5IORA

Flavin-dependent thymidylate synthase in complex with fad and 2'-deoxyuridine-5'-monosulfate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
216
Chain Sequence
KIDILDKGFVELVDVMGNDLSAVRAARVSFDMGKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deprotonations in the Reaction of Flavin-Dependent Thymidylate Synthase.
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 77
structure length 216
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5iorA00
4FZBA 5IOSA 5CHPA 4P5AA 4KATA 1O27A 4KARA 4GTCA 3N0BA 3AH5A 4GTLA 1O26A 1O2BA 4KASA 3N0CA 4GTEA 5IORA 4GTFA 5IOQA 3G4CA 1O25A 4GTDA 5IOTA 1KQ4A 1O28A 1O2AA 4GT9A 5JFEA 1O24A 2CFAB 4P5BA 1O29A 4GTBA 3G4AA 3N3YA 2CFAA 4GTAA
chains in the Genus database with same CATH superfamily
1I50K 4FZBA 1IE0A 2O5JA 2A6EA 5IYBC 1XZPB 2V6TA 1BJTA 4G0UA 4A3BK 4BBRK 3S2DC 1TWCC 4KASA 3GTQK 5C4XC 1R9TA 2WAQD 4A3MC 2NVYK 3S1RK 1VH2A 4ILDA 3DXJA 1YNJA 1EI6A 2E2HA 2NVXC 5TMFA 3T01A 2JA8K 1PJ5A 4C3JK 3GTQA 3PO2C 3S1RC 1BS2A 1XXBA 1EH1A 3OREA 1IS1A 3HOYC 3V4GA 1JVIA 3GTMA 3HOUC 1AB4A 1XZQA 2PMZD 5IOQA 4JK1A 3S1NK 3BUEA 1TWHC 1WORA 4Y52C 3VA7A 1J6XA 1BDFA 1EK8A 4BXXC 3GTOK 3FOFA 2A6HA 4KARA 4C3HC 2YU9C 2JA6C 2ZFZA 2D6FC 1J98A 1SFOK 2NVXA 3HOYK 2Y3PA 4J3NA 4X6AC 4C2MC 1JQWA 1F7VA 4BY1C 4KB4A 5IYBK 2JA7A 1TWGC 4YG2A 2ZUEA 5IYCC 5C44C 5IYDK 3M3YC 4OINA 2YU9K 4C3IK 1VJEA 1TWAA 5CJ9A 1BGWA 1I6HC 2GAGC 2B63C 3S1QK 2PA8D 4AH6A 2O5IA 2FQTA 2XCRB 1L0WA 3L4JA 5FLMK 2WB1L 4LR2A 5IYDC 5D4DA 4MEXA 1DCOA 3RZOK 3S17C 1J6VA 2E2HC 3ERED 1WOOA 4A3LC 4OIRA 1DCHA 2WAQL 1EQRA 4GTAA 4Q4ZA 4O2DA 5M3MK 2JA8C 5CHPA 1XXCA 2P8TA 1ZQ1C 4BKWA 3GEHA 4OIOA 2R93A 4G0VA 1IW7A 3GDZA 3HXAA 1I3QA 4C45A 3HOZK 3S16K 2R92A 1TWAC 1YX2A 5JFEA 3H3VL 3H0GA 3GTLA 3CQZK 4GTBA 4BBSC 1F9NA 5FLMC 2CFAA 1SFOC 4MEYA 3RZDK 2JA6K 4KDDA 4Q5SA 3AH5A 3BP8C 4G7HA 4A3GK 1IL2A 4ZH4A 1TWHA 4MQ9A 3GTOA 3GTKC 3HOVK 3I4NK 3GEEA 4Y7NK 2R93K 3M4OC 3HKZD 2GSUA 4AYBD 1TWAK 4PAAA 3AQPA 2WB1D 4GT9A 1HI9A 5E68A 4KM8A 4LK0A 1V5VA 2E2IA 1WCMA 2NVTK 4A3GC 2JA7C 1IQ0A 3G4AA 3ADAC 4C3IC 5IOSA 3CQZC 4BBSK 1UV7A 5C44K 2R92C 4WJ3M 1TWGK 2R7ZK 4LOWA 1INNA 1TWHK 3AD7C 3H0GC 4BLBA 1K83C 2E2JK 1ISEA 3GTMC 4KAWX 4XLPA 3GTJC 1O25A 5JVOA 4GTDA 2BE5A 5IP7K 4XSZA 1DD5A 4Y52K 3T00A 4A3IK 1IBAA 3GTQC 4C3HK 4A3KK 3AQOA 2B63A 4BBRC 3S2DK 3PO3C 4LQYA 4P9SA 4GTLA 4YFNA 3GTJK 4C2MK 2ZUFA 1PJ7A 3QX3A 5TMCA 3GTMK 4A3FK 1B4BA 1Y1VC 5M5YK 4OIQA 5IP9K 2JA5C 4LJZA 4LLGA 4XLNA 1G51A 2JA5A 4A3KC 2P5MA 2NVQC 1O2AA 3EQLA 2CFAB 1ZVUA 3A8IA 4NOIA 3TFJA 2PHCB 3NUHA 4BY7K 2PMZL 4KMHA 3PO3K 3S16C 3K7AK 2YU9A 3LAPA 1WQHA 1XZQB 1R9TC 1Y1WA 3BP3A 2NVQK 3GTPA 3S2HK 4KMAA 3JSTA 1O2FB 5IP9C 2JA5K 3GTKK 2VUMA 1WQFA 1KQ4A 3S15K 3GTOC 5FJ8K 2VUMK 3S1MC 2E2HK 1Y1WK 5C3EC 1I50C 2E2IC 1SMYA 5HL8A 4GTCA 3GTPK 1WOSA 3T02A 4G0WA 1O2BA 2XCOA 3SZZA 2PA8L 4A3BC 2NVYA 3GSIA 4KMUA 5IYCK 1Y1WC 3N3YA 3S15C 1I6VA 3LAJA 1YNNA 4OIPA 3A8KA 1XZPA 1K83A 2RH6A 3Q3QA 3RZDC 2NVXK 1Y1VK 1VLOA 2Y0SD 3MMLB 3M4OK 3M3YK 1ZXOA 4QIWL 3CAGA 4PABA 5M3FK 3GTPC 3S14C 2V6SA 3HOXC 3I4NC 1WSRA 1O28A 1C0AA 4A3DK 3FHZA 3H3VD 2GSOA 1GE9A 1TWFC 3RZOC 1WCMC 4KMDA 1DCPA 3GTGC 1Y1VA 3HKZL 4P5AA 2NVYC 3FKIK 1K83K 2E2JC 1ZYRA 3TTGA 3S2HC 2R7ZA 4BXXK 5L46A 1EFWA 1RU0A 3GTJA 4A3IC 4X6AK 5TJ3A 3GTGK 3PO2K 2EBBA 1WCMK 3HOZC 1O24A 4C3JC 2E2IK 4LK1A 4A3JC 4GZYA 3I4MC 4XSXA 3FOEA 4A3DC 4KM9A 4KN4A 4KN7A 2VUMC 4KATA 1ZBSA 1O27A 3FKIA 2R93C 1TWGA 2V6UA 2A68A 3S0XA 3SZYA 3N0CA 4A3EK 4G7OA 1I6HK 5M5WK 4A93K 3HOUK 3S17K 3WODA 3G4CA 2A69A 3GEIA 2NVTC 4WJ4A 3I4MK 1I3QK 3HOWK 3OEPA 2Y0SL 4P5BA 4RMFA 3IPJA 2R92K 1XPPA 1YCLA 3K7AC 3L4KA 3A8JA 3GIRA 1HQMA 1B4AA 1WQGA 3AD9C 1TWCK 1F7UA 2JA7K 4A3CK 1J6WA 3HOXK 4WILA 4KB2A 3TFIA 1WIHA 2R7ZC 1PJ6A 1I3QC 3HOWC 4A3MK 3AD8C 4YFXA 4KC6A 5C4XK 5C4JK 4A93C 5EGHA 2JA6A 3S1MK 4DDQA 4QJVB 4XCHA 4A3EC 5EGEA 3CQZA 1F93A 2XCQA 1I50A 4FM9A 2PPBA 2GSNA 4YFKA 1TWCA 5IP7C 5M5XK 5C3EK 4M1XA 3TFHA 2B63K 4Y7NC 2CW0A 4A3CC 3S1NC 1TWFA 4G7ZA 2GAHC 2JH3A 5C4JC 5IOTA 3GTKA 1XXAA 4A3FC 3S1QC 2KWAA 1USOA 4QIWD 3GTLK 1WOPA 4QJVA 1SFOA 4AYBL 1JOEA 2W7VA 3OPFA 4BLAA 1USMA 3H0GK 3N0BA 4A3JK 4A3LK 1O26A 4BY7C 1VRQC 2FQOA 1X31C 4GTEA 5IORA 4GTFA 1TWFK 4GFQA 1WSVA 1R9TK 4BY1K 1VGXA 3GTLC 3FKIC 2RGRA 1O29A 3S14K 3GTGA 3LPXA 3HOVC
chains in the Genus database with same CATH topology
4FZBA 4KMHA 5CHPA 1XXCA 4KATA 1ZBSA 1O27A 3FKIA 4BKWA 1BJTA 2YU9A 4G0UA 3LAPA 1WQHA 1TWGA 4KASA 1Y1WA 3S0XA 2R93A 3GTPA 1R9TA 3N0CA 4KMAA 4G0VA 4ILDA 4KM9A 1I3QA 3G4CA 2VUMA 1WQFA 1KQ4A 2R92A 5JFEA 3OEPA 4P5BA 2E2HA 3H0GA 3GTLA 4GTBA 1F9NA 2CFAA 3L4KA 3GTQA 1B4AA 1WQGA 4KDDA 4GTCA 3AH5A 1XXBA 1EH1A 3OREA 1IS1A 1TWHA 4G0WA 1O2BA 3V4GA 3GTOA 2XCOA 4KB2A 1WIHA 3GTMA 1AB4A 2GSUA 5IOQA 2NVYA 3BUEA 3AQPA 4KC6A 4GT9A 5EGHA 2JA6A 4KM8A 3VA7A 2E2IA 4DDQA 1WCMA 1EK8A 5EGEA 3G4AA 3CQZA 3N3YA 4C3IC 5IOSA 2XCQA 1I50A 3LAJA 3FOFA 4FM9A 1K83A 2RH6A 2GSNA 3Q3QA 1TWCA 4KARA 4C3HC 4M1XA 2ZFZA 4BLBA 2NVXA 3MMLB 1ZXOA 2Y3PA 4J3NA 3CAGA 4C2MC 1TWFA 2JH3A 1ISEA 4KB4A 4KAWX 1O25A 5JVOA 4GTDA 5IOTA 3GTKA 1O28A 1XXAA 3FHZA 2GSOA 2KWAA 1DD5A 2JA7A 1GE9A 4KMDA 1SFOA 1Y1VA 3AQOA 2B63A 4P5AA 3OPFA 4BLAA 3N0BA 4LQYA 4GTLA 1O26A 1TWAA 5CJ9A 2R7ZA 3QX3A 1BGWA 1B4BA 2JA5A 4GTEA 5IORA 4GTFA 2XCRB 3GTJA 3L4JA 4GFQA 5TJ3A 4LR2A 2P5MA 1O2AA 1O24A 2CFAB 4C3JC 1ZVUA 3ERED 2RGRA 1O29A 3FOEA 2PHCB 3GTGA 3LPXA 3NUHA 4GTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZB A;  5IOS A;  5CHP A;  4P5A A;  4KAT A;  1O27 A;  4KAR A;  4GTC A;  3N0B A;  3AH5 A;  4GTL A;  1O26 A;  1O2B A;  4KAS A;  3N0C A;  4GTE A;  5IOR A;  4GTF A;  5IOQ A;  3G4C A;  1O25 A;  4GTD A;  5IOT A;  1KQ4 A;  1O28 A;  1O2A A;  4GT9 A;  5JFE A;  1O24 A;  2CFA B;  4P5B A;  1O29 A;  4GTB A;  3G4A A;  3N3Y A;  2CFA A;  4GTA A; 
#chains in the Genus database with same CATH topology
 1I50 K;  4FZB A;  1IE0 A;  2O5J A;  2A6E A;  5IYB C;  1XZP B;  2V6T A;  1BJT A;  4G0U A;  4A3B K;  4BBR K;  3S2D C;  1TWC C;  4KAS A;  3GTQ K;  5C4X C;  1R9T A;  2WAQ D;  4A3M C;  2NVY K;  3S1R K;  1VH2 A;  4ILD A;  3DXJ A;  1YNJ A;  1EI6 A;  2E2H A;  2NVX C;  5TMF A;  3T01 A;  2JA8 K;  1PJ5 A;  4C3J K;  3GTQ A;  3PO2 C;  3S1R C;  1BS2 A;  1XXB A;  1EH1 A;  3ORE A;  1IS1 A;  3HOY C;  3V4G A;  1JVI A;  3GTM A;  3HOU C;  1AB4 A;  1XZQ A;  2PMZ D;  5IOQ A;  4JK1 A;  3S1N K;  3BUE A;  1TWH C;  1WOR A;  4Y52 C;  3VA7 A;  1J6X A;  1BDF A;  1EK8 A;  4BXX C;  3GTO K;  3FOF A;  2A6H A;  4KAR A;  4C3H C;  2YU9 C;  2JA6 C;  2ZFZ A;  2D6F C;  1J98 A;  1SFO K;  2NVX A;  3HOY K;  2Y3P A;  4J3N A;  4X6A C;  4C2M C;  1JQW A;  1F7V A;  4BY1 C;  4KB4 A;  5IYB K;  2JA7 A;  1TWG C;  4YG2 A;  2ZUE A;  5IYC C;  5C44 C;  5IYD K;  3M3Y C;  4OIN A;  2YU9 K;  4C3I K;  1VJE A;  1TWA A;  5CJ9 A;  1BGW A;  1I6H C;  2GAG C;  2B63 C;  3S1Q K;  2PA8 D;  4AH6 A;  2O5I A;  2FQT A;  2XCR B;  1L0W A;  3L4J A;  5FLM K;  2WB1 L;  4LR2 A;  5IYD C;  5D4D A;  4MEX A;  1DCO A;  3RZO K;  3S17 C;  1J6V A;  2E2H C;  3ERE D;  1WOO A;  4A3L C;  4OIR A;  1DCH A;  2WAQ L;  1EQR A;  4GTA A;  4Q4Z A;  4O2D A;  5M3M K;  2JA8 C;  5CHP A;  1XXC A;  2P8T A;  1ZQ1 C;  4BKW A;  3GEH A;  4OIO A;  2R93 A;  4G0V A;  1IW7 A;  3GDZ A;  3HXA A;  1I3Q A;  4C45 A;  3HOZ K;  3S16 K;  2R92 A;  1TWA C;  1YX2 A;  5JFE A;  3H3V L;  3H0G A;  3GTL A;  3CQZ K;  4GTB A;  4BBS C;  1F9N A;  5FLM C;  2CFA A;  1SFO C;  4MEY A;  3RZD K;  2JA6 K;  4KDD A;  4Q5S A;  3AH5 A;  3BP8 C;  4G7H A;  4A3G K;  1IL2 A;  4ZH4 A;  1TWH A;  4MQ9 A;  3GTO A;  3GTK C;  3HOV K;  3I4N K;  3GEE A;  4Y7N K;  2R93 K;  3M4O C;  3HKZ D;  2GSU A;  4AYB D;  1TWA K;  4PAA A;  3AQP A;  2WB1 D;  4GT9 A;  1HI9 A;  5E68 A;  4KM8 A;  4LK0 A;  1V5V A;  2E2I A;  1WCM A;  2NVT K;  4A3G C;  2JA7 C;  1IQ0 A;  3G4A A;  3ADA C;  4C3I C;  5IOS A;  3CQZ C;  4BBS K;  1UV7 A;  5C44 K;  2R92 C;  4WJ3 M;  1TWG K;  2R7Z K;  4LOW A;  1INN A;  1TWH K;  3AD7 C;  3H0G C;  4BLB A;  1K83 C;  2E2J K;  1ISE A;  3GTM C;  4KAW X;  4XLP A;  3GTJ C;  1O25 A;  5JVO A;  4GTD A;  2BE5 A;  5IP7 K;  4XSZ A;  1DD5 A;  4Y52 K;  3T00 A;  4A3I K;  1IBA A;  3GTQ C;  4C3H K;  4A3K K;  3AQO A;  2B63 A;  4BBR C;  3S2D K;  3PO3 C;  4LQY A;  4P9S A;  4GTL A;  4YFN A;  3GTJ K;  4C2M K;  2ZUF A;  1PJ7 A;  3QX3 A;  5TMC A;  3GTM K;  4A3F K;  1B4B A;  1Y1V C;  5M5Y K;  4OIQ A;  5IP9 K;  2JA5 C;  4LJZ A;  4LLG A;  4XLN A;  1G51 A;  2JA5 A;  4A3K C;  2P5M A;  2NVQ C;  1O2A A;  3EQL A;  2CFA B;  1ZVU A;  3A8I A;  4NOI A;  3TFJ A;  2PHC B;  3NUH A;  4BY7 K;  2PMZ L;  4KMH A;  3PO3 K;  3S16 C;  3K7A K;  2YU9 A;  3LAP A;  1WQH A;  1XZQ B;  1R9T C;  1Y1W A;  3BP3 A;  2NVQ K;  3GTP A;  3S2H K;  4KMA A;  3JST A;  1O2F B;  5IP9 C;  2JA5 K;  3GTK K;  2VUM A;  1WQF A;  1KQ4 A;  3S15 K;  3GTO C;  5FJ8 K;  2VUM K;  3S1M C;  2E2H K;  1Y1W K;  5C3E C;  1I50 C;  2E2I C;  1SMY A;  5HL8 A;  4GTC A;  3GTP K;  1WOS A;  3T02 A;  4G0W A;  1O2B A;  2XCO A;  3SZZ A;  2PA8 L;  4A3B C;  2NVY A;  3GSI A;  4KMU A;  5IYC K;  1Y1W C;  3N3Y A;  3S15 C;  1I6V A;  3LAJ A;  1YNN A;  4OIP A;  3A8K A;  1XZP A;  1K83 A;  2RH6 A;  3Q3Q A;  3RZD C;  2NVX K;  1Y1V K;  1VLO A;  2Y0S D;  3MML B;  3M4O K;  3M3Y K;  1ZXO A;  4QIW L;  3CAG A;  4PAB A;  5M3F K;  3GTP C;  3S14 C;  2V6S A;  3HOX C;  3I4N C;  1WSR A;  1O28 A;  1C0A A;  4A3D K;  3FHZ A;  3H3V D;  2GSO A;  1GE9 A;  1TWF C;  3RZO C;  1WCM C;  4KMD A;  1DCP A;  3GTG C;  1Y1V A;  3HKZ L;  4P5A A;  2NVY C;  3FKI K;  1K83 K;  2E2J C;  1ZYR A;  3TTG A;  3S2H C;  2R7Z A;  4BXX K;  5L46 A;  1EFW A;  1RU0 A;  3GTJ A;  4A3I C;  4X6A K;  5TJ3 A;  3GTG K;  3PO2 K;  2EBB A;  1WCM K;  3HOZ C;  1O24 A;  4C3J C;  2E2I K;  4LK1 A;  4A3J C;  4GZY A;  3I4M C;  4XSX A;  3FOE A;  4A3D C;  4KM9 A;  4KN4 A;  4KN7 A;  2VUM C;  4KAT A;  1ZBS A;  1O27 A;  3FKI A;  2R93 C;  1TWG A;  2V6U A;  2A68 A;  3S0X A;  3SZY A;  3N0C A;  4A3E K;  4G7O A;  1I6H K;  5M5W K;  4A93 K;  3HOU K;  3S17 K;  3WOD A;  3G4C A;  2A69 A;  3GEI A;  2NVT C;  4WJ4 A;  3I4M K;  1I3Q K;  3HOW K;  3OEP A;  2Y0S L;  4P5B A;  4RMF A;  3IPJ A;  2R92 K;  1XPP A;  1YCL A;  3K7A C;  3L4K A;  3A8J A;  3GIR A;  1HQM A;  1B4A A;  1WQG A;  3AD9 C;  1TWC K;  1F7U A;  2JA7 K;  4A3C K;  1J6W A;  3HOX K;  4WIL A;  4KB2 A;  3TFI A;  1WIH A;  2R7Z C;  1PJ6 A;  1I3Q C;  3HOW C;  4A3M K;  3AD8 C;  4YFX A;  4KC6 A;  5C4X K;  5C4J K;  4A93 C;  5EGH A;  2JA6 A;  3S1M K;  4DDQ A;  4QJV B;  4XCH A;  4A3E C;  5EGE A;  3CQZ A;  1F93 A;  2XCQ A;  1I50 A;  4FM9 A;  2PPB A;  2GSN A;  4YFK A;  1TWC A;  5IP7 C;  5M5X K;  5C3E K;  4M1X A;  3TFH A;  2B63 K;  4Y7N C;  2CW0 A;  4A3C C;  3S1N C;  1TWF A;  4G7Z A;  2GAH C;  2JH3 A;  5C4J C;  5IOT A;  3GTK A;  1XXA A;  4A3F C;  3S1Q C;  2KWA A;  1USO A;  4QIW D;  3GTL K;  1WOP A;  4QJV A;  1SFO A;  4AYB L;  1JOE A;  2W7V A;  3OPF A;  4BLA A;  1USM A;  3H0G K;  3N0B A;  4A3J K;  4A3L K;  1O26 A;  4BY7 C;  1VRQ C;  2FQO A;  1X31 C;  4GTE A;  5IOR A;  4GTF A;  1TWF K;  4GFQ A;  1WSV A;  1R9T K;  4BY1 K;  1VGX A;  3GTL C;  3FKI C;  2RGR A;  1O29 A;  3S14 K;  3GTG A;  3LPX A;  3HOV C; 
#chains in the Genus database with same CATH homology
 4FZB A;  4KMH A;  5CHP A;  1XXC A;  4KAT A;  1ZBS A;  1O27 A;  3FKI A;  4BKW A;  1BJT A;  2YU9 A;  4G0U A;  3LAP A;  1WQH A;  1TWG A;  4KAS A;  1Y1W A;  3S0X A;  2R93 A;  3GTP A;  1R9T A;  3N0C A;  4KMA A;  4G0V A;  4ILD A;  4KM9 A;  1I3Q A;  3G4C A;  2VUM A;  1WQF A;  1KQ4 A;  2R92 A;  5JFE A;  3OEP A;  4P5B A;  2E2H A;  3H0G A;  3GTL A;  4GTB A;  1F9N A;  2CFA A;  3L4K A;  3GTQ A;  1B4A A;  1WQG A;  4KDD A;  4GTC A;  3AH5 A;  1XXB A;  1EH1 A;  3ORE A;  1IS1 A;  1TWH A;  4G0W A;  1O2B A;  3V4G A;  3GTO A;  2XCO A;  4KB2 A;  1WIH A;  3GTM A;  1AB4 A;  2GSU A;  5IOQ A;  2NVY A;  3BUE A;  3AQP A;  4KC6 A;  4GT9 A;  5EGH A;  2JA6 A;  4KM8 A;  3VA7 A;  2E2I A;  4DDQ A;  1WCM A;  1EK8 A;  5EGE A;  3G4A A;  3CQZ A;  3N3Y A;  4C3I C;  5IOS A;  2XCQ A;  1I50 A;  3LAJ A;  3FOF A;  4FM9 A;  1K83 A;  2RH6 A;  2GSN A;  3Q3Q A;  1TWC A;  4KAR A;  4C3H C;  4M1X A;  2ZFZ A;  4BLB A;  2NVX A;  3MML B;  1ZXO A;  2Y3P A;  4J3N A;  3CAG A;  4C2M C;  1TWF A;  2JH3 A;  1ISE A;  4KB4 A;  4KAW X;  1O25 A;  5JVO A;  4GTD A;  5IOT A;  3GTK A;  1O28 A;  1XXA A;  3FHZ A;  2GSO A;  2KWA A;  1DD5 A;  2JA7 A;  1GE9 A;  4KMD A;  1SFO A;  1Y1V A;  3AQO A;  2B63 A;  4P5A A;  3OPF A;  4BLA A;  3N0B A;  4LQY A;  4GTL A;  1O26 A;  1TWA A;  5CJ9 A;  2R7Z A;  3QX3 A;  1BGW A;  1B4B A;  2JA5 A;  4GTE A;  5IOR A;  4GTF A;  2XCR B;  3GTJ A;  3L4J A;  4GFQ A;  5TJ3 A;  4LR2 A;  2P5M A;  1O2A A;  1O24 A;  2CFA B;  4C3J C;  1ZVU A;  3ERE D;  2RGR A;  1O29 A;  3FOE A;  2PHC B;  3GTG A;  3LPX A;  3NUH A;  4GTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...