5IORA

Flavin-dependent thymidylate synthase in complex with fad and 2'-deoxyuridine-5'-monosulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
216
Chain Sequence
KIDILDKGFVELVDVMGNDLSAVRAARVSFDMGKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 77
structure length 216
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iorA00
1O27A 1O29A 4GTFA 4P5BA 4GTAA 4GTLA 1O2AA 3N0BA 5IOQA 4GTDA 4KASA 3N3YA 2CFAB 4GTBA 4P5AA 4FZBA 1O25A 1O2BA 3G4AA 1O28A 1O26A 4GTCA 1O24A 4KARA 4GT9A 5IORA 5JFEA 3G4CA 5CHPA 4KATA 5IOTA 2CFAA 5IOSA 1KQ4A 4GTEA 3N0CA 3AH5A
chains in the Genus database with same CATH superfamily
3GSIA 2JA7C 4BXXK 4A93C 1TWFC 3GTKK 3HOUK 1J98A 5IYBK 1O2AA 2WAQL 1XXAA 4A3JC 1DCHA 2JA5K 4MEYA 2YU9K 4BY7K 2PA8D 3AQOA 1WORA 2ZUEA 4C3IC 2FQOA 4A3LC 5L46A 3S0XA 4G7HA 5M5YK 4YFKA 2CFAA 1IS1A 1WQHA 4A3DK 1ZQ1C 3BUEA 5IYCC 1TWHA 4KN4A 1TWFK 2VUMK 5EGEA 2R93C 1TWHC 3N0BA 3M4OC 3CQZC 2A69A 2E2IK 2R92C 3VA7A 4P5AA 3K7AK 4A3MK 4C3IK 3T00A 5IOTA 4ZH4A 1ZYRA 4Q4ZA 3S1NC 2O5JA 5FLMC 5IYDK 1TWCA 2R93K 1XZPA 4KM8A 4BY1C 3BP3A 4KB4A 5C4JK 4XLNA 1VH2A 5C3EK 2XCQA 4Y7NK 1K83A 2BE5A 4A3CC 5HL8A 3S17K 5TMCA 5IP7C 3RZOC 3G4AA 1BJTA 3CQZA 4Y52C 4G7OA 3S1NK 4WJ3M 1WQGA 3AD8C 3GTGK 3WODA 5FLMK 2B63K 3JSTA 1R9TK 2NVXA 1VLOA 3GTJK 1WOPA 3A8IA 4A3EK 3HOVC 2XCOA 2JA6C 3HOYC 1WQFA 3CAGA 1I6VA 4GTBA 1TWCC 2NVTC 1XZQA 3S1QC 3GTOC 2R7ZA 3ADAC 1O28A 3I4MC 5IYBC 1B4AA 4KMUA 3LAJA 5M3MK 1BDFA 2ZUFA 2R7ZC 2R92A 4X6AC 1JOEA 1ZBSA 1TWAK 1I3QC 2YU9C 3GTQK 1DD5A 1I6HK 2B63C 3TFJA 4NOIA 3ERED 4KDDA 1ZVUA 3AD7C 5M3FK 4OIOA 3GTOK 2RH6A 4AYBL 4BXXC 1K83C 3M4OK 2JH3A 2WB1D 3FKIK 5IP9C 3HKZD 4BBRK 2JA8C 3GTLA 2XCRB 1C0AA 1USOA 3S14C 2NVQK 1O27A 3SZYA 1J6WA 4DDQA 2YU9A 3LAPA 4QJVB 3S2HK 2NVYK 4XLPA 3MMLB 3T02A 3S1RC 4BY1K 3HOWC 1K83K 1O24A 5IORA 4P9SA 4BBRC 3A8KA 2VUMA 4MEXA 3S14K 4KMDA 1GE9A 2NVQC 5IP7K 1YNNA 3EQLA 5E68A 3M3YC 4KC6A 4GTFA 4KAWX 3HOXK 3GEHA 4GTAA 2B63A 2GSUA 3HKZL 2WB1L 4A3KC 2NVXK 1IL2A 3L4JA 4RMFA 3HOWK 3T01A 1DCOA 3S1MC 2V6TA 4KATA 5C44C 3GDZA 5C4JC 4G0WA 3PO2K 3GEEA 4LK1A 5C3EC 3AH5A 4GTEA 4C2MC 4A3CK 2JA6A 1TWAA 1Y1VK 1WOSA 3GTPA 1IW7A 2PMZD 4A3KK 2RGRA 1INNA 4C3JK 4YFNA 1TWGK 4KMAA 4LLGA 1XZPB 3GTGC 3S16C 4QIWL 5EGHA 1I3QA 3RZDC 3GTGA 3G4CA 4BLAA 4C45A 3OPFA 5C44K 3A8JA 4BBSK 3HOYK 3Q3QA 4C2MK 1XXCA 3S1QK 1Y1VC 3TTGA 2VUMC 3H0GK 1BS2A 2R7ZK 4X6AK 1TWGC 1SMYA 3NUHA 1TWAC 4A3FC 3S15C 2R92K 1I6HC 1L0WA 2E2JC 2V6SA 4M1XA 4GTCA 3GTLC 5CJ9A 5C4XK 2E2HK 4G7ZA 1WCMA 3S1RK 4P5BA 2JA7K 4XSZA 4QJVA 3GTMA 5JVOA 4A3GC 4G0VA 4BKWA 1BGWA 1JVIA 4GTDA 4C3HK 1EI6A 1PJ6A 3PO3C 4A3FK 4Y7NC 4BY7C 3M3YK 3LPXA 3FKIA 2PPBA 2PHCB 4AH6A 2W7VA 3GTLK 1O26A 4GT9A 4XCHA 2E2HC 3H3VD 3DXJA 1UV7A 5TMFA 3FHZA 4BLBA 1O2FB 3S2HC 3I4NC 2NVYC 4FM9A 3HXAA 3QX3A 1EK8A 4A3GK 4A3EC 3HOVK 2NVYA 2WAQD 4GTLA 4LQYA 4OIQA 2JA6K 3PO2C 1WCMC 3PO3K 2E2IC 1Y1VA 4KB2A 1ZXOA 1Y1WA 4A3MC 1XPPA 3IPJA 1RU0A 1Y1WC 4PAAA 1J6VA 3OEPA 2FQTA 4YG2A 5JFEA 4C3JC 4G0UA 2V6UA 4A3BK 4KM9A 1I3QK 1HI9A 4KN7A 3GTPC 4A3IK 4O2DA 3H3VL 1V5VA 3S1MK 1J6XA 1EQRA 3GTMC 3GTKA 4Q5SA 4LOWA 1YX2A 3TFIA 3RZOK 4JK1A 1G51A 3HOUC 4KARA 2JA5A 4ILDA 4A3JK 2GSNA 1IBAA 3FKIC 5CHPA 5IP9K 1WOOA 4A3BC 2JA8K 3S15K 1X31C 3GTPK 5M5XK 4WILA 2E2JK 3SZZA 2PA8L 3GEIA 1YCLA 1O29A 1TWGA 4LR2A 3S16K 1B4BA 3RZDK 2JA7A 2P5MA 1TWFA 4KASA 3GTMK 1F9NA 1SFOK 1F93A 4OINA 1EFWA 1I50A 5IYCK 1XZQB 4BBSC 3BP8C 4QIWD 2CW0A 2P8TA 2KWAA 3I4MK 4PABA 1ISEA 4OIRA 1PJ5A 4AYBD 4C3HC 3GTKC 4LK0A 3GTQC 3K7AC 5TJ3A 3TFHA 3AD9C 3L4KA 2GSOA 1DCPA 3H0GA 2A6HA 3HOXC 4A3LK 2PMZL 5FJ8K 5D4DA 1F7UA 5C4XC 1SFOC 2Y0SD 4KMHA 3I4NK 1WSVA 2E2HA 1HQMA 4A3DC 1PJ7A 3V4GA 2GAGC 1WIHA 1XXBA 3AQPA 1WCMK 2GAHC 2ZFZA 1TWHK 2A68A 4XSXA 3CQZK 5IOSA 4MQ9A 3FOFA 3S17C 4Y52K 2E2IA 1YNJA 4GFQA 4WJ4A 3S2DK 3OREA 3N3YA 5M5WK 3HOZC 1IE0A 3GTJC 2D6FC 4GZYA 2EBBA 1WSRA 1O25A 1IQ0A 5IYDC 1VRQC 1I50C 2Y3PA 1TWCK 2NVTK 1F7VA 2R93A 4YFXA 4J3NA 2CFAB 3N0CA 1AB4A 4A93K 3GTQA 1Y1WK 1VJEA 3S2DC 1JQWA 1USMA 2NVXC 5IOQA 3H0GC 4OIPA 3HOZK 2JA5C 2Y0SL 1VGXA 4FZBA 1EH1A 4LJZA 4A3IC 1O2BA 2O5IA 1R9TC 1SFOA 1I50K 3GTOA 1R9TA 3GTJA 1KQ4A 3GIRA 2A6EA 3FOEA
chains in the Genus database with same CATH topology
1O29A 4KDDA 1TWGA 1ZVUA 4LR2A 1B4BA 1O2AA 2JA7A 1XXAA 2P5MA 1TWFA 3NUHA 4KASA 1F9NA 1I50A 3AQOA 2RH6A 2KWAA 4M1XA 4C3IC 4GTCA 5CJ9A 1ISEA 2JH3A 4C3HC 3S0XA 3GTLA 2XCRB 2CFAA 1IS1A 1WQHA 5TJ3A 1WCMA 3L4KA 2GSOA 4P5BA 3H0GA 3BUEA 1TWHA 1O27A 5EGEA 3GTMA 5JVOA 4DDQA 4G0VA 4BKWA 2YU9A 3LAPA 1BGWA 3N0BA 4GTDA 4KMHA 3VA7A 3LPXA 2E2HA 3FKIA 3MMLB 4P5AA 3V4GA 2PHCB 1WIHA 1XXBA 1O26A 1O24A 5IORA 4GT9A 3AQPA 2ZFZA 5IOTA 3FHZA 2VUMA 4BLBA 5IOSA 4KMDA 3FOFA 1GE9A 4FM9A 3QX3A 4KC6A 1TWCA 1EK8A 4GTFA 4KM8A 4KAWX 2E2IA 2NVYA 4GFQA 4GTAA 4GTLA 2GSUA 4KB4A 4LQYA 2B63A 3OREA 3L4JA 2XCQA 3N3YA 1K83A 1Y1VA 4KB2A 1ZXOA 1Y1WA 1O25A 3OEPA 3G4AA 1BJTA 3CQZA 5JFEA 4C3JC 4G0UA 2Y3PA 4KATA 4G0WA 2R93A 4KM9A 1WQGA 3AH5A 4GTEA 4J3NA 3N0CA 2CFAB 4C2MC 2JA6A 2NVXA 1TWAA 1AB4A 3GTQA 2XCOA 3GTPA 2RGRA 5IOQA 1WQFA 3CAGA 4GTBA 3GTKA 4KMAA 4FZBA 2R7ZA 1EH1A 1O2BA 5EGHA 1O28A 1SFOA 4KARA 1I3QA 2JA5A 1B4AA 3LAJA 4ILDA 3GTGA 3G4CA 4BLAA 2GSNA 3GTOA 2R92A 3OPFA 5CHPA 1R9TA 1ZBSA 3GTJA 1DD5A 3Q3QA 1KQ4A 1XXCA 3ERED 3FOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O27 A;  1O29 A;  4GTF A;  4P5B A;  4GTA A;  4GTL A;  1O2A A;  3N0B A;  5IOQ A;  4GTD A;  4KAS A;  3N3Y A;  2CFA B;  4GTB A;  4P5A A;  4FZB A;  1O25 A;  1O2B A;  3G4A A;  1O28 A;  1O26 A;  4GTC A;  1O24 A;  4KAR A;  4GT9 A;  5IOR A;  5JFE A;  3G4C A;  5CHP A;  4KAT A;  5IOT A;  2CFA A;  5IOS A;  1KQ4 A;  4GTE A;  3N0C A;  3AH5 A; 
#chains in the Genus database with same CATH topology
 3GSI A;  2JA7 C;  4BXX K;  4A93 C;  1TWF C;  3GTK K;  3HOU K;  1J98 A;  5IYB K;  1O2A A;  2WAQ L;  1XXA A;  4A3J C;  1DCH A;  2JA5 K;  4MEY A;  2YU9 K;  4BY7 K;  2PA8 D;  3AQO A;  1WOR A;  2ZUE A;  4C3I C;  2FQO A;  4A3L C;  5L46 A;  3S0X A;  4G7H A;  5M5Y K;  4YFK A;  2CFA A;  1IS1 A;  1WQH A;  4A3D K;  1ZQ1 C;  3BUE A;  5IYC C;  1TWH A;  4KN4 A;  1TWF K;  2VUM K;  5EGE A;  2R93 C;  1TWH C;  3N0B A;  3M4O C;  3CQZ C;  2A69 A;  2E2I K;  2R92 C;  3VA7 A;  4P5A A;  3K7A K;  4A3M K;  4C3I K;  3T00 A;  5IOT A;  4ZH4 A;  1ZYR A;  4Q4Z A;  3S1N C;  2O5J A;  5FLM C;  5IYD K;  1TWC A;  2R93 K;  1XZP A;  4KM8 A;  4BY1 C;  3BP3 A;  4KB4 A;  5C4J K;  4XLN A;  1VH2 A;  5C3E K;  2XCQ A;  4Y7N K;  1K83 A;  2BE5 A;  4A3C C;  5HL8 A;  3S17 K;  5TMC A;  5IP7 C;  3RZO C;  3G4A A;  1BJT A;  3CQZ A;  4Y52 C;  4G7O A;  3S1N K;  4WJ3 M;  1WQG A;  3AD8 C;  3GTG K;  3WOD A;  5FLM K;  2B63 K;  3JST A;  1R9T K;  2NVX A;  1VLO A;  3GTJ K;  1WOP A;  3A8I A;  4A3E K;  3HOV C;  2XCO A;  2JA6 C;  3HOY C;  1WQF A;  3CAG A;  1I6V A;  4GTB A;  1TWC C;  2NVT C;  1XZQ A;  3S1Q C;  3GTO C;  2R7Z A;  3ADA C;  1O28 A;  3I4M C;  5IYB C;  1B4A A;  4KMU A;  3LAJ A;  5M3M K;  1BDF A;  2ZUF A;  2R7Z C;  2R92 A;  4X6A C;  1JOE A;  1ZBS A;  1TWA K;  1I3Q C;  2YU9 C;  3GTQ K;  1DD5 A;  1I6H K;  2B63 C;  3TFJ A;  4NOI A;  3ERE D;  4KDD A;  1ZVU A;  3AD7 C;  5M3F K;  4OIO A;  3GTO K;  2RH6 A;  4AYB L;  4BXX C;  1K83 C;  3M4O K;  2JH3 A;  2WB1 D;  3FKI K;  5IP9 C;  3HKZ D;  4BBR K;  2JA8 C;  3GTL A;  2XCR B;  1C0A A;  1USO A;  3S14 C;  2NVQ K;  1O27 A;  3SZY A;  1J6W A;  4DDQ A;  2YU9 A;  3LAP A;  4QJV B;  3S2H K;  2NVY K;  4XLP A;  3MML B;  3T02 A;  3S1R C;  4BY1 K;  3HOW C;  1K83 K;  1O24 A;  5IOR A;  4P9S A;  4BBR C;  3A8K A;  2VUM A;  4MEX A;  3S14 K;  4KMD A;  1GE9 A;  2NVQ C;  5IP7 K;  1YNN A;  3EQL A;  5E68 A;  3M3Y C;  4KC6 A;  4GTF A;  4KAW X;  3HOX K;  3GEH A;  4GTA A;  2B63 A;  2GSU A;  3HKZ L;  2WB1 L;  4A3K C;  2NVX K;  1IL2 A;  3L4J A;  4RMF A;  3HOW K;  3T01 A;  1DCO A;  3S1M C;  2V6T A;  4KAT A;  5C44 C;  3GDZ A;  5C4J C;  4G0W A;  3PO2 K;  3GEE A;  4LK1 A;  5C3E C;  3AH5 A;  4GTE A;  4C2M C;  4A3C K;  2JA6 A;  1TWA A;  1Y1V K;  1WOS A;  3GTP A;  1IW7 A;  2PMZ D;  4A3K K;  2RGR A;  1INN A;  4C3J K;  4YFN A;  1TWG K;  4KMA A;  4LLG A;  1XZP B;  3GTG C;  3S16 C;  4QIW L;  5EGH A;  1I3Q A;  3RZD C;  3GTG A;  3G4C A;  4BLA A;  4C45 A;  3OPF A;  5C44 K;  3A8J A;  4BBS K;  3HOY K;  3Q3Q A;  4C2M K;  1XXC A;  3S1Q K;  1Y1V C;  3TTG A;  2VUM C;  3H0G K;  1BS2 A;  2R7Z K;  4X6A K;  1TWG C;  1SMY A;  3NUH A;  1TWA C;  4A3F C;  3S15 C;  2R92 K;  1I6H C;  1L0W A;  2E2J C;  2V6S A;  4M1X A;  4GTC A;  3GTL C;  5CJ9 A;  5C4X K;  2E2H K;  4G7Z A;  1WCM A;  3S1R K;  4P5B A;  2JA7 K;  4XSZ A;  4QJV A;  3GTM A;  5JVO A;  4A3G C;  4G0V A;  4BKW A;  1BGW A;  1JVI A;  4GTD A;  4C3H K;  1EI6 A;  1PJ6 A;  3PO3 C;  4A3F K;  4Y7N C;  4BY7 C;  3M3Y K;  3LPX A;  3FKI A;  2PPB A;  2PHC B;  4AH6 A;  2W7V A;  3GTL K;  1O26 A;  4GT9 A;  4XCH A;  2E2H C;  3H3V D;  3DXJ A;  1UV7 A;  5TMF A;  3FHZ A;  4BLB A;  1O2F B;  3S2H C;  3I4N C;  2NVY C;  4FM9 A;  3HXA A;  3QX3 A;  1EK8 A;  4A3G K;  4A3E C;  3HOV K;  2NVY A;  2WAQ D;  4GTL A;  4LQY A;  4OIQ A;  2JA6 K;  3PO2 C;  1WCM C;  3PO3 K;  2E2I C;  1Y1V A;  4KB2 A;  1ZXO A;  1Y1W A;  4A3M C;  1XPP A;  3IPJ A;  1RU0 A;  1Y1W C;  4PAA A;  1J6V A;  3OEP A;  2FQT A;  4YG2 A;  5JFE A;  4C3J C;  4G0U A;  2V6U A;  4A3B K;  4KM9 A;  1I3Q K;  1HI9 A;  4KN7 A;  3GTP C;  4A3I K;  4O2D A;  3H3V L;  1V5V A;  3S1M K;  1J6X A;  1EQR A;  3GTM C;  3GTK A;  4Q5S A;  4LOW A;  1YX2 A;  3TFI A;  3RZO K;  4JK1 A;  1G51 A;  3HOU C;  4KAR A;  2JA5 A;  4ILD A;  4A3J K;  2GSN A;  1IBA A;  3FKI C;  5CHP A;  5IP9 K;  1WOO A;  4A3B C;  2JA8 K;  3S15 K;  1X31 C;  3GTP K;  5M5X K;  4WIL A;  2E2J K;  3SZZ A;  2PA8 L;  3GEI A;  1YCL A;  1O29 A;  1TWG A;  4LR2 A;  3S16 K;  1B4B A;  3RZD K;  2JA7 A;  2P5M A;  1TWF A;  4KAS A;  3GTM K;  1F9N A;  1SFO K;  1F93 A;  4OIN A;  1EFW A;  1I50 A;  5IYC K;  1XZQ B;  4BBS C;  3BP8 C;  4QIW D;  2CW0 A;  2P8T A;  2KWA A;  3I4M K;  4PAB A;  1ISE A;  4OIR A;  1PJ5 A;  4AYB D;  4C3H C;  3GTK C;  4LK0 A;  3GTQ C;  3K7A C;  5TJ3 A;  3TFH A;  3AD9 C;  3L4K A;  2GSO A;  1DCP A;  3H0G A;  2A6H A;  3HOX C;  4A3L K;  2PMZ L;  5FJ8 K;  5D4D A;  1F7U A;  5C4X C;  1SFO C;  2Y0S D;  4KMH A;  3I4N K;  1WSV A;  2E2H A;  1HQM A;  4A3D C;  1PJ7 A;  3V4G A;  2GAG C;  1WIH A;  1XXB A;  3AQP A;  1WCM K;  2GAH C;  2ZFZ A;  1TWH K;  2A68 A;  4XSX A;  3CQZ K;  5IOS A;  4MQ9 A;  3FOF A;  3S17 C;  4Y52 K;  2E2I A;  1YNJ A;  4GFQ A;  4WJ4 A;  3S2D K;  3ORE A;  3N3Y A;  5M5W K;  3HOZ C;  1IE0 A;  3GTJ C;  2D6F C;  4GZY A;  2EBB A;  1WSR A;  1O25 A;  1IQ0 A;  5IYD C;  1VRQ C;  1I50 C;  2Y3P A;  1TWC K;  2NVT K;  1F7V A;  2R93 A;  4YFX A;  4J3N A;  2CFA B;  3N0C A;  1AB4 A;  4A93 K;  3GTQ A;  1Y1W K;  1VJE A;  3S2D C;  1JQW A;  1USM A;  2NVX C;  5IOQ A;  3H0G C;  4OIP A;  3HOZ K;  2JA5 C;  2Y0S L;  1VGX A;  4FZB A;  1EH1 A;  4LJZ A;  4A3I C;  1O2B A;  2O5I A;  1R9T C;  1SFO A;  1I50 K;  3GTO A;  1R9T A;  3GTJ A;  1KQ4 A;  3GIR A;  2A6E A;  3FOE A; 
#chains in the Genus database with same CATH homology
 1O29 A;  4KDD A;  1TWG A;  1ZVU A;  4LR2 A;  1B4B A;  1O2A A;  2JA7 A;  1XXA A;  2P5M A;  1TWF A;  3NUH A;  4KAS A;  1F9N A;  1I50 A;  3AQO A;  2RH6 A;  2KWA A;  4M1X A;  4C3I C;  4GTC A;  5CJ9 A;  1ISE A;  2JH3 A;  4C3H C;  3S0X A;  3GTL A;  2XCR B;  2CFA A;  1IS1 A;  1WQH A;  5TJ3 A;  1WCM A;  3L4K A;  2GSO A;  4P5B A;  3H0G A;  3BUE A;  1TWH A;  1O27 A;  5EGE A;  3GTM A;  5JVO A;  4DDQ A;  4G0V A;  4BKW A;  2YU9 A;  3LAP A;  1BGW A;  3N0B A;  4GTD A;  4KMH A;  3VA7 A;  3LPX A;  2E2H A;  3FKI A;  3MML B;  4P5A A;  3V4G A;  2PHC B;  1WIH A;  1XXB A;  1O26 A;  1O24 A;  5IOR A;  4GT9 A;  3AQP A;  2ZFZ A;  5IOT A;  3FHZ A;  2VUM A;  4BLB A;  5IOS A;  4KMD A;  3FOF A;  1GE9 A;  4FM9 A;  3QX3 A;  4KC6 A;  1TWC A;  1EK8 A;  4GTF A;  4KM8 A;  4KAW X;  2E2I A;  2NVY A;  4GFQ A;  4GTA A;  4GTL A;  2GSU A;  4KB4 A;  4LQY A;  2B63 A;  3ORE A;  3L4J A;  2XCQ A;  3N3Y A;  1K83 A;  1Y1V A;  4KB2 A;  1ZXO A;  1Y1W A;  1O25 A;  3OEP A;  3G4A A;  1BJT A;  3CQZ A;  5JFE A;  4C3J C;  4G0U A;  2Y3P A;  4KAT A;  4G0W A;  2R93 A;  4KM9 A;  1WQG A;  3AH5 A;  4GTE A;  4J3N A;  3N0C A;  2CFA B;  4C2M C;  2JA6 A;  2NVX A;  1TWA A;  1AB4 A;  3GTQ A;  2XCO A;  3GTP A;  2RGR A;  5IOQ A;  1WQF A;  3CAG A;  4GTB A;  3GTK A;  4KMA A;  4FZB A;  2R7Z A;  1EH1 A;  1O2B A;  5EGH A;  1O28 A;  1SFO A;  4KAR A;  1I3Q A;  2JA5 A;  1B4A A;  3LAJ A;  4ILD A;  3GTG A;  3G4C A;  4BLA A;  2GSN A;  3GTO A;  2R92 A;  3OPF A;  5CHP A;  1R9T A;  1ZBS A;  3GTJ A;  1DD5 A;  3Q3Q A;  1KQ4 A;  1XXC A;  3ERE D;  3FOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...