5IORA

Flavin-dependent thymidylate synthase in complex with fad and 2'-deoxyuridine-5'-monosulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
216
Chain Sequence
KIDILDKGFVELVDVMGNDLSAVRAARVSFDMGKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
total genus 77
structure length 216
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iorA00
3N0CA 2CFAB 3G4AA 1O26A 4KASA 4GT9A 5JFEA 1O2AA 4P5BA 3G4CA 1O28A 1O27A 1O25A 1O2BA 4GTBA 4KATA 5CHPA 4FZBA 4GTDA 4GTCA 5IOQA 1KQ4A 4P5AA 4GTAA 3N0BA 1O29A 4KARA 5IOSA 4GTEA 1O24A 2CFAA 3AH5A 4GTFA 5IORA 3N3YA 5IOTA 4GTLA
chains in the Genus database with same CATH superfamily
2P8TA 2NVXC 2R93A 2E2IA 2RGRA 1C0AA 5IYBC 2JA8C 3I4MC 1AB4A 4G7ZA 3S1QC 5FJ8K 1RU0A 2ZUFA 2JA5A 3N0BA 1Y1WA 4YFXA 4C2MK 4BKWA 3T02A 2R93C 1XXAA 3S1MC 3BUEA 2D6FC 5IYBK 4LK0A 2JA8K 5IOTA 3I4MK 4QJVB 3S1QK 1I3QC 3A8KA 1R9TK 3AD8C 2R92A 2JA5C 5E68A 1J6WA 3PO2K 3OPFA 5CHPA 4AYBL 1Y1WC 4A3FC 4XSXA 3TTGA 2E2IK 2R93K 5C3EC 4ILDA 4LK1A 1XPPA 2YU9A 4KMDA 1VH2A 4C3IC 4GTEA 1XZPB 2CW0A 3HOXC 2WAQD 1I6HC 1F9NA 2JA5K 4A3JK 3JSTA 3HOYC 3S14C 1USMA 1Y1WK 4OIPA 3QX3A 3S2DC 4P5BA 3HOVC 1EQRA 2NVYK 3SZYA 4A3FK 1F7VA 2B63A 5C3EK 3HOWC 1G51A 5HL8A 4GTCA 1EFWA 4X6AC 4Y52K 2PMZD 1WOOA 1YNJA 4A3LC 1JVIA 4KN4A 2R92K 3S2HC 1TWHC 1WIHA 3S14K 4WJ3M 3GTJC 3RZOK 3GTQA 4KB2A 4A3GC 2B63C 3AQPA 1Y1VA 3HOWK 1O2AA 2YU9K 4KB4A 2PA8L 4Q5SA 4A3IC 4KATA 3L4JA 3GEIA 3S16K 2PMZL 4KAWX 3SZZA 5IOQA 1F93A 4OIOA 4BY7C 4LJZA 4KM8A 4A3BK 3HOUK 4A3MC 3GTPA 2RH6A 5C4XC 4GZYA 4XCHA 4G7OA 3Q3QA 4A3GK 1TWAA 1XXBA 2B63K 5C4JC 1Y1VC 1J6XA 2JA6A 3FHZA 4A3EC 4KMUA 4GT9A 3S15K 1WSRA 1TWFC 5EGEA 3WODA 1ZVUA 2NVQK 3GDZA 4BXXC 3S17C 4OIRA 4OIQA 1IL2A 4A3MK 3GTPC 3GTQK 1TWGA 1BGWA 4RMFA 4C3HC 1BS2A 1Y1VK 2JA6C 1DCOA 2JH3A 1WQHA 3H3VL 4ZH4A 4YG2A 3I4NK 3S1RC 2XCOA 1USOA 1DCHA 4BY1C 1X31C 4BBRC 2VUMC 4AH6A 3G4CA 1I6VA 3GTPK 5IP7K 1TWGC 1I3QA 1TWAK 4KDDA 5C44C 5TJ3A 5IP9K 3FKIC 4O2DA 1SFOA 4A3DK 1EH1A 1WORA 1O24A 2CFAA 3S1RK 2NVXK 1WOSA 5M3MK 4BY1K 3M4OC 3N0CA 3LAJA 4P9SA 3LAPA 4G7HA 1XXCA 3GTKA 1HI9A 4A3CC 3K7AC 3PO3C 5FLMC 2GSUA 2XCQA 3AD9C 1SFOC 2Y0SD 4GTAA 4FM9A 3S1MK 5M5YK 4MEYA 5IORA 1I3QK 2JA7C 3GTKC 1PJ6A 4GTLA 4KARA 3V4GA 3A8IA 3AQOA 5TMCA 1HQMA 2R7ZC 4A3CK 1IW7A 2O5JA 4OINA 1TWHA 1SFOK 3GTJA 1VLOA 1J6VA 5IYDC 4KC6A 1VJEA 4BLBA 4C3IK 4G0UA 3H0GC 3RZDC 2E2HA 1WQFA 3HOXK 3GTKK 1I6HK 3FOEA 1WQGA 2WAQL 4GTFA 1WSVA 3HOYK 3GTGC 3S2DK 3G4AA 5L46A 3HOVK 3HOZC 2A6EA 4X6AK 5M5WK 1O2FB 4GTDA 5M5XK 5IYCC 4Q4ZA 1EI6A 4QIWD 4C3JC 2E2HC 4A3LK 1TWFA 2EBBA 1O29A 4XLNA 3S2HK 1I50A 1TWHK 4A3KC 4KM9A 3GTJK 3GIRA 3N3YA 4MEXA 2CFAB 5TMFA 4KMHA 2ZFZA 4A3IK 5M3FK 1JQWA 2E2JC 1TWCA 1ZQ1C 1B4AA 2P5MA 1XZQA 4BY7K 1I50C 2VUMA 1PJ7A 5C4XK 4XLPA 3M3YC 3GTLC 4LR2A 4Y7NC 5C4JK 1IQ0A 3HXAA 3GTMC 3FKIA 4A3EK 1WOPA 1TWCC 1ZYRA 1O26A 1DD5A 1TWFK 2XCRB 4JK1A 1YX2A 1I50K 2A69A 2A68A 2BE5A 4BXXK 1VRQC 1SMYA 3S17K 3S1NC 1F7UA 2FQOA 4BBSC 2GSNA 4P5AA 4C3HK 3TFIA 4PAAA 2JA6K 4M1XA 1BJTA 1TWCK 1GE9A 2FQTA 4C2MC 2A6HA 2VUMK 4BBRK 2V6UA 3S1NK 1VGXA 4J3NA 5JFEA 4BBSK 1TWGK 2JA7A 1O28A 2R7ZA 1O27A 3HKZD 5C44K 1R9TC 4C45A 3FKIK 3FOFA 4AYBD 1KQ4A 3PO2C 4BLAA 3ERED 5CJ9A 2NVYA 3LPXA 4DDQA 2E2IC 3CQZA 3M4OK 3GTOA 3H0GA 3GSIA 2V6SA 4KASA 3IPJA 3K7AK 3TFHA 3PO3K 5FLMK 1UV7A 3HKZL 3GTGA 4A3JC 2PPBA 2Y0SL 1EK8A 2NVYC 1XZQB 3CQZC 5JVOA 4Y52C 3GTOC 1B4BA 3VA7A 2JA7K 2V6TA 3AH5A 2R7ZK 3S0XA 2R92C 1ISEA 4LOWA 3L4KA 2Y3PA 3NUHA 3AD7C 1BDFA 3RZOC 3A8JA 1K83A 2WB1D 3GEHA 3CQZK 5IYDK 1INNA 1O25A 1O2BA 2YU9C 2PA8D 4GFQA 3GTOK 3H0GK 3OEPA 1ZBSA 4KN7A 3RZDK 3S16C 1V5VA 2W7VA 3TFJA 3CAGA 3GTGK 4QJVA 4A3BC 1WCMA 3HOUC 3HOZK 3GTLA 1K83C 3ADAC 4WJ4A 5D4DA 4KMAA 2WB1L 3GTMA 3DXJA 1IE0A 5IYCK 2KWAA 3EQLA 4XSZA 4C3JK 2E2HK 2NVTC 2ZUEA 3S15C 4QIWL 1L0WA 1YCLA 4LLGA 2NVQC 1XZPA 4A3KK 1IBAA 2GAHC 3T00A 5IOSA 2O5IA 1WCMC 4YFNA 3GTQC 1K83K 3BP3A 2GAGC 3GEEA 3H3VD 1JOEA 4PABA 2E2JK 4LQYA 4G0WA 1IS1A 4NOIA 2NVTK 3I4NC 1ZXOA 4A93C 2NVXA 5EGHA 4YFKA 3OREA 4GTBA 2PHCB 3T01A 4G0VA 1DCPA 3MMLB 1PJ5A 4FZBA 1WCMK 4MQ9A 5IP7C 3M3YK 3GTLK 4Y7NK 1R9TA 1TWAC 2GSOA 3GTMK 5IP9C 4WILA 1YNNA 3BP8C 4A3DC 1J98A 4A93K
chains in the Genus database with same CATH topology
2R93A 3FHZA 2E2IA 3G4AA 2RGRA 4KASA 4GT9A 3GTGA 1AB4A 5EGEA 1ZVUA 4GTDA 1EK8A 4C3JC 2JA5A 1TWFA 3N0BA 1O29A 1Y1WA 5JVOA 1TWGA 1BGWA 1I50A 4C3HC 1B4BA 3VA7A 1XXBA 4BKWA 2JH3A 1WQHA 4KM9A 1XXAA 3AH5A 3BUEA 3S0XA 1ISEA 3N3YA 5IOTA 3L4KA 2CFAB 2Y3PA 3NUHA 2XCOA 4KMHA 2ZFZA 2R92A 1TWCA 1K83A 1B4AA 2P5MA 3G4CA 1O25A 1O2BA 3OPFA 5CHPA 1I3QA 4GFQA 4KDDA 2VUMA 3OEPA 1ZBSA 5TJ3A 4ILDA 2YU9A 4KMDA 1SFOA 1EH1A 3CAGA 4LR2A 4GTEA 4C3IC 1O24A 2CFAA 3FKIA 1WCMA 1F9NA 3GTLA 3N0CA 3LAJA 4KMAA 1O26A 1DD5A 3LAPA 3GTMA 2XCRB 1XXCA 3QX3A 3GTKA 4P5BA 2KWAA 2B63A 2GSUA 4GTCA 2XCQA 2GSNA 4P5AA 4GTAA 4M1XA 5IOSA 4FM9A 1BJTA 1GE9A 1WIHA 4C2MC 5IORA 4GTLA 4KARA 3V4GA 4LQYA 3GTQA 3AQOA 4KB2A 1IS1A 4G0WA 1TWHA 3AQPA 1Y1VA 4J3NA 1O2AA 1ZXOA 5JFEA 2NVXA 5EGHA 2JA7A 1O28A 4KB4A 3GTJA 2R7ZA 1O27A 3OREA 4GTBA 4KATA 3L4JA 2PHCB 4KAWX 4G0VA 4FZBA 3MMLB 3FOFA 5IOQA 1KQ4A 4KC6A 4BLBA 4BLAA 3ERED 4G0UA 1R9TA 2GSOA 4KM8A 5CJ9A 2NVYA 3LPXA 4DDQA 1WQFA 2E2HA 3CQZA 3GTPA 3FOEA 2RH6A 1WQGA 4GTFA 3GTOA 3Q3QA 3H0GA 1TWAA 2JA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0C A;  2CFA B;  3G4A A;  1O26 A;  4KAS A;  4GT9 A;  5JFE A;  1O2A A;  4P5B A;  3G4C A;  1O28 A;  1O27 A;  1O25 A;  1O2B A;  4GTB A;  4KAT A;  5CHP A;  4FZB A;  4GTD A;  4GTC A;  5IOQ A;  1KQ4 A;  4P5A A;  4GTA A;  3N0B A;  1O29 A;  4KAR A;  5IOS A;  4GTE A;  1O24 A;  2CFA A;  3AH5 A;  4GTF A;  5IOR A;  3N3Y A;  5IOT A;  4GTL A; 
#chains in the Genus database with same CATH topology
 2P8T A;  2NVX C;  2R93 A;  2E2I A;  2RGR A;  1C0A A;  5IYB C;  2JA8 C;  3I4M C;  1AB4 A;  4G7Z A;  3S1Q C;  5FJ8 K;  1RU0 A;  2ZUF A;  2JA5 A;  3N0B A;  1Y1W A;  4YFX A;  4C2M K;  4BKW A;  3T02 A;  2R93 C;  1XXA A;  3S1M C;  3BUE A;  2D6F C;  5IYB K;  4LK0 A;  2JA8 K;  5IOT A;  3I4M K;  4QJV B;  3S1Q K;  1I3Q C;  3A8K A;  1R9T K;  3AD8 C;  2R92 A;  2JA5 C;  5E68 A;  1J6W A;  3PO2 K;  3OPF A;  5CHP A;  4AYB L;  1Y1W C;  4A3F C;  4XSX A;  3TTG A;  2E2I K;  2R93 K;  5C3E C;  4ILD A;  4LK1 A;  1XPP A;  2YU9 A;  4KMD A;  1VH2 A;  4C3I C;  4GTE A;  1XZP B;  2CW0 A;  3HOX C;  2WAQ D;  1I6H C;  1F9N A;  2JA5 K;  4A3J K;  3JST A;  3HOY C;  3S14 C;  1USM A;  1Y1W K;  4OIP A;  3QX3 A;  3S2D C;  4P5B A;  3HOV C;  1EQR A;  2NVY K;  3SZY A;  4A3F K;  1F7V A;  2B63 A;  5C3E K;  3HOW C;  1G51 A;  5HL8 A;  4GTC A;  1EFW A;  4X6A C;  4Y52 K;  2PMZ D;  1WOO A;  1YNJ A;  4A3L C;  1JVI A;  4KN4 A;  2R92 K;  3S2H C;  1TWH C;  1WIH A;  3S14 K;  4WJ3 M;  3GTJ C;  3RZO K;  3GTQ A;  4KB2 A;  4A3G C;  2B63 C;  3AQP A;  1Y1V A;  3HOW K;  1O2A A;  2YU9 K;  4KB4 A;  2PA8 L;  4Q5S A;  4A3I C;  4KAT A;  3L4J A;  3GEI A;  3S16 K;  2PMZ L;  4KAW X;  3SZZ A;  5IOQ A;  1F93 A;  4OIO A;  4BY7 C;  4LJZ A;  4KM8 A;  4A3B K;  3HOU K;  4A3M C;  3GTP A;  2RH6 A;  5C4X C;  4GZY A;  4XCH A;  4G7O A;  3Q3Q A;  4A3G K;  1TWA A;  1XXB A;  2B63 K;  5C4J C;  1Y1V C;  1J6X A;  2JA6 A;  3FHZ A;  4A3E C;  4KMU A;  4GT9 A;  3S15 K;  1WSR A;  1TWF C;  5EGE A;  3WOD A;  1ZVU A;  2NVQ K;  3GDZ A;  4BXX C;  3S17 C;  4OIR A;  4OIQ A;  1IL2 A;  4A3M K;  3GTP C;  3GTQ K;  1TWG A;  1BGW A;  4RMF A;  4C3H C;  1BS2 A;  1Y1V K;  2JA6 C;  1DCO A;  2JH3 A;  1WQH A;  3H3V L;  4ZH4 A;  4YG2 A;  3I4N K;  3S1R C;  2XCO A;  1USO A;  1DCH A;  4BY1 C;  1X31 C;  4BBR C;  2VUM C;  4AH6 A;  3G4C A;  1I6V A;  3GTP K;  5IP7 K;  1TWG C;  1I3Q A;  1TWA K;  4KDD A;  5C44 C;  5TJ3 A;  5IP9 K;  3FKI C;  4O2D A;  1SFO A;  4A3D K;  1EH1 A;  1WOR A;  1O24 A;  2CFA A;  3S1R K;  2NVX K;  1WOS A;  5M3M K;  4BY1 K;  3M4O C;  3N0C A;  3LAJ A;  4P9S A;  3LAP A;  4G7H A;  1XXC A;  3GTK A;  1HI9 A;  4A3C C;  3K7A C;  3PO3 C;  5FLM C;  2GSU A;  2XCQ A;  3AD9 C;  1SFO C;  2Y0S D;  4GTA A;  4FM9 A;  3S1M K;  5M5Y K;  4MEY A;  5IOR A;  1I3Q K;  2JA7 C;  3GTK C;  1PJ6 A;  4GTL A;  4KAR A;  3V4G A;  3A8I A;  3AQO A;  5TMC A;  1HQM A;  2R7Z C;  4A3C K;  1IW7 A;  2O5J A;  4OIN A;  1TWH A;  1SFO K;  3GTJ A;  1VLO A;  1J6V A;  5IYD C;  4KC6 A;  1VJE A;  4BLB A;  4C3I K;  4G0U A;  3H0G C;  3RZD C;  2E2H A;  1WQF A;  3HOX K;  3GTK K;  1I6H K;  3FOE A;  1WQG A;  2WAQ L;  4GTF A;  1WSV A;  3HOY K;  3GTG C;  3S2D K;  3G4A A;  5L46 A;  3HOV K;  3HOZ C;  2A6E A;  4X6A K;  5M5W K;  1O2F B;  4GTD A;  5M5X K;  5IYC C;  4Q4Z A;  1EI6 A;  4QIW D;  4C3J C;  2E2H C;  4A3L K;  1TWF A;  2EBB A;  1O29 A;  4XLN A;  3S2H K;  1I50 A;  1TWH K;  4A3K C;  4KM9 A;  3GTJ K;  3GIR A;  3N3Y A;  4MEX A;  2CFA B;  5TMF A;  4KMH A;  2ZFZ A;  4A3I K;  5M3F K;  1JQW A;  2E2J C;  1TWC A;  1ZQ1 C;  1B4A A;  2P5M A;  1XZQ A;  4BY7 K;  1I50 C;  2VUM A;  1PJ7 A;  5C4X K;  4XLP A;  3M3Y C;  3GTL C;  4LR2 A;  4Y7N C;  5C4J K;  1IQ0 A;  3HXA A;  3GTM C;  3FKI A;  4A3E K;  1WOP A;  1TWC C;  1ZYR A;  1O26 A;  1DD5 A;  1TWF K;  2XCR B;  4JK1 A;  1YX2 A;  1I50 K;  2A69 A;  2A68 A;  2BE5 A;  4BXX K;  1VRQ C;  1SMY A;  3S17 K;  3S1N C;  1F7U A;  2FQO A;  4BBS C;  2GSN A;  4P5A A;  4C3H K;  3TFI A;  4PAA A;  2JA6 K;  4M1X A;  1BJT A;  1TWC K;  1GE9 A;  2FQT A;  4C2M C;  2A6H A;  2VUM K;  4BBR K;  2V6U A;  3S1N K;  1VGX A;  4J3N A;  5JFE A;  4BBS K;  1TWG K;  2JA7 A;  1O28 A;  2R7Z A;  1O27 A;  3HKZ D;  5C44 K;  1R9T C;  4C45 A;  3FKI K;  3FOF A;  4AYB D;  1KQ4 A;  3PO2 C;  4BLA A;  3ERE D;  5CJ9 A;  2NVY A;  3LPX A;  4DDQ A;  2E2I C;  3CQZ A;  3M4O K;  3GTO A;  3H0G A;  3GSI A;  2V6S A;  4KAS A;  3IPJ A;  3K7A K;  3TFH A;  3PO3 K;  5FLM K;  1UV7 A;  3HKZ L;  3GTG A;  4A3J C;  2PPB A;  2Y0S L;  1EK8 A;  2NVY C;  1XZQ B;  3CQZ C;  5JVO A;  4Y52 C;  3GTO C;  1B4B A;  3VA7 A;  2JA7 K;  2V6T A;  3AH5 A;  2R7Z K;  3S0X A;  2R92 C;  1ISE A;  4LOW A;  3L4K A;  2Y3P A;  3NUH A;  3AD7 C;  1BDF A;  3RZO C;  3A8J A;  1K83 A;  2WB1 D;  3GEH A;  3CQZ K;  5IYD K;  1INN A;  1O25 A;  1O2B A;  2YU9 C;  2PA8 D;  4GFQ A;  3GTO K;  3H0G K;  3OEP A;  1ZBS A;  4KN7 A;  3RZD K;  3S16 C;  1V5V A;  2W7V A;  3TFJ A;  3CAG A;  3GTG K;  4QJV A;  4A3B C;  1WCM A;  3HOU C;  3HOZ K;  3GTL A;  1K83 C;  3ADA C;  4WJ4 A;  5D4D A;  4KMA A;  2WB1 L;  3GTM A;  3DXJ A;  1IE0 A;  5IYC K;  2KWA A;  3EQL A;  4XSZ A;  4C3J K;  2E2H K;  2NVT C;  2ZUE A;  3S15 C;  4QIW L;  1L0W A;  1YCL A;  4LLG A;  2NVQ C;  1XZP A;  4A3K K;  1IBA A;  2GAH C;  3T00 A;  5IOS A;  2O5I A;  1WCM C;  4YFN A;  3GTQ C;  1K83 K;  3BP3 A;  2GAG C;  3GEE A;  3H3V D;  1JOE A;  4PAB A;  2E2J K;  4LQY A;  4G0W A;  1IS1 A;  4NOI A;  2NVT K;  3I4N C;  1ZXO A;  4A93 C;  2NVX A;  5EGH A;  4YFK A;  3ORE A;  4GTB A;  2PHC B;  3T01 A;  4G0V A;  1DCP A;  3MML B;  1PJ5 A;  4FZB A;  1WCM K;  4MQ9 A;  5IP7 C;  3M3Y K;  3GTL K;  4Y7N K;  1R9T A;  1TWA C;  2GSO A;  3GTM K;  5IP9 C;  4WIL A;  1YNN A;  3BP8 C;  4A3D C;  1J98 A;  4A93 K; 
#chains in the Genus database with same CATH homology
 2R93 A;  3FHZ A;  2E2I A;  3G4A A;  2RGR A;  4KAS A;  4GT9 A;  3GTG A;  1AB4 A;  5EGE A;  1ZVU A;  4GTD A;  1EK8 A;  4C3J C;  2JA5 A;  1TWF A;  3N0B A;  1O29 A;  1Y1W A;  5JVO A;  1TWG A;  1BGW A;  1I50 A;  4C3H C;  1B4B A;  3VA7 A;  1XXB A;  4BKW A;  2JH3 A;  1WQH A;  4KM9 A;  1XXA A;  3AH5 A;  3BUE A;  3S0X A;  1ISE A;  3N3Y A;  5IOT A;  3L4K A;  2CFA B;  2Y3P A;  3NUH A;  2XCO A;  4KMH A;  2ZFZ A;  2R92 A;  1TWC A;  1K83 A;  1B4A A;  2P5M A;  3G4C A;  1O25 A;  1O2B A;  3OPF A;  5CHP A;  1I3Q A;  4GFQ A;  4KDD A;  2VUM A;  3OEP A;  1ZBS A;  5TJ3 A;  4ILD A;  2YU9 A;  4KMD A;  1SFO A;  1EH1 A;  3CAG A;  4LR2 A;  4GTE A;  4C3I C;  1O24 A;  2CFA A;  3FKI A;  1WCM A;  1F9N A;  3GTL A;  3N0C A;  3LAJ A;  4KMA A;  1O26 A;  1DD5 A;  3LAP A;  3GTM A;  2XCR B;  1XXC A;  3QX3 A;  3GTK A;  4P5B A;  2KWA A;  2B63 A;  2GSU A;  4GTC A;  2XCQ A;  2GSN A;  4P5A A;  4GTA A;  4M1X A;  5IOS A;  4FM9 A;  1BJT A;  1GE9 A;  1WIH A;  4C2M C;  5IOR A;  4GTL A;  4KAR A;  3V4G A;  4LQY A;  3GTQ A;  3AQO A;  4KB2 A;  1IS1 A;  4G0W A;  1TWH A;  3AQP A;  1Y1V A;  4J3N A;  1O2A A;  1ZXO A;  5JFE A;  2NVX A;  5EGH A;  2JA7 A;  1O28 A;  4KB4 A;  3GTJ A;  2R7Z A;  1O27 A;  3ORE A;  4GTB A;  4KAT A;  3L4J A;  2PHC B;  4KAW X;  4G0V A;  4FZB A;  3MML B;  3FOF A;  5IOQ A;  1KQ4 A;  4KC6 A;  4BLB A;  4BLA A;  3ERE D;  4G0U A;  1R9T A;  2GSO A;  4KM8 A;  5CJ9 A;  2NVY A;  3LPX A;  4DDQ A;  1WQF A;  2E2H A;  3CQZ A;  3GTP A;  3FOE A;  2RH6 A;  1WQG A;  4GTF A;  3GTO A;  3Q3Q A;  3H0G A;  1TWA A;  2JA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...