3V4GA

1.60 angstrom resolution crystal structure of an arginine repressor from vibrio vulnificus cmcp6
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
151
structure length
145
Chain Sequence
KQDNLVRAFKALLKEERFGSQGEIVEALKQEGFENINQSKVSRMLTKFGAVRTRNAKMEMVYCLPTVSSSLRELVLDVDHNQALVVIHTGPGAAQLIARMLDSLGKSEGILGVVAGDDTIFITPTLTITTEQLFKSVCELFEYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title 1.60 Angstrom resolution crystal structure of an arginine repressor from Vibrio vulnificus CMCP6
rcsb
source organism Vibrio vulnificus
molecule tags Dna binding protein
total genus 51
structure length 145
sequence length 151
ec nomenclature
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v4gA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3v4gA02
1IN8A 3L09A 1FPQA 3E6DA 1YW9A 4UV9A 3CO6C 1ON1A 4A0YA 3L00A 3KP6A 4J3NA 3ZQ7A 1XMAA 1Z6TA 3T1BA 2A69F 1BBYA 2IPQX 1B4BA 3HYIA 5L3CA 4MTDA 2OQGA 4ENMA 3DFGA 4HF0A 1ZYRF 1IXSB 2XCQA 5JFRA 2O03A 2F5DA 4XSXF 2UWMA 3K0LA 1WI9A 2ELHA 4O6JA 4RB1A 4KC6A 1E2XA 1SD4A 2FRHA 4LG0A 3HTUA 3QU3A 4ETSA 1Z91A 1G6NA 2BE5F 4HQMA 4IHSA 5LHGA 1QZZA 4RGXA 2P5MA 2O8XA 2L54A 2DQRA 1ODDA 2LNBA 1JXSA 2F2EA 2NRAC 4EJVA 1MDMB 1KYWA 3DV8A 2HKXA 4L9JA 1G3YA 3E6MA 2NNYA 3P9CA 4HDUA 1W5SA 3QU6A 1BIBA 3O3KA 5K5OA 4FHTA 2Z9OA 1FC3A 1IF1A 1U3EM 3BY6A 5ICGA 3JSPA 2RQPA 4O5VA 1LQ1A 3GF2A 4M71A 1RUNA 5L3GA 1SAXA 3C18A 3MMLB 2K27A 1VTNC 3RYRA 1BN5A 1J2XA 1O3TA 4MTEA 3E5QA 3NRVA 3E3VA 2H6BA 2R7DA 3NUHA 3FOEA 5FD6A 2XGXA 1SFEA 2FNPA 1JHFA 1HW1A 3E6CC 3HRSA 5H6RA 2FXAA 2OBPA 4LLGF 2JPCA 2FA5A 3KFWX 2HTJA 1G3WA 2HDCA 2DO7A 2D2WA 2GXGA 5LGNA 2TDXA 4AWXB 3DPTA 3E5UA 2KIFA 1DD5A 1UB9A 2ETHA 4QLCU 2K7LA 4HA8A 5HLIA 3KZYA 6PAXA 2IA2A 1FBUA 2RKHA 4H0EA 5LGUA 1KU7A 1FWZA 3VODA 1S29A 2R3SA 5E17F 1O7LA 1YG2A 2PBIA 2QWWA 4M72A 1AWCA 4BHPA 5L3DA 3WGHA 4IHTA 3BP8A 1XSXA 1WRJA 3I59B 3BJAA 2MLKA 2HTSA 2STTA 2BBYA 3FMQA 3WGGA 1CF7B 1IN5A 4RB3C 3L2CA 4MQVA 2OZUA 4YFKF 5IT9Z 4ENJA 5HS8A 1LEAA 3F8BA 2JPBA 4HV6A 4MGRA 3D5LA 4KICA 1K6OA 3I54A 2LSOA 3V7RA 3LSTA 1P4XA 2EFNA 3WG9A 2L02A 2UZKA 3BJOA 4FX0A 3CUQB 3LA7A 2DK8A 2ZJ2A 2HOEA 3ZPLA 1BIAA 1MKMA 2RGVA 5JVTA 2GIVA 4E70A 4AIHA 1HKQA 4LLNA 4CXFA 3F6OA 4HX7A 5CJ9A 4ZYEA 1XSVA 1YW7A 2FNAA 4M9ZA 2GAUA 1DDNA 4I2OA 4S04A 3HRUA 4D0PA 3EQLF 2OU2A 3GFLA 3CUQC 3HIFA 2G9WA 5LRSA 5FLXZ 4WF2A 4U0WA 3KEQA 1IN6A 1SMTA 4DNCA 1I27A 3KLNA 4BHBA 2FBHA 3F21A 2ADUA 2ISZA 1QO0D 4LMYA 1XXCA 1U5TB 1REPC 1MD0A 3AAFA 4KB4A 2EA2A 4XSZF 3I0TA 2BGCA 3ROUA 3JAMZ 4AIJA 4I01A 1ZG1A 2Y0MA 2HYGD 1SMYF 2QZ8A 4NB5A 3QRFF 1U5TC 4RAYA 1R1VA 4R79A 3I5UA 1MGTA 1W5TA 2VT2A 4HZFA 3O6BB 3DP7A 3LPXA 2V1UA 2HEOA 1BI3A 5F6FA 4PGHA 1FP2A 1WQGA 4FM9A 1R5HA 2ZBKA 3DKWA 1O3RA 5A2QK 5K1YA 4L5IA 4L18B 4OU0A 4HX8A 4KA4A 2P7VB 2RC4A 5D4SA 2Q8KA 1O57A 4KT5C 4I09A 4P55A 5E1ZB 3MQ0A 2DK5A 1YIOA 2K02A 2MD5A 3HRMA 5ILVA 4A6DA 1H0MA 4EM1A 4LD5A 2O61A 4HAMA 4BHCA 4XBFA 5D4RA 1SFXA 3K9TA 3DEUA 3GO5A 1HKSA 2HQNA 3COAC 3FXUA 2HR3A 4MEXF 3BPXA 1OR7A 2KJBA 3KETA 5L3EA 3QOPA 4WXHA 3WTZA 5E1WA 1FSHA 3VOEA 2HKOA 1YFHA 3F3XA 4NHJA 1K7AA 3ECHA 5DUKA 2RV8A 2RGRA 2D1VA 5J8CA 1PDNC 3JSOA 4UNOA 5BOXA 2DU9A 4CHUA 4WK8F 3RIRA 3VA7A 1H9TA 1P2FA 3WTWC 2XASA 3MAJA 2WTEA 4F7ZA 2NNNA 4EMSA 3BWGA 2BYVE 2PHCB 1U6GA 1YTYA 3R0JA 5LRRA 3WTSC 4B09A 3QP5A 1RI7A 4M9SA 2CWEA 2Y75A 3LAPA 2MH9A 1IRFA 2QQ9A 2DLLA 1RZ4A 4MNUA 2EFOA 3FOFA 5TJJA 2GA2A 3WE3A 3FZVA 4Q4ZF 1XXAA 1FBQA 4Y17A 2GQQA 2O3FA 2GZWA 1BC8C 4G6QA 2PQ8A 3SXYA 2YX7A 2VOPA 5JI6A 3LAJA 4BXUA 3GW2A 1ZHFA 3C3WA 3WTVC 1EH6A 4UV8A 1FNNA 3GWZA 4WX9A 4ENKA 2P6TA 2FQ3A 3ZMUA 3TGNA 3I64A 4A0ZA 2EJRA 1FLIA 2VC0A 2ZFZA 3EDPA 1R22A 1W7PA 3DF8A 4IF4A 4L9NA 4JBAA 1ZVUA 4EJUA 3RPQA 1UFMA 1C0WA 2FE3A 4G7ZF 2YSRA 2AXLA 4QWQA 3LWFA 1OYIA 2W24A 5ILUA 2XIGA 2EB7A 4EM0B 3W6JB 3FXQA 3CUOA 5D5UB 1GHCA 4Z2YA 2F5EA 3W6KB 3EYIA 3IKTA 1LDJA 3VFZA 4KB2A 4OMZA 1KU9A 3K1NA 1EH1A 1HSJA 4P96A 5DCMA 5H6QA 5JVOA 3IRQA 1S3JA 3GFIA 3I71A 4PCQA 1DPRA 4IRGA 4GO1A 2P4WA 4CO8A 1BJTA 1RUOA 1YYVA 1LVAA 4PDKA 2FBKA 2KRFA 4G7HF 1LB2A 2RDPA 4HW0A 1XMKA 3M9AA 1ZARA 1Z1DA 3SQNA 4OIPF 5CLSA 4ASNA 4WCGA 1Z9CA 4ESJA 1D5VA 4KNYA 1BI0A 3E97A 4DDQA 5F1RA 1R1UA 2E1NA 5CVUA 1SFUA 1J5YA 3G3ZA 2IW5A 5DD8A 4Y15A 4U0VA 3TO9A 2O6GE 4R8HA 2YPRA 4HX4A 1G4DA 3QPTA 5LEJA 3GXOA 2DW4A 1HXDA 3GUDA 2RN7A 4RGRA 5J8FA 1T98A 1TQMA 3PQKA 2DQLA 3ZMDA 4A5MA 3KCCA 2K86A 1WQHA 4KIGA 4JK1X 2HGCA 1HKTA 3KP2A 1S8NA 2GA1A 3IL2A 1DP7P 3V4GA 3E5XA 4GYGA 3SFZA 4CICA 3IHUA 3RJPA 2Y3PA 3OV8A 3M8FA 4NQWA 4ZZLA 4IXAA 5L3FA 1GXPA 4HV5A 3ABUA 1FX7A 1XGMA 1R5GA 1P92A 3J81Z 5ED4A 1F4KA 5FB2A 1L3LA 2ESNA 2HS5A 3TQNA 2A5YB 1T2KA 3U9GA 1YLFA 1ZAOA 1D3YA 1H9GA 2D1HA 2XAHA 3OOPA 3TO6A 4YFXF 4YIFA 4RB0A 3GVAA 1EK8A 3R60A 2XROA 2QQBA 5DCFA 3KEOA 4CDGA 2R7FA 1S6LA 2A68F 4LGWA 1OPCA 4EVIA 2MA3A 4L0YB 1XN7A 1OYWA 1DPUA 2CYYA 1LNWA 2V79A 3ISPA 3WTXC 5JR3A 3MZHA 3ECOA 5HVQC 2KKOA 5D8LB 2JSCA 3F8NA 1QPMA 1B59A 1U8RA 1ON2A 1ZLJA 4WXDA 2EFQA 5D6FA 4AIKA 3U1DA 2MBFA 3GYHX 3RPUA 2P5KA 2WC2A 5IT9K 5LBQA 3M8EA 4M9XA 1KQ8A 4U88A 2M87A 5KVRA 3EUHA 3QPHA 1KU3A 2W57A 3T0YA 5E20A 2ZNZA 3TOBA 3ELKA 4M73A 1R1TA 3IC7A 3MEXA 1RNLA 3ZMZA 4B8XA 1JE8A 1LJ9A 4KIBA 2F5FA 5EEGA 4I98B 2VODA 2LF7A 2IA0A 4LJZF 1I1GA 1IN4A 3F8MA 3T8TA 3CO7C 5EEHA 2W84A 1FYMA 4ZH4F 5K5QA 1BOAA 3K1MA 2XCOA 1J75A 1ZREA 3D0SA 5FLXK 2QBYB 1O7FA 2KWAA 2H6CA 3QX3A 5J6XA 5BMZA 4L0ZB 1BM9A 3GFMA 2F5CA 3TKYA 4A6EA 1JGSA 2LF8A 3WODF 3JAMK 3PFIA 3P9KA 2FEZA 2ZMEB 3WU1B 3ZN0A 4WWCA 2L4MA 1ZG3A 4G6DA 4HLYA 1GXQA 1IXCA 2FMYA 3N97A 1L0OC 5DYMA 4KIFA 4Q47A 3TOAA 1B9MA 2Q0OA 1MDMA 3EYYA 1T6SA 1R23A 3IKVA 2CFXA 4PZJA 2X0LA 2DAOA 2STWA 3CAGA 1K78B 1R00A 5BPIA 2P6SA 2HYFA 3K69A 1EH8A 2J5PA 3BZ6A 5HDNA 5CVJA 1BJAA 2FOKA 3FF5A 3Q9VA 3HSRA 3MFKA 3L4JA 2XAFA 3U2RA 3VEPA 5AONA 4IPAA 2ZO4A 4CYDA 1D8KA 4XLPF 3I4PA 5ICFA 3RKYA 2GXBA 2XKOA 2VONA 4OINF 3TDZC 5HDKA 4U7DA 2XAGA 4RGUA 4GGGA 5ERIA 4KFCA 1HQCA 4A12A 1TNSA 1HBXG 4KUMA 4UHTA 3WE2A 4LG0B 1IUYA 4HQEA 4WXCA 1QNTA 1Q1HA 5HDGA 1YO5C 1U78A 3ZMVA 2EA4A 2XVCA 1X3UA 2OA4A 3S2WA 1GVJA 1J59A 2VBZA 4G94A 3BJ6A 1T39A 2C6YA 4A2UA 4BH9A 2OZ6A 5D6EA 1XDUA 4G0UA 4EV0A 3NQOA 4OIQF 3F6VA 2V6CA 1BC7C 3M1EA 3I58A 4G7OF 4HF2A 2JRTA 3N4MA 3EETA 4P9UA 3Q9SA 1LDDA 3I59A 2Z33A 2XAJA 4FT8A 3OEPA 1FZPB 3IRRA 4KDDA 4LLLA 3V7CA 4CGZA 1RIOH 5ICCA 2DBBA 3T5XA 3LQQA 1MJAA 1CF7A 1DUXC 2EV0A 5FFZA 2CSOA 2H09A 4JQFA 5E8IA 5L3BA 4EJOA 4ESFA 1IAWA 2QUFA 3C7JA 3J80Z 3MWMA 3HTSB 3CUQA 1STZA 1HW2A 2B0LA 2Z3YA 3NEUA 3V7SA 2VBXA 2EK5A 2IVMA 4RGSA 5JHUA 4ENNA 4YIIA 5HS9A 2M5WA 3HSFA 2MC3A 4HLXA 3FMRA 1P6RA 3HHGA 3SHFA 4KN4X 3ULQB 5IT3A 1XXBA 4LB5A 2P5LC 4MHGA 4HOBA 2VC1A 2WV0A 3ZP5A 4AVPA 4M6XA 1UHWA 2BV6A 2VE8A 4IVNA 3WTYC 3HRTA 4L9VA 3V8JA 1B6AA 3O2PE 3Q5FA 4KDPA 2PMUA 5TRDA 2P8TA 5LEKA 1ZGJA 5ILSA 3P9IA 2IT0A 1B9NA 3DXJF 2J5OA 3GEZA 2CGPA 2QM3A 2XHKA 4ZYHA 1UCRA 1W4MA 2IJLA 3WTTC 3QP6A 2Q2EA 3IWZA 2CW0F 1XCBA 1BGWA 4A5NA 5FO5A 3DPLC 4KYWA 4O3MA 3BROA 3HOTA 3OREA 4FX4A 4I7HA 3SZTA 1MZBA 2XRNA 3MZYA 3RYPA 3R61A 1MJ9A 3FWEA 2W85A 2PJPA 3CJNA 2H94A 1B1BA 4UVAA 2D45A 3KP5A 1ISEA 3BPVA 5ICEA 1Z05A 1JHHA 5E1XA 3FMSA 5H20A 1WQFA 5HLHA 1AOYA 5AIQA 4U7BA 1F9NA 1XCVA 3ZMTA 2CQKA 3E6BA 3WGIA 1F5TA 2M45A 4L5JA 2QYOA 1R58A 1TLHB 2EFPA 3KP7A 5AIPA 1ULYA 4EJTA 1S7OA 2Z99A 3JW4A 3J81K 1R36A 4N9IA 2ZCWA 4MEYF 4DQ2A 1WKMA 4G9YA 2L3DA 1KQ0A 2OD5A 1EV7A 2AS5F 1IXRC 5E8GA 2YX4A 5HLGA 1FOKA 4BYYA 3HOSA 3L9FA 1KYZA 2OAZA 4LK0F 3B02A 3TO7A 4K2EA 2FMLA 2IRFG 3I53A 5FD5A 1ZLKA 5DD4A 3REOA 1NHAA 1XDSA 5CVIA 4Y13A 3HUGA 3OPFA 1KGSA 2QENA 3KLOA 4I0AA 1WIHA 1IRGA 5DDGA 4OMYA 4M74A 2MLGA 4XLNF 3L7WA 1J0RA 1YW8A 5D8KB 2ESHA 1WWXA 1FYLA 5BS6A 3ZMSA 1P4WA 5BQTA 2P7CB 4KMFA 4G8XA 2M30A 3RTRA 3MCZA 3RKXA 5LGTA 4RAZA 1T38A 4G0WA 1SD5A 2FF4A 4N0BA 4N9HA 1O3SA 3KP4A 1J9IA 4GCVA 1YS7A 4BAYA 4TV7A 2DPUA 2P5VA 3B73A 3RKWA 1PP7U 2QVOA 2VBWA 2JT1A 2DFIA 3JTHA 1XD7A 3FM3A 2PLYA 3F8FA 3LQRA 1PP8F 1G3TA 3GFJA 2XV4S 2ISYA 2VT3A 1V4RA 2CO5A 1ZRFA 2VN2A 4ESBA 2YR2A 2VBYA 2DI3A 2Z5UA 4HF1A 2UXNA 3JTGA 3L4KA 3LA3A 1ZH5A 1ONVA 2HWVA 4M6YA 4UXNA 1E17A 3F23A 1TNTA 5LHHA 1ZRCA 2HQRA 4EM2A 2M1BA 3FHZA 1GE9A 1Z7UA 3R4KA 3V8KA 4OIOF 4YFNF 1QBJA 2K4BA 3QAHA 1XSDA 1J7KA 4G0VA 1W7PB 1G3SA 1XB4A 3H92A 1TBXA 4RS8A 2NYXA 1D8JA 2OQRA 2KIUA 1B4AA 5E18F 1PUEE 3VB2A 5CVVA 2EV5A 2NS0A 1F1ZA 3ABTA 4KN7X 2G7UA 1LEBA 1XGOA 1USTA 1ZGAA 4OOIA 4IRHA 2DT5A 2PG4A 1IN7A 2GWRA 4Q48A 3ZN1A 5LLQA 3CDHA 4ZZDA 3C1DA 2G7HA 5DEQA 3BDDA 5DCMB 2V9VA 4HDVA 3BOQA 5BPDA 1I5ZA 4CZZA 4LB6B 3CTAA 1Z6RA 4A0XA 2A61A 5FFXA 1QGPA 2L4AA 2V1DA 2IP2A 2PFBA 1FP1D 3TDUC 3K2ZA 3GLXA 5LHIA 2L01A 3BUEA 4BQAA 4XRFA 2A6HF 5D5WB 3RI4A 1UHMA 1XGSA 2UXXA 1W7PD 1QZYA 2LKPA 1U2WA 3R6SA 4HYEA 2IA1A 4PGGA 4ZYGA 1R7JA 2ACJA 3KE2A 5KK1A 3SZPA 4BNCA 2Y48A 2ZNYA 2PMHA 1MJBA 2JTVA 5A2QZ 1K79A 1YS6A 3G73A 1S7AA 1CGPA 2H27A 1KU2A 4IJAA 2K4JA 2XAQA 2XKPA 1OMIA 4AD9A 2BEOA 3WU0A 2XUBA 1SD6A 1T0FA 2O0YA 3K1PA 3F8CA 1SD7A 2JZYA 3R0AA 3GX4X 1YQAA 3V8LA 1AB4A 1FBSA 3WTUC 3HSEA 4GYIA 5DUIA 1P4AA 4KMUX 1FY7A 1WSUA 1KA8A 4UVCA 1BI1A 3DQVC 2DTRA 2XCRB 1USSA 1Y0UA 1IW7F 2EV6A 1O3QA 4L9TA 4IRIA 4KAWX 3T8RA 3GZ5A 2DPDA 4S05A 1LDKB 2FSWA 3F72A 4U0YA 2KJCA 2COMA 2A07F 1TTYA 3H3ZA 2LDUA 4OIRF 2E7XA 2ZKZA 5D5XB 4I0BA 4ZYDA 4UVBA 2V1XA 1FYKA 3CLOA 1I1SA 2VOOA 3IWFA 3LA2A 1OYYA 1HW5A 3J80K 4P5OA 4R1HA 1IS1A 1TW2A 1A04A 1I6XA 3HHHA 2A6EF 5D5VB 4EQQA 2PN6A 4EGZA 1ZRDA 1IZ1A 4P9FA 4EJWA 5CYVA 5CVRA 5FGMA 5HS7A 2E1CA 1TQPA 2KIMA 2FU4A 3H3UA 4UUVA 1OKRA 4Q5SF 3P7NA 3KZZA 2W25A 4MQ9F 2VXZA 1TQIA 2EWNA 2VE9A 4I02A 2HZTA 2WWYA 2QBYA 1ZG5A 1QQIA 4GFQA 3RDIA 3F22A 1EH7A 1BI2A 5HOOA 2E7WA 2RNJA 3KP3A 1TW3A 2A3SA 4RB2C 5F64A 2NAZA 1V3FA 4YG2F 2PI0A 2FBIA 2QLZA 3LFKA 1WQ2A 2ZMEA 3FX3A 3FXRA 4EGYA 2ZXJA 5K5RA 1U5TA 2QQAA 4LFUA 2M8EA 3M7GA 4ON0A 3ERED 1XGNA 1FT9A 3PQJA 1FSEA 2X4HA 2MH2A 3FM5A 4GXOA 2PEXA 2HFHA 3GZ6A 1HSTA 3J7AO 4HBLA 3ML6A 1ZN2A 2ZFWA 2RVCA 2CG4A 5DV5A 4LK1F 2EFWA 1K78A 2YU3A 1KQ9A
chains in the Genus database with same CATH superfamily
2JA2A 1IN8A 3L09A 4E4HA 1FPQA 3E6DA 2K9QA 4A3FK 1YW9A 4UV9A 1I3QA 3CO6C 4D9JA 3MMYB 1ON1A 3CCSI 5FLMC 3EUAA 4E7JA 1Z21A 3HOVC 4A0YA 3L00A 3A4CA 3KP6A 1SEUA 4J3NA 4HSRA 3BG7A 3ZQ7A 4DBQA 3HKZA 1XMAA 1X4OA 1Z6TA 4XLEA 3T1BA 3N0BA 2A69F 4F55A 1FIAA 5H2FC 4W1UA 4HNUA 2H1KA 1BBYA 2IPQX 3S3NA 3DKXA 3QODA 3HYIA 1B4BA 3CZ6A 5L3CA 4MTDA 2HNHA 2OQGA 4MEYA 2NVXC 1EFWA 4ENMA 3DFGA 2KLOA 4HF0A 2BY2A 3D5RC 1WZ2A 1ZYRF 2XF5A 1SC7A 1UAAA 4AIDA 1H89C 1IXSB 2DJIA 2XCQA 2DMNA 3RPUD 3WG7H 5JFRA 2O03A 2F5DA 4XKBA 3AG2H 4XSXF 2UWMA 4A3EJ 2MW8A 1WCMC 1IV8A 4LK0A 4Y52K 3QPLA 3DBHB 1MMGA 1WI9A 3K0LA 4M3BA 2ELHA 2GXAA 4O6JA 4RB1A 4KC6A 3W3CA 4XONA 4XLAA 1E2XA 1SD4A 1RR8C 3MKWB 3OYKA 3G2BA 4KMDA 2FRHA 4LG0A 4BEHB 2YU9A 3HTUA 3QU3A 4ETSA 1Z91A 2I5UA 1G6NA 2M4GA 2BE5F 4HQMA 3L2QA 4IHSA 1J98A 5LHGA 5CHPA 2LTPA 1QZZA 2PJRA 4RGXA 4YEJA 2P5MA 2O8XA 4NUBA 2L54A 2OTLI 4FASD 5F08A 4CCKA 2DQRA 2P81A 3JRGA 1N77A 3TP3A 1ODDA 1Y1WC 1SVLA 3SDGA 2LNBA 4A3MJ 1W0UA 2ZXWH 3L2WA 2F2EA 2NRAC 1JXSA 4EJVA 2O9LA 4YELA 4XLNA 2LY1A 1MDMB 1KYWA 4KMAA 2WY8Q 3DV8A 2HKXA 1YNNA 1ZGWA 4L9JA 1G3YA 3E6MA 3HXLA 3K4MA 2NNYA 3H5RA 3P9CA 5C3EK 4HDUA 1W5SA 1EQRA 4XKWA 1YOVB 1LUJB 1FOYA 2VUMK 3QU6A 1EF4A 3S1NC 1BIBA 1TT5B 3SFIA 2MC4A 3ZQIA 3O3KA 5K5OA 3CCQI 4FHTA 1HLVA 2Z9OA 5C44K 2JA6K 1FC3A 1IF1A 3GTJC 1U3EM 2K5CA 1ZXOA 3BY6A 5ICGA 1XPPA 3JSPA 2RQPA 1IV6A 4O5VA 4Y3OA 1LQ1A 4KARA 1D5YA 3PO2J 3J7AY 3GF2A 4I6ZA 3PO3K 1X1CA 4M71A 1RUNA 2CQ7A 5L3GA 1SAXA 3W2WA 3C18A 2HPMA 2R93J 3G6EI 2GBYA 1DGRM 2Y30A 3MMLB 2K27A 3H5NA 1IG7A 3BLYA 1VTNC 3RYRA 1BN5A 1J2XA 1RPWA 1UZCA 2XDVA 3HOUJ 1FOXA 2V1NA 4N4OB 1O3TA 5IP9K 3RCOA 1XC5A 3DEEA 4BUPA 4MTEA 3KPHA 3VYRB 1VZ0A 3E5QA 5M5YJ 3NRVA 4HSTA 3E3VA 2H6BA 2R7DA 2VIXA 3A01B 3NUHA 3FOEA 2R5ZA 1A36A 5FD6A 4A93C 2XGXA 3EPZA 4E7IA 1SFEA 1M1EB 2FNPA 2VUMA 2XB5A 4ZDOA 1JHFA 4A3IK 4C2MC 1HW1A 3E6CC 3HRSA 2M8GX 5H6RA 2ZJPF 1R9TC 2FXAA 2OBPA 4LLGF 4A3KJ 2JA6A 1R49A 2JPCA 3GTMK 4S0HB 2FA5A 3KFWX 2HTJA 1G3WA 2HDCA 2DO7A 2D2WA 2GXGA 1RRJA 1BL0A 5LGNA 2TDXA 4RAFA 3DPTA 3G1OA 4AWXB 3OMYA 3E5UA 2KIFA 4H4KC 1DD5A 2LREA 3OYCA 1G8XA 4GTFA 3BZCA 3S2HJ 1LE8A 1VQNI 1ORKA 1UB9A 2ETHA 3IAS2 3G1LA 5F0HA 4QLCU 3ZOBA 2K7LA 3GTGC 3GTQC 1VH2A 1D1BA 2VKVA 1OCTC 4HA8A 1TWCC 5HLIA 3FKIJ 3KZYA 3PIPF 1ACIA 2E2IA 2BW3B 6PAXA 1JKRC 2IA2A 2EZIA 1JVIA 5F0CA 2JA7C 3OS1A 3AD7C 2CH0A 1V55H 3OIOA 1FBUA 2RKHA 3WHCA 2O5JA 4H0EA 1VQ5I 5LGUA 4ZDPA 1KU7A 3H35A 3N0CA 3RZDJ 1FWZA 3VODA 3A2KA 3GTOK 1JUSA 1AU7A 1S29A 2R3SA 2L7KA 5E17F 3MVPA 1XTAA 1O7LA 4AC0A 2L9SA 2F4OB 3BQZA 3HOWJ 1YG2A 2K9LA 2PBIA 2QWWA 4M72A 3OYFA 1AWCA 4C45A 4BHPA 5L3DA 3WGHA 4BDZA 4IHTA 3RZOK 5HODA 3BP8A 2L7FP 1XSXA 4OIOA 5LD2C 3K7AC 3S1QC 4AM3A 4YFNA 4BQOA 4XKCA 2CFOA 1K4TA 1WRJA 1B8IA 3SEZA 3I59B 3M3YK 5JLXA 2DMPA 4X6AC 4A3LJ 5M5XK 1PYVA 1DCPA 4A3BJ 3BJAA 1IDYA 1AA7A 1LFUP 2MLKA 2HTSA 2STTA 2BBYA 3FMQA 5C4XJ 3GTKJ 2DA1A 2HZDA 3WGGA 1CF7B 1IN5A 3JRCA 4RB3C 1U0JA 3L2CA 1K6YA 4MQVA 2OZUA 4YFKF 4IHVA 2NVQJ 5IT9Z 4ENJA 4FCYA 2AXTC 2F4MB 5HS8A 1LEAA 3F8BA 1BW6A 3AQPA 2JPBA 4HV6A 4MGRA 1G51A 3S0XA 5M5WJ 3I55I 4IHXA 2BHYA 2NVTK 3GTOA 4KT6A 3D5LA 2DA7A 2HQAA 4KICA 1TWGJ 1K6OA 3S3OA 3I54A 2K3PA 4XN3A 1Y1VK 2LSOA 2R7RA 3V7RA 5B5EC 3LSTA 2K9SA 1BS2A 1P4XA 2EFNA 3WG9A 2L02A 2VXDA 1O24A 1PJ6A 2X6YA 2UZKA 3BJOA 4GDFA 4FX0A 3CUQB 3LA7A 1DCOA 2DK8A 2ZJ2A 2HOEA 4F92B 3ZPLA 1BIAA 4FE7A 1MKMA 2RGVA 5JVTA 4C3JC 1JKOC 4LIVA 2GIVA 3LSGA 3ESWB 4E70A 5J47A 5D4DA 4AIHA 1HKQA 4LLNA 4CXFA 4XRMA 3F6OA 4RLFA 2DOEA 4HX7A 5CJ9A 4ZYEA 4HRIA 5HNHA 3S17K 4QSHA 1XSVA 1YW7A 1XMXA 1HA8A 2MD0A 2FNAA 4M9ZA 1BR2A 2MSYA 5HL8A 2GAUA 4LIUA 1DDNA 4I2OA 4S04A 4BE0A 3HRUA 4D0PA 3EQLF 2OU2A 1LPQA 3GIRA 3GFLA 3CUQC 3HIFA 2G9WA 3GTLC 1S72I 2HOAA 5LRSA 3I56I 4BBRJ 4A3EK 2VJ4A 2CUZA 5FLXZ 4WF2A 1I3QJ 2W7VA 3DEWA 4U0WA 3KEQA 1A6IA 1IN6A 5E68A 1SMTA 3TFJA 4DNCA 1I27A 3KLNA 1GT0C 4IOAF 4LOCA 4BHBA 1IGNA 1Y1VA 2YS9A 2FBHA 1WGXA 3F21A 1J6WA 3OYDA 1ZQ3P 2A6HA 2IAIA 3S8PA 2ADUA 2ISZA 2E2JC 1QO0D 3HXAA 3DTIA 4LMYA 3L2UA 1XXCA 1U5TB 1REPC 4G12A 1MD0A 3AAFA 4BBSC 4KB4A 5IY5H 2EA2A 4XSZF 3I0TA 4ABZA 3S14C 2BGCA 3ROUA 3JAMZ 4AIJA 2L9NA 3ZXSA 4I01A 4A3JC 1ZG1A 2Y0MA 1FTZA 4BS9A 3QQAA 2HYGD 2Y0SL 1SMYF 2WB1A 3CF2A 3CJQB 1ERDA 1JTXA 1JGGA 2E35A 2RQQA 2QZ8A 3BTCA 3BR2A 4C3HJ 3SYTA 1PJ5A 2ZXIA 4NB5A 3QRFF 1U5TC 4RBOA 4RAYA 1R1VA 2W1OA 4R79A 3I5UA 2I8DA 4A3FJ 1MGTA 2JSPA 1W5TA 5B1AH 5IP7K 2IS4A 2DODA 2VT2A 4HZFA 3LSPA 1O2BA 1TWHC 2Q2EB 3O6BB 1J09A 3DP7A 3CD6I 3LPXA 2V1UA 2HEOA 1BI3A 5F6FA 1RETA 5JVGF 3PJRA 4PGHA 1FP2A 3H5AA 1U9OA 1ZR2A 2JQ7A 1EA3A 2CS3A 2F4IA 2ZC2A 3BTLA 1WQGA 4FM9A 1KZHA 4CYCB 2DT7B 1R5HA 2ZBKA 3DKWA 1O3RA 2PMZA 5A2QK 1K4SA 3V42A 4L5IA 5K1YA 4LOWA 3OSFA 1UG2A 4L18B 2R92K 5FROA 3A02A 4OU0A 1WOPA 3S1MK 4HX8A 4KA4A 3SEQA 1A31A 2JA8C 2P7VB 2HPIA 2RC4A 4A3DC 3AFHA 2K9NA 2Q8KA 5D4SA 3OS0A 4A3CC 3OYJA 1O57A 4KT5C 4I09A 4P55A 3C2HA 3MQ0A 5E1ZB 2DK5A 1YIOA 2K02A 2MD5A 3HRMA 3CJTB 1IW7A 5ILVA 4A6DA 1H0MA 2WADA 4EM1A 1YI2I 3Q0VA 2N8GA 4LD5A 4Y33A 4D5FA 4I99C 2KFDA 3AG1H 2O61A 4HAMA 4KN4A 1ZK8A 4BHCA 1MMSA 4FTHA 2ECCA 4FETA 4XBFA 5EGOB 4Y52J 4BU2A 1QPIA 3ABKH 4XR6A 3I4MC 2X1DA 1ETWA 4PJ0C 1XZQA 5KHDA 4G6TB 1K83C 4A69C 5D4RA 1SFXA 3K9TA 3KYDB 4DIQA 2QCOA 3QYBA 3DEUA 3GZNB 3GO5A 1JOEA 2CFAA 4OIRA 1YX3A 1HKSA 1OCCH 3QYFA 3M8JA 1RR7A 2HQNA 2KQRA 2WB1N 3COAC 3FXUA 2HR3A 2EBBA 2R92A 3T01A 3S16K 4XM3A 4MEXF 3BPXA 1OR7A 2LFBA 2KJBA 3KETA 2FQ4A 5L3EA 2BY1A 3QOPA 4WXHA 3WTZA 5E1WA 5K7HA 1FSHA 2A6EA 2ZJQF 2DXIA 3VOEA 1B72B 3FKIK 3HGGA 1CQTA 3HOYC 1EI6A 2HKOA 1YFHA 3F3XA 5C3EJ 2CU7A 4NHJA 1K7AA 3ECHA 5DUKA 2RV8A 2XPVA 2RGRA 2VUMJ 2D1VA 1OLTA 2FD5A 1IO2A 5J8CA 1PDNC 2YU9C 3JSOA 1TWFK 1A5JA 4M6VA 4UNOA 5JFEA 4N4NB 2WY7Q 2G0EA 2DU9A 5BOXA 5C44J 2QSHX 4CHUA 2GSOA 4Q5SA 2NXNB 2DN0A 3DU5A 4WK8F 2V6UA 3RIRA 2V4JC 3LSMA 3VA7A 2EBIA 5J1RA 3CESA 4MQ9A 1H9TA 1T08B 2H8RA 3LNQA 4GTLA 1P2FA 3WTWC 2XASA 1K61A 4OWRB 3MAJA 2WTEA 3PO3J 4F7ZA 2NNNA 4EMSA 3BWGA 3ERMA 1VFCA 2HOTA 2BYVE 3I4NC 2PHCB 3FK6A 3M4OK 1U6GA 1YTYA 2BY3A 3R0JA 5LRRA 2OC6A 3WTSC 3W2VA 3S2DC 4B09A 2IGKA 2B7EA 3QP5A 1RI7A 3SZYA 4BY1K 4M9SA 4GTDA 2CWEA 2KRHA 2Y75A 4WJ3M 3LAPA 2MH9A 3HUGB 1TC3C 1U8BA 1IRFA 3A0BC 2QQ9A 2DLLA 3CDLA 1RZ4A 1MH3A 4MNUA 3JREA 2Y9ZA 2EFOA 3QPSA 3FKIA 3FOFA 5TJJA 3HOXC 3AQOA 5TMCA 3HOZC 2GA2A 2LBFB 1L0WA 4JYKA 3WE3A 3FZVA 4YG2A 4Q4ZF 4PABA 5M5WK 1XXAA 1TWFA 1FBQA 3VSKA 4Y17A 4A3IJ 2M4KA 1LKXA 3CC2I 2GQQA 2ICWG 2W7NA 1JKQC 1I6HK 2O3FA 2GZWA 3GTMJ 1PJRA 2QSFX 1BC8C 4G6QA 2PQ8A 4BJ5C 3SXYA 3G4SI 2YX7A 3JRIA 2VOPA 3IAM2 3S3MA 4PJJA 5JI6A 1TWAC 3LAJA 3PFYA 3ASNH 3GW2A 1ZHFA 4BXUA 5IYDC 3C3WA 3WTVC 1EH6A 4XRSG 1YJNI 5TMFA 2GLOA 4UV8A 1FNNA 3GWZA 4WX9A 4ENKA 2P6TA 3NAUA 1NH3A 2KP6A 1ITYA 2FQ3A 3ZMUA 3LFUA 1D1CA 3N05A 2JVGA 3I64A 3TGNA 2EJRA 4A0ZA 5K7FA 1FLIA 1PJ7A 2VC0A 2ZFZA 1F93A 1F7VA 3HC7A 3GTKA 3EDPA 1R22A 1W7PA 1X2MA 3DF8A 2NS8A 4IF4A 4CCNA 4UUSB 4L9NA 4C2TA 5IYCK 3Q0WA 1FEXA 1Y56A 4KM8A 4BY7C 2AQEA 4JBAA 1O4XA 1HF0A 1J6XA 4Y7NK 1X4PA 4LK1A 2VLAA 1ZVUA 5EYRA 4EJUA 5HLTA 3RPQA 1UFMA 1C0WA 3HOVJ 2FE3A 4G7ZF 2UV1A 2YSRA 2AXLA 4QWQA 3X2QH 3VWBA 4C3IC 3BC8A 2E2HK 3LWFA 1OYIA 1SFKA 3VYSB 3GTOJ 2W24A 2ME0A 4UB8C 3ZQCA 2LD5A 2CUFA 5ILUA 2XIGA 1ENHA 3FXMA 2EB7A 3U1KA 3S1RK 4EM0B 3W6JB 4EATA 1LFPA 2DA4A 4XKVA 3RZOJ 3FXQA 1F7UA 3F9KA 2O5RA 4A3GK 3CUOA 3HPHA 2FJ1A 5D5UB 3L1PA 1GHCA 4Z2YA 1Q1VA 5JHFA 2F5EA 3W6KB 3EYIA 1R6RA 4D7NA 1D1AA 4I76A 1WJ5A 3M3YJ 5M5XJ 3IKTA 1LDJA 4OIPA 2V6SA 3VFZA 2LY2A 2O8KA 4RDUA 4KB2A 2E2IC 4OMZA 1KU9A 3K1NA 3DKYA 1EH1A 1HSJA 2V9KA 3H0GK 5LFAA 4P96A 5EGHA 5DCMA 5H6QA 5JVOA 1WCMJ 1NG6A 3CCYA 3IRQA 1S3JA 3GFIA 3I71A 3PNYA 1ZYRA 3FHNA 5E79C 3MZ8A 1GVDA 4XMYA 3LOCA 1INNA 2JA5C 4PCQA 1WH7A 1DPRA 3DTKA 4IRGA 4GO1A 4F93B 5GPCA 2P4WA 2E2HA 4ZJZA 4ZC3A 3OYLA 4XSXA 4CCLA 2NVTJ 2X1EA 2HDWA 4CO8A 4BXXK 1OCOH 1BJTA 3TFHA 1RUOA 1YYVA 1LVAA 4PDKA 3BCBA 2FBKA 4IO9F 2KRFA 4G7HF 1LB2A 1Y1VJ 2RDPA 4HW0A 3CMEI 1XMKA 2WAQN 3TEDA 3M9AA 5FJ8K 1ZARA 3BR6A 1Z1DA 2LG4A 2BE5A 2R7ZC 5C4JC 1GV2A 3SQNA 3L2RA 4AH6A 4OIPF 2LR8A 4GT9A 3LSRA 1Y0NA 1X31C 3U21A 3IPJA 3HJEA 2XSJC 5CLSA 3B6CA 1ETXA 1YNJA 4ASNA 4WCGA 2GAHC 3GTPK 1Z9CA 2XRLA 4ESJA 3H0GA 1D5VA 3S17J 1WH5A 4KNYA 4NC6A 1BI0A 3E97A 2X85A 5F1RA 4DDQA 1R1UA 2JJ7A 2L9VA 2JMWA 2E1NA 4HPQA 5CVUA 1SFUA 3TBIA 3FK7A 1J5YA 2JN6A 2IW5A 3G3ZA 5IPAA 5DD8A 3FXKA 4PJMA 4Y15A 4U0VA 4PJLA 3GEIA 1PUFB 3TO9A 5FKNA 2O6GE 5CQEA 2X9DA 4JX5A 2R0QC 4RMFA 5EJCA 4R8HA 2M0MA 2R5YA 2YPRA 4HX4A 3OYBA 1G4DA 5FKKA 4JOMA 3QPTA 5LEJA 3GXOA 2DW4A 1HXDA 3GUDA 2RN7A 2B9SA 1JQWA 2FOWA 4RGRA 5CKTA 2CV0A 5J8FA 1T98A 1MMNA 1TQMA 1VNDA 3DTEA 3PQKA 3UKGA 2DQLA 4AYBA 4IHYA 3BR3A 3ZMDA 4A5MA 3KCCA 5FRMA 2K86A 3GTPA 3MN2A 1TZLA 1VF9A 2HQ5A 4Z6YA 1WQHA 1VI0A 4MO7A 4KIGA 4JK1X 4GTCA 2HGCA 4AUXA 3KP2A 1HKTA 3D5SC 4X0GA 4C2MJ 3OR1C 3J7YJ 1S8NA 2GA1A 3C2BA 3O8GA 3IL2A 1ETQA 1DP7P 3V4GA 2XGEA 3E5XA 4QJVB 3PUFA 4GYGA 2ID6A 3SFZA 4CICA 3IHUA 4XL9A 3RJPA 1MH4A 2Y3PA 5EG0A 3OV8A 2DDAA 3M8FA 3HKZN 1KONA 3S93A 2PPBA 1P7JA 5IP7J 2LY9A 1S5LC 4NQWA 2IGOA 2HOSA 4ZZLA 4GTBA 5J4YA 4LLGA 1MNDA 4IXAA 2NVYK 5L3FA 2Y9YA 2R7QA 1GXPA 3TFIA 4HV5A 3ABUA 1FX7A 1XGMA 3H9GA 1R5GA 4XLHA 1P92A 3ZQQA 2DDBA 3J81Z 2Y0SA 5ED4A 2D6FC 4MLOA 4KM9A 4RM2A 1F4KA 2R92J 1Z0XA 3OL3A 5FB2A 1L3LA 2ESNA 2HS5A 4DZJA 3S1MJ 2PA8D 2QF7A 3TQNA 3S15K 3HG9A 3HDDA 2A5YB 2GOXB 4FE4A 2XB0X 2QKMB 4RMNA 3GBGA 1T2KA 5L46A 2KIQA 4IOCF 3ADAC 4BE2A 3U9GA 3PM1A 2GOMA 1YLFA 1ZAOA 1D3YA 1H9GA 2LKSA 4JX4A 3CMMA 1S9HA 1JUMA 2ZSIB 2D1HA 1X58A 2XAHA 3OOPA 3TO6A 3H3VK 4YFXF 4YIFA 3S1QJ 4RB0A 3GVAA 1EKEA 5KNLA 1EK8A 1RESA 3R60A 1YRNB 1DGWY 2XROA 5GAGJ 1WJFA 3CQZK 3FKJA 4AYBN 2W48A 4IKFA 5IYBK 2QQBA 4KN7A 2NVYA 5DCFA 3HL2A 3OYMA 3TMOA 3BR1A 1KQ4A 4RM3A 3KEOA 4FISA 2MFZA 3DCFA 4CDGA 2R7FA 4A3MC 1S6LA 2A68F 4LGWA 1OPCA 3L2VA 4EVIA 4DYRA 2MA3A 3S16J 4L0YB 1XN7A 1OYWA 3I3LA 1DPUA 3ZCOA 2A5WA 2CYYA 1LNWA 1XZPA 3FISA 2V79A 3ISPA 3WTXC 1W5CC 5JR3A 9ANTA 1ETVA 5FRNA 2O7OA 5EEAA 3MZHA 3ECOA 1G2HA 1UHSA 2KKOA 5D8LB 2JSCA 5HVQC 1YJ9I 2IXSA 3F8NA 1QPMA 1B59A 4YFKA 4DW6A 1U8RA 1WHUA 1Y39A 5FLMK 2CUJA 3A8IA 3K70C 1T0FC 3HOVK 2F48A 1YE9A 1ON2A 1ZLJA 4FQGA 4WXDA 1TWFJ 2ELKA 5GTIC 1I39A 2EFQA 5D6FA 1DU6A 1OQYA 1Z3YA 2LLKA 1OFCX 2Y0SN 3PO2C 4MFDA 4B44A 4AIKA 2VI6A 3CQZA 3LSKA 2Q1ZB 3U1DA 3ABMH 1MSEC 3GTMA 1ZELA 2MBFA 2GSNA 3GYHX 3RPUA 2P5KA 1TT0A 3IV5A 2WC2A 2R93C 2HDDA 5EZHA 2NVXK 5IT9K 4B3AA 4LJZA 5TISC 5LBQA 1RKWA 3M4OJ 3HOUC 1F43A 3M8EA 4M9XA 1KQ8A 4U88A 5F1JA 2MGQA 2M87A 2LVSA 4BY1J 5KVRA 3EUHA 3QPHA 4BLAA 1KU3A 2HI3A 2W57A 4B47A 1VJEA 2V9PA 3T0YA 5E20A 2E1MB 2ZNZA 3ELKA 3BG3A 3TOBA 2CV2A 1WCMK 4PFPA 4M73A 4LR2A 1R1TA 1WI3A 4GZYA 3CMYA 1T33A 3IC7A 3EQLA 3MEXA 1RNLA 3ZMZA 4B8XA 1JE8A 4A3KC 2E71A 2KMUA 4CCMA 1LJ9A 1Z3XA 3OYNA 4PSXA 4KIBA 2F5FA 5EEGA 2XGDA 1UV7A 4I98B 2K40A 4E7KA 2E1OA 1I6HJ 3I9V2 2VODA 2DT6A 2LF7A 2IA0A 1YX2A 3S14J 1Y1WK 4ZTFA 2E1MC 3K70D 1O25A 1WJCA 4A3JJ 3S2HC 4LJZF 1I1GA 1IN4A 2NVXA 2XAUA 3F8MA 2VJIA 1MBJA 3OR2C 3T8TA 3JRAA 3WU2C 3CO7C 1IL2A 3FIWA 5EEHA 3Q3SA 2W84A 1FYMA 4ZH4F 4KASA 2BHZA 5K5QA 3G4CA 1BOAA 3K1MA 1JT0A 2HVRA 2XCOA 1BA5A 4QTRA 1WFXA 5EDNA 1J75A 1O2AA 4XSZA 1ZREA 3D0SA 2OF7A 3OYAA 2QBYB 5J1YA 5FLXK 1O7FA 3K4CA 2KWAA 2H6CA 5IYCJ 4KMUA 5J6XA 1WCMA 4NC8A 3QX3A 3S1NK 2AO9A 1PVEA 5BMZA 4L0ZB 1BM9A 3RQIA 1I50C 1V5GA 3A8KA 4Y7NJ 1SMYA 3RZDC 1F36A 1P9QC 4ZYAA 2L2OA 2ZXHA 3GTJK 3GFMA 3PUBA 3RSNA 3OS2A 4GRIA 2F5CA 4F3QA 3O8HA 2E2HJ 1T56A 3TKYA 3HOWC 2H8WA 2QQ8A 4A6EA 1JGSA 1BJZA 2DTZA 3A1YA 2LF8A 3ZQLA 5KCMA 3S1RJ 1SFOC 3WODF 3PFIA 3JAMK 2LRDA 1QRYA 5FLVA 1UG0A 3P9KA 1Y1WA 2FEZA 2B63C 3KYLA 4A3GJ 4A3LC 2ZMEB 2GIZA 4A3BC 3WU1B 3ZN0A 5E3NA 4WWCA 2FX0A 3AKZA 2L4MA 1ZG3A 1VQMI 4G6DA 5EGEA 2EPFA 2AHQA 4BEHA 5C4XC 3E1SA 4HLYA 3GEHA 2M2EA 1O27A 1GXQA 1BOBA 4D7MA 1IXCA 4A93K 3H0GJ 2FMYA 2NVQC 4JX6A 3N97A 2HXIA 2DFEA 4DJAA 2VKHA 1W1WE 2Y2ZA 1X19A 3VSLA 3HM5A 1L0OC 2LKXA 4C2MK 1JKPC 1AKHB 5DYMA 4KIFA 4Q47A 1R9TK 3TOAA 4V2FA 2ZMEC 3GTJA 3D1NI 1B9MA 5CQGA 2Q0OA 1MDMA 3EYYA 4GFBA 1TWGC 1USOA 4XLPA 1T6SA 1R23A 3IKVA 2CFXA 2CJJA 2X0LA 2DAOA 2KPMA 2BZTA 4PZJA 2STWA 4BXXJ 3CAGA 1K78B 1R00A 3T00A 5BPIA 2P6SA 2M7AA 1IE0A 4DBRA 5FJ8J 2ZUEA 1WVRA 3MKZA 1FMVA 5DM7F 3GTGK 3CCLI 4NDLA 2HYFA 1RKTA 3GTQK 4E7LA 3K69A 1EH8A 2J5PA 3PIOF 2ZUFA 1TWCK 3BZ6A 5HDNA 2RH6A 2HVSA 5E3LA 5CVJA 1BJAA 1X2NA 2FOKA 3FF5A 2JA7K 4CCJA 3Q9VA 2VPLA 3HSRA 2AQFA 5M3FJ 1IQ0A 4MFEA 3GTPJ 3MFKA 4MEXA 1O29A 4KJZA 4AVZA 1JT6A 2ZFUA 2LYCA 3L4JA 2XAFA 4LG3A 3U2RA 3VEPA 5AONA 4IPAA 2WAQD 2CW8A 2ZO4A 4CYDA 1R9TA 4PJNA 4BBRC 1D8KA 2A6TA 3H36A 1I3QC 4XLPF 3I4PA 5ICFA 3RKYA 2GXBA 2XKOA 3S1QK 3K7AK 3A01A 2VONA 4OINF 3TDZC 5HDKA 4U7DA 2XAGA 2W00A 4GGGA 4RGUA 5ERIA 3E7LA 3CF5F 4X6AK 4QIWN 4PK4A 4D1QA 3SJMA 1IRXA 4KFCA 1HQCA 4A12A 1YIJI 3GTGA 3GTQA 1ETYA 1TNSA 2CQQA 2NVYC 3CP2A 5FKMA 1HBXG 4KUMA 4UHTA 3F0CA 3KYCB 1XX5A 3WE2A 1MMDA 1NG7A 4LG0B 2JA7A 2W4SA 1IUYA 3RQ4A 4HQEA 2PJRB 4WXCA 1QNTA 3ZGKA 3GDZA 1Q1HA 2ZB9A 2PX9A 5HDGA 4C3HC 1YO5C 1U78A 4NC7A 3ZMVA 5E3OA 3CC4I 2V26A 2EA4A 3OY9A 5GAHJ 4XRSA 2XVCA 1X3UA 2OA4A 1N75A 1GVJA 3S2WA 4A3FC 1J59A 3FDYA 2VBZA 4RA2A 4G94A 1ZKGA 3BJ6A 1T39A 2C6YA 4A2UA 2BW3A 4D5CA 4BH9A 1WSRA 2OZ6A 4Q4ZA 2PMZN 1HI9A 3E0JB 5D6EA 5IOQA 1XDUA 4C3JK 4G0UA 3TTGA 4EV0A 2CUEA 2NVYJ 3NQOA 1GV5A 4OIQF 5IORA 4IEJA 3F6VA 4IQ4A 2V6CA 1BC7C 3M1EA 4BY7J 1I50K 2NS7A 4HNVA 3LL7A 4AU7A 5J3LA 2X6OA 3HKZD 3I58A 1HCRA 1UJ8A 2QEXI 4HF2A 2JRTA 4G7OF 3S15J 2LMDA 4BJ6C 3CCRI 3N4MA 3EETA 4P9UA 3Q9SA 1LDDA 3I59A 2Z33A 3SDBA 3GTLK 2E60A 3M1CA 2XAJA 3GEEA 3DPUA 4FT8A 3OEPA 4UUTA 1Y6IA 3IRRA 1FZPB 4KDDA 4LLLA 1OISA 3V7CA 3JRBA 4CGZA 1RIOH 5ICCA 2QA4I 4C9YA 2DBBA 3T5XA 3LQQA 1MJAA 1CF7A 2B63K 2E2JK 4G7ZA 4BJTA 2L0KA 1MMAA 2EV0A 2E19A 5FFZA 4BXFA 1DUXC 2CSOA 4CUGA 1HC8A 3CMAI 1NTCA 2H09A 4JQFA 2R5ZB 5E8IA 3CQZJ 3CDIA 4BBSK 5L3BA 5IYBJ 4XQFA 2PA8L 4B48A 3S14K 1OCZH 4EJOA 4ESFA 4KITB 4A3JK 1VQ7I 1SVMA 2OCCH 5EF6A 2OCEA 4BGDA 1IAWA 2QUFA 3C7JA 1Y8QB 3J80Z 2M34A 4KISA 3MWMA 2K3FA 1APLC 3HTSB 1VQOI 1IDZA 3BR0A 3BP3A 3CUQA 3AD9C 1STZA 1HW2A 2B0LA 4AYBD 3GTLA 2Z3YA 3NEUA 3DBLB 3V7SA 2VBXA 4DYQA 2EK5A 2IVMA 2L7MP 4RGSA 2DYRH 1LE8B 5JHUA 4ENNA 2R7SA 2VUMC 5KAIC 1TWHK 4YIIA 5HS9A 2M5WA 3HSFA 3IH3A 5FLMJ 4E7ZA 5C44C 2JA6C 4PFOA 2MC3A 1H88C 4HLXA 3K4BA 3FMRA 1P6RA 3HHGA 1VQPI 1BW5A 3SHFA 3PO3C 2L7ZA 4KN4X 1WJDA 4G7HA 3SZZA 3ULQB 5IT3A 2A05A 1XXBA 2JA8K 2V7FA 1EJ9A 1VQ4I 2NVXJ 4ZDLA 2DCEA 4A3DK 4LB5A 3AG4H 4A3CK 2P5LC 5B1BH 4JP0A 4MHGA 3AG3H 2VC1A 4HOBA 1UMQA 2WV0A 3OIQA 2M3AA 5IP9C 1TP4A 3GLLA 3ZP5A 3FBNB 4M6XA 4AVPA 1UHWA 2BV6A 4M3EA 2IS2A 1MSFC 2VE8A 5IP6A 2NOJB 1B8IB 1VLOA 4E6KG 4IVNA 2EINH 2VPRA 3WTYC 3HRTA 4L9VA 1Y8RB 5TJ3A 3G4AA 3I4MK 3UNGC 3V8JA 1B6AA 1TWHA 3O2PE 3Q5FA 4KDPA 3GCMA 2PMUA 5HNFA 5TRDA 1K83K 4A3IC 5GAEJ 3CP8A 2KISA 3DWLE 2P8TA 5LEKA 2DA6A 2GM4A 1ZGJA 5ILSA 4MIMA 4B1RA 3P9IA 4DOZA 3NWTA 3JCUC 3ZQFA 2IT0A 1B9NA 3BP8C 3DXJF 2J5OA 3GEZA 4IL6C 2CGPA 1ZBSA 3PSIA 2QM3A 1Y1WJ 3FXOA 2XHKA 4ZYHA 1YCLA 5K7ZA 1UCRA 4U87A 3H9JA 1W4MA 4HNTA 3J7ZI 2WBMA 2IJLA 3WTTC 1FIPA 3B6AA 2Q2EA 3HZJA 3IWZA 3QP6A 2CW0F 4E7HA 1FTTA 1XCBA 1BGWA 4A5NA 5FO5A 3WHBA 3Q3QA 3HOYK 3DPLC 4KYWA 1MNEA 3BG6A 2Z16A 4CYCA 5GTHC 5M3FK 2L9RA 4O3MA 3N3YA 3BROA 2LK2A 3UR3C 3HOTA 2K9MA 2RNGA 4J19A 1D0XA 2R7UA 3OREA 3S1NJ 2YU9K 1DCHA 4WILA 2VQLA 4FX4A 4I7HA 2LOOA 3GTJJ 1K83A 3SZTA 4XCHA 1MZBA 3GTOC 2XRNA 3MZYA 3RYPA 3R61A 1MJ9A 3FWEA 2W85A 2PJPA 3CJNA 2H94A 4KATA 1B1BA 2DJNA 3AH5A 3H3VD 2VKDA 4UVAA 2D45A 3RZOC 3KP5A 1ISEA 3I4NK 4BLBA 1MBKA 3BPVA 5ICEA 1Z05A 1NK2P 2HYJA 1JHHA 5E1XA 1JUPA 3S2DK 1O28A 3M3YC 5EGOA 2DA2A 2JWTA 3LMMA 2V6TA 4RLQA 5EZGA 2I10A 3FMSA 5H20A 1WQFA 5HLHA 1AOYA 5AIQA 4U7BA 3JR9A 1F9NA 1XCVA 2TCTA 3ZMTA 1IBAA 2CQKA 3E6BA 3WGIA 2EQRA 3PNTA 1F5TA 3HOXK 2M45A 2VB6A 4L5JA 2QYOA 2DMTA 3HOZK 4W97A 2HVQA 4XOTA 4A93J 1R58A 3VYUB 3BG5A 1TLHB 1IC8A 1QVUA 2EZHA 2R7TA 5GP9A 2MABA 5BNGA 2EFPA 4HG2A 3KP7A 5AIPA 3CCUI 1ULYA 4EJTA 2IS6A 1HDPA 1R9TJ 1S7OA 4XOPA 2V6EA 1MIJA 2Z99A 4M3DA 2NVTC 4WJ4A 2HXOA 1E3OC 2LC2A 3JW4A 4YFXA 1ETOA 1B72A 3DBRB 3J81K 1R36A 1Y1VC 4N9IA 2ZCWA 4MEYF 4DQ2A 1TWAK 1WKMA 2RREA 5IYDK 4G9YA 1ZR4A 4II2A 3LSIA 3GSIA 1V54H 2L3DA 1KQ0A 1BR1A 1EV7A 2OD5A 1IXRC 2AS5F 3OYGA 5E8GA 1HDDC 2YX4A 5HLGA 3GMEA 4J00A 3GTGJ 3GTQJ 1FOKA 4BYYA 1RU0A 3HOSA 1TWCJ 3L9FA 2XGCA 1KYZA 2OAZA 5F27A 2YUSA 4BY7K 4LK0F 3B02A 2A68A 2JA7J 3S17C 3FXJA 2DMUA 4BKXA 2WAFA 2E5ZA 3TO7A 1YX5A 3ONQA 4K2EA 2CQNA 1X3WB 2FMLA 2IRFG 4LQYA 3I53A 4CSWA 1W0TA 4C3IK 3CCMI 5FD5A 1ZLKA 2E36A 4CH7A 4DGWB 1HQMA 5DD4A 4M1XA 3REOA 3JRDA 4M3GA 1NHAA 1XDSA 4A3EC 5CVIA 4Y13A 3HUGA 3OPFA 4UB6C 1O26A 1KGSA 5B66C 1FMWA 3OYHA 2M0CA 2XF7A 3K7AJ 2QENA 3KLOA 1GLNA 4I0AA 1WIHA 3MKLA 5DDGA 4PUSA 2DFHA 4OMYA 1IRGA 4M74A 1TWAA 5J40A 4XK4A 1JJ6C 2MLGA 3BTJA 4XLNF 3L7WA 4L5EA 1J0RA 2L5QA 1YW8A 4X6AJ 2LBFA 5D8KB 2EIJH 2ESHA 1WWXA 1VQ8I 2E2IK 1FYLA 4BACA 5BS6A 3ZMSA 1WORA 3K4JA 1P4WA 5BQTA 2P7CB 4IQJA 4KMFA 5TGTA 3ZRGA 1JJ8C 1R5ID 4G8XA 3ABLH 2R7WA 1XZQB 3IUOA 2WAQL 2M30A 3RTRA 3MCZA 3RKXA 3C2GA 5B3SH 3DLAA 5LGTA 4V19K 2KZVA 3CLQA 4RAZA 2JA5K 3QWLA 1T38A 1V5VA 2CFAB 1ZQ1C 2KDOA 4QIWD 4G0WA 1OJLA 1SD5A 2DYSH 4O2DA 2FF4A 4N0BA 3HPGA 4N9HA 1O3SA 3KP4A 1J9IA 2ECBA 4GCVA 2P0WA 1QA6A 1YS7A 2EZLA 4BAYA 2WB1D 1E3PA 4TV7A 4UUSA 5IP7C 2QSGX 4J01A 1X1BA 2DPUA 3H1CA 2P5VA 4CA0A 4V2GA 1Z7LA 3B73A 2R7ZK 5CPRB 3RKWA 5C4JK 4C3JJ 4UY8I 2WAEA 1PP7U 2HU9A 2QVOA 5JLWA 3HGYA 2VBWA 1IJWC 2X48A 2JT1A 2DFIA 1J6VA 2R92C 3JTHA 1XD7A 2KRCA 3CCJI 3S1MC 1OR7C 3BQYA 3FM3A 1I50J 3OL4A 1SANA 2JA5A 2PLYA 4ZH4A 2PMZD 3F8FA 1WJBA 3LQRA 1GUUA 1PP8F 4RAGA 3GTLJ 1R4NB 1G3TA 3GFJA 2XV4S 2ISYA 3K4KA 3G1MA 2DFFA 2VT3A 1SFOJ 5DS9A 2VKEA 3NWSA 5M3MK 1V4RA 2CO5A 1ZRFA 1WSVA 4CZCA 4BDYA 2B63J 2E2JJ 1OCPA 1H8AC 3W2AA 2VN2A 4ESBA 1WOOA 2YR2A 3K4LA 2R7ZA 2VBYA 2DI3A 2Z5UA 4BBSJ 1MNMC 3HKZL 4HF1A 3WODA 2UXNA 3JTGA 1GDTA 2D5VA 3LA3A 1ZH5A 3L4KA 1POGA 3FXLA 5IOSA 1ONVA 5J4VA 2HWVA 2ID3A 3S16C 4M6YA 4UXNA 4QPQA 2DOFA 4XN0A 3S32A 1P7IA 1E17A 3F23A 1TNTA 5LHHA 1ZRCA 2HQRA 2BVLA 2BXYA 4EM2A 3FKIC 4P5BA 3IH4A 1USMA 3JSTA 3AD8C 1A6QA 2M1BA 2ZJRF 4BKWA 2VJJA 3FHZA 1GE9A 5J1UA 1I3AA 1Z7UA 2XPUA 3R4KA 5FKLA 1R4MB 3V8KA 1VQKI 4OIOF 2XC7A 4YFNF 4NNJA 2E5NA 1RC9A 1XG1A 1TWHJ 3RKQA 3PSFA 1QZEA 1YITI 2K4BA 4XLFA 3JRFA 1QBJA 1TWFC 4OAYA 3QAHA 1XSDA 1J7KA 4G0VA 1W7PB 4DZPA 1N78A 1G3SA 5DM6F 1XB4A 3H92A 2O5IA 1TBXA 4RS8A 3CJRB 2NYXA 3PL8A 1E0EA 2R4GA 3NARA 2Z1DA 1D8JA 1JI8A 2OQRA 3CC7I 1R71A 2KIUA 1PUFA 2XF6A 1B4AA 1O2FB 5E18F 1PUEE 3VB2A 4DYCA 3P5JA 3M4OC 5CVVA 3CCEI 1WJAA 2JA8J 4AYBL 4A3DJ 2EV5A 1W36C 2LP0A 2NS0A 2VQHA 2OV7A 4A3CJ 1F1ZA 4BY1C 2CQXA 2EIKH 1UELB 3ABTA 4KN7X 2VL8A 2M9HA 3GTKC 2G7UA 1JTYA 1LEBA 1XGOA 1USTA 1ZGAA 4OOIA 3A8JA 4IRHA 4XLCA 2DT5A 2PG4A 1X1DA 2VQGA 1IN7A 2GWRA 4Q48A 3ZN1A 5LLQA 3BCAA 3CDHA 3K2AA 4ZZDA 3I4MJ 3W6VA 2X51A 3OYEA 3JRHA 2IGMA 1D0ZA 3C1DA 4ITVA 5IOYA 1K83J 2IEKA 1A35A 4YIRX 2G7HA 5DEQA 3BDDA 4NBQA 5DCMB 2V9VA 2Z2SB 1I6HC 4HDVA 3CCVI 4C2UA 1VRQC 1V5FA 3BOQA 5BPDA 4OINA 1I5ZA 2R7OA 4A3MK 4QJVA 4CZZA 4LB6B 1T8IA 1YHQI 2BXZA 4F52A 3CTAA 3K4NA 4M3FA 1Z6RA 4A0XA 4LITA 2A61A 5FFXA 1NK3P 2K85A 2EILH 1QGPA 2L4AA 2EH3A 2V1DA 2MYSA 1XPXA 2IP2A 1BDFA 1XS9A 3HOYJ 3DU6A 2PFBA 1WPKA 1Z67A 5IYCC 3OOUA 2VJ5A 2XSDC 1FP1D 3TDUC 3K2ZA 4Y7NC 3GLXA 5LHIA 2L01A 3BUEA 1W36D 3BR5A 4BQAA 3A0HC 4XRFA 2YU9J 2A6HF 5D5WB 4B4CA 3RI4A 1VGXA 1UHMA 4BL0B 1S7EA 4ZTJA 1XGSA 2E2HC 2UXXA 3PO2K 1W7PD 1QZYA 2LKPA 1U2WA 2M7BA 4XIDA 3QYEA 4GTEA 3R6SA 2QKLB 4E7SA 3BG9A 3FBIB 4HYEA 2IA1A 4PGGA 3S1RC 2X1CA 2R93K 4B43A 4ZYGA 1R7JA 2X6WA 1MBFA 4KMHA 2ACJA 3VYTB 3I4NJ 3KE2A 1MBHA 5KK1A 4A3GC 3SZPA 2Y31A 4X1EA 3HOUK 3LSHA 4BNCA 1N25A 3S2DJ 2Y48A 2ZNYA 3TW7A 1QHHD 2F6CA 2PMHA 1MJBA 5M5YK 2F5VA 2JTVA 1YRNA 5A2QZ 1K79A 1YS6A 3G73A 4OIQA 1S7AA 1LFBA 1TWCA 5F04A 1X1PA 2GAGC 2R5YB 2GSUA 3H0GC 2XPWA 1CGPA 2H27A 3HOXJ 1HOMA 1KU2A 4IJAA 2K4JA 2XAQA 2XKPA 3HOZJ 1OMIA 3ASOH 3PNVA 5FKOA 2E34A 2BEOA 4AD9A 3WU0A 4G7OA 2XUBA 1SD6A 1T0FA 2JK3A 2O0YA 3MD2A 2NVUB 2R7XA 2IBDA 4A3KK 3K1PA 3H3VL 3F8CA 3VPRA 1SD7A 2JZYA 3R0AA 3GX4X 1YQAA 2DMQA 3V8LA 1Z77A 2KDZA 1D0YA 1FBSA 3WTUC 1AB4A 3HSEA 4BXXC 2BVMA 4XICA 4GYIA 4QPOA 3K6GA 5DUIA 1P4AA 4KMUX 1WOSA 2R93A 1FY7A 3IP4B 4XORA 1WSUA 3S2HK 1KA8A 4UVCA 1V5EA 1BI1A 1TWAJ 3DQVC 2DTRA 2XCRB 5IYDJ 1ETKA 4F91B 4YRVA 1USSA 1SAUA 1Y0UA 2KZGA 5EG0B 1IW7F 2EV6A 4PAAA 3A03A 2FQTA 2COBA 1O3QA 3QOEA 3LSJA 4L9TA 2OTJI 4IRIA 2H1LA 4KAWX 3T8RA 3GTPC 3GZ5A 4NQWB 1TL8A 3AL0B 2DPDA 1T95A 4S05A 3OSGA 2Y69H 3RZDK 1BR4A 1LDKB 2X6XA 2FSWA 2RAEA 3F72A 4U0YA 2JA6J 1IRZA 2KJCA 4C3IJ 3HB9A 2COMA 4P9SA 2A07F 3HOWK 1TTYA 2ELJA 3H3ZA 2LDUA 1SVOA 4OIRF 2E7XA 2UUZA 2ZKZA 4HEA2 5D5XB 4XNFA 2KL4A 4I0BA 4IX7A 4ZYDA 2OUMA 4UVBA 2V1XA 4Y52C 1SFOK 2CMPA 2KT0A 4P1WA 3KIOA 1FYKA 3CLOA 1I1SA 4A3LK 4A3BK 3AL0C 2VOOA 3IWFA 3LA2A 1OYYA 1HW5A 3J80K 4P5OA 4R1HA 2WA0A 1IS1A 1TW2A 1A04A 3DLLF 4C30A 1I6XA 3Q0UA 2FQOA 2LH9A 3HHHA 5C4XK 2A6EF 5IOZA 5IP9J 5D5VB 4EQQA 3GTKK 2PN6A 4EGZA 2TRTA 2E2IJ 1ZRDA 3KX2A 4IZZA 1IZ1A 4P9FA 1WJEA 4EJWA 2NVQK 5CYVA 5CVRA 5FGMA 4P5AA 2ME6A 1VQ6I 5HS7A 2E1CA 1IUFA 5KAFC 1TQPA 2CW7A 2KIMA 2QGUA 1I50A 2FU4A 3H3UA 2JA5J 3ZQGA 1U9NA 5F0FA 4UUVA 1OKRA 3ZQHA 4Q5SF 3P7NA 3KZZA 3OIPA 5GPAA 1AHDP 3KEYA 2W25A 1TWGK 2JUGA 1I6VA 4MQ9F 1QU3A 5C3EC 2JUCA 2VXZA 1QHGA 1TQIA 2EWNA 2JRMA 4BQNA 1DP3A 2JVHA 4EEFG 2VE9A 4I02A 1SFOA 2HZTA 2WWYA 2QBYA 2FUG2 1ZG5A 1QQIA 3T02A 1XZPB 4PSWA 1FJLA 4GFQA 4JK1A 2B63A 3RDIA 3F22A 2KHMA 4II3A 1EH7A 2OPTA 2R7ZJ 1BI2A 3TW6A 2WAQA 5HOOA 4CCOA 2E7WA 5C4JJ 1G59A 3TP0A 3TL4X 2IS1A 3DXJA 2RNJA 3ZR8X 4IHWA 2OJED 1VQLI 4FZBA 3OYIA 3BTIA 3KP3A 5DTDA 1TW3A 3HEFA 1X3ZB 2A3SA 4RB2C 4QIWL 3G71I 2NOGA 1LVKA 4ANJA 5GADJ 5F64A 1MW7A 1ZTRA 2NAZA 3S15C 1V3FA 4YG2F 2PI0A 2CW0A 2FBIA 2QLZA 3LFKA 1VQ9I 1WQ2A 2BOLA 2ZMEA 4BBRK 3FX3A 3FXRA 1YJWI 2WB1L 4GTAA 1MBEA 4Y4RA 3SZGA 2Y0SD 4EGYA 1I3QK 2ZXJA 2W82A 4OAZA 1TWGA 5K5RA 1U5TA 2QQAA 2R7VA 4LFUA 2M8EA 2JH3A 3M7GA 1DQUA 3OWTA 2MG4A 4ON0A 3ERED 1XGNA 1FT9A 3PQJA 1FSEA 1QVTA 2EIMH 2IGNA 3KZIC 5M3MJ 2VQCA 2X4HA 2MH2A 3FM5A 4GXOA 2PEXA 4B3XA 1X1AA 2DA3A 2HFHA 3GZ6A 2A69A 4ILDA 1HSTA 4BQQA 1C0AA 2CV1A 2WV1A 3CQZC 3H0DA 3GTMC 3EUKL 3H9QA 3IH2A 3J7AO 1AKHA 3K10A 5IYBC 5IOTA 1FOWA 3HBLA 4HBLA 3VDXA 3ML6A 4BE1A 3MKYB 1ZN2A 2ZFWA 5E3MA 2DOAA 1DU0A 2PMZL 2RVCA 2CRGA 2CG4A 4NOIA 1OCRH 2DA5A 5DV5A 1E3HA 4LK1F 1MBGA 2ZSHB 3M07A 2EZKA 2BY0A 2EFWA 1K78A 4C3HK 2YU3A 3EUHC 2VASA 1KQ9A 3BZKA 3BT9A
chains in the Genus database with same CATH topology
1IN8A 3L09A 1FPQA 3E6DA 1YW9A 4UV9A 1I3QA 3CO6C 1ON1A 4A0YA 3L00A 3KP6A 4J3NA 3ZQ7A 1XMAA 1Z6TA 3T1BA 3N0BA 2A69F 1BBYA 2IPQX 1B4BA 3HYIA 5L3CA 4MTDA 2OQGA 4ENMA 3DFGA 4HF0A 1ZYRF 1IXSB 2XCQA 5JFRA 2O03A 2F5DA 4XSXF 2UWMA 3K0LA 1WI9A 2ELHA 4O6JA 4RB1A 4KC6A 1E2XA 1SD4A 4KMDA 2FRHA 4LG0A 2YU9A 3HTUA 3QU3A 4ETSA 1Z91A 1G6NA 5CHPA 2BE5F 4HQMA 4IHSA 5LHGA 1QZZA 4RGXA 2P5MA 2O8XA 2L54A 2DQRA 1ODDA 2LNBA 1JXSA 2F2EA 2NRAC 4EJVA 1MDMB 1KYWA 4KMAA 3DV8A 2HKXA 4L9JA 1G3YA 3E6MA 2NNYA 3P9CA 4HDUA 1W5SA 3QU6A 1BIBA 3O3KA 5K5OA 4FHTA 2Z9OA 1FC3A 1IF1A 1U3EM 1ZXOA 3BY6A 5ICGA 3JSPA 2RQPA 4O5VA 1LQ1A 4KARA 3GF2A 4M71A 1RUNA 5L3GA 1SAXA 3C18A 3MMLB 2K27A 1VTNC 3RYRA 1BN5A 1J2XA 1O3TA 4MTEA 3E5QA 3NRVA 3E3VA 2H6BA 2R7DA 3NUHA 3FOEA 5FD6A 2XGXA 1SFEA 2FNPA 2VUMA 1JHFA 4C2MC 1HW1A 3E6CC 3HRSA 5H6RA 2FXAA 2OBPA 4LLGF 2JA6A 2JPCA 2FA5A 3KFWX 2HTJA 1G3WA 2HDCA 2DO7A 2D2WA 2GXGA 5LGNA 2TDXA 4AWXB 3DPTA 3E5UA 2KIFA 1DD5A 4GTFA 1UB9A 2ETHA 4QLCU 2K7LA 4HA8A 5HLIA 3KZYA 2E2IA 6PAXA 2IA2A 1FBUA 2RKHA 4H0EA 5LGUA 1KU7A 3N0CA 1FWZA 3VODA 1S29A 2R3SA 5E17F 1O7LA 1YG2A 2PBIA 2QWWA 4M72A 1AWCA 4BHPA 5L3DA 3WGHA 4IHTA 3BP8A 1XSXA 1WRJA 3I59B 3BJAA 2MLKA 2HTSA 2STTA 2BBYA 3FMQA 3WGGA 1CF7B 1IN5A 4RB3C 3L2CA 4MQVA 2OZUA 4YFKF 5IT9Z 4ENJA 5HS8A 1LEAA 3F8BA 3AQPA 2JPBA 4HV6A 4MGRA 3S0XA 3GTOA 3D5LA 4KICA 1K6OA 3I54A 2LSOA 3V7RA 3LSTA 1P4XA 2EFNA 3WG9A 2L02A 1O24A 2UZKA 3BJOA 4FX0A 3CUQB 3LA7A 2DK8A 2ZJ2A 2HOEA 3ZPLA 1BIAA 1MKMA 2RGVA 5JVTA 4C3JC 2GIVA 4E70A 4AIHA 1HKQA 4LLNA 4CXFA 3F6OA 4HX7A 5CJ9A 4ZYEA 1XSVA 1YW7A 2FNAA 4M9ZA 2GAUA 1DDNA 4I2OA 4S04A 3HRUA 4D0PA 3EQLF 2OU2A 3GFLA 3CUQC 3HIFA 2G9WA 5LRSA 5FLXZ 4WF2A 4U0WA 3KEQA 1IN6A 1SMTA 4DNCA 1I27A 3KLNA 4BHBA 1Y1VA 2FBHA 3F21A 2ADUA 2ISZA 1QO0D 4LMYA 1XXCA 1U5TB 1REPC 1MD0A 3AAFA 4KB4A 2EA2A 4XSZF 3I0TA 2BGCA 3ROUA 3JAMZ 4AIJA 4I01A 1ZG1A 2Y0MA 2HYGD 1SMYF 2QZ8A 4NB5A 3QRFF 1U5TC 4RAYA 1R1VA 4R79A 3I5UA 1MGTA 1W5TA 2VT2A 4HZFA 1O2BA 3O6BB 3DP7A 3LPXA 2V1UA 2HEOA 1BI3A 5F6FA 4PGHA 1FP2A 1WQGA 4FM9A 1R5HA 2ZBKA 3DKWA 1O3RA 5A2QK 5K1YA 4L5IA 4L18B 4OU0A 4HX8A 4KA4A 2P7VB 2RC4A 5D4SA 2Q8KA 1O57A 4KT5C 4I09A 4P55A 5E1ZB 3MQ0A 2DK5A 1YIOA 2K02A 2MD5A 3HRMA 5ILVA 4A6DA 1H0MA 4EM1A 4LD5A 2O61A 4HAMA 4BHCA 4XBFA 5D4RA 1SFXA 3K9TA 3DEUA 3GO5A 2CFAA 1HKSA 2HQNA 3COAC 3FXUA 2HR3A 2R92A 4MEXF 3BPXA 1OR7A 2KJBA 3KETA 5L3EA 3QOPA 4WXHA 3WTZA 5E1WA 1FSHA 3VOEA 2HKOA 1YFHA 3F3XA 4NHJA 1K7AA 3ECHA 5DUKA 2RV8A 2RGRA 2D1VA 5J8CA 1PDNC 3JSOA 4UNOA 5JFEA 2GSOA 5BOXA 2DU9A 4CHUA 4WK8F 3RIRA 3VA7A 1H9TA 4GTLA 1P2FA 3WTWC 2XASA 3MAJA 2WTEA 4F7ZA 2NNNA 4EMSA 3BWGA 2BYVE 2PHCB 1U6GA 1YTYA 3R0JA 5LRRA 3WTSC 4B09A 3QP5A 1RI7A 4M9SA 4GTDA 2CWEA 2Y75A 3LAPA 2MH9A 1IRFA 2QQ9A 2DLLA 3FKIA 1RZ4A 4MNUA 2EFOA 3FOFA 5TJJA 3AQOA 2GA2A 3WE3A 3FZVA 4Q4ZF 1XXAA 1TWFA 1FBQA 4Y17A 2GQQA 2O3FA 2GZWA 1BC8C 4G6QA 2PQ8A 3SXYA 2YX7A 2VOPA 5JI6A 3LAJA 4BXUA 3GW2A 1ZHFA 3C3WA 3WTVC 1EH6A 4UV8A 1FNNA 3GWZA 4WX9A 4ENKA 2P6TA 2FQ3A 3ZMUA 3TGNA 3I64A 4A0ZA 2EJRA 1FLIA 2VC0A 2ZFZA 3GTKA 3EDPA 1R22A 1W7PA 3DF8A 4IF4A 4L9NA 4KM8A 4JBAA 1ZVUA 4EJUA 3RPQA 1UFMA 1C0WA 2FE3A 4G7ZF 2YSRA 2AXLA 4QWQA 4C3IC 3LWFA 1OYIA 2W24A 5ILUA 2XIGA 2EB7A 4EM0B 3W6JB 3FXQA 3CUOA 5D5UB 1GHCA 4Z2YA 2F5EA 3W6KB 3EYIA 3IKTA 1LDJA 3VFZA 4KB2A 4OMZA 1KU9A 3K1NA 1EH1A 1HSJA 4P96A 5EGHA 5DCMA 5H6QA 5JVOA 3IRQA 1S3JA 3GFIA 3I71A 4PCQA 1DPRA 4IRGA 4GO1A 2P4WA 2E2HA 4CO8A 1BJTA 1RUOA 1YYVA 1LVAA 4PDKA 2FBKA 2KRFA 4G7HF 1LB2A 2RDPA 4HW0A 1XMKA 3M9AA 1ZARA 1Z1DA 3SQNA 4OIPF 4GT9A 5CLSA 4ASNA 4WCGA 1Z9CA 3H0GA 4ESJA 1D5VA 4KNYA 1BI0A 3E97A 4DDQA 5F1RA 1R1UA 2E1NA 5CVUA 1SFUA 1J5YA 3G3ZA 2IW5A 5DD8A 4Y15A 4U0VA 3TO9A 2O6GE 4R8HA 2YPRA 4HX4A 1G4DA 3QPTA 5LEJA 3GXOA 2DW4A 1HXDA 3GUDA 2RN7A 4RGRA 5J8FA 1T98A 1TQMA 3PQKA 2DQLA 3ZMDA 4A5MA 3KCCA 2K86A 3GTPA 1WQHA 4KIGA 4JK1X 4GTCA 2HGCA 1HKTA 3KP2A 1S8NA 2GA1A 3IL2A 1DP7P 3V4GA 3E5XA 4GYGA 3SFZA 4CICA 3IHUA 3RJPA 2Y3PA 3OV8A 3M8FA 4NQWA 4ZZLA 4GTBA 4IXAA 5L3FA 1GXPA 4HV5A 3ABUA 1FX7A 1XGMA 1R5GA 1P92A 3J81Z 5ED4A 4KM9A 1F4KA 5FB2A 1L3LA 2ESNA 2HS5A 3TQNA 2A5YB 1T2KA 3U9GA 1YLFA 1ZAOA 1D3YA 1H9GA 2D1HA 2XAHA 3OOPA 3TO6A 4YFXF 4YIFA 4RB0A 3GVAA 1EK8A 3R60A 2XROA 2QQBA 2NVYA 5DCFA 1KQ4A 3KEOA 4CDGA 2R7FA 1S6LA 2A68F 4LGWA 1OPCA 4EVIA 2MA3A 4L0YB 1XN7A 1OYWA 1DPUA 2CYYA 1LNWA 2V79A 3ISPA 3WTXC 5JR3A 3MZHA 3ECOA 5HVQC 2KKOA 5D8LB 2JSCA 3F8NA 1QPMA 1B59A 1U8RA 1ON2A 1ZLJA 4WXDA 2EFQA 5D6FA 4AIKA 3CQZA 3U1DA 3GTMA 2MBFA 2GSNA 3GYHX 3RPUA 2P5KA 2WC2A 5IT9K 5LBQA 3M8EA 4M9XA 1KQ8A 4U88A 2M87A 5KVRA 3EUHA 3QPHA 4BLAA 1KU3A 2W57A 3T0YA 5E20A 2ZNZA 3TOBA 3ELKA 4M73A 4LR2A 1R1TA 3IC7A 3MEXA 1RNLA 3ZMZA 4B8XA 1JE8A 1LJ9A 4KIBA 2F5FA 5EEGA 4I98B 2VODA 2LF7A 2IA0A 1O25A 4LJZF 1I1GA 1IN4A 2NVXA 3F8MA 3T8TA 3CO7C 5EEHA 2W84A 1FYMA 4ZH4F 4KASA 5K5QA 3G4CA 1BOAA 3K1MA 2XCOA 1J75A 1O2AA 1ZREA 3D0SA 5FLXK 2QBYB 1O7FA 2KWAA 2H6CA 3QX3A 5J6XA 1WCMA 5BMZA 4L0ZB 1BM9A 3GFMA 2F5CA 3TKYA 4A6EA 1JGSA 2LF8A 3WODF 3JAMK 3PFIA 3P9KA 1Y1WA 2FEZA 2ZMEB 3WU1B 3ZN0A 4WWCA 2L4MA 1ZG3A 4G6DA 5EGEA 4HLYA 1O27A 1GXQA 1IXCA 2FMYA 3N97A 1L0OC 5DYMA 4KIFA 4Q47A 3TOAA 3GTJA 1B9MA 2Q0OA 1MDMA 3EYYA 1T6SA 1R23A 3IKVA 2CFXA 4PZJA 2X0LA 2DAOA 2STWA 3CAGA 1K78B 1R00A 5BPIA 2P6SA 2HYFA 3K69A 1EH8A 2J5PA 3BZ6A 5HDNA 2RH6A 5CVJA 1BJAA 2FOKA 3FF5A 3Q9VA 3HSRA 3MFKA 1O29A 3L4JA 2XAFA 3U2RA 3VEPA 5AONA 4IPAA 2ZO4A 4CYDA 1R9TA 1D8KA 4XLPF 3I4PA 5ICFA 3RKYA 2GXBA 2XKOA 2VONA 4OINF 3TDZC 5HDKA 4U7DA 2XAGA 4RGUA 4GGGA 5ERIA 4KFCA 1HQCA 4A12A 3GTGA 3GTQA 1TNSA 1HBXG 4KUMA 4UHTA 3WE2A 4LG0B 2JA7A 1IUYA 4HQEA 4WXCA 1QNTA 1Q1HA 5HDGA 4C3HC 1YO5C 1U78A 3ZMVA 2EA4A 2XVCA 1X3UA 2OA4A 3S2WA 1GVJA 1J59A 2VBZA 4G94A 3BJ6A 1T39A 2C6YA 4A2UA 4BH9A 2OZ6A 5D6EA 5IOQA 1XDUA 4G0UA 4EV0A 3NQOA 4OIQF 5IORA 3F6VA 2V6CA 1BC7C 3M1EA 3I58A 4G7OF 4HF2A 2JRTA 3N4MA 3EETA 4P9UA 3Q9SA 1LDDA 3I59A 2Z33A 2XAJA 4FT8A 3OEPA 1FZPB 3IRRA 4KDDA 4LLLA 3V7CA 4CGZA 1RIOH 5ICCA 2DBBA 3T5XA 3LQQA 1MJAA 1CF7A 1DUXC 2EV0A 5FFZA 2CSOA 2H09A 4JQFA 5E8IA 5L3BA 4EJOA 4ESFA 1IAWA 2QUFA 3C7JA 3J80Z 3MWMA 3HTSB 3CUQA 1STZA 1HW2A 2B0LA 3GTLA 2Z3YA 3NEUA 3V7SA 2VBXA 2EK5A 2IVMA 4RGSA 5JHUA 4ENNA 4YIIA 5HS9A 2M5WA 3HSFA 2MC3A 4HLXA 3FMRA 1P6RA 3HHGA 3SHFA 4KN4X 3ULQB 5IT3A 1XXBA 4LB5A 2P5LC 4MHGA 4HOBA 2VC1A 2WV0A 3ZP5A 4AVPA 4M6XA 1UHWA 2BV6A 2VE8A 4IVNA 3WTYC 3HRTA 4L9VA 5TJ3A 3G4AA 3V8JA 1B6AA 1TWHA 3O2PE 3Q5FA 4KDPA 2PMUA 5TRDA 2P8TA 5LEKA 1ZGJA 5ILSA 3P9IA 2IT0A 1B9NA 3DXJF 2J5OA 3GEZA 2CGPA 1ZBSA 2QM3A 2XHKA 4ZYHA 1UCRA 1W4MA 2IJLA 3WTTC 3QP6A 2Q2EA 3IWZA 2CW0F 1XCBA 1BGWA 4A5NA 5FO5A 3Q3QA 3DPLC 4KYWA 4O3MA 3N3YA 3BROA 3HOTA 3OREA 4FX4A 4I7HA 1K83A 3SZTA 1MZBA 2XRNA 3MZYA 3RYPA 3R61A 1MJ9A 3FWEA 2W85A 2PJPA 3CJNA 2H94A 4KATA 1B1BA 3AH5A 4UVAA 2D45A 3KP5A 1ISEA 4BLBA 3BPVA 5ICEA 1Z05A 1JHHA 5E1XA 1O28A 3FMSA 5H20A 1WQFA 5HLHA 1AOYA 5AIQA 4U7BA 1F9NA 1XCVA 3ZMTA 2CQKA 3E6BA 3WGIA 1F5TA 2M45A 4L5JA 2QYOA 1R58A 1TLHB 2EFPA 3KP7A 5AIPA 1ULYA 4EJTA 1S7OA 2Z99A 3JW4A 3J81K 1R36A 4N9IA 2ZCWA 4MEYF 4DQ2A 1WKMA 4G9YA 2L3DA 1KQ0A 2OD5A 1EV7A 2AS5F 1IXRC 5E8GA 2YX4A 5HLGA 1FOKA 4BYYA 3HOSA 3L9FA 1KYZA 2OAZA 4LK0F 3B02A 3TO7A 4K2EA 2FMLA 2IRFG 4LQYA 3I53A 5FD5A 1ZLKA 5DD4A 4M1XA 3REOA 1NHAA 1XDSA 5CVIA 4Y13A 3HUGA 3OPFA 1O26A 1KGSA 2QENA 3KLOA 4I0AA 1WIHA 1IRGA 5DDGA 4OMYA 4M74A 1TWAA 2MLGA 4XLNF 3L7WA 1J0RA 1YW8A 5D8KB 2ESHA 1WWXA 1FYLA 5BS6A 3ZMSA 1P4WA 5BQTA 2P7CB 4KMFA 4G8XA 2M30A 3RTRA 3MCZA 3RKXA 5LGTA 4RAZA 1T38A 2CFAB 4G0WA 1SD5A 2FF4A 4N0BA 4N9HA 1O3SA 3KP4A 1J9IA 4GCVA 1YS7A 4BAYA 4TV7A 2DPUA 2P5VA 3B73A 3RKWA 1PP7U 2QVOA 2VBWA 2JT1A 2DFIA 3JTHA 1XD7A 3FM3A 2JA5A 2PLYA 3F8FA 3LQRA 1PP8F 1G3TA 3GFJA 2XV4S 2ISYA 2VT3A 1V4RA 2CO5A 1ZRFA 2VN2A 4ESBA 2YR2A 2R7ZA 2VBYA 2DI3A 2Z5UA 4HF1A 2UXNA 3JTGA 3L4KA 3LA3A 1ZH5A 5IOSA 1ONVA 2HWVA 4M6YA 4UXNA 1E17A 3F23A 1TNTA 5LHHA 1ZRCA 2HQRA 4P5BA 4EM2A 4BKWA 2M1BA 3FHZA 1GE9A 1Z7UA 3R4KA 3V8KA 4OIOF 4YFNF 1QBJA 2K4BA 3QAHA 1XSDA 1J7KA 4G0VA 1W7PB 1G3SA 1XB4A 3H92A 1TBXA 4RS8A 2NYXA 1D8JA 2OQRA 2KIUA 1B4AA 5E18F 1PUEE 3VB2A 5CVVA 2EV5A 2NS0A 1F1ZA 3ABTA 4KN7X 2G7UA 1LEBA 1XGOA 1USTA 1ZGAA 4OOIA 4IRHA 2DT5A 2PG4A 1IN7A 2GWRA 4Q48A 3ZN1A 5LLQA 3CDHA 4ZZDA 3C1DA 2G7HA 5DEQA 3BDDA 5DCMB 2V9VA 4HDVA 3BOQA 5BPDA 1I5ZA 4CZZA 4LB6B 3CTAA