2ZBKA 1H0MA 5ILUA 4KN7X 2P6SA 2Z99A 3WGHA 1YLFA 4GXOA 3PFIA 1XDUA 2VONA 1ISEA 1B4BA 2HR3A 1OPCA 5A2QK 1SD6A 1IN7A 5D5WB 3Q5FA 2DT5A 1TW2A 1KU7A 1BI1A 2ESNA 1T2KA 1ZVUA 2K02A 4BXUA 2LSOA 2VE9A 3GFIA 1K79A 1EH1A 1ZG1A 3KZZA 1BJTA 4I7HA 1AOYA 2AXLA 4I98B 2ZO4A 4EMSA 2VC0A 1Z9CA 1EH7A 4XBFA 1JXSA 4LMYA 2ADUA 2GIVA 2VOPA 2MD5A 2PJPA 2YR2A 3Q9SA 4PDKA 3ZMUA 1FOKA 4L0YB 1U3EM 4HQEA 3SXYA 2KIMA 3DF8A 4N0BA 3IWFA 3LQRA 4ENNA 3U1DA 3HSRA 1EH8A 2HOEA 1FY7A 2VBXA 1FC3A 4MQ9F 5LHIA 3ZMTA 1J9IA 3FXRA 2VODA 3O2PE 2M30A 2RVCA 1P6RA 3V7SA 3O3KA 2UXNA 4ENKA 4QLCU 1G4DA 3H3UA 4M6YA 5D4SA 4UV9A 4HAMA 2RGRA 1OYWA 1UFMA 4MGRA 1U6GA 3LWFA 4LLNA 3MZHA 2KJCA 4WXHA 3SQNA 4DNCA 3ZMVA 3COAC 3KEOA 1LJ9A 3RIRA 1FPQA 5E18F 3WE3A 3R4KA 4LK1F 4U0YA 3ECOA 5E1WA 4P96A 2CQKA 3F8CA 5FGMA 5L3BA 4A0YA 1DPUA 3MZYA 1FBQA 2F2EA 1AWCA 2G7UA 5DD4A 2MLKA 3F8BA 4LD5A 1LNWA 1FP2A 2LNBA 2RKHA 2DU9A 4O6JA 1B9NA 5JR3A 3RYRA 1O3SA 1XDSA 3R0JA 5HDKA 2H09A 1ZRCA 3SFZA 2H27A 4B09A 2HFHA 1S3JA 1IN5A 2HTSA 1LQ1A 2A3SA 1KGSA 3MCZA 4IF4A 3E5UA 1OR7A 2P8TA 3K0LA 1TLHB 4GYIA 3HRUA 4FX4A 4ZYGA 1ON2A 3PQKA 1IXCA 3VA7A 2RNJA 1U5TA 4OINF 2IW5A 5HVQC 2HYFA 2V9VA 1XXAA 4M71A 3F21A 4HZFA 2H6BA 2K7LA 2PG4A 5IT9K 1BI3A 2EFQA 3FOFA 3FOEA 2V6CA 5FO5A 4O5VA 1R58A 3GEZA 4RGRA 5BS6A 1GHCA 1VTNC 4HF1A 3LPXA 4Y15A 4EJUA 4P9FA 2EK5A 4ENMA 2BBYA 1J5YA 3GFLA 2P5LC 3HYIA 4AWXB 2DK5A 3P9IA 2D45A 1U5TC 3WG9A 3CUOA 1FSHA 2BEOA 4YIIA 3TDUC 1IN8A 1I27A 3FXQA 5BMZA 3H92A 1QZYA 2P5KA 3GVAA 3EQLF 2VT2A 4EGZA 3K1NA 5LRSA 2HDCA 3IL2A 1J0RA 2QM3A 1KQ8A 4UXNA 2A6HF 5K5QA 5LBQA 1JHFA 1IRFA 3C18A 3RKWA 4G7OF 2STTA 3DQVC 2P5VA 2XAFA 2KRFA 4LG0A 5H20A 2QBYA 3I64A 1RI7A 4HF0A 2OBPA 1YTYA 1F5TA 1E17A 1SD7A 3KP6A 1FBUA 4ENJA 3L2CA 2WV0A 4MEYF 4GO1A 4BYYA 4IHSA 5F6FA 4JK1X 1H9TA 1LEAA 1BIAA 3F8FA 1W7PA 2ZNYA 2W85A 4RGUA 1WSUA 2K4BA 1T38A 2F5FA 3ZMSA 3ERED 1ZG5A 3GLXA 1RNLA 5D8LB 1P92A 5DCMA 4CYDA 1C0WA 4HX4A 3IRRA 6PAXA 3I59B 5EEHA 4ESJA 1LB2A 2XKOA 5EEGA 1UB9A 2M1BA 5HOOA 3VB2A 1BM9A 2HQNA 2CO5A 1R1VA 1GVJA 3H3ZA 2QZ8A 2QLZA 2A69F 4RB0A 3RDIA 1P2FA 2DAOA 1KU2A 2VXZA 4KUMA 4DDQA 4OMYA 1KA8A 2B0LA 2DLLA 1BIBA 3GW2A 1J2XA 2FXAA 3OEPA 3G3ZA 2GAUA 2YX7A 4UVAA 3TGNA 4G0WA 2FMYA 3RKXA 2HEOA 1FT9A 3CDHA 1DP7P 3VFZA 5ICEA 4CICA 1HW1A 2PMUA 2P6TA 2GQQA 3CUQB 3GZ6A 1BI2A 1ZGJA 3R61A 4JBAA 3V7CA 3R6SA 1OYIA 2FNPA 3WTUC 4L5JA 2GA2A 4RAZA 1ZARA 4BHPA 3KFWX 1XB4A 3F72A 4U88A 5HS9A 1Q1HA 4I01A 3T8TA 1ON1A 4U7BA 2YU3A 3EYYA 2A61A 5IT3A 1KQ0A 3L7WA 2XCOA 3V8JA 5E1XA 1HKQA 4I02A 2DQLA 3TO9A 2KWAA 3IWZA 1B4AA 1NHAA 2FRHA 2XHKA 2O8XA 4KAWX 1R00A 1S6LA 3FHZA 3JAMZ 1FSEA 1WKMA 5BPDA 3P7NA 2EV0A 5H6QA 2L4AA 4EGYA 5J6XA 5DDGA 2VBWA 1UHWA 2D1VA 2M5WA 1JGSA 1QO0D 5L3FA 3E6CC 4ZYHA 5D6FA 3DPTA 2HS5A 4WXCA 2XAQA 3O6BB 2F5CA 5LLQA 4NQWA 2EB7A 2DBBA 2XVCA 2UWMA 3NEUA 4UHTA 1HW5A 2L54A 3EETA 2H6CA 2COMA 5K1YA 2LKPA 1I6XA 1MJAA 3D0SA 3CLOA 1G3TA 1D5VA 1W4MA 1DPRA 1SFEA 2AS5F 1IF1A 4Z2YA 3MMLB 3J80Z 1ZG3A 2CFXA 1DUXC 1RZ4A 4BAYA 1TW3A 1USSA 3JTGA 4OIQF 2KKOA 4PGGA 1XSVA 5LGNA 4UNOA 2QUFA 1O57A 3TOAA 2XKPA 1WRJA 1BBYA 3F3XA 3B02A 2DQRA 1R23A 4A6EA 1B1BA 1T0FA 3ZN0A 3E5QA 1HW2A 5AONA 3FZVA 3OOPA 3E6BA 2LF7A 5FD5A 5DV5A 1R7JA 3BJOA 1XGSA 2MH9A 1ZLKA 3MQ0A 3Q9VA 3RPUA 4K2EA 4I2OA 3E5XA 3J81Z 1DD5A 3MAJA 3E6DA 2D1HA 3NRVA 1CF7B 1MDMB 2ACJA 2HYGD 5HDGA 1Z05A 1JHHA 3C7JA 1KU9A 3KLOA 2XCQA 3LSTA 1SFUA 4XLNF 1LEBA 1KQ9A 2O03A 1YYVA 4ASNA 3KP7A 1DDNA 2UZKA 2Z9OA 2PFBA 2FF4A 5FLXZ 1XGNA 1B6AA 1MGTA 1Z7UA 3W6KB 4LJZF 5ICGA 4CZZA 1LVAA 2IVMA 4R8HA 4RB3C 2W84A 2JTVA 1QPMA 3HRTA 4ESBA 2PQ8A 4GYGA 2XAGA 1UHMA 2RDPA 4PGHA 4HDUA 2PHCB 1J75A 3K1MA 3T0YA 4ESFA 2HZTA 1BGWA 4Y13A 5JVOA 3FMQA 4LLLA 2DW4A 5HLHA 3WGIA 3FXUA 3M8EA 3TOBA 1TQIA 2IA0A 1HBXG 2ETHA 3SHFA 5ED4A 3ZMDA 1YS6A 1B9MA 4LLGF 2IP2A 2HQRA 3F8MA 3JSPA 4CDGA 2P4WA 2NAZA 5TRDA 1I5ZA 4G94A 4L9JA 1I1GA 2ZNZA 3KETA 2PEXA 3BPVA 1WWXA 3OV8A 3WTVC 2A6EF 2OA4A 4HX7A 2IJLA 1PP8F 1O7LA 4G6DA 5L3DA 4A2UA 1MJBA 1P4AA 4JQFA 3D5LA 1V4RA 3OPFA 4M9ZA 3JAMK 4BQAA 1YW8A 3V8KA 1KU3A 2QYOA 5DYMA 3DKWA 1S7AA 5E8GA 3HRMA 3HRSA 1YFHA 2L01A 5DUKA 4KN4X 1A04A 3KEQA 5L3GA 5F1RA 1IRGA 5E20A 4IPAA 1P4WA 3TKYA 4M74A 3E3VA 1RIOH 5AIQA 5D5XB 2DI3A 3IKTA 4RS8A 2NNYA 4L5IA 1XXBA 1GE9A 3BDDA 3ECHA 3J80K 1G3SA 1H9GA 1GXPA 3TQNA 4L0ZB 3LQQA 5LGUA 2QENA 5E1ZB 3GFMA 4HLXA 4G7ZF 1HSJA 2P7CB 4IRIA 1BI0A 2G7HA 3ZMZA 3I4PA 2HGCA 3I5UA 3DPLC 2IA1A 3DEUA 2CSOA 1L3LA 2EV6A 3QPTA 3B73A 1Z6RA 1U5TB 5DEQA 5ILSA 2J5OA 2Y48A 2A5YB 3GYHX 2QQ9A 4UVBA 3KP3A 4BHCA 4YIFA 2TDXA 3QRFF 1OYYA 5BQTA 4B8XA 2M45A 4J3NA 2IRFG 2FU4A 3HTSB 1K7AA 3GZ5A 3J81K 4YFXF 4WWCA 1U78A 4D0PA 1IW7F 1O3QA 1XCVA 4HV5A 4YFNF 3WTSC 2PMHA 2RN7A 1R22A 3BP8A 3FWEA 1TQMA 2GXGA 2PN6A 1TNSA 5DD8A 1YW9A 5J8CA 3V7RA 1XN7A 2V1DA 3WE2A 4RGXA 2FBIA 4HDVA 1IZ1A 3I54A 1KYZA 2HWVA 1ULYA 4HV6A 1W5TA 1FP1D 5FLXK 1UCRA 2W24A 3ISPA 5CJ9A 4HW0A 5KK1A 5LRRA 2ZXJA 3IKVA 5CVRA 3I0TA 5BPIA 4HBLA 4H0EA 1W7PD 2XGXA 2FSWA 1FYLA 4KFCA 5CVJA 1FX7A 3GXOA 2ELHA 1S8NA 2F5EA 4MTEA 3BZ6A 1XGOA 2IPQX 3N97A 4MTDA 1IXRC 1OMIA 1J7KA 1YW7A 2NRAC 4GCVA 2OD5A 2FE3A 4ETSA 4IRGA 2EFWA 2Q0OA 4LG0B 1IXSB 2CWEA 2QBYB 1XMKA 5CYVA 3N4MA 2YSRA 3GX4X 2R7FA 4RB1A 4FM9A 3BOQA 1YO5C 4GGGA 4KT5C 4KICA 3WTYC 2RGVA 4RAYA 1XSXA 3M7GA 3FMRA 2VBYA 1SFXA 4I0AA 2FOKA 3GFJA 1W7PB 1Z6TA 3QU6A 2MLGA 3P9CA 4KMFA 5HLGA 3BUEA 2RC4A 4ZZLA 2OQGA 1OKRA 5DCMB 3EUHA 3V4GA 3BWGA 3LAJA 4WF2A 4CHUA 3QOPA 3KZYA 3NQOA 1ZGAA 2JRTA 1CGPA 3E6MA 3I71A 2BYVE 2O0YA 4ZYDA 4MEXF 1XD7A 2R3SA 4OIOF 4R79A 4G6QA 1FBSA 3HIFA 2ZCWA 4R1HA 3QX3A 3GF2A 2ESHA 3CJNA 2ZMEA 1SMTA 4PZJA 1QGPA 4XSZF 2LF8A 3KCCA 3OREA 3KP4A 4M9SA 3QP5A 1SD5A 3EDPA 3GO5A 3BJAA 1YS7A 2R7DA 1P4XA 3L9FA 5J8FA 3JW4A 1I1SA 5JVTA 2NNNA 3F23A 4CXFA 3MFKA 2V1UA 2D2WA 4A0ZA 4EM2A 1FLIA 1L0OC 3ZPLA 2E7XA 1QBJA 2C6YA 4IHTA 4KB2A 1GXQA 1IN4A 1HKSA 2JZYA 4HOBA 2PBIA 1XXCA 4WX9A 2E1CA 2Z3YA 3T1BA 2QWWA 2CG4A 5ILVA 2V79A 1TNTA 5ERIA 5ICFA 1S7OA 1EV7A 2O3FA 2HKXA 3FM3A 4UUVA 1AB4A 4KB4A 1Z1DA 4U0VA 3VEPA 2W25A 4XLPF 4KDDA 1B59A 3ROUA 1EK8A 2LDUA 1U8RA 1FWZA 5D4RA 2GA1A 2X4HA 2FBKA 3IRQA 1O7FA 4ZYEA 2BV6A 4MNUA 5E17F 1FYMA 2J5PA 3HOTA 4LB5A 1XMAA 2OQRA 4OMZA 1ZH5A 2EJRA 3WTXC 1ZRDA 2JPBA 3V8LA 1XSDA 1R1TA 4DQ2A 2G9WA 3NUHA 4L9VA 1V3FA 2K86A 4WXDA 3LA3A 4Q4ZF 2WC2A 4G0UA 1IAWA 2EFOA 4OIRF 2MBFA 3RTRA 1FYKA 3MEXA 2GWRA 2Q8KA 3KP2A 1Y0UA 4A5NA 3QPHA 3QU3A 3ZN1A 3FX3A 1ZHFA 3WGGA 3QP6A 2NYXA 4LGWA 4EV0A 3C3WA 2JSCA 2EFPA 4EM1A 3T5XA 3T8RA 2MH2A 3HUGA 1F4KA 5HS8A 4YG2F 3AAFA 1G6NA 2FA5A 1K6OA 2BGCA 2Z33A 1JE8A 5BOXA 3FF5A 2VBZA 4IVNA 4IRHA 4A0XA 1MZBA 1T39A 4EQQA 2JPCA 1QZZA 3RPQA 2PLYA 4L18B 3DXJF 4S05A 3PQJA 1SMYF 1FZPB 5D8KB 4BH9A 3RI4A 4PCQA 2VN2A 4HQMA 5JI6A 4TV7A 3BPXA 2FMLA 2O61A 1FNNA 2FEZA 5F64A 1K78A 2ZJ2A 2A68F 4EJVA 5HDNA 4FT8A 1X3UA 4N9IA 2DK8A 3KP5A 2W57A 2STWA 4OOIA 1F9NA 1HXDA 1QQIA 4L9TA 3I58A 4IXAA 3L00A 2L02A 5JFRA 2L4MA 4HLYA 2KJBA 3HOSA 3SZTA 3RYPA 4ON0A 3R0AA 4G7HF 4P9UA 2CYYA 2M87A 5TJJA 1R5GA 3LAPA 3BJ6A 1G3YA 5D5VB 4U0WA 4EJWA 4YFKF 2DTRA 1PP7U 4RB2C 4KIBA 2VOOA 4M73A 1LDDA 1LDJA 3EYIA 3WTZA 5AIPA 2MC3A 4CGZA 3ELKA 3F6VA 3JSOA 4Q5SF 3U9GA 4NB5A 5FD6A 4Q47A 2RV8A 1ZRFA 2E1NA 5L3EA 4KNYA 1IS1A 3HHHA 5DCFA 1WIHA 2EV5A 5D5UB 3REOA 1BC8C 4KA4A 1PDNC 1MD0A
chains in the Genus database with same CATH superfamily
4IZZA 3PFYA 1D1BA 4BNCA 1K78B 1INNA 4G7ZA 1IUYA 1X19A 4EJOA 4PK4A 2Z2SB 2VLAA 5CVVA 2G0EA 4OWRB 2EFNA 1T98A 3O8GA 4OIPF 1HKTA 1D0YA 3AL0C 3B6CA 3ABUA 5M5XJ 1ZELA 1YRNA 2EIMH 2JA6C 2CW0F 2GXBA 3JRBA 4UV8A 3K69A 4PSXA 2OU2A 3FXJA 3WTTC 4HX8A 3KLNA 2L5QA 3K9TA 4XSXF 3FM5A 3K4KA 3EQLA 2R92C 2K27A 5ICCA 4AIJA 1OFCX 3ZOBA 3HOYJ 4LFUA 4NHJA 5FLMK 1UMQA 3FMSA 1Z91A 1D8KA 3F8NA 5H6RA 1I6HC 2VQCA 4A3KC 1ZAOA 3A03A 3GUDA 4I09A 2ZFZA 5IOYA 1MJ9A 5E3LA 1F1ZA 3VOEA 4A6DA 3ABMH 3L09A 3BROA 1E0EA 3S0XA 5C44C 3HKZA 2D5VA 3VODA 4RDUA 2XPWA 3VSLA 3F22A 4U7DA 1PUFA 1VRQC 1SFOJ 1G59A 1REPC 3HOVK 1T6SA 3N0BA 2MA3A 3G73A 2NS0A 4YFXA 5HS7A 1G3WA 3A8IA 3I3LA 3CO6C 4EM0B 1W5SA 1BC7C 1EH6A 2HVRA 3HKZD 2F48A 1IW7A 1Y1WA 1DGWY 2IEKA 4A12A 3CAGA 1D5YA 1ZN2A 3PO2K 4M9XA 4YFNA 1SVMA 2X0LA 4XNFA 4CO8A 2BZTA 3K2ZA 5KVRA 3TO6A 1I50A 1IN6A 4XOPA 2I5UA 2A07F 3ABTA 1JUPA 3ZXSA 4IJAA 2XASA 3CCUI 3OS0A 2GLOA 3M1EA 3A01B 2GOMA 2RREA 3CTAA 3ULQB 5GAGJ 4E7HA 2OZUA 3J7AO 2WY8Q 1ONVA 2R7UA 5IY5H 4WCGA 5K5OA 2X1DA 1U2WA 3GEHA 4CYCA 3WTWC 1Y0NA 1ACIA 2M8EA 3I59A 3A8KA 4MIMA 4BBRC 3BCBA 2HTJA 5C4JJ 2Y0SN 4IOAF 3DP7A 5DM7F 1Y56A 1QHHD 4XONA 5E68A 2IT0A 1YQAA 2K9MA 2DOEA 2OAZA 3BTCA 3K1PA 4F7ZA 4WK8F 4C3IK 2M7BA 3GWZA 3NAUA 3I4NC 1BOAA 3CO7C 5LHHA 4XRSA 4C3JC 2L3DA 2XIGA 4HA8A 4S0HB 5LGTA 3E97A 4O3MA 1HC8A 2V6TA 4DYQA 4LOCA 4A3JC 3WODF 4C2MJ 4KM8A 2LFBA 5LEJA 5E79C 1MBGA 5A2QZ 5L3CA 2K9SA 2F5DA 1E2XA 4CSWA 4AIHA 5TISC 4FHTA 2K4JA 3LSIA 4PFPA 4AD9A 1RRJA 1Y1WC 1SAXA 2L2OA 4LK0F 3S2WA 1ITYA 4HNVA 2FUG2 3Q0VA 3J7YJ 1BN5A 3H5NA 1ZREA 3LSPA 4X6AC 1XCBA 3RKQA 5IP7J 1I50C 2HKOA 4KASA 3L4KA 5FB2A 4KDPA 1H89C 1BR4A 1STZA 3ZQCA 3ZGKA 2CUZA 5M5WK 2O9LA 1O4XA 4Y33A 2Z5UA 4A5MA 2W1OA 2EWNA 4G12A 3CLQA 1TQPA 1LE8B 2JT1A 2VPLA 1IQ0A 4GFQA 1XPPA 4FX0A 3CUQA 2QA4I 4BBSJ 1MKMA 3P9KA 2Y9ZA 2BW3B 4KIFA 4JX4A 3ZP5A 3TO7A 4BLAA 2ECCA 2QVOA 3CJRB 2XROA 2LVSA 2W7NA 3F6OA 2Y75A 4Y17A 3SZPA 2F4IA 4GTLA 1WJAA 1QPIA 4I0BA 1SD4A 2LMDA 3JRCA 1KZHA 5CVUA 4L9NA 1EQRA 1HSTA 5JHUA 3HHGA 4M6XA 3S1QC 4QIWL 2GZWA 1ODDA 4BXXC 2R7ZK 1GV2A 3S1NJ 2WTEA 4BKWA 2CV1A 1WQHA 2XCRB 3H3VL 3D1NI 2E7WA 4G8XA 2P5MA 2KIFA 4BDYA 5EEAA 2CMPA 4G0VA 2VASA 3WG7H 3MKZA 2CGPA 2FBHA 2AXTC 1B8IA 2KRHA 1X1PA 2PI0A 2HPMA 4KM9A 1BJAA 1TTYA 3ZR8X 1YHQI 1IJWC 3AKZA 2F4OB 3PO3J 3SDGA 2V1XA 1RR7A 2BE5F 2XV4S 3H9QA 3WU0A 1I3QK 3CUQC 4P55A 3S2DC 3TMOA 1TBXA 1V5VA 3S16J 5CLSA 1RUNA 1USTA 1WH5A 4QWQA 4EJTA 5FKKA 3HOUK 2B63C 3QPLA 2LY9A 1FTTA 2KIUA 5LEKA 4AIKA 1HOMA 1XGMA 3ZQ7A 3CCQI 5IYBK 3JTHA 3MKWB 1I39A 1RC9A 2JA8J 5GAEJ 5LHGA 4DZPA 2DFIA 1O27A 4P5OA 4HYEA 3ZQGA 1O3TA 2H94A 2KQRA 5KHDA 3MWMA 1WQ2A 3HSEA 1PUEE 4BJTA 2P7VB 3LSKA 5HLIA 5M3MJ 4U87A 2VE8A 1ETQA 1WQGA 3GBGA 1WPKA 2Q2EA 4MEXA 4OIOA 4B4CA 1R36A 1FIAA 2MG4A 3M9AA 1LDKB 2DPUA 1Y1VJ 2DYSH 2EA2A 1ZYRF 3RSNA 3IAS2 3LA2A 2R93K 2ISZA 2XAHA 1PJRA 5E8IA 1RU0A 3HBLA 3GTMK 4XLAA 2CS3A 3LNQA 5JVGF 3DV8A 3H3VD 4FE7A 2WAEA 2DO7A 2XRNA 2XF6A 2BY3A 1J98A 2LOOA 4UUSB 5FJ8J 3MZ8A 4Q48A 3JR9A 2WWYA 2VIXA 3QPSA 2YPRA 1O3RA 3A2KA 5J4YA 2Y9YA 4A3CJ 3RCOA 2MYSA 4G9YA 4M3GA 4QPOA 2R5ZB 2EA4A 4V2GA 3M3YK 3DLLF 2XUBA 2OZ6A 2VC1A 2XC7A 5FLVA 3HTUA 4DBRA 1WSRA 1HQCA 3IC7A 4M72A 5KNLA 5FKNA 2ZKZA 1S29A 3S1MC 4RA2A 3AG1H 3GTLJ 3NWSA 2DPDA 2QCOA 3M4OC 3I9V2 3WHBA 2DA5A 1X1AA 4KYWA 2E2JC 1FOXA 4KMAA 3QAHA 3TDZC 2HXOA 2DTZA 2E5NA 1R6RA 3PNTA 1O2FB 3BR6A 1Z3YA 4IOCF 3LSMA 4Y7NJ 2DMTA 1KYWA 2NVUB 1TL8A 1LFPA 4MQVA 4E7KA 2YX4A 4I76A 2A05A 4E70A 4OU0A 4HF2A 2IA2A 4RM3A 3PNYA 2WA0A 5CVIA 2YS9A 4MHGA 1BW5A 3U2RA 1JT0A 2QQBA 4KMUX 1MNDA 4UB8C 5FFZA 4LR2A 2JA6K 3DU6A 3OYLA 5K5RA 2R7SA 1S72I 3DFGA 4MFDA 4BKXA 4KIGA 4J01A 3IUOA 1R9TJ 1QNTA 5FRMA 1WQFA 2R92K 2GIZA 2ZFWA 3HPGA 1F7UA 1E3PA 3JRHA 2DMPA 4EVIA 1JUSA 2EIKH 4NC8A 4ZH4F 1I6HK 1WI9A 1YG2A 3KE2A 4A3KK 2BVMA 2CUEA 4DOZA 1R5HA 5IYCJ 4NUBA 3HB9A 4N9HA 5EF6A 4ZJZA 3C2HA 3LFUA 5TGTA 1AKHA 1IDYA 1VQ6I 2CUJA 4ZDOA 5C44K 2L9RA 5D6EA 2QQAA 2ISYA 4ZDLA 4XRFA 5FFXA 1SC7A 2XAJA 1R1UA 3CF2A 5IT9Z 3WU1B 3OSFA 3HZJA 1J59A 2DN0A 4LB6B 2FNAA 2JUGA 4BHBA 2HOAA 4RGSA 4D1QA 5JLXA 1D8JA 1D1AA 1UELB 2Y0MA 1X4OA 1JJ8C 2GSUA 3GDZA 1D3YA 2VT3A 3C1DA 4ZZDA 4S04A 3A02A 2XGCA 4KC6A 2R7VA 3ML6A 3R60A 1VGXA 3IHUA 5GPAA 1CF7A 3T02A 3RJPA 1MDMA 1JKOC 2HVSA 4XLPA 1VNDA 2JVHA 3M8FA 2VJ4A 3L4JA 2O6GE 3HSFA 1ZLJA 2EZKA 5DUIA 1DCOA 1OQYA 2Y3PA 3LA7A 1YIOA 1JKRC 1G51A 3IV5A 1Z0XA 3W6JB 4KITB 2ZMEB 2RQPA 2CW8A 2L9SA 3LFKA 3CC2I 2UXXA 4AVPA 4BU2A 2FQ3A 1N25A 3BY6A 3I53A 3CDIA 3RKYA 3J7AY 4BBRK 4UVCA 1RUOA 4DYRA 2ZBKA 1H0MA 3FIWA 4A3BK 3BP3A 3FBIB 5ILUA 4KN7X 1T95A 2P6SA 2IGKA 2Z99A 3WGHA 3HPHA 1SFKA 4Z6YA 4CCJA 1YLFA 3I4NK 4GXOA 1RKWA 3DBRB 3S8PA 4C3JK 3PL8A 3PFIA 1XDUA 2N8GA 3K7AJ 2Y2ZA 2VONA 1B4BA 1ISEA 2HR3A 3BR0A 4A3GC 4A3JK 1OPCA 5A2QK 1WCMJ 3D5RC 1SD6A 1LFBA 1YNNA 2L0KA 1IN7A 5D5WB 2E2IA 4QJVA 3Q5FA 4Q4ZA 1Y1WK 2DT5A 3F9KA 1TW2A 4GTDA 1FIPA 1KU7A 4KN4A 2IS4A 1BI1A 2ESNA 4OIRA 1T2KA 1ZVUA 2HQAA 2K02A 1EJ9A 4BXUA 1I50K 5C4XC 1FEXA 2H8RA 2LSOA 2VE9A 4HPQA 1V5FA 1NTCA 2F5VA 1AU7A 3GFIA 1VQ8I 1K79A 1EH1A 1ZG1A 3KZZA 1BJTA 4I7HA 1Z21A 3QQAA 4PJMA 3GMEA 1AOYA 2AXLA 4I98B 3K70D 2ZO4A 4EMSA 2VC0A 1Z9CA 3GTJA 1EH7A 2IBDA 4XBFA 1JXSA 2LC2A 4LMYA 4A3MC 2XGEA 5J1YA 3PIOF 2ADUA 2GIVA 4A3DC 2VOPA 2MD5A 4NDLA 3OIOA 5CQGA 2PJPA 1WOOA 2M2EA 2IXSA 2YR2A 3Q9SA 5HL8A 4PDKA 5LFAA 2JVGA 3ZMUA 1TP4A 1FOKA 2FJ1A 3L1PA 1U3EM 4L0YB 4HQEA 1T0FC 1VF9A 3PSFA 3S1QK 2X51A 2K9NA 2LH9A 3SXYA 3VYTB 1JVIA 3S15C 3GTKA 2KIMA 3DF8A 2X1EA 3OS1A 2E2IC 4BY7J 3HOXC 4N0BA 3GTGA 3IWFA 4M3EA 1S9HA 3LQRA 5K7FA 3VWBA 4ENNA 3GTPC 3U1DA 1TWFJ 3S3MA 5L46A 1N77A 2I10A 3HSRA 4B3AA 2E1OA 1MIJA 1EH8A 2OTLI 4RLFA 1S5LC 3H0GC 1TWGJ 2AQEA 2HOEA 1X2MA 1FY7A 3DXJA 2FQ4A 2VBXA 1W36C 1FC3A 1SMYA 5JFEA 3A4CA 2NVYA 1ZKGA 2VQGA 2XGDA 4MQ9F 5LHIA 3ZMTA 5TJ3A 2E36A 1J9IA 3S2DK 3FXRA 2VODA 2FOWA 3O2PE 3GTJC 2M30A 2RVCA 1P6RA 2Y69H 2KDOA 3O3KA 3V7SA 2UXNA 2B63K 2HZDA 4ENKA 5C3EC 4QLCU 1BS2A 3HXAA 3OS2A 3ZRGA 1G4DA 5IOSA 3MKYB 4XLCA 3H3UA 4M6YA 3CD6I 3MMYB 1IC8A 5D4SA 4UV9A 1YE9A 5F0HA 2KP6A 4HAMA 2XPVA 1OCZH 5J3LA 1OYWA 3MN2A 2RGRA 2K40A 5TMFA 4AU7A 2OUMA 2A68A 4WJ4A 1UFMA 4MGRA 4BEHB 1U6GA 3LWFA 2CQXA 3MZHA 4LLNA 3GTKC 2KJCA 4WXHA 2VKHA 2DJIA 3QYFA 3SQNA 4B3XA 3GTGC 2A6EA 2HU9A 3VDXA 4DNCA 3ZMVA 3D5SC 3COAC 2EZHA 1IO2A 3KEOA 3GTMA 4DGWB 1LJ9A 3AQOA 1MMAA 1GDTA 3FKIA 3HOUC 4B47A 3RIRA 3S2HC 1FPQA 5E18F 3WE3A 2R7XA 3HGYA 3R4KA 3GTOJ 4LK1F 4U0YA 3ECOA 2NVYC 3QYBA 5E1WA 2F4MB 3IH3A 4P96A 2CQKA 1VI0A 5B3SH 2W82A 3F8CA 5IPAA 5FGMA 5L3BA 4CA0A 4XORA 4A0YA 3CCMI 3OR1C 1DPUA 1MW7A 3MZYA 3CDLA 1OCOH 2COBA 1N78A 1FBQA 3G6EI 2F2EA 1AWCA 2G7UA 5DD4A 3TFHA 4YFKA 1XZPB 2MLKA 2W00A 3F8BA 3S14C 4LD5A 1LNWA 1FP2A 2LNBA 4BE1A 4J00A 4F93B 3S1MK 3M4OK 3HUGB 4Q5SA 4X1EA 2ME6A 4PJNA 2RKHA 2DU9A 5K7HA 2E2JK 4O6JA 1B9NA 3PM1A 5JR3A 3S17J 9ANTA 3RYRA 1O3SA 1XDSA 4A3LJ 3R0JA 4BXFA 1M1EB 2H09A 3DTIA 5HDKA 1ZRCA 3SFZA 2H27A 2JA6A 3TW7A 2AQFA 4B09A 2HFHA 1S3JA 1IN5A 3FKIC 2HTSA 3AQPA 4XCHA 3CQZJ 2R92A 3SEZA 1TWHJ 2XDVA 2O7OA 2A3SA 1LQ1A 1KGSA 3MCZA 3PSIA 4IF4A 1APLC 2IS2A 1EF4A 3C2GA 3ABKH 3E5UA 1OR7A 1UG2A 3BLYA 2P8TA 4OIPA 3S1RJ 3K0LA 1TLHB 4GYIA 4BL0B 3HRUA 3HOWC 4FX4A 3T00A 4ZYGA 1ON2A 3PQKA 1IXCA 3VA7A 4D7NA 2NVTC 2RNJA 4CCLA 1U5TA 1USOA 4OINF 2IW5A 5HVQC 4D7MA 3VYSB 4BY1J 4XN0A 2HYFA 4Y52C 4XSXA 4LOWA 2V9VA 2E5ZA 4A93J 4IX7A 1K4TA 2EQRA 1XXAA 4M71A 5F1JA 3F21A 5M5YK 1QVTA 3LOCA 4HZFA 2JA7A 2H6BA 4ZTJA 4V19K 2K7LA 4A3EC 3DWLE 2PG4A 2GOXB 4W97A 5IT9K 1BI3A 4LIVA 3ABLH 2EFQA 3CP2A 3S3NA 3N3YA 3A1YA 2JUCA 3FOFA 2MGQA 1CQTA 3RZDJ 3FOEA 2V6CA 5FO5A 4O5VA 3TFJA 1R58A 4P5BA 3GEZA 4M6VA 4RGRA 5BS6A 1GHCA 2WAQN 1VTNC 4HF1A 1ERDA 3C2BA 5EG0B 2NVXJ 3LPXA 3G1OA 4Y15A 4EJUA 1R4MB 4P9FA 2X6WA 2EK5A 4ENMA 2BBYA 3E1SA 1J5YA 3ZQHA 1BR2A 5IP9C 3OYHA 3RQ4A 4ABZA 3GFLA 2EBBA 1RETA 2P5LC 1OR7C 5J4VA 2LBFB 2VJJA 3HYIA 4AWXB 5GAHJ 4KARA 1MBJA 2DK5A 3GEIA 3P9IA 3AL0B 2D45A 1U5TC 1JQWA 3WG9A 3CUOA 2DXIA 1FSHA 3ERMA 5IYDC 4A3FC 3HOZC 5GP9A 2JA7C 4YELA 4CCOA 2BEOA 4YIIA 2JN6A 3TDUC 2PMZN 2JSPA 2ID6A 1IN8A 2ZXHA 4XICA 1PJ5A 1I27A 2V7FA 3FXQA 5BMZA 3H92A 4A3GK 2R4GA 2JA5A 1D1CA 1MMGA 1QZYA 5IORA 3ADAC 3OWTA 4DW6A 3GEEA 1KONA 1R4NB 3G2BA 2P5KA 2WB1N 3GVAA 3EQLF 2L9NA 2VT2A 4EGZA 2DMUA 1B72B 3K1NA 4LITA 4RM2A 5LRSA 2HDCA 1WJ5A 3IL2A 3WODA 3A0BC 4ZDPA 1K83A 1J0RA 4PJLA 1TWAC 5EJCA 4C3HC 1Q1VA 3CCYA 5C4XK 4E7ZA 2QM3A 3L2QA 4LQYA 1KQ8A 1QRYA 4UXNA 2A6HF 4JX6A 4A3BC 4LK0A 2ZC2A 3BCAA 5K5QA 4RMFA 3FHNA 1LPQA 5LBQA 1JHFA 3DCFA 4ILDA 2DA6A 1IRFA 3C18A 1K4SA 3RKWA 2JWTA 1YRNB 3G71I 1O2AA 4G7OF 2IGOA 2STTA 3DQVC 4A3MK 1XMXA 2P5VA 2QSGX 2XAFA 2VKEA 2KRFA 4LG0A 4XR6A 4PJ0C 4A3DK 5H20A 2W48A 2QBYA 3I64A 1RI7A 5HODA 4C45A 4HF0A 2OPTA 2OBPA 2ID3A 2WV1A 4P5AA 2X1CA 1TWCA 4XN3A 3RZOC 1SANA 1EA3A 3TW6A 2JA5C 1YTYA 2EBIA 1F5TA 2LLKA 2M9HA 1E17A 1BOBA 5DTDA 3H5AA 3BG7A 3S15K 2NOGA 2E2IK 2GSNA 1SD7A 3HOXK 2LY2A 3KP6A 4AYBL 1FBUA 4ENJA 3L2CA 2M8GX 1PUFB 2DDAA 2WV0A 4MEYF 1XC5A 4GO1A 1K83C 5FLMJ 2BY0A 4BYYA 4IHSA 1VJEA 3GTPK 1XX5A 2QGUA 1XS9A 4IHVA 5F6FA 4C2TA 2L9VA 2KDZA 3H0GK 1WFXA 4FZBA 4JK1X 2B63A 1H9TA 4J19A 1WVRA 1LEAA 1BIAA 4E4HA 3GTQA 1MMSA 3F8FA 3LMMA 2UUZA 1W7PA 5EGOA 3HOVJ 1V5EA 2ZNYA 2ICWG 5E3MA 3AD7C 1ETOA 2BXYA 2W85A 4RGUA 1WSUA 2K4BA 1T38A 1WH7A 1YI2I 3TBIA 3GTJK 4A3IC 2F5FA 3ZMSA 1HLVA 3ERED 5C3EK 3BTJA 2BE5A 1ZG5A 3GLXA 1RNLA 3ZCOA 1OISA 5D8LB 1UAAA 1P92A 5DCMA 1D0ZA 1A6IA 1T08B 4CYDA 4HX4A 1ZTRA 2DT7B 3CCSI 1C0WA 4L5EA 3IRRA 3PO2J 6PAXA 4CYCB 1TWCC 2Q1ZB 3I59B 2E1MC 5EEHA 3CMAI 2YU9A 2EZLA 4ESJA 1ZGWA 2KHMA 5DS9A 1LB2A 3BP8C 3PUBA 1FTZA 2R5YA 2CFAA 3GTKK 3GZNB 2XKOA 5EEGA 1I6VA 2X85A 3P5JA 2E2HA 3GTGK 1UB9A 2M1BA 5HOOA 3VB2A 1BM9A 2HQNA 2CO5A 1W5CC 4GFBA 1R1VA 3DLAA 1GVJA 1A6QA 3H3ZA 2QZ8A 2QLZA 1WZ2A 2A69F 4RB0A 1Z77A 3RDIA 1P2FA 4AYBA 3B6AA 2ZXIA 2DAOA 1KU2A 2VXZA 4KUMA 2LTPA 1OCCH 1AHDP 4OMYA 1KA8A 4CCMA 2B0LA 4DDQA 3S2HK 3GTQC 2EZIA 2LR8A 4C3IJ 2DLLA 3W2WA 1BIBA 3I4MC 3GW2A 2NVYK 1J2XA 2FXAA 3OEPA 5IOZA 3G3ZA 2L7FP 2GAUA 2YX7A 4UVAA 1XZQA 4NC7A 3TGNA 4AYBD 4G0WA 2FMYA 3RKXA 2HEOA 1ZYRA 4V2FA 1FT9A 3H36A 1V55H 3TTGA 1DU0A 3CDHA 4XKCA 1DP7P 3VFZA 5ICEA 3LSRA 1JJ6C 4CICA 1HW1A 1SVOA 1JKPC 2K9LA 2PMUA 2Y0SL 5DM6F 1A35A 2P6TA 2GQQA 3CUQB 3S14K 3GZ6A 1IV8A 2KFDA 1BI2A 4D5FA 1ZGJA 3R61A 2YU9C 1TT5B 4NNJA 4JBAA 3CCLI 4PABA 1SFOA 3IH4A 2M4KA 3V7CA 3R6SA 1WJDA 5IYCK 5M5WJ 3W2AA 1UV7A 2E2HC 1OYIA 3U1KA 1QHGA 5EGOB 2DJNA 4QIWD 2FNPA 1NK2P 3WTUC 2R7WA 1IE0A 3W2VA 4I99C 3FXMA 1WJBA 3K10A 1S7EA 2GXAA 4L5JA 2GA2A 4RAZA 1ZARA 4BHPA 1WJFA 4NOIA 3KFWX 4G6TB 1XB4A 3F72A 1IRZA 1O2BA 2HDWA 4U88A 2H1LA 5HS9A 1POGA 2IS1A 3FKIK 1Q1HA 4I01A 3T8TA 1A5JA 1PJ7A 3AD8C 1FOWA 1F43A 4XSZA 1ON1A 4U7BA 2YU3A 2Z1DA 3EYYA 2DODA 2K5CA 3BG5A 2A61A 4E7SA 1U0JA 3HOYK 3Q3QA 5IT3A 1KQ0A 4PUSA 1SVLA 1B8IB 2ME0A 2TRTA 3L7WA 2R7ZJ 3HOYC 1ETXA 3SYTA 2XCOA 3V8JA 2WB1A 4C2UA 5M3FK 5E1XA 3HOWK 4XLEA 1J6VA 2LREA 1HKQA 2NVTK 4I02A 1LKXA 2DQLA 2R7OA 3TO9A 2KWAA 3IWZA 1B4AA 1NHAA 2FRHA 3OYDA 4Y52K 5J1RA 2XHKA 4KISA 1YOVB 3JRFA 1BL0A 1SFOC 2P0WA 2O8XA 2Y0SA 3HEFA 5GADJ 4ZH4A 3KIOA 4KAWX 1R00A 4A3EK 3IH2A 1IBAA 3K4NA 2HOTA 1S6LA 3FHZA 3JAMZ 4BLBA 1FSEA 1WKMA 2HVQA 5BPDA 4JX5A 1I3QJ 3P7NA 2EV0A 1OJLA 1JUMA 2WY7Q 1O26A 4JP0A 5H6QA 2Y0SD 4XLHA 2L4AA 4EGYA 5EZGA 5J6XA 1DGRM 5DDGA 2VBWA 2WBMA 1UHWA 2D1VA 2M5WA 4IHXA 1ENHA 1JGSA 3EUHC 2NVQJ 1Y8RB 2LK2A 1QO0D 2Q2EB 5IYBJ 5L3FA 3BG9A 4PJJA 2MSYA 4EEFG 5IP9K 3BC8A 3E6CC 5FROA 2IGMA 3CJQB 3FKJA 2H1KA 2VUMJ 4ZYHA 4FISA 5D6FA 3DPTA 4X0GA 2PJRA 2HS5A 4WXCA 2M0CA 1DCPA 1AA7A 1BW6A 2R0QC 4XK4A 4FASD 2XAQA 3O6BB 3G4CA 2F5CA 5LLQA 3HXLA 5C4JC 4NQWA 2EB7A 1HDDC 2DBBA 4BQQA 2XVCA 2UWMA 3NEUA 2OF7A 3ZQQA 4UHTA 5IYDK 4A3FK 1HI9A 2EIJH 3HOZK 1HW5A 3OY9A 2JA7K 2L54A 3AG2H 3SDBA 5KAFC 3EETA 2H6CA 2COMA 3UNGC 2HOSA 5K1YA 1W1WE 3JSTA 2LKPA 1I6XA 1MJAA 3D0SA 4C2MC 3CLOA 5GPCA 2PA8L 1G3TA 2R93J 4PAAA 2MC4A 1D5VA 4CCNA 1ZR2A 1W4MA 1VQKI 1DPRA 2P81A 2CH0A 3PNVA 1SFEA 2AS5F 3GTMJ 1IF1A 3HC7A 4RAGA 4Z2YA 1YX3A 3MMLB 1ETVA 2VQHA 3J80Z 1ZG3A 5IP7C 2CFXA 1DUXC 1RZ4A 4BAYA 1TW3A 1USSA 3JTGA 4OIQF 3O8HA 3M3YJ 2KKOA 3VSKA 1TWAK 4PGGA 1XSVA 2JJ7A 2DFHA 5LGNA 4C3HK 4UNOA 2LP0A 2DCEA 2QUFA 1O57A 3TOAA 2ZJRF 2XKPA 1WRJA 2M3AA 1BBYA 3F3XA 3B02A 4IHYA 3HGGA 4BBSC 2DQRA 1R23A 1PVEA 3BTIA 4AC0A 4A6EA 2CRGA 1B1BA 1ORKA 2IGNA 1T0FA 2KRCA 4II3A 5F0FA 3ZN0A 3E5QA 3HL2A 1HW2A 5AONA 3FZVA 2E34A 4XL9A 3OOPA 1HA8A 3E6BA 3OYMA 3H9JA 3DU5A 3S1NC 3CC4I 2LF7A 1JKQC 3RZOK 2JA6J 3OIPA 2JA5K 3GTPA 5FD5A 5H2FC 2Z16A 3BR2A 5DV5A 1E3OC 3HJEA 2RNGA 1R7JA 3H0GA 1IL2A 3ZQLA 1AKHB 3BJOA 1XGSA 5CKTA 3S32A 2R92J 1LFUP 3OYBA 3WHCA 1IGNA 2MH9A 1K83K 2M0MA 1ZLKA 2DT6A 2X6XA 1I6HJ 1Y1VA 3MQ0A 3Q9VA 4A3KJ 3QOEA 3EUAA 3RPUA 4K2EA 3K4JA 4I2OA 3E5XA 3PO3C 1J09A 1UG0A 1YX5A 2XSJC 3BG3A 3BR5A 3BTLA 4D5CA 3J81Z 4ZTFA 1H88C 2VKDA 2PA8D 4CCKA 1DD5A 4KMDA 2Y30A 3MAJA 1W36D 3E6DA 2D1HA 3S16C 3NRVA 4B43A 5C44J 1CF7B 1MDMB 5D4DA 4GRIA 5F27A 3RPUD 2ACJA 2HYGD 4A3IK 1JOEA 5HDGA 1Z05A 1JHHA 3C7JA 4YG2A 1KU9A 3JREA 3KLOA 3OYIA 2XCQA 3OYEA 4MQ9A 2JA8C 2O5JA 2PPBA 1X58A 2BHZA 3LSTA 2EPFA 5GTIC 1SFUA 1VQ7I 3KEYA 2NXNB 4XLNF 1DCHA 1TWCK 1LEBA 4M1XA 3GTLA 1KQ9A 2O03A 1MNMC 2V9PA 4CUGA 1YYVA 2BOLA 4ASNA 1VLOA 1GT0C 3FK6A 3KP7A 1USMA 5IOTA 5CQEA 3CC7I 2RQQA 1DDNA 3AG3H 4JOMA 2UZKA 2Z9OA 2PFBA 2O8KA 2FF4A 5FLXZ 1Y1VC 1XGNA 3HKZN 4BBRJ 4GTAA 1B6AA 2OCEA 1MGTA 1Z7UA 3FK7A 2RAEA 3W6KB 4LJZF 5ICGA 3BQZA 4M3FA 4CZZA 3EPZA 4QJVB 1LVAA 2IVMA 3GTQK 1TT0A 4PSWA 2ZSHB 2TCTA 4R8HA 3I4NJ 4RB3C 1IG7A 2W84A 3I4MK 2JTVA 5F04A 1QPMA 3HRTA 4C3JJ 1R9TA 4ESBA 4A3CC 4A3JJ 2PQ8A 1YJWI 4GYGA 2XAGA 1UHMA 2RDPA 4PGHA 4HDUA 4LK1A 3DTEA 2PHCB 4I6ZA 1J75A 3IAM2 3K1MA 4Y3OA 4NC6A 3OL3A 3T0YA 4ESFA 2HZTA 1Y1WJ 1HDPA 1Z3XA 1BGWA 4MFEA 4Y13A 3GTLC 5JVOA 3FMQA 4LLLA 2DW4A 5HLHA 3WGIA 2YU9K 1K61A 4X6AJ 1I50J 3L2UA 1MBEA 3FXUA 4OAZA 3M8EA 3TOBA 1TQIA 2E2HK 2IA0A 1HBXG 3ESWB 4Y7NC 3SEQA 1HQMA 2HXIA 3NARA 2ETHA 3SHFA 3OIQA 2BXZA 4GTBA 3K2AA 4N4OB 3VYUB 5ED4A 1FMVA 2FQTA 5B1AH 2E60A 3ZMDA 1BJZA 1YS6A 3BR3A 2R7TA 1B9MA 2X48A 3ONQA 4LLGF 2IP2A 1D0XA 2HQRA 4E7JA 1LVKA 2MW8A 3F8MA 5M5XK 4G7HA 4HSTA 2QF7A 1X3ZB 2DFFA 3OYNA 2GM4A 2BVLA 4EATA 3K4LA 3JSPA 4CDGA 2P4WA 4IQ4A 1R9TC 4FTHA 2NVXK 2NAZA 4D9JA 3S1QJ 3NWTA 4XKVA 3M8JA 5TRDA 4BXXJ 1P7JA 1I5ZA 2LY1A 4G94A 1I1GA 4L9JA 5KCMA 3QODA 2KMUA 2ZNZA 4XQFA 1FMWA 3KETA 2PEXA 3BPVA 4GT9A 1WWXA 1GVDA 3OV8A 3WTVC 1WGXA 2A6EF 4HEA2 5IYCC 4XM3A 2OA4A 4HX7A 4II2A 2IJLA 4KJZA 1PP8F 1O7LA 3OSGA 2O5IA 3DPUA 5CPRB 4ZC3A 2EILH 4G6DA 5L3DA 4A2UA 1MJBA 1P4AA 4JQFA 1BA5A 3GSIA 1SFOK 3D5LA 1V4RA 3OPFA 4M9ZA 1VQ5I 3S3OA 2XRLA 4OINA 1VQ4I 4M3DA 2IAIA 3JAMK 1ZQ3P 4BQAA 2DOFA 3F0CA 3CCRI 1YW8A 3V8KA 3S2DJ 4ANJA 4RBOA 1V54H 3E0JB 1UZCA 4DBQA 1G2HA 1RESA 1KU3A 2B63J 2F6CA 2VJIA 1X4PA 2QYOA 5DYMA 3DKWA 1S7AA 5B66C 2CW0A 5E8GA 1VQOI 2JK3A 1ETWA 3FXOA 3HRMA 3HRSA 3OYFA 4XMYA 1YFHA 3H9GA 3SJMA 2L01A 4MO7A 5DUKA 2B9SA 4KN4X 3SZGA 1A04A 3KEQA 5L3GA 4ZYAA 5F1RA 3SZYA 2NS7A 1MBHA 1IRGA 5E20A 5C4JK 4IPAA 4LIUA 1P4WA 1Y6IA 2M4GA 2V4JC 2X6YA 3A01A 3MKLA 3TKYA 4M74A 3E3VA 4BQOA 1RIOH 1WSVA 4UY8I 5AIQA 3LSGA 5D5XB 1X1BA 3G1MA 2DI3A 3K7AC 4N4NB 2K9QA 4RS8A 3IKTA 4IQJA 2NNYA 4L5IA 1WCMC 4C2MK 4HRIA 1XXBA 1GE9A 1TWAA 4RAFA 3BDDA 3ZQFA 1TC3C 1NG6A 3ECHA 1YX2A 2K3FA 3J80K 1G3SA 1TWFA 1H9GA 2XB0X 4BS9A 1GXPA 5IP7K 3TQNA 1VQPI 3LQQA 5LGUA 4L0ZB 5FRNA 2VKVA 2QENA 1TWGA 5E1ZB 3GFMA 4HLXA 4LG3A 3BG6A 4W1UA 4AIDA 5IP6A 3TP0A 4QIWN 2HQ5A 1ZR4A 4G7ZF 1X2NA 2DA7A 2HYJA 3S1MJ 1HSJA 3OYCA 4BBSK 3M4OJ 2P7CB 1EI6A 2E2JJ 1OCTC 4IRIA 1BI0A 3VPRA 2ZFUA 1RPWA 2A6HA 1OCRH 2G7HA 2NOJB 3ZMZA 3I4PA 2HGCA 3I5UA 3DPLC 3Q3SA 1QA6A 3AD9C 3JCUC 5KAIC 2IA1A 4B48A 3DEUA 3KZIC 1LE8A 2VI6A 3KYCB 5BNGA 4HNUA 2CSOA 1L3LA 3LSHA 3H0DA 2EV6A 3KYDB 4G7OA 4AH6A 3QPTA 2BW3A 3B73A 5J47A 3S1NK 4FQGA 1UJ8A 1Z6RA 1U5TB 4HG2A 2VB6A 5DEQA 5JHFA 2ZJPF 4BY7C 1NG7A 5ILSA 2J5OA 2Y48A 2A5YB 2XAUA 4XLFA 3GYHX 2QQ9A 4UVBA 3KP3A 4BHCA 4YIFA 1TWFC 4BE2A 2TDXA 1N75A 1OYYA 5BQTA 4B8XA 2M45A 3QRFF 4J3NA 1BR1A 1JTYA 2HNHA 5J40A 2IRFG 4KATA 2FU4A 2QSHX 2GBYA 3HTSB 1K7AA 3ASOH 2CV0A 1TWGC 2K3PA 2A5WA 1X1CA 2KISA 3FXKA 3GZ5A 1F7VA 3OYKA 3J81K 3PO3K 4XOTA 4YFXF 5GTHC 3GTOA 4WWCA 1EKEA 1MMDA 1U78A 1HF0A 3GLLA 5M5YJ 4MEYA 4D0PA 2YUSA 2EINH 1IW7F 4BJ5C 1O3QA 3S16K 1XCVA 1X31C 4KMUA 4HV5A 3BQYA 4YFNF 3HDDA 3WTSC 3OYGA 2PMHA 2RN7A 2ZUFA 1O29A 1R22A 3BP8A 1C0AA 2I8DA 3FWEA 1TQMA 2GXGA 2JH3A 2KT0A 2JA8K 2PN6A 1TNSA 5DD8A 3Q0UA 1YJNI 1YW9A 1WORA 5J8CA 3V7RA 1XN7A 2V1DA 4BACA 3WE2A 4RGXA 2FBIA 4KT6A 1IZ1A 4HDVA 5M3MK 3I54A 1KYZA 2HWVA 3J7ZI 1ULYA 4HV6A 1U9OA 1W5TA 1FP1D 5FLXK 1UCRA 2W24A 3ISPA 5CJ9A 1WI3A 4HW0A 5KK1A 1Y1VK 2WAQL 5LRRA 2ZXJA 3HG9A 3CF5F 3IKVA 3CQZA 3GTOC 2ELJA 5CVRA 5FKMA 1TWHA 3I0TA 5BPIA 2DA2A 4HBLA 4H0EA 2A69A 4P9SA 1ZQ1C 1W7PD 2XGXA 2FSWA 3UKGA 1FYLA 5CVJA 4KFCA 1FX7A 5K7ZA 5FJ8K 3GXOA 4A3GJ 5TMCA 4A3CK 3CCVI 4CZCA 1XPXA 2ELHA 1S8NA 2VPRA 2F5EA 3FXLA 3K4CA 4MTEA 3BZ6A 1XGOA 2QSFX 2IPQX 3N97A 1UHSA 4BGDA 4MTDA 1IXRC 2MABA 1OMIA 2E35A 4DIQA 4DYCA 1J7KA 4FETA 1YW7A 4QPQA 2JMWA 3BZKA 1R71A 2NRAC 4UUSA 4GCVA 3GTLK 2OD5A 4UB6C 2LKXA 2FE3A 5C4XJ 1MSFC 5B1BH 4ETSA 3I56I 2PMZL 4IRGA 3S17C 2DDBA 2EFWA 1JI8A 2Q0OA 2R5ZA 4LG0B 4KN7A 4A3LC 1JTXA 2BY2A 3JRAA 1IXSB 4O2DA 2AHQA 2CWEA 2QBYB 4Y7NK 2XF7A 2ZB9A 1WOPA 1K6YA 1XMKA 4MLOA 5CYVA 4KMHA 2O5RA 2JQ7A 3N4MA 5F0CA 2WB1L 2QQ8A 2YSRA 4AM3A 2E1MB 3GX4X 2NVXA 2R7FA 3HM5A 4RB1A 3H5RA 3CQZC 1QZEA 4A3MJ 1TWHC 4FM9A 1R5ID 1MNEA 3M07A 3BOQA 4A3DJ 3DKXA 2WAQA 1YO5C 3OR2C 4GGGA 3T01A 4KT5C 4KICA 3WTYC 3S1RC 1R9TK 2RGVA 4RAYA 2NVQK 1XSXA 3M7GA 2R7RA 2CUFA 3FMRA 2VBYA 3DEEA 1SFXA 4I0AA 2XPUA 3S15J 4M3BA 2FOKA 2E2IJ 2WAQD 4BY1C 3HOXJ 3GFJA 3U21A 3KX2A 4E6KG 2VUMK 1W7PB 4A93C 4E7IA 1Z6TA 3QU6A 2CFOA 3QWLA 3GTPJ 4HNTA 3LSJA 2MLGA 3TEDA 2KLOA 4IEJA 2DA4A 3P9CA 2MD0A 2XSDC 4KMFA 5HLGA 3H0GJ 1QVUA 3BUEA 2RC4A 3N05A 4ZZLA 2OQGA 3RZDC 1TZLA 1OKRA 4XKBA 5CHPA 5E3NA 5DCMB 3EUHA 3V4GA 4AUXA 3PIPF 2PMZA 3L2WA 2DMQA 1VQNI 3BWGA 3JRDA 2IS6A 3LAJA 5IOQA 2NVXC 2NS8A 4WF2A 1Z67A 3GTJJ 1J6XA 2R5YB 2DYRH 4CHUA 2CFAB 3AH5A 3QOPA 3KZYA 3NQOA 1ZGAA 2JRTA 3JRIA 1CGPA 3DEWA 5C3EJ 1Y8QB 3AFHA 1T33A 3E6MA 3I71A 2BYVE 2O0YA 5HNHA 3QYEA 1PJ6A 2PMZD 4ZYDA 5LD2C 4MEXF 1VQMI 1XD7A 2R3SA 2UV1A 4OIOF 3X2QH 5EZHA 3AG4H 4R79A 2WB1D 3GTKJ 3SZZA 1O24A 4G6QA 2AO9A 1FBSA 3HIFA 2ZCWA 3GTGJ 1X1DA 2VXDA 4R1HA 2HPIA 3JRGA 1HCRA 3QX3A 4NBQA 2JRMA 1G8XA 3GF2A 1XZQB 2ESHA 3CJNA 2ZMEA 1SMTA 4YIRX 1L0WA 2M34A 2VQLA 2DMNA 1T8IA 3K7AK 4PZJA 3W6VA 1QGPA 3HOUJ 4XSZF 2LF8A 1P7IA 2DOAA 3S2HJ 3KCCA 1WCMK 5FKLA 3G1LA 3GCMA 3OREA 3KP4A 2NVYJ 4M9SA 3IPJA 3QP5A 1PYVA 1SD5A 3EDPA 3GO5A 3GIRA 1A31A 3BJAA 1YNJA 3BR1A 1YS7A 1RR8C 3MD2A 2CQNA 2R7DA 5F08A 3PJRA 1P4XA 3L9FA 5J8FA 1MBKA 3JW4A 1I1SA 5JVTA 2NNNA 1IRXA 3F23A 4CXFA 2XB5A 3MFKA 2FQOA 2ZUEA 2H8WA 2D2WA 2V1UA 1FJLA 4A0ZA 4EM2A 1FLIA 1L0OC 3S14J 3ZPLA 2E7XA 3L2RA 2OC6A 1QBJA 4GDFA 4F3QA 2C6YA 4IHTA 4KB2A 4OIQA 1GXQA 1YCLA 1IN4A 5EGEA 4F52A 1V5GA 3TFIA 1HKSA 2GAHC 2JZYA 4GTCA 1ZK8A 2ZMEC 4HOBA 2FX0A 2PBIA 1QU3A 4JYKA 4XRSG 3S93A 1GV5A 5EGHA 3FKIJ 1XXCA 4WX9A 2E1CA 3K4BA 2Z3YA 3A0HC 3T1BA 1IDZA 2QWWA 2CG4A 3E7LA 3OOUA 3VYRB 4BY7K 5ILVA 2OTJI 1F93A 3OMYA 3V42A 4Y4RA 2V79A 1TNTA 3CMMA 5ERIA 5ICFA 1S7OA 5FLMC 2WAFA 4AVZA 2V9KA 2KIQA 1O25A 1EV7A 1TWFK 2O3FA 2HKXA 5M3FJ 1GLNA 3HOWJ 3FM3A 4F55A 4UUVA 1XG1A 2NVTJ 1AB4A 1TWGK 4KB4A 1Z1DA 1DQUA 1DU6A 1GUUA 2OJED 3KPHA 3L2VA 1JT6A 4C30A 4Y52J 1MH4A 1X3WB 2ZSIB 1H8AC 3OL4A 1P9QC 1WJCA 3HOVC 4U0VA 3VEPA 3H1CA 5JLWA 4A3EJ 3G4SI 2W25A 4XLPF 4KDDA 1B59A 2B7EA 2X6OA 3ROUA 2W7VA 1EK8A 2LDUA 1IV6A 3CMEI 1MBFA 2L7MP 3DTKA 3ZQIA 2KPMA 1FWZA 5D4RA 1U8RA 5EDNA 2GA1A 2X4HA 2BY1A 2FBKA 3TP3A 3IRQA 3PO2C 1O7FA 2PJRB 3LL7A 4IKFA 4ZYEA 2BV6A 1U9NA 4MNUA 4IO9F 1RKTA 1ETYA 4NQWB 1FYMA 5E17F 2J5PA 2OV7A 3HOTA 3A8JA 4PFOA 5IP9J 2ELKA 4LB5A 1XMAA 2OQRA 2WADA 1WJEA 2LD5A 4XLNA 1VFCA 3OYAA 2CJJA 3FBNB 4OMZA 1ZH5A 1ZBSA 4X6AK 2EJRA 3WTXC 1ZRDA 2JPBA 1VZ0A 3PUFA 3V8LA 4FCYA 2QKLB 4BEHA 1XSDA 2PX9A 3WU2C 1R1TA 1SEUA 1NK3P 1OLTA 4DQ2A 1MMNA 2V1NA 2G9WA 5EYRA 4C3IC 5HNFA 1KQ4A 2CQ7A 5IYDJ 3NUHA 4A3FJ 3HOZJ 3GTOK 2LG4A 4L9VA 1V3FA 2K86A 4WXDA 5E3OA 2JA7J 3LA3A 4A69C 4Q4ZF 2WC2A 4G0UA 4RMNA 1DP3A 2R7ZA 2BHYA 1IAWA 2EFOA 2KZGA 4OIRF 5HLTA 4XRMA 4LJZA 3K6GA 2MBFA 3RTRA 1FYKA 3MEXA 1NH3A 2CW7A 1MSEC 2GWRA 3KYLA 2Q8KA 1ETKA 3KP2A 2HI3A 4C9YA 4DZJA 1YJ9I 1Y0UA 4FE4A 4BXXK 2A6TA 3OYJA 1SAUA 4A5NA 4IHWA 4B44A 2DA3A 3QPHA 1F36A 3BT9A 3QU3A 3ZN1A 3CCJI 1A36A 3FX3A 1TWAJ 4C3HJ 1ZHFA 3WGGA 3QP6A 1W0UA 2NYXA 3Q0WA 4LGWA 1Y39A 3S17K 4A3LK 4EV0A 4A3BJ 4GZYA 1I3QA 3K70C 2GSOA 1BDFA 3C3WA 1XZPA 2JSCA 3CESA 2EFPA 1T56A 2KL4A 2MFZA 4EM1A 5B5EC 3T5XA 3SFIA 3T8RA 2MH2A 3HUGA 1F4KA 5HS8A 2V26A 3CQZK 4YG2F 4OAYA 3CCEI 3AAFA 1TWHK 1G6NA 2FA5A 4QSHA 4YEJA 3RQIA 1K6OA 2BGCA 2E71A 3BZCA 2Z33A 2EH3A 1JE8A 5BOXA 3FF5A 2VUMA 2VBZA 2R7ZC 4P1WA 1J6WA 4LLGA 4IVNA 1I3AA 4IRHA 4A0XA 3S1RK 4XKWA 3RZOJ 1MZBA 3H35A 4BQNA 3IP4B 2JA2A 2JPCA 4EQQA 1T39A 1U8BA 2JA5J 1WOSA 1E3HA 3CMYA 1QZZA 2CV2A 3DKYA 2ZJQF 4HSRA 3RPQA 2PLYA 1YIJI 4L18B 4BY1K 1WHUA 2ECBA 3DXJF 4S05A 2QEXI 2D6FC 2LKSA 3PQJA 1SMYF 4GTEA 4A93K 4GTFA 1FZPB 1VH2A 4ITVA 2GAGC 1K83J 5D8KB 4BJ6C 4BH9A 2HDDA 3RI4A 4PCQA 2VN2A 4HQMA 5FKOA 2R93A 1JGGA 5JI6A 2X9DA 4TV7A 4BE0A 3BPXA 1VQ9I 1I3QC 2FMLA 2O61A 3RZDK 4WJ3M 2K85A 1FNNA 2KZVA 2FEZA 5F64A 3FISA 3G4AA 1ZXOA 1Z7LA 1XTAA 1K78A 2ZJ2A 2A68F 4A3IJ 1VQLI 4UUTA 2NVQC 1YITI 4EJVA 5HDNA 3K4MA 5IYBC 3CJTB 4FT8A 1X3UA 4N9IA 2DK8A 2VUMC 1W0TA 1R49A 3KP5A 3ASNH 2W57A 2V6EA 2STWA 4XIDA 4OOIA 1TWCJ 2OCCH 3CP8A 1F9NA 1HXDA 2E19A 3EUKL 5EG0A 2RH6A 1QQIA 4L9TA 4DJAA 1IUFA 3I58A 4IXAA 3L00A 4JK1A 3UR3C 4BUPA 5J1UA 1LUJB 2L02A 2CQQA 5JFRA 3CZ6A 2L4MA 1OCPA 2QKMB 4YRVA 2ZXWH 4RLQA 4HLYA 1WCMA 2L7ZA 3FDYA 2M7AA 2KJBA 3HOSA 4BDZA 3SZTA 2LBFA 3TL4X 1O28A 3RYPA 2LYCA 3N0CA 4WILA 4ON0A 3R0AA 4G7HF 4P9UA 2R93C 2DA1A 2CU7A 4IL6C 2CYYA 2M87A 5TJJA 1R5GA 2DFEA 1G3YA 3BJ6A 5D5VB 3LAPA 3GTMC 4E7LA 4QTRA 3H3VK 3GTQJ 3M1CA 2VL8A 4U0WA 4EJWA 4YFKF 4H4KC 3I4MJ 2DTRA 1PP7U 2R7QA 4KIBA 4RB2C 4M73A 2VOOA 1EFWA 1LDDA 1LDJA 2L7KA 3EYIA 4F91B 3WTZA 5AIPA 2MC3A 1FOYA 3MVPA 4F92B 4CGZA 3ELKA 3M3YC 3F6VA 3JSOA 4Q5SF 2V6SA 3U9GA 3I55I 3HKZL 2W4SA 3W3CA 4NB5A 5FD6A 4Q47A 2RV8A 4B1RA 4CH7A 2FD5A 3DBLB 3DBHB 2V6UA 1ZRFA 2E1NA 5L3EA 4KNYA 1B72A 1MH3A 2LRDA 2YU9J 1IS1A 3HHHA 5DCFA 1WIHA 2EV5A 2XF5A 5D5UB 3REOA 1BC8C 4KA4A 4AYBN 2VJ5A 2Y31A 1PDNC 2E2HJ 1MD0A
chains in the Genus database with same CATH topology
4BNCA 1K78B 1IUYA 4EJOA 5CVVA 2EFNA 1T98A 4OIPF 1HKTA 3ABUA 2CW0F 2GXBA 4UV8A 3K69A 2OU2A 3WTTC 4HX8A 3KLNA 3K9TA 4XSXF 3FM5A 2K27A 5ICCA 4AIJA 4LFUA 4NHJA 3FMSA 1Z91A 1D8KA 3F8NA 5H6RA 1ZAOA 3GUDA 4I09A 2ZFZA 1MJ9A 1F1ZA 3VOEA 4A6DA 3L09A 3BROA 3S0XA 3VODA 3F22A 4U7DA 1REPC 1T6SA 3N0BA 2MA3A 3G73A 2NS0A 5HS7A 1G3WA 3CO6C 4EM0B 1W5SA 1BC7C 1EH6A 1Y1WA 4A12A 3CAGA 1ZN2A 4M9XA 2X0LA 4CO8A 3K2ZA 5KVRA 3TO6A 1I50A 1IN6A 2A07F 3ABTA 4IJAA 2XASA 3M1EA 3ULQB 3CTAA 2OZUA 3J7AO 1ONVA 4WCGA 5K5OA 1U2WA 3WTWC 2M8EA 3I59A 2HTJA 3DP7A 2IT0A 1YQAA 3K1PA 2OAZA 4WK8F 4F7ZA 3GWZA 1BOAA 3CO7C 5LHHA 4C3JC 2L3DA 2XIGA 4HA8A 5LGTA 3E97A 4O3MA 3WODF 4KM8A 5LEJA 5A2QZ 5L3CA 2F5DA 1E2XA 4AIHA 4FHTA 2K4JA 4AD9A 1SAXA 4LK0F 3S2WA 1BN5A 1ZREA 1XCBA 2HKOA 4KASA 3L4KA 5FB2A 4KDPA 1STZA 2Z5UA 4A5MA 2EWNA 1TQPA 2JT1A 4GFQA 4FX0A 3CUQA 1MKMA 3P9KA 4KIFA 3ZP5A 3TO7A 4BLAA 2QVOA 2XROA 3F6OA 2Y75A 4Y17A 3SZPA 4GTLA 4I0BA 1SD4A 5CVUA 4L9NA 1HSTA 5JHUA 3HHGA 4M6XA 2GZWA 1ODDA 2WTEA 4BKWA 1WQHA 2XCRB 2E7WA 4G8XA 2P5MA 2KIFA 4G0VA 2CGPA 2FBHA 2PI0A 4KM9A 1BJAA 1TTYA 2V1XA 2BE5F 2XV4S 3WU0A 3CUQC 4P55A 1TBXA 5CLSA 1RUNA 1USTA 4QWQA 4EJTA 2KIUA 5LEKA 4AIKA 1XGMA 3ZQ7A 3JTHA 5LHGA 2DFIA 1O27A 4P5OA 4HYEA 1O3TA 2H94A 3MWMA 1WQ2A 3HSEA 1PUEE 2P7VB 5HLIA 2VE8A 1WQGA 2Q2EA 1R36A 3M9AA 1LDKB 2DPUA 2EA2A 1ZYRF 3LA2A 2ISZA 2XAHA 5E8IA 3DV8A 2DO7A 2XRNA 1O3RA 4Q48A 2WWYA 2YPRA 4G9YA 2EA4A 2XUBA 2OZ6A 2VC1A 3HTUA 1HQCA 3IC7A 4M72A 2ZKZA 1S29A 2DPDA 4KYWA 4KMAA 3QAHA 3TDZC 1KYWA 4MQVA 2YX4A 4E70A 4OU0A 4HF2A 2IA2A 4MHGA 5CVIA 3U2RA 2QQBA 4KMUX 5FFZA 4LR2A 5K5RA 3DFGA 4KIGA 1QNTA 1WQFA 2ZFWA 4EVIA 4ZH4F 1WI9A 1YG2A 3KE2A 1R5HA 4N9HA 5D6EA 2QQAA 2ISYA 4XRFA 5FFXA 2XAJA 1R1UA 5IT9Z 3WU1B 1J59A 4LB6B 4BHBA 2FNAA 4RGSA 1D8JA 2Y0MA 2GSUA 1D3YA 2VT3A 3C1DA 4ZZDA 4S04A 4KC6A 3ML6A 3R60A 3IHUA 1CF7A 3RJPA 1MDMA 3M8FA 3L4JA 2O6GE 3HSFA 1ZLJA 5DUIA 2Y3PA 3LA7A 1YIOA 3W6JB 2ZMEB 2RQPA 3LFKA 2UXXA 4AVPA 2FQ3A 3I53A 3BY6A 3RKYA 4UVCA 1RUOA 2ZBKA 1H0MA 5ILUA 4KN7X 2P6SA 2Z99A 3WGHA 1YLFA 4GXOA 3PFIA 1XDUA 2VONA 1ISEA 1B4BA 2HR3A 1OPCA 5A2QK 1SD6A 1IN7A 5D5WB 2E2IA 3Q5FA 2DT5A 4GTDA 1TW2A 1KU7A 1BI1A 2ESNA 1T2KA 1ZVUA 2K02A 4BXUA 2LSOA 2VE9A 3GFIA 1K79A 1EH1A 1ZG1A 3KZZA 1BJTA 4I7HA 1AOYA 2AXLA 4I98B 2ZO4A 4EMSA 2VC0A 1Z9CA 3GTJA 1EH7A 4XBFA 1JXSA 4LMYA 2ADUA 2GIVA 2VOPA 2MD5A 2PJPA 2YR2A 3Q9SA 4PDKA 3ZMUA 1FOKA 4L0YB 1U3EM 4HQEA 3SXYA 3GTKA 2KIMA 3DF8A 4N0BA 3GTGA 3IWFA 3LQRA 4ENNA 3U1DA 3HSRA 1EH8A 2HOEA 1FY7A 2VBXA 1FC3A 5JFEA 2NVYA 5TJ3A 4MQ9F 5LHIA 3ZMTA 1J9IA 3FXRA 2VODA 3O2PE 2M30A 2RVCA 1P6RA 3V7SA 3O3KA 2UXNA 4ENKA 4QLCU 1G4DA 5IOSA 3H3UA 4M6YA 5D4SA 4UV9A 4HAMA 2RGRA 1OYWA 1UFMA 4MGRA 1U6GA 3LWFA 4LLNA 3MZHA 2KJCA 4WXHA 3SQNA 4DNCA 3ZMVA 3COAC 3KEOA 3GTMA 1LJ9A 3AQOA 3FKIA 3RIRA 1FPQA 5E18F 3WE3A 3R4KA 4LK1F 4U0YA 3ECOA 5E1WA 4P96A 2CQKA 3F8CA 5FGMA 5L3BA 4A0YA 1DPUA 3MZYA 1FBQA 2F2EA 1AWCA 2G7UA 5DD4A 2MLKA 3F8BA 4LD5A 1LNWA 1FP2A 2LNBA 2RKHA 2DU9A 4O6JA 1B9NA 5JR3A 3RYRA 1O3SA 1XDSA 3R0JA 2JA6A 5HDKA 2H09A 1ZRCA 3SFZA 2H27A 4B09A 2HFHA 1S3JA 1IN5A 2HTSA 3AQPA 2R92A 1LQ1A 2A3SA 1KGSA 3MCZA 4IF4A 3E5UA 1OR7A 2P8TA 3K0LA 1TLHB 4GYIA 3HRUA 4FX4A 4ZYGA 1ON2A 3PQKA 1IXCA 3VA7A 2RNJA 1U5TA 4OINF 2IW5A 5HVQC 2HYFA 2V9VA 1XXAA 4M71A 3F21A 2JA7A 4HZFA 2H6BA 2K7LA 2PG4A 5IT9K 1BI3A 2EFQA 3N3YA 3FOFA 3FOEA 2V6CA 5FO5A 4O5VA 1R58A 4P5BA 3GEZA 4RGRA 5BS6A 1GHCA 1VTNC 4HF1A 3LPXA 4Y15A 4EJUA 4P9FA 2EK5A 4ENMA 2BBYA 1J5YA 3GFLA 2P5LC 3HYIA 4AWXB 4KARA 2DK5A 3P9IA 2D45A 1U5TC 3WG9A 3CUOA 1FSHA 2BEOA 4YIIA 3TDUC 1IN8A 1I27A 3FXQA 5BMZA 3H92A 2JA5A 1QZYA 5IORA 2P5KA 3GVAA 3EQLF 2VT2A 4EGZA 3K1NA 5LRSA 2HDCA 3IL2A 1K83A 1J0RA 4C3HC 2QM3A 4LQYA 1KQ8A 4UXNA 2A6HF 5K5QA 5LBQA 1JHFA 4ILDA 1IRFA 3C18A 3RKWA 1O2AA 4G7OF 2STTA 3DQVC 2P5VA 2XAFA 2KRFA 4LG0A 5H20A 2QBYA 3I64A 1RI7A 4HF0A 2OBPA 4P5AA 1TWCA 1YTYA 1F5TA 1E17A 2GSNA 1SD7A 3KP6A 1FBUA 4ENJA 3L2CA 2WV0A 4MEYF 4GO1A 4BYYA 4IHSA 5F6FA 4FZBA 4JK1X 2B63A 1H9TA 1LEAA 1BIAA 3GTQA 3F8FA 1W7PA 2ZNYA 2W85A 4RGUA 1WSUA 2K4BA 1T38A 2F5FA 3ZMSA 3ERED 1ZG5A 3GLXA 1RNLA 5D8LB 1P92A 5DCMA 4CYDA 1C0WA 4HX4A 3IRRA 6PAXA 3I59B 5EEHA 2YU9A 4ESJA 1LB2A 2CFAA 2XKOA 5EEGA 2E2HA 1UB9A 2M1BA 5HOOA 3VB2A 1BM9A 2HQNA 2CO5A 1R1VA 1GVJA 3H3ZA 2QZ8A 2QLZA 2A69F 4RB0A 3RDIA 1P2FA 2DAOA 1KU2A 2VXZA 4KUMA 4DDQA 4OMYA 1KA8A 2B0LA 2DLLA 1BIBA 3GW2A 1J2XA 2FXAA 3OEPA 3G3ZA 2GAUA 2YX7A 4UVAA 3TGNA 4G0WA 2FMYA 3RKXA 2HEOA 1FT9A 3CDHA 1DP7P 3VFZA 5ICEA 4CICA 1HW1A 2PMUA 2P6TA 2GQQA 3CUQB 3GZ6A 1BI2A 1ZGJA 3R61A 4JBAA 1SFOA 3V7CA 3R6SA 1OYIA 2FNPA 3WTUC 4L5JA 2GA2A 4RAZA 1ZARA 4BHPA 3KFWX 1O2BA 1XB4A 3F72A 4U88A 5HS9A 1Q1HA 4I01A 3T8TA 1ON1A 4U7BA 2YU3A 3EYYA 2A61A 3Q3QA 5IT3A 1KQ0A 3L7WA 2XCOA 3V8JA 5E1XA 1HKQA 4I02A 2DQLA 3TO9A 2KWAA 3IWZA 1B4AA 1NHAA 2FRHA 2XHKA 2O8XA 4KAWX 1R00A 1S6LA 3FHZA 3JAMZ 4BLBA 1FSEA 1WKMA 5BPDA 3P7NA 2EV0A 1O26A 5H6QA 2L4AA 4EGYA 5J6XA 5DDGA 2VBWA 1UHWA 2D1VA 2M5WA 1JGSA 1QO0D 5L3FA 3E6CC 4ZYHA 5D6FA 3DPTA 2HS5A 4WXCA 2XAQA 3O6BB 3G4CA 2F5CA 5LLQA 4NQWA 2EB7A 2DBBA 2XVCA 2UWMA 3NEUA 4UHTA 1HW5A 2L54A 3EETA 2H6CA 2COMA 5K1YA 2LKPA 1I6XA 1MJAA 3D0SA 4C2MC 3CLOA 1G3TA 1D5VA 1W4MA 1DPRA 1SFEA 2AS5F 1IF1A 4Z2YA 3MMLB 3J80Z 1ZG3A 2CFXA 1DUXC 1RZ4A 4BAYA 1TW3A 1USSA 3JTGA 4OIQF 2KKOA 4PGGA 1XSVA 5LGNA 4UNOA 2QUFA 1O57A 3TOAA 2XKPA 1WRJA 1BBYA 3F3XA 3B02A 2DQRA 1R23A 4A6EA 1B1BA 1T0FA 3ZN0A 3E5QA 1HW2A 5AONA 3FZVA 3OOPA 3E6BA 2LF7A 3GTPA 5FD5A 5DV5A 1R7JA 3H0GA 3BJOA 1XGSA 2MH9A 1ZLKA 1Y1VA 3MQ0A 3Q9VA 3RPUA 4K2EA 4I2OA 3E5XA 3J81Z 1DD5A 4KMDA 3MAJA 3E6DA 2D1HA 3NRVA 1CF7B 1MDMB 2ACJA 2HYGD 5HDGA 1Z05A 1JHHA 3C7JA 1KU9A 3KLOA 2XCQA 3LSTA 1SFUA 4XLNF 3GTLA 1LEBA 4M1XA 1KQ9A 2O03A 1YYVA 4ASNA 3KP7A 5IOTA 1DDNA 2UZKA 2Z9OA 2PFBA 2FF4A 5FLXZ 1XGNA 4GTAA 1B6AA 1MGTA 1Z7UA 3W6KB 4LJZF 5ICGA 4CZZA 1LVAA 2IVMA 4R8HA 4RB3C 2W84A 2JTVA 1QPMA 3HRTA 1R9TA 4ESBA 2PQ8A 4GYGA 2XAGA 1UHMA 2RDPA 4PGHA 4HDUA 2PHCB 1J75A 3K1MA 3T0YA 4ESFA 2HZTA 1BGWA 4Y13A 5JVOA 3FMQA 4LLLA 2DW4A 5HLHA 3WGIA 3FXUA 3M8EA 3TOBA 1TQIA 2IA0A 1HBXG 2ETHA 3SHFA 4GTBA 5ED4A 3ZMDA 1YS6A 1B9MA 4LLGF 2IP2A 2HQRA 3F8MA 3JSPA 4CDGA 2P4WA 2NAZA 5TRDA 1I5ZA 4G94A 4L9JA 1I1GA 2ZNZA 4GT9A 3KETA 2PEXA 3BPVA 1WWXA 3OV8A 3WTVC 2A6EF 2OA4A 4HX7A 2IJLA 1PP8F 1O7LA 4G6DA 5L3DA 4A2UA 1MJBA 1P4AA 4JQFA 3D5LA 1V4RA 3OPFA 4M9ZA 3JAMK 4BQAA 1YW8A 3V8KA 1KU3A 2QYOA 5DYMA 3DKWA 1S7AA 5E8GA 3HRMA 3HRSA 1YFHA 2L01A 5DUKA 4KN4X 1A04A 3KEQA 5L3GA 5F1RA 1IRGA 5E20A 4IPAA 1P4WA 3TKYA 4M74A 3E3VA 1RIOH 5AIQA 5D5XB 2DI3A 3IKTA 4RS8A 2NNYA 4L5IA 1XXBA 1GE9A 1TWAA 3BDDA 3ECHA 3J80K 1G3SA 1TWFA 1H9GA 1GXPA 3TQNA 4L0ZB 3LQQA 5LGUA 2QENA 1TWGA 5E1ZB 3GFMA 4HLXA 4G7ZF 1HSJA 2P7CB 4IRIA 1BI0A 2G7HA 3ZMZA 3I4PA 2HGCA 3I5UA 3DPLC 2IA1A 3DEUA 2CSOA 1L3LA 2EV6A 3QPTA 3B73A 1Z6RA 1U5TB 5DEQA 5ILSA 2J5OA 2Y48A 2A5YB 3GYHX 2QQ9A 4UVBA 3KP3A 4BHCA 4YIFA 2TDXA 3QRFF 1OYYA 5BQTA 4B8XA 2M45A 4J3NA 4KATA 2IRFG 2FU4A 3HTSB 1K7AA 3GZ5A 3J81K 4YFXF 3GTOA 4WWCA 1U78A 4D0PA 1IW7F 1O3QA 1XCVA 4HV5A 4YFNF 3WTSC 2PMHA 2RN7A 1O29A 1R22A 3BP8A 3FWEA 1TQMA 2GXGA 2JH3A 2PN6A 1TNSA 5DD8A 1YW9A 5J8CA 3V7RA 1XN7A 2V1DA 3WE2A 4RGXA 2FBIA 4HDVA 1IZ1A 3I54A 1KYZA 2HWVA 1ULYA 4HV6A 1W5TA 1FP1D 5FLXK 1UCRA 2W24A 3ISPA 5CJ9A 4HW0A 5KK1A 5LRRA 2ZXJA 3IKVA 3CQZA 5CVRA 1TWHA 3I0TA 5BPIA 4HBLA 4H0EA 1W7PD 2XGXA 2FSWA 1FYLA 4KFCA 5CVJA 1FX7A 3GXOA 2ELHA 1S8NA 2F5EA 4MTEA 3BZ6A 1XGOA 2IPQX 3N97A 4MTDA 1IXRC 1OMIA 1J7KA 1YW7A 2NRAC 4GCVA 2OD5A 2FE3A 4ETSA 4IRGA 2EFWA 2Q0OA 4LG0B 1IXSB 2CWEA 2QBYB 1XMKA 5CYVA 4KMHA 3N4MA 2YSRA 3GX4X 2NVXA 2R7FA 4RB1A 4FM9A 3BOQA 1YO5C 4GGGA 4KT5C 4KICA 3WTYC 2RGVA 4RAYA 1XSXA 3M7GA 3FMRA 2VBYA 1SFXA 4I0AA 2FOKA 3GFJA 1W7PB 1Z6TA 3QU6A 2MLGA 3P9CA 4KMFA 5HLGA 3BUEA 2RC4A 4ZZLA 2OQGA 5CHPA 1OKRA 5DCMB 3EUHA 3V4GA 3BWGA 3LAJA 5IOQA 4WF2A 3AH5A 2CFAB 4CHUA 3QOPA 3KZYA 3NQOA 1ZGAA 2JRTA 1CGPA 3E6MA 3I71A 2BYVE 2O0YA 4ZYDA 4MEXF 1XD7A 2R3SA 4OIOF 4R79A 1O24A 4G6QA 1FBSA 3HIFA 2ZCWA 4R1HA 3QX3A 3GF2A 2ESHA 3CJNA 2ZMEA 1SMTA 4PZJA 1QGPA 4XSZF 2LF8A 3KCCA 3OREA 3KP4A 4M9SA 3QP5A 1SD5A 3EDPA 3GO5A 3BJAA 1YS7A 2R7DA 1P4XA 3L9FA 5J8FA 3JW4A 1I1SA 5JVTA 2NNNA 3F23A 4CXFA 3MFKA 2V1UA 2D2WA 4A0ZA 4EM2A 1FLIA 1L0OC 3ZPLA 2E7XA 1QBJA 2C6YA 4IHTA 4KB2A 1GXQA 1IN4A 5EGEA 1HKSA