5IORA

Flavin-dependent thymidylate synthase in complex with fad and 2'-deoxyuridine-5'-monosulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
216
Chain Sequence
KIDILDKGFVELVDVMGNDLSAVRAARVSFDMGKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 77
structure length 216
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iorA00
4GT9A 1O26A 4GTCA 3G4CA 4KATA 1O28A 5IOQA 5IOSA 3N3YA 4GTFA 5JFEA 2CFAA 3G4AA 2CFAB 1O27A 1O2BA 1O24A 4GTDA 5CHPA 4KARA 4GTBA 1O2AA 5IORA 5IOTA 1O29A 1O25A 3N0BA 4KASA 4P5BA 4FZBA 3N0CA 4GTAA 4P5AA 3AH5A 1KQ4A 4GTLA 4GTEA
chains in the Genus database with same CATH superfamily
3HOXC 1DD5A 1TWFC 4KB4A 4GZYA 4LK1A 4Y7NC 5IOSA 4GTFA 3S14C 1WQGA 3HKZD 1SFOK 2R7ZA 1XXBA 2A6EA 4QIWD 2R7ZC 5M5WK 4A3MK 1GE9A 4AH6A 2GSNA 4WILA 1KQ4A 4GTLA 1INNA 4A3BK 1HQMA 3GTQK 3GTJK 2R92A 5L46A 1JOEA 2R92C 3H3VL 4O2DA 4BBSC 3HOVK 3I4NC 1YNJA 4A3DC 3S1RC 2JA5A 3I4MC 3N0BA 1Y1WK 2JA5C 2NVYA 3N0CA 1I6HC 2NVYC 3FOFA 4A3EC 4LQYA 4BLAA 1PJ5A 3HOZC 4GTCA 5FLMC 4OIRA 1TWCK 1WSVA 2VUMA 5CJ9A 3FOEA 2VUMC 1Y1VA 3HOWK 4KMAA 5D4DA 3GSIA 3GEIA 1Y1VC 4A93C 4JK1A 3K7AK 1ZBSA 4C3HK 1O29A 3CAGA 1BJTA 3OEPA 5M3FK 2XCQA 4YFNA 4GTEA 1X31C 4A3IK 1F93A 3ADAC 2XCOA 1I50A 2E2IA 1WSRA 3GTGK 4LJZA 2E2IC 3S1NK 1SFOA 3AD8C 1JVIA 3GEHA 1EH1A 1EK8A 1TWHK 1SFOC 4ZH4A 4BBRK 2JA6K 1XXCA 2BE5A 4A3MC 4A3LK 1R9TK 2E2JC 3GTQA 1ISEA 4BKWA 3TFJA 3S1RK 3M4OK 4A3BC 3GTQC 2RGRA 4G0VA 3GTJC 1IBAA 1DCHA 4G0UA 4OINA 3H3VD 3GTKA 3S16K 5IYCK 1XXAA 1DCOA 4KB2A 4A3EK 2YU9K 1G51A 3HOVC 5JFEA 4PABA 4Q5SA 5CHPA 3WODA 5C4JK 1F7UA 1XPPA 4KMHA 4GTBA 3H0GK 4FZBA 1WQHA 3S2DK 3GTOK 2KWAA 1TWCA 1TWCC 2ZFZA 3HOWC 4X6AK 1I50K 4MEXA 2E2IK 3K7AC 3T00A 3GTLA 4C3HC 3A8KA 2JH3A 3BUEA 3PO3K 3S1MK 1SMYA 5JVOA 2P8TA 1ZYRA 4KC6A 4C3IK 2R93A 3GTGA 3LAPA 4A3IC 3GTGC 2E2JK 1VH2A 5TJ3A 3S1NC 4KN7A 1TWHA 1EQRA 3GIRA 4GT9A 3LAJA 2JA6A 1TWHC 5E68A 4BBRC 2JA6C 1TWGK 5M5XK 4LR2A 1WIHA 3MMLB 1USOA 3GTKK 3EQLA 1R9TA 5EGHA 2O5IA 4A3LC 1R9TC 3GTMK 1IQ0A 4NOIA 3NUHA 3M4OC 4RMFA 1O2AA 2FQOA 3AD7C 1J98A 4P5BA 1K83K 5M5YK 3S16C 5IYCC 5TMFA 3LPXA 2YU9A 5C4XK 4BXXK 3S2HK 1V5VA 2YU9C 5EGEA 3G4CA 5IOQA 1WORA 4BY1K 5TMCA 3G4AA 5C4JC 4G7ZA 4OIOA 3H0GA 3JSTA 4C2MK 4FM9A 3H0GC 3GTOA 1AB4A 3S2DC 3GTOC 4XLNA 3HXAA 2V6SA 3T02A 3GTLK 3L4KA 3DXJA 2O5JA 3QX3A 4XSXA 4G7HA 4GTAA 2NVXK 1VGXA 2Y3PA 3TFHA 1WOSA 2R93K 4X6AC 4AYBL 5HL8A 3M3YK 4WJ4A 1O2FB 1I50C 2PMZL 4YFXA 4Y52C 3A8IA 3PO3C 5C3EK 5M3MK 2WB1L 3S1MC 1TWAK 2V6TA 4XCHA 4C3IC 1L0WA 4LOWA 2V6UA 4DDQA 1PJ7A 4BLBA 2PA8L 1TWGA 4C45A 2A6HA 1ZQ1C 1TWGC 3RZDK 5IP7C 1HI9A 1I3QK 3OPFA 4WJ3M 3GTKC 4KAWX 2B63K 2Y0SL 3GTMA 3HOYK 3GTMC 1IE0A 2CFAA 1K83A 2NVTK 4J3NA 1VRQC 2E2HK 4KARA 1K83C 1EI6A 3AQOA 3L4JA 4OIQA 3PO2K 5C4XC 1XZPB 4BXXC 3S2HC 4GFQA 2JA7A 1IW7A 2JA7C 4BY7K 5IP9K 3FKIK 3GTPK 1O26A 4BY1C 4A3GK 2PHCB 1IS1A 1XZQA 4KM8A 2XCRB 4C2MC 4XLPA 3GEEA 4Y52K 3S0XA 2WAQL 4MQ9A 3GTLC 3GDZA 5IOTA 3RZOK 2NVXA 4QJVA 3VA7A 1YNNA 3S15K 2NVXC 3OREA 4AYBD 1XZPA 1VJEA 1B4AA 4A3JC 4P5AA 2PMZD 2R93C 4XSZA 4A3CK 3M3YC 5IYBK 4LK0A 2WB1D 1TWAA 1WOPA 5C3EC 1TWAC 1F9NA 3Q3QA 5IP7K 1UV7A 5C44C 1WQFA 1YCLA 4KDDA 3TFIA 2PA8D 3BP8C 1B4BA 2NVQK 3AQPA 1I3QA 3SZZA 1I6VA 2GSOA 2Y0SD 4YFKA 3RZDC 2B63A 1J6XA 1I3QC 5IYDK 2D6FC 2B63C 3HOYC 3A8JA 2FQTA 4A3FK 3BP3A 2JA7K 2JA8K 1C0AA 2E2HA 3SZYA 2NVTC 1RU0A 3S1QC 3TTGA 4ILDA 1O27A 4A3KK 2E2HC 4C3JK 1O24A 4PAAA 1USMA 3PO2C 3CQZA 1JQWA 2GAHC 3S17C 1PJ6A 1O25A 2EBBA 3CQZC 1BDFA 3FKIA 4KMDA 3GTPA 1J6WA 4BY7C 5IP9C 3FKIC 4G0WA 1BS2A 4MEYA 3GTPC 3IPJA 4LLGA 1J6VA 3HOUK 4A3GC 4P9SA 4A3JK 1WCMK 1YX2A 2W7VA 3HOXK 1ZXOA 2WAQD 1TWFK 2GSUA 4Q4ZA 1VLOA 2CFAB 1O2BA 4Y7NK 2CW0A 3RZOC 4KM9A 1IL2A 1F7VA 3S15C 2A69A 3S14K 5C44K 5IORA 2GAGC 1DCPA 3HKZL 2R7ZK 4A3CC 5IYBC 4QIWL 3AH5A 2A68A 4KN4A 1EFWA 3AD9C 1O28A 1XZQB 3N3YA 2R92K 2ZUFA 3ERED 4M1XA 4BBSK 4OIPA 3I4NK 2RH6A 3S1QK 2NVQC 3V4GA 3T01A 4A3DK 4QJVB 3GTJA 4KASA 5IYDC 3I4MK 3S17K 2JA5K 2PPBA 3CQZK 4A3FC 1BGWA 1I6HK 2NVYK 2JA8C 4G7OA 4KATA 3HOZK 4A3KC 4C3JC 5FLMK 4KMUA 1Y1WA 1Y1WC 4GTDA 2VUMK 1ZVUA 1Y1VK 4YG2A 4A93K 1WOOA 3FHZA 2P5MA 1WCMA 3HOUC 5FJ8K 1WCMC 1TWFA 2ZUEA
chains in the Genus database with same CATH topology
1DD5A 1XXAA 2Y3PA 4KB4A 4KB2A 5IOSA 2E2HA 4GTFA 5JFEA 4ILDA 1O27A 1WQGA 1O24A 2R7ZA 1XXBA 5CHPA 4C3IC 3CQZA 4KMHA 4GTBA 1O25A 3FKIA 4KMDA 4FZBA 3GTPA 1GE9A 4DDQA 1WQHA 2GSNA 4G0WA 1KQ4A 4GTLA 2KWAA 1TWCA 4BLBA 1TWGA 2ZFZA 2R92A 3OPFA 4KAWX 1ZXOA 3GTMA 2GSUA 2CFAA 2CFAB 3GTLA 1O2BA 4C3HC 4KM9A 2JH3A 1K83A 3BUEA 4J3NA 5JVOA 4KARA 4KC6A 2JA5A 5IORA 3N0BA 2R93A 3AQOA 3L4JA 2NVYA 3GTGA 3N0CA 3LAPA 4GFQA 3AH5A 3FOFA 2JA7A 5TJ3A 4LQYA 4BLAA 1TWHA 3LAJA 4GT9A 1O26A 2JA6A 4GTCA 2PHCB 2VUMA 1IS1A 1O28A 4LR2A 5CJ9A 4KM8A 2XCRB 3FOEA 3N3YA 1WIHA 1Y1VA 3MMLB 4KMAA 4C2MC 1R9TA 5EGHA 3ERED 3S0XA 4M1XA 1ZBSA 3NUHA 2RH6A 3V4GA 1O2AA 5IOTA 2NVXA 1O29A 3CAGA 3VA7A 3GTJA 1BJTA 4KASA 4P5BA 3OREA 3OEPA 1B4AA 4P5AA 3LPXA 2XCQA 2YU9A 4GTEA 2XCOA 1BGWA 1I50A 2E2IA 5EGEA 3G4CA 1SFOA 1TWAA 4KATA 5IOQA 1EH1A 1EK8A 4C3JC 1F9NA 3Q3QA 1Y1WA 3G4AA 1WQFA 1XXCA 3H0GA 4GTDA 4KDDA 4FM9A 1ZVUA 3GTOA 1AB4A 1B4BA 3FHZA 3GTQA 1ISEA 4BKWA 3L4KA 2P5MA 1WCMA 3QX3A 3AQPA 1I3QA 4GTAA 2GSOA 2RGRA 4G0VA 2B63A 1TWFA 4G0UA 3GTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GT9 A;  1O26 A;  4GTC A;  3G4C A;  4KAT A;  1O28 A;  5IOQ A;  5IOS A;  3N3Y A;  4GTF A;  5JFE A;  2CFA A;  3G4A A;  2CFA B;  1O27 A;  1O2B A;  1O24 A;  4GTD A;  5CHP A;  4KAR A;  4GTB A;  1O2A A;  5IOR A;  5IOT A;  1O29 A;  1O25 A;  3N0B A;  4KAS A;  4P5B A;  4FZB A;  3N0C A;  4GTA A;  4P5A A;  3AH5 A;  1KQ4 A;  4GTL A;  4GTE A; 
#chains in the Genus database with same CATH topology
 3HOX C;  1DD5 A;  1TWF C;  4KB4 A;  4GZY A;  4LK1 A;  4Y7N C;  5IOS A;  4GTF A;  3S14 C;  1WQG A;  3HKZ D;  1SFO K;  2R7Z A;  1XXB A;  2A6E A;  4QIW D;  2R7Z C;  5M5W K;  4A3M K;  1GE9 A;  4AH6 A;  2GSN A;  4WIL A;  1KQ4 A;  4GTL A;  1INN A;  4A3B K;  1HQM A;  3GTQ K;  3GTJ K;  2R92 A;  5L46 A;  1JOE A;  2R92 C;  3H3V L;  4O2D A;  4BBS C;  3HOV K;  3I4N C;  1YNJ A;  4A3D C;  3S1R C;  2JA5 A;  3I4M C;  3N0B A;  1Y1W K;  2JA5 C;  2NVY A;  3N0C A;  1I6H C;  2NVY C;  3FOF A;  4A3E C;  4LQY A;  4BLA A;  1PJ5 A;  3HOZ C;  4GTC A;  5FLM C;  4OIR A;  1TWC K;  1WSV A;  2VUM A;  5CJ9 A;  3FOE A;  2VUM C;  1Y1V A;  3HOW K;  4KMA A;  5D4D A;  3GSI A;  3GEI A;  1Y1V C;  4A93 C;  4JK1 A;  3K7A K;  1ZBS A;  4C3H K;  1O29 A;  3CAG A;  1BJT A;  3OEP A;  5M3F K;  2XCQ A;  4YFN A;  4GTE A;  1X31 C;  4A3I K;  1F93 A;  3ADA C;  2XCO A;  1I50 A;  2E2I A;  1WSR A;  3GTG K;  4LJZ A;  2E2I C;  3S1N K;  1SFO A;  3AD8 C;  1JVI A;  3GEH A;  1EH1 A;  1EK8 A;  1TWH K;  1SFO C;  4ZH4 A;  4BBR K;  2JA6 K;  1XXC A;  2BE5 A;  4A3M C;  4A3L K;  1R9T K;  2E2J C;  3GTQ A;  1ISE A;  4BKW A;  3TFJ A;  3S1R K;  3M4O K;  4A3B C;  3GTQ C;  2RGR A;  4G0V A;  3GTJ C;  1IBA A;  1DCH A;  4G0U A;  4OIN A;  3H3V D;  3GTK A;  3S16 K;  5IYC K;  1XXA A;  1DCO A;  4KB2 A;  4A3E K;  2YU9 K;  1G51 A;  3HOV C;  5JFE A;  4PAB A;  4Q5S A;  5CHP A;  3WOD A;  5C4J K;  1F7U A;  1XPP A;  4KMH A;  4GTB A;  3H0G K;  4FZB A;  1WQH A;  3S2D K;  3GTO K;  2KWA A;  1TWC A;  1TWC C;  2ZFZ A;  3HOW C;  4X6A K;  1I50 K;  4MEX A;  2E2I K;  3K7A C;  3T00 A;  3GTL A;  4C3H C;  3A8K A;  2JH3 A;  3BUE A;  3PO3 K;  3S1M K;  1SMY A;  5JVO A;  2P8T A;  1ZYR A;  4KC6 A;  4C3I K;  2R93 A;  3GTG A;  3LAP A;  4A3I C;  3GTG C;  2E2J K;  1VH2 A;  5TJ3 A;  3S1N C;  4KN7 A;  1TWH A;  1EQR A;  3GIR A;  4GT9 A;  3LAJ A;  2JA6 A;  1TWH C;  5E68 A;  4BBR C;  2JA6 C;  1TWG K;  5M5X K;  4LR2 A;  1WIH A;  3MML B;  1USO A;  3GTK K;  3EQL A;  1R9T A;  5EGH A;  2O5I A;  4A3L C;  1R9T C;  3GTM K;  1IQ0 A;  4NOI A;  3NUH A;  3M4O C;  4RMF A;  1O2A A;  2FQO A;  3AD7 C;  1J98 A;  4P5B A;  1K83 K;  5M5Y K;  3S16 C;  5IYC C;  5TMF A;  3LPX A;  2YU9 A;  5C4X K;  4BXX K;  3S2H K;  1V5V A;  2YU9 C;  5EGE A;  3G4C A;  5IOQ A;  1WOR A;  4BY1 K;  5TMC A;  3G4A A;  5C4J C;  4G7Z A;  4OIO A;  3H0G A;  3JST A;  4C2M K;  4FM9 A;  3H0G C;  3GTO A;  1AB4 A;  3S2D C;  3GTO C;  4XLN A;  3HXA A;  2V6S A;  3T02 A;  3GTL K;  3L4K A;  3DXJ A;  2O5J A;  3QX3 A;  4XSX A;  4G7H A;  4GTA A;  2NVX K;  1VGX A;  2Y3P A;  3TFH A;  1WOS A;  2R93 K;  4X6A C;  4AYB L;  5HL8 A;  3M3Y K;  4WJ4 A;  1O2F B;  1I50 C;  2PMZ L;  4YFX A;  4Y52 C;  3A8I A;  3PO3 C;  5C3E K;  5M3M K;  2WB1 L;  3S1M C;  1TWA K;  2V6T A;  4XCH A;  4C3I C;  1L0W A;  4LOW A;  2V6U A;  4DDQ A;  1PJ7 A;  4BLB A;  2PA8 L;  1TWG A;  4C45 A;  2A6H A;  1ZQ1 C;  1TWG C;  3RZD K;  5IP7 C;  1HI9 A;  1I3Q K;  3OPF A;  4WJ3 M;  3GTK C;  4KAW X;  2B63 K;  2Y0S L;  3GTM A;  3HOY K;  3GTM C;  1IE0 A;  2CFA A;  1K83 A;  2NVT K;  4J3N A;  1VRQ C;  2E2H K;  4KAR A;  1K83 C;  1EI6 A;  3AQO A;  3L4J A;  4OIQ A;  3PO2 K;  5C4X C;  1XZP B;  4BXX C;  3S2H C;  4GFQ A;  2JA7 A;  1IW7 A;  2JA7 C;  4BY7 K;  5IP9 K;  3FKI K;  3GTP K;  1O26 A;  4BY1 C;  4A3G K;  2PHC B;  1IS1 A;  1XZQ A;  4KM8 A;  2XCR B;  4C2M C;  4XLP A;  3GEE A;  4Y52 K;  3S0X A;  2WAQ L;  4MQ9 A;  3GTL C;  3GDZ A;  5IOT A;  3RZO K;  2NVX A;  4QJV A;  3VA7 A;  1YNN A;  3S15 K;  2NVX C;  3ORE A;  4AYB D;  1XZP A;  1VJE A;  1B4A A;  4A3J C;  4P5A A;  2PMZ D;  2R93 C;  4XSZ A;  4A3C K;  3M3Y C;  5IYB K;  4LK0 A;  2WB1 D;  1TWA A;  1WOP A;  5C3E C;  1TWA C;  1F9N A;  3Q3Q A;  5IP7 K;  1UV7 A;  5C44 C;  1WQF A;  1YCL A;  4KDD A;  3TFI A;  2PA8 D;  3BP8 C;  1B4B A;  2NVQ K;  3AQP A;  1I3Q A;  3SZZ A;  1I6V A;  2GSO A;  2Y0S D;  4YFK A;  3RZD C;  2B63 A;  1J6X A;  1I3Q C;  5IYD K;  2D6F C;  2B63 C;  3HOY C;  3A8J A;  2FQT A;  4A3F K;  3BP3 A;  2JA7 K;  2JA8 K;  1C0A A;  2E2H A;  3SZY A;  2NVT C;  1RU0 A;  3S1Q C;  3TTG A;  4ILD A;  1O27 A;  4A3K K;  2E2H C;  4C3J K;  1O24 A;  4PAA A;  1USM A;  3PO2 C;  3CQZ A;  1JQW A;  2GAH C;  3S17 C;  1PJ6 A;  1O25 A;  2EBB A;  3CQZ C;  1BDF A;  3FKI A;  4KMD A;  3GTP A;  1J6W A;  4BY7 C;  5IP9 C;  3FKI C;  4G0W A;  1BS2 A;  4MEY A;  3GTP C;  3IPJ A;  4LLG A;  1J6V A;  3HOU K;  4A3G C;  4P9S A;  4A3J K;  1WCM K;  1YX2 A;  2W7V A;  3HOX K;  1ZXO A;  2WAQ D;  1TWF K;  2GSU A;  4Q4Z A;  1VLO A;  2CFA B;  1O2B A;  4Y7N K;  2CW0 A;  3RZO C;  4KM9 A;  1IL2 A;  1F7V A;  3S15 C;  2A69 A;  3S14 K;  5C44 K;  5IOR A;  2GAG C;  1DCP A;  3HKZ L;  2R7Z K;  4A3C C;  5IYB C;  4QIW L;  3AH5 A;  2A68 A;  4KN4 A;  1EFW A;  3AD9 C;  1O28 A;  1XZQ B;  3N3Y A;  2R92 K;  2ZUF A;  3ERE D;  4M1X A;  4BBS K;  4OIP A;  3I4N K;  2RH6 A;  3S1Q K;  2NVQ C;  3V4G A;  3T01 A;  4A3D K;  4QJV B;  3GTJ A;  4KAS A;  5IYD C;  3I4M K;  3S17 K;  2JA5 K;  2PPB A;  3CQZ K;  4A3F C;  1BGW A;  1I6H K;  2NVY K;  2JA8 C;  4G7O A;  4KAT A;  3HOZ K;  4A3K C;  4C3J C;  5FLM K;  4KMU A;  1Y1W A;  1Y1W C;  4GTD A;  2VUM K;  1ZVU A;  1Y1V K;  4YG2 A;  4A93 K;  1WOO A;  3FHZ A;  2P5M A;  1WCM A;  3HOU C;  5FJ8 K;  1WCM C;  1TWF A;  2ZUE A; 
#chains in the Genus database with same CATH homology
 1DD5 A;  1XXA A;  2Y3P A;  4KB4 A;  4KB2 A;  5IOS A;  2E2H A;  4GTF A;  5JFE A;  4ILD A;  1O27 A;  1WQG A;  1O24 A;  2R7Z A;  1XXB A;  5CHP A;  4C3I C;  3CQZ A;  4KMH A;  4GTB A;  1O25 A;  3FKI A;  4KMD A;  4FZB A;  3GTP A;  1GE9 A;  4DDQ A;  1WQH A;  2GSN A;  4G0W A;  1KQ4 A;  4GTL A;  2KWA A;  1TWC A;  4BLB A;  1TWG A;  2ZFZ A;  2R92 A;  3OPF A;  4KAW X;  1ZXO A;  3GTM A;  2GSU A;  2CFA A;  2CFA B;  3GTL A;  1O2B A;  4C3H C;  4KM9 A;  2JH3 A;  1K83 A;  3BUE A;  4J3N A;  5JVO A;  4KAR A;  4KC6 A;  2JA5 A;  5IOR A;  3N0B A;  2R93 A;  3AQO A;  3L4J A;  2NVY A;  3GTG A;  3N0C A;  3LAP A;  4GFQ A;  3AH5 A;  3FOF A;  2JA7 A;  5TJ3 A;  4LQY A;  4BLA A;  1TWH A;  3LAJ A;  4GT9 A;  1O26 A;  2JA6 A;  4GTC A;  2PHC B;  2VUM A;  1IS1 A;  1O28 A;  4LR2 A;  5CJ9 A;  4KM8 A;  2XCR B;  3FOE A;  3N3Y A;  1WIH A;  1Y1V A;  3MML B;  4KMA A;  4C2M C;  1R9T A;  5EGH A;  3ERE D;  3S0X A;  4M1X A;  1ZBS A;  3NUH A;  2RH6 A;  3V4G A;  1O2A A;  5IOT A;  2NVX A;  1O29 A;  3CAG A;  3VA7 A;  3GTJ A;  1BJT A;  4KAS A;  4P5B A;  3ORE A;  3OEP A;  1B4A A;  4P5A A;  3LPX A;  2XCQ A;  2YU9 A;  4GTE A;  2XCO A;  1BGW A;  1I50 A;  2E2I A;  5EGE A;  3G4C A;  1SFO A;  1TWA A;  4KAT A;  5IOQ A;  1EH1 A;  1EK8 A;  4C3J C;  1F9N A;  3Q3Q A;  1Y1W A;  3G4A A;  1WQF A;  1XXC A;  3H0G A;  4GTD A;  4KDD A;  4FM9 A;  1ZVU A;  3GTO A;  1AB4 A;  1B4B A;  3FHZ A;  3GTQ A;  1ISE A;  4BKW A;  3L4K A;  2P5M A;  1WCM A;  3QX3 A;  3AQP A;  1I3Q A;  4GTA A;  2GSO A;  2RGR A;  4G0V A;  2B63 A;  1TWF A;  4G0U A;  3GTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...