2P8TA

Hypothetical protein ph0730 from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
184
Chain Sequence
EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0730
publication title Hypothetical protein PH0730 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 61
structure length 184
sequence length 186
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14544 DUF4443 Domain of unknown function (DUF4443)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p8tA01
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 2p8tA02
4HDVA 3T8RA 4XSXF 1P92A 4LLNA 5H6QA 3LFKA 1H0MA 2A3SA 2ACJA 2GA1A 4IRIA 2P5LC 1YIOA 3WGIA 1ZHFA 5DCMB 5DDGA 2W84A 3I71A 3V7CA 1K79A 3MWMA 2UWMA 4LK0F 3BJOA 4HZFA 1YW9A 1WI9A 4GCVA 2OQGA 3LA7A 3JSOA 3T5XA 3M9AA 3TGNA 3ZQ7A 2NNYA 3IRQA 2STTA 1ZARA 4U0VA 3WTYC 1XD7A 2A6EF 3P7NA 4L5IA 2Y48A 2XKPA 5IT9Z 4OIQF 2STWA 1I6XA 4JQFA 2MC3A 2HZTA 3EYIA 4I01A 3SFZA 5E1WA 5HVQC 4A0ZA 2QWWA 1S6LA 2LF7A 4FT8A 3RPQA 1PP7U 4KA4A 1A04A 2PQ8A 1EH6A 2K4BA 5L3DA 2QM3A 4KN4X 1G3WA 2XAFA 2GA2A 2P7VB 2VC0A 4AIJA 2FMYA 3MZYA 5LEJA 3TKYA 2OD5A 4M73A 1D3YA 3ZP5A 3CTAA 4A0YA 4UVBA 5LHGA 2CSOA 1I1GA 4EGZA 1B9MA 2OAZA 2D6FC 2IA2A 2ZJ2A 3H3ZA 3I58A 2X0LA 2RN7A 1REPC 1OYIA 3KP3A 1FYKA 2ELHA 2ZKZA 1IAWA 4L18B 2KJCA 5BPDA 4HLYA 4RGXA 5K1YA 1ZRFA 4HV5A 1RNLA 2W57A 1FYMA 2F5CA 1TNTA 3GXOA 1R00A 1USTA 5ERIA 1KU7A 3RYPA 2COMA 3E5XA 2B0LA 4NB5A 2EWNA 3VODA 5DUKA 1KGSA 2RNJA 1MDMB 5DCMA 4BNCA 3CUQA 5EEHA 3DXJF 2DU9A 2VBWA 3OOPA 2BYVE 2DPUA 1VTNC 2TDXA 2JT1A 2FA5A 2V6CA 2VN2A 4Q47A 3JSPA 1OMIA 3LQRA 1WRJA 3GW2A 2QBYB 3R0AA 2PMUA 2K02A 4TV7A 3R6SA 4M74A 1SD7A 3TDUC 3E6BA 1CF7B 1FSEA 2NRAC 1LEBA 3D0SA 2C6YA 2EB7A 3HRUA 4NQWA 1ZG5A 2WV0A 2MH2A 2O03A 1I5ZA 2H6CA 4EM2A 4Q48A 4IXAA 3ZMDA 3VFZA 4B09A 5CVUA 1O3RA 4HBLA 1R36A 4M71A 4UV9A 1YG2A 1BIAA 2LSOA 3HSRA 2UXNA 1X3UA 3FM3A 2MH9A 3U9GA 5A2QK 1IN7A 2HFHA 2WC2A 3ZN0A 3TDZC 1MZBA 5LLQA 1TLHB 2FNAA 5ICEA 4EJWA 3C1DA 3HSEA 4YG2F 4HYEA 3GFLA 3HTUA 5HLHA 2UZKA 3M8FA 5AIQA 5D5WB 1XMAA 2EA2A 3QRFF 3E6CC 1KYWA 2QLZA 2P8TA 4EQQA 3COAC 4G6DA 4RMFA 3SXYA 4I2OA 2JTVA 3KEOA 1LNWA 3WTTC 4A5NA 2KIFA 1MJAA 2XRNA 4EM1A 1WWXA 4IJAA 3F8CA 3EETA 5E1ZB 1Y0UA 1BI1A 4UUVA 5CLSA 1GHCA 3I59A 1W4MA 3HRTA 1D8KA 1O57A 3IC7A 2FOKA 5BOXA 1R5GA 3ZMVA 2ZNYA 2MLKA 1YS6A 5FD5A 3K9TA 5D8LB 1L3LA 4M72A 3QU6A 2LKPA 3H3UA 3WU0A 4O6JA 2K4JA 3RJPA 1FBSA 1MDMA 1F5TA 1BJAA 3FF5A 2VOPA 4U0WA 4XSZF 2G9WA 2KIMA 3GFJA 1SFUA 2YPRA 1P2FA 4YFXF 2A5YB 3QOPA 3WTZA 2WTEA 4OOIA 3VB2A 2QBYA 3J81K 4KN7X 3CUQC 2P7CB 1ZLKA 1HKTA 3F8MA 1K7AA 4UV8A 4ZH4F 2ETHA 4EVIA 2FU4A 3JTHA 3C7JA 3PQJA 2ZXJA 2Z9OA 3GFMA 4G6QA 5FFZA 4BYYA 2XAGA 2IJLA 3EUHA 1ZAOA 2V1DA 4P5OA 5KVRA 4MEXF 5FO5A 1T0FA 3QP5A 1LDDA 1ZG1A 3KP4A 2GWRA 4P9FA 4CXFA 3BY6A 3FXRA 3M8EA 1XCVA 3BDDA 4UXNA 1TQPA 2XKOA 5DEQA 2V1XA 3ABUA 4KUMA 2F2EA 3QP6A 4LJZF 5CVIA 2HQNA 3HRSA 4LG0A 5JFRA 2W24A 5CVVA 4KIGA 3ML6A 1IZ1A 1FBQA 2YU3A 4LFUA 5DUIA 4RGSA 4Q5SF 2PMHA 2J5OA 4R1HA 3GWZA 3SZPA 2GXGA 2PI0A 2F5DA 4HA8A 1IW7F 1TQMA 2GQQA 5IT3A 4HX4A 3T8TA 3F72A 3J80Z 2QVOA 3FM5A 4A6DA 1XDSA 3QU3A 2L4MA 2VE8A 1KU3A 3WTSC 1IF1A 3Q5FA 1LQ1A 2AXLA 5HS8A 2MBFA 3SHFA 1YYVA 5A2QZ 1S7AA 5L3GA 1IXCA 1XGMA 1BBYA 3V4GA 1U78A 2VONA 3LAPA 2RC4A 4U7BA 3ZMZA 4IF4A 4L0YB 2XGXA 2JPBA 2JSCA 1B4AA 1H9GA 4A2UA 1G51A 1TQIA 4I98B 4LLGF 5HDKA 2EFQA 1O3TA 5LRSA 1XGNA 2KRFA 1O7LA 1ZGJA 5D4SA 3SQNA 5L3BA 1D8JA 4A12A 5E8IA 2VOOA 2QQBA 3TO6A 1YS7A 4BHCA 1U8RA 3BZ6A 3FXUA 1DP7P 3O3KA 1DDNA 2HTSA 2QENA 1BI0A 4KT5C 2DK5A 3I53A 4U88A 4XRFA 1J75A 1SAXA 1G3SA 4CZZA 1QGPA 3DP7A 1W5TA 1U2WA 5HLIA 5ILSA 3LSTA 3CUQB 4NHJA 3V8LA 3KZZA 2CW0F 2LF8A 2E7WA 2RGVA 3F6VA 2EA4A 1ZQ1C 1FBUA 1LB2A 1AOYA 3G3ZA 2O3FA 4MTDA 3WGGA 2IRFG 2F5FA 2QQAA 1ULYA 2P6TA 1Q1HA 2V1UA 3CO6C 4L0ZB 3J81Z 3EDPA 4KIBA 3HHHA 4N0BA 2HOEA 4HX7A 3FX3A 1BI2A 3HIFA 3DFGA 1Z7UA 1MD0A 5FB2A 2CG4A 4U7DA 4EMSA 4G8XA 2HWVA 2M8EA 1R7JA 2GIVA 3U2RA 2A6HF 4PCQA 3R61A 1HSJA 2OZUA 1HKQA 2ZCWA 2R7DA 4EJTA 3MEXA 1AWCA 4RB1A 4QWQA 3FMRA 5E18F 4O2DA 1IXSB 2O61A 3DQVC 3R4KA 5DCFA 2K86A 5DD4A 4HDUA 1ZREA 5AIPA 2PEXA 2XHKA 3V7SA 2V79A 5BS6A 1XGSA 2FNPA 4RB3C 3HOTA 5D8KB 2VT2A 3ECHA 2G7UA 2G7HA 2NYXA 2DI3A 4N9HA 3ZMUA 4XLPF 3RIRA 3LQQA 4BQAA 1S8NA 2XAJA 2K7LA 2MLGA 2HEOA 3T0YA 1TTYA 1FP2A 1IN4A 1EFWA 2H6BA 2ZFWA 2HKXA 3RTRA 2DPDA 1G4DA 2P5VA 2RDPA 4GGGA 3I59B 4K2EA 1DPRA 1MGTA 3RKWA 3V8JA 3F8BA 2JRTA 4AD9A 1RI7A 2DQLA 2OQRA 2ESHA 3FMSA 2EFNA 1DPUA 3IKTA 3M7GA 3ZMSA 3U1DA 2VBZA 4LD5A 3GFIA 4HLXA 3GYHX 2D2WA 3C18A 2GXBA 3KLOA 5FD6A 5JVTA 4Y17A 3V8KA 4Q4ZF 4IHTA 2DQRA 1BIBA 2NS0A 4OMZA 3KLNA 2OZ6A 4G7OF 2L3DA 2RKHA 4WCGA 4YIFA 3ROUA 1D5VA 1UHWA 1B9NA 1T98A 3BPXA 3FHZA 3FMQA 5LBQA 3PFIA 3J80K 4ZZDA 4KYWA 1ZH5A 3GVAA 3W6JB 1FZPB 3ISPA 2ZMEB 1C0WA 2M30A 4MQVA 1I1SA 2ISZA 1W7PB 4PZJA 3DV8A 5FLXK 1YW7A 3E5QA 4OU0A 3E3VA 1PP8F 2EFWA 1RUNA 2HKOA 2FBHA 1RUOA 3QPTA 4LG0B 1XGOA 2ESNA 4AIHA 2Q8KA 3QPHA 4BHBA 2ZBKA 3GEZA 3WU1B 3V7RA 4LB5A 4Y13A 2FEZA 4P96A 1JHFA 2H27A 5DV5A 3WE3A 3KCCA 2QQ9A 5F64A 2WWYA 3PQKA 4ENNA 4G94A 2HQRA 3O2PE 3WE2A 1FPQA 4AIKA 1XMKA 5BMZA 1EH8A 4S04A 4GYGA 2ADUA 1ON1A 1HW1A 1OYWA 3DPLC 4KIFA 3K69A 2JZYA 4U0YA 3WTXC 2K27A 2ZNZA 3K1PA 4E70A 4LMYA 3KFWX 4UHTA 1HW2A 2KJBA 1RZ4A 1H9TA 3C3WA 2P4WA 1QNTA 2D45A 1ZYRF 2EV6A 4ZYHA 2KKOA 3K2ZA 3I64A 1J9IA 3MQ0A 3F8NA 1DUXC 2A69F 1PDNC 4AWXB 2YX7A 1U5TC 4G7ZF 4HQEA 3BJ6A 4N9IA 5HDGA 4UVAA 4EM0B 3E6MA 3L7WA 1SMYF 3FWEA 3QAHA 2MA3A 1T2KA 4HF1A 3JAMK 1UCRA 1HW5A 3JW4A 3TO9A 2VXZA 1Z6TA 4YFNF 3P9CA 3L09A 3HUGA 3DKWA 5D4RA 4WXCA 2E7XA 2GZWA 4RB0A 1OYYA 1SMTA 2ZMEA 3RPUA 1ZRCA 1NHAA 4HX8A 3CO7C 1W7PA 4CO8A 3ZMTA 2L01A 2VC1A 3AAFA 1Z05A 2RQPA 2XVCA 3L9FA 3ZPLA 3B73A 4RB2C 2PLYA 3CDHA 2BE5F 2IT0A 4IHSA 5J8CA 1FLIA 5J8FA 4HF2A 2VBYA 2V9VA 4I7HA 4P9UA 1IN8A 2FQ3A 1FOKA 1MJ9A 3MFKA 4MGRA 2PFBA 1QQIA 1K6OA 1J7KA 4HAMA 2FF4A 4KMFA 3GX4X 1GXPA 1J0RA 4BH9A 1J5YA 3G73A 4Y15A 5FGMA 5LGTA 2IVMA 4WF2A 2L02A 1YFHA 1BI3A 3WTUC 4KFCA 4WJ4A 1OKRA 1E17A 4MHGA 3TOBA 1KQ0A 3BROA 4ESBA 1TW2A 2DLLA 1R58A 5DYMA 3P9IA 2VT3A 1O3QA 4O3MA 4P55A 1KQ9A 4MTEA 3KP6A 4LGWA 5FLXZ 4G9YA 1XDUA 3LA2A 3W6KB 2L54A 4ESJA 1KA8A 1G6NA 2VODA 2EFOA 4GO1A 3HOSA 5TRDA 3D5LA 5CVRA 1I27A 1B59A 3P9KA 5HS7A 2KIUA 2XV4S 4MEYF 1JXSA 5K5OA 2O6GE 4HOBA 2NNNA 4L9VA 4M9SA 2FSWA 1KYZA 2JPCA 4HW0A 1ZRDA 2EK5A 4R79A 2F5EA 1S7OA 3ULQB 2DT5A 4ESFA 3K1MA 4AVPA 2J5PA 1QZYA 1SD4A 1OPCA 4A6EA 1SFXA 1P4XA 3REOA 2EV5A 3MAJA 1ZGAA 2HDCA 1LEAA 2D1VA 1QBJA 5ICFA 3DF8A 5D5UB 4IRGA 3Q9SA 3DEUA 3F22A 1HXDA 3IKVA 5JI6A 1IN5A 1U5TB 1RIOH 4CDGA 4M9ZA 4EJUA 3KEQA 2QYOA 1BM9A 2PBIA 1LDJA 1V3FA 3KE2A 4M9XA 1F1ZA 5ICGA 1Z9CA 2HYFA 2RV8A 5D5XB 4WX9A 4ENKA 2BV6A 1W7PD 2VBXA 4A5MA 1STZA 5LGUA 3MZHA 2P5KA 4L9TA 3B02A 2DW4A 2DFIA 2L4AA 1T39A 2Z5UA 4HQMA 3IRRA 3H92A 2E1NA 4CYDA 3GZ5A 3JAMZ 4MQ9F 2M45A 1YW8A 3VEPA 2R3SA 2CGPA 2VE9A 2M87A 2O0YA 5AONA 3RYRA 1T6SA 1HSTA 3ZN1A 3L00A 2Q0OA 2DTRA 3Q9VA 1J59A 5ILVA 2CQKA 3O6BB 5ILUA 1YTYA 1EV7A 5H6RA 2EV0A 3N4MA 5JR3A 1T38A 1K78A 3ELKA 2Z3YA 1BOAA 1HKSA 3FZVA 4WJ3M 1IRFA 3KP7A 4D0PA 4M6YA 2YX4A 2HS5A 3F3XA 4MNUA 3FXQA 4FHTA 1MKMA 4CICA 3WGHA 2OBPA 1BC8C 4WXHA 1ONVA 1P6RA 1TNSA 2CO5A 1YO5C 4PDKA 1QZZA 1MJBA 1JGSA 1GVJA 4KMUX 1LVAA 4EV0A 5D6EA 4LK1F 1FC3A 1CGPA 3L2CA 1YLFA 5J6XA 1F4KA 2PN6A 5K5QA 2FBIA 4YIIA 1EQRA 1JHHA 3F6OA 4DQ2A 4ZZLA 1BC7C 1FSHA 3BP8A 1LJ9A 2QUFA 5L3EA 1U5TA 2CFXA 2Q2EA 3LA3A 4ZYEA 4FX0A 1UFMA 1Z6RA 1OR7A 3E5UA 2OA4A 4RAYA 4FX4A 1GXQA 1O3SA 1XSVA 1ON2A 1WQ2A 4RS8A 3BOQA 6PAXA 1IN6A 2E1CA 3TOAA 1P4WA 1UB9A 2ISYA 4LLLA 3K1NA 1ODDA 2FMLA 5EEGA 4ETSA 5KK1A 2XAQA 4B8XA 4HV6A 4A0XA 4CGZA 3KP5A 1FP1D 1TBXA 1KU2A 5HLGA 1SD6A 5ED4A 4L9JA 3HYIA 2CWEA 5L3FA 2LNBA 3LAJA 2QZ8A 5TJJA 1FT9A 1FYLA 1V4RA 1S3JA 3KZYA 1SFEA 5K5RA 1IUYA 2IA0A 3ERED 1YQAA 2FXAA 1BN5A 3E6DA 2UXXA 1R1UA 3J7AO 4ENJA 4UVCA 2NAZA 4I0AA 5H20A 2EJRA 2XROA 4KICA 5LEKA 1ZN2A 2DK8A 3T1BA 4L9NA 1XSXA 1WSUA 4IRHA 1F9NA 5LHHA 3NEUA 1E2XA 2Z99A 1FY7A 3CJNA 1EH7A 3HTSB 1XSDA 5CVJA 3ABTA 2P6SA 5LHIA 4WWCA 4RAZA 5F6FA 4L5JA 3I5UA 1FNNA 3WG9A 4RGUA 2ZO4A 1IL2A 2XIGA 3IWFA 3IWZA 2XAHA 2LDUA 3WTVC 1XN7A 2M5WA 1J2XA 3HRMA 4WXDA 1ZG3A 1L0OC 1S29A 5E17F 4BHPA 2HYGD 3I0TA 5ICCA 1XB4A 4G7HF 2FBKA 2IW5A 5F1RA 4EJOA 4JK1X 3F23A 2R7FA 5E1XA 1W5SA 2GAUA 4KNYA 3LWFA 1QO0D 3DPTA 3OV8A 2A68F 1PUEE 1R1VA 3RKYA 2CYYA 4I09A 3GZ6A 2H09A 4YFKF 5JHUA 5CYVA 4DNCA 2IA1A 3R0JA 3BJAA 2MD5A 2D1HA 5E20A 5DD8A 5HDNA 4IVNA 1FX7A 1R5HA 3IHUA 4I02A 2W25A 2DAOA 4S05A 3I4PA 1CF7A 2W85A 5D6FA 3VOEA 4BXUA 1FWZA 4ZYGA 4QLCU 2O8XA 1QPMA 5IT9K 3IL2A 3GUDA 4LB6B 4OIRF 3JTGA 3SZTA 1R23A 3N97A 1Z1DA 2PJPA 2X4HA 3RI4A 4PGGA 1Z91A 1SD5A 1ZLJA 2Y0MA 4OMYA 3WODF 3RKXA 1UHMA 4H0EA 3HSFA 2YSRA 2DO7A 4EGYA 2Y75A 3RDIA 2FRHA 4ZYDA 4UNOA 4JBAA 3CUOA 4PGHA 4R8HA 4AH6A 2BGCA 5LRRA 4I0BA 4HF0A 4IPAA 2OU2A 2A61A 5FFXA 2A07F 1P4AA 3BPVA 4XBFA 5CJ9A 2BBYA 2DBBA 4ENMA 5BPIA 1B6AA 2H94A 2HTJA 4OIPF 3NRVA 1LDKB 3MCZA 2IPQX 4XLNF 4ASNA 3TQNA 1G3YA 1XCBA 2HR3A 1K78B 5HOOA 3TO7A 1HQCA 1JE8A 3EQLF 1KU9A 2YR2A 1HBXG 3F21A 1USSA 3EYYA 3ECOA 4OIOF 2RVCA 4GXOA 3GF2A 1R22A 3KETA 2M1BA 4GYIA 3K0LA 2EFPA 5BQTA 1O7FA 3F8FA 4WK8F 1TW3A 1L0WA 3BWGA 1U3EM 5L3CA 1IRGA 3KP2A 1U6GA 2IP2A 2FE3A 1G3TA 3NQOA 1C0AA 3GO5A 1IXRC 1B1BA 2XASA 3R60A 4M6XA 3CLOA 2AS5F 3E97A 3S2WA 3M1EA 4O5VA 2BEOA 3HHGA 4OINF 4CHUA 3WTWC 2Z33A 4ON0A 4BAYA 5LGNA 4Z2YA 1WKMA 2PG4A 4KDPA 4RGRA 1KQ8A 5E8GA 4F7ZA 2HGCA 2XUBA 5D5VB 5HS9A 4EJVA 3I54A 3GLXA 1R1TA
chains in the Genus database with same CATH superfamily
3GTJK 4HDVA 1BOBA 3T8RA 4D9JA 2IS6A 1DGRM 2WAEA 3GTQJ 4F93B 3NUHA 4XSXF 1P92A 5TGTA 3T00A 4LLNA 5H6QA 1KQ4A 3AG3H 3LFKA 1X4OA 1H0MA 2A3SA 2VASA 2ACJA 2GA1A 4IRIA 2P5LC 2LY2A 1YIOA 3WGIA 2ZSHB 1ZHFA 5DCMB 4BBRJ 4CA0A 1KONA 2W84A 3GLLA 3VSKA 5DDGA 3I71A 3V7CA 1YI2I 1K79A 1TWCA 2WBMA 4XMYA 1BGWA 5DS9A 1W1WE 2M4KA 3IAS2 3MWMA 3CCMI 3JRGA 2UWMA 1S9HA 4LK0F 2R92A 3A8IA 1Y1WA 3BJOA 3CMAI 2R5ZA 1IQ0A 4HZFA 4XOTA 2JQ7A 1YW9A 2VJ4A 4Y52C 2ICWG 1LE8A 3RZDC 1WI9A 4GCVA 3KEYA 4JP0A 4D5FA 2OQGA 1OQYA 3LA7A 1IRXA 3JSOA 3T5XA 3M9AA 2EQRA 1ISEA 4PABA 3TGNA 3ZQ7A 2NNYA 3F9KA 3MD2A 3IRQA 3CF5F 2STTA 1ZARA 3GTMJ 4BE1A 4C2MC 4U0VA 1ETVA 1XD7A 2A6EF 5FKMA 3WTYC 3PL8A 2R7WA 2YU9J 3TFHA 3P7NA 2H1KA 4L5IA 3HKZN 2Y48A 4XRSG 2XKPA 4NQWB 5IT9Z 4OIQF 3PNVA 4DDQA 1EKEA 2STWA 1I6XA 2EH3A 1X3WB 4JQFA 2MC3A 3LSMA 2HZTA 3CQZC 3BQZA 1P7IA 3G4AA 3EYIA 4I01A 1V5EA 2NVXC 2MYSA 3SFZA 4M3BA 2DJIA 5E1WA 3WHCA 3L4JA 5HVQC 1ETWA 5CHPA 4FM9A 4G0VA 4ZC3A 2LVSA 2QWWA 4A0ZA 1JT6A 1S6LA 2AHQA 1HDDC 2LF7A 4FT8A 3OYNA 3RPQA 4MO7A 1PP7U 4KA4A 1A04A 1SVOA 2Y0SN 2DA4A 2PQ8A 1EH6A 3JRHA 2ZUEA 2EZIA 4XLAA 2K4BA 1UELB 5L3DA 3S1NC 2M34A 2QM3A 4KN4X 5F0HA 1G3WA 2XAFA 2GA2A 4Y52K 2P7VB 3AD7C 3OL3A 3RZDK 3M07A 4FTHA 2IS2A 2A5WA 3GTMA 5KAIC 3SEQA 2VC0A 4AIJA 1HOMA 3S1QC 2FMYA 2YU9A 3H9GA 3MZYA 5LEJA 3CCJI 3TKYA 2OD5A 2WB1L 3MMYB 4M73A 4RDUA 3GTPJ 1D3YA 4QJVA 4C2MK 3ZP5A 3CTAA 3PSFA 3W3CA 4RM3A 1AHDP 4A0YA 4UVBA 1J6VA 2L9VA 4B3XA 5LHGA 2CSOA 5M5XJ 5FKNA 2XRLA 1I1GA 4EGZA 2CUZA 3M3YJ 1D0ZA 1SFOC 1WJ5A 1B9MA 3QX3A 2OAZA 2D6FC 3CQZK 1IV6A 5EJCA 4BKXA 2IA2A 2E34A 2WB1D 1TP4A 2ZJ2A 3H3ZA 1PUFA 3I58A 1Z3XA 3S16C 2X0LA 2RN7A 4DGWB 5JVGF 1REPC 2O5IA 1OYIA 3KP3A 4ZTJA 3GTOJ 1FYKA 2KWAA 2ELHA 4PJJA 2ZKZA 1IAWA 4L18B 3G1MA 2G0EA 1N78A 2KJCA 5BPDA 4UB6C 5KNLA 1DCOA 2V9KA 3PIPF 4HLYA 4FETA 3L2VA 4RGXA 3E1SA 1I50J 3H0GJ 3ZXSA 5K1YA 2LOOA 3S1NK 1VQNI 1ZRFA 4BXXC 4BUPA 4HV5A 1RNLA 2W57A 1FYMA 4OAYA 2F5CA 1TNTA 5IORA 4F3QA 3GXOA 3HOWC 1R00A 4XK4A 1USTA 5ERIA 4G7HA 3M4OK 3PO3K 3DBRB 1KU7A 3BG9A 2E1MB 4KMUA 3CC2I 3RYPA 3G2BA 1ZBSA 3K4CA 2COMA 3E5XA 2B0LA 2OV7A 5HLTA 1QPIA 4NB5A 3HOZC 2EWNA 2A68A 3VODA 1IC8A 5DUKA 3HEFA 1E3HA 1KGSA 5IYCC 2RNJA 3OYEA 3QPLA 1MDMB 5DCMA 3AL0B 4BNCA 4M3GA 1ETKA 3CUQA 4YFKA 5EEHA 5EEAA 2QSFX 3OIPA 3DXJF 4HEA2 2EBIA 1EF4A 2DU9A 1SFOK 2VBWA 1WJDA 3TFJA 2LP0A 4IOAF 3OYLA 3HOYJ 3OOPA 4DOZA 1NH3A 2BYVE 3CCSI 2DPUA 1S5LC 2GAGC 2K9NA 3EUKL 2MD0A 4GFBA 1VTNC 3S16K 2TDXA 2W82A 2JT1A 2FA5A 1WQFA 2V6CA 2VN2A 4BL0B 5FJ8J 4Q47A 3LSKA 3JSPA 1I50A 1OMIA 3LQRA 1WRJA 2CU7A 3GW2A 2QBYB 3JRAA 4DZPA 2GIZA 3R0AA 5FKOA 2PMUA 2K02A 1TWCC 4TV7A 3BR1A 3R6SA 1VQ5I 1WOPA 4M74A 1SD7A 3TDUC 4A3GJ 5IOTA 3E6BA 1CF7B 1FSEA 4A3BC 4IHYA 2NRAC 4BXXK 3GTLJ 1LEBA 1Y1WC 3ZQHA 2K85A 3D0SA 3LSRA 3DLLF 3OS1A 3HOXC 3HOWK 2C6YA 4BE0A 2EB7A 3HRUA 4OIRA 3IH4A 4NQWA 5F04A 3PIOF 1ZG5A 4XN3A 2WV0A 2RH6A 4P5AA 1V54H 2MH2A 3ZQIA 5IYBJ 3BG6A 4LOCA 3D1NI 3OYCA 2O03A 1RR8C 1I5ZA 2H6CA 4M6VA 4Q48A 4EM2A 4IXAA 3HOZK 3ZMDA 2E2IJ 2R0QC 2R5YB 3VFZA 1XPXA 2QF7A 5IYCK 4B09A 5CVUA 4G0UA 1O3RA 4HBLA 2W7VA 1G2HA 3HB9A 1LFBA 5B66C 4BQQA 1R36A 3GTQC 1JT0A 1NK3P 4M71A 4UV9A 1O24A 1TWAA 1YG2A 1BIAA 2LSOA 4I76A 4Y33A 4Y7NJ 4E6KG 3HSRA 4PFPA 3OYFA 2UXNA 5LFAA 1X3UA 3FM3A 3K4JA 4IHXA 3I9V2 3ABLH 3WODA 1GV2A 2MH9A 3U9GA 5A2QK 2JK3A 1IN7A 2F6CA 4HSTA 1WH5A 2HFHA 2WC2A 2JWTA 3ZN0A 2X85A 3PSIA 1W0TA 4YIRX 2V6TA 4BBRC 2YUSA 1O27A 4QSHA 3TDZC 2JA5J 1MZBA 2E19A 5LLQA 1TLHB 2FNAA 3HXAA 5ICEA 3LSPA 4EJWA 3C1DA 3HSEA 4YG2F 3TTGA 4QIWL 5B1AH 4IO9F 4HYEA 4BACA 3GFLA 3HTUA 2XF6A 4B44A 5IOQA 3GTLA 1TWCK 5HLHA 4DIQA 2GOMA 5EGOA 2HYJA 2UZKA 3M8FA 5AIQA 5H2FC 5D5WB 4AM3A 1XMAA 2EA2A 1F93A 4A3BK 2R92K 3QRFF 1Y1WK 3E6CC 1KYWA 3O8GA 3HOXK 4RBOA 1X4PA 3OSFA 4J3NA 3PM1A 2QLZA 2P8TA 1BR2A 4ITVA 4EQQA 2ZJPF 4QIWD 3COAC 4G6DA 2E2IA 4RMFA 3SXYA 5J1YA 2Y69H 4OIPA 2LYCA 3GTMC 3ZR8X 2JTVA 3KEOA 4I2OA 2IS1A 1BW5A 1J6WA 1LNWA 1F7VA 3GEEA 4B4CA 1KZHA 2YU9C 3WTTC 1UG2A 4A5NA 1UAAA 1I6VA 2VQHA 5LD2C 2KIFA 1MJAA 2OCCH 2XRNA 4EM1A 1R9TJ 2NVQJ 3C2BA 3N0CA 1WWXA 4IJAA 3HG9A 3EQLA 4W97A 2DMUA 3DEWA 2V4JC 3F8CA 2Y31A 3EETA 5E1ZB 3TW6A 1Y0UA 1BI1A 2GM4A 1O29A 4UUVA 3HC7A 2LH9A 2V9PA 5CLSA 4C9YA 4OIOA 1GHCA 3I59A 2KT0A 1DCPA 1W4MA 3HRTA 1D8KA 1NK2P 1O57A 3IC7A 3CP8A 3OIOA 2XCQA 5EG0B 2FOKA 4BBRK 5BOXA 1R5GA 2WAQA 4D7NA 4A3IK 1VLOA 4AUXA 4XKVA 4CCLA 3ZMVA 3N0BA 2NVYJ 2ZNYA 2MLKA 1YS6A 1QHGA 2M7BA 4C2TA 5FD5A 3S1MJ 3K9TA 4XOPA 4LOWA 2XGDA 1AB4A 3QOEA 5D8LB 3A8JA 3FBNB 1L3LA 2LC2A 4M72A 1LFPA 3QU6A 2LKPA 3H3UA 4A3JJ 3WU0A 4AYBL 4O6JA 2K4JA 4F92B 2EPFA 4RA2A 3RJPA 5DM6F 1GLNA 3D5RC 4M3EA 1FBSA 3K70C 1MDMA 1F5TA 3DEEA 3ZQFA 4C3JJ 3C2HA 1I6HK 4A3FJ 1BJAA 4IX7A 3FF5A 3UR3C 2VOPA 1D0YA 5IP9J 3GTPC 3GTMK 4U0WA 2YU9K 4XSZF 1TT5B 5CPRB 3FHNA 3IAM2 2G9WA 2RREA 2KIMA 3GFJA 3ZRGA 1SFUA 2YPRA 1P2FA 4AYBD 4OINA 1A6QA 3SDBA 2W00A 1K6YA 2A5YB 2Y9YA 3QOPA 3WTZA 4YFXF 1WGXA 3TEDA 2ZJQF 2WTEA 4OOIA 3M3YC 3VB2A 1YJ9I 4BJ5C 3H9JA 1OJLA 3KX2A 4UUSA 2QBYA 3J81K 4KN7X 3CUQC 4BJ6C 1A35A 2VJIA 2P7CB 3K2AA 1VNDA 1H8AC 1ZLKA 1HKTA 4GTBA 4RAGA 3F8MA 2KMUA 1K7AA 2NVYA 4UV8A 4ZH4F 2ETHA 3M1CA 4F55A 1D5YA 4EVIA 1JQWA 4IEJA 2FU4A 3JTHA 3C7JA 1HA8A 2BVLA 3PQJA 1FOYA 2ZXJA 2Z9OA 4QPQA 4HSRA 3GFMA 2CW7A 3ADAC 3S1RJ 4G6QA 5FFZA 4BYYA 2XAGA 5HNHA 2IJLA 3EUHA 1I50C 4XSXA 1ZAOA 3DBLB 1USMA 2V1DA 4P5OA 5KVRA 4MEXF 2FUG2 5FO5A 1T0FA 4A3EJ 3QP5A 3I55I 5FLVA 1LDDA 1ZG1A 2V6EA 3S2HJ 3KP4A 1WJFA 1VQOI 2GWRA 4P9FA 2BY2A 4CXFA 3BY6A 3FXRA 1X1DA 3RZOJ 2Y0SA 3M8EA 1XCVA 3BDDA 5J3LA 3EUAA 4BU2A 2X6XA 1XXBA 4UXNA 4XM3A 5IY5H 1TQPA 2XKOA 3FXMA 1K4SA 4X6AJ 2F4IA 5DEQA 3FKJA 4XLHA 1AU7A 2E5NA 2MABA 1X1CA 4LK0A 2V1XA 3ABUA 1JOEA 4KUMA 2F2EA 2F48A 3QP6A 4A3MK 4LJZF 5CVIA 3TW7A 2HVSA 3ABKH 5M5XK 2HQNA 1LFUP 3S15K 3BR0A 3HRSA 4LG0A 5JFRA 2R5ZB 3M3YK 1BR4A 4NC7A 2R7SA 1LE8B 2LY9A 2W24A 5CVVA 2EZHA 2PPBA 4KIGA 2K3PA 3ML6A 2NXNB 3HOYC 3I4MJ 1IZ1A 1FBQA 2YU3A 4LFUA 4RM2A 5F08A 5DUIA 1JKOC 1V5GA 4RGSA 4ANJA 2NVXA 4Q5SF 4GRIA 2I8DA 4BE2A 4CCJA 2BVMA 2PMHA 2LREA 3G6EI 4AVZA 1OISA 1SC7A 1ORKA 2O9LA 2MSYA 2HPIA 2VI6A 5C3EJ 2J5OA 3DCFA 2XCOA 4OIQA 4R1HA 3GWZA 1I50K 1Z7LA 3SZPA 4A3GC 2GXGA 2PI0A 2F5DA 4HA8A 5C4XJ 1IW7F 1TQMA 3GTLC 4IOCF 3E0JB 1ZR4A 3J7AY 2GQQA 5IT3A 4HX4A 4XKBA 2L7ZA 3TL4X 2HPMA 3T8TA 4M3FA 3F72A 2P0WA 3CESA 3DKYA 2QVOA 3FM5A 3J80Z 2E35A 1WSVA 2FJ1A 4A6DA 2VQLA 3GDZA 5IYBC 3GCMA 3ZGKA 5C44J 2H8RA 1XDSA 3QU3A 2E2JJ 2VL8A 2L4MA 2VE8A 5J40A 4KB2A 1KU3A 2E2IC 3WTSC 2V7FA 1IF1A 4KMDA 3Q5FA 2HXIA 4PSWA 1LQ1A 2DA3A 2AXLA 1PJ5A 3T02A 5FKLA 5HS8A 2MBFA 3QYBA 2NVTJ 4IKFA 3SHFA 3CCRI 3G1OA 1YYVA 5A2QZ 1S7AA 5L3GA 1IXCA 1XGMA 4Y7NC 1XS9A 1BBYA 1TWGJ 3V4GA 1U78A 2VONA 2XCRB 1PJRA 3LAPA 1JI8A 2LK2A 3K4LA 3K7AJ 1TWAK 3HOYK 1MBGA 2RC4A 1MH3A 4JX4A 4U7BA 1V5FA 3ZMZA 4IF4A 3ZCOA 5FJ8K 4L5EA 5TMCA 5M5YJ 4XIDA 2JA5C 2HOAA 4JYKA 1IG7A 4QJVB 4CZCA 3KPHA 4L0YB 4H4KC 2XGXA 5FRMA 1VQKI 2BXYA 2JPBA 2JSCA 2JN6A 1B4AA 1XX5A 2FX0A 2GSNA 1H9GA 4HNTA 1YX2A 4A3GK 3TP3A 1QVTA 4NDLA 4A2UA 3GTLK 1G51A 1TQIA 1Y1VJ 4I98B 1VFCA 4PJ0C 4FASD 5M5WJ 4NC8A 1PUFB 3HGYA 5J4YA 4LLGF 2CQQA 2OTJI 5HDKA 1V55H 2EFQA 1EH1A 1O3TA 5LRSA 1IGNA 1PJ7A 5IYBK 5K7FA 3LNQA 3MKWB 4A3KK 1XGNA 2KRFA 1O7LA 1ZGJA 3OYAA 5D4SA 3PUBA 3SQNA 5L3BA 1D8JA 4A12A 2E2IK 4ZYAA 1WQGA 1TWGA 1R9TC 5E8IA 2VOOA 2NVQC 3HKZL 2QQBA 1T95A 3TO6A 1YS7A 2IGMA 4RMNA 4BY7J 4BHCA 4Y7NK 1U8RA 3L2RA 3BZ6A 5M3FJ 3DLAA 1WOSA 1P7JA 3FXUA 1DP7P 3JREA 1ZQ3P 3LSGA 3O3KA 1DDNA 2HTSA 2QENA 1BI0A 2WAQN 2R7QA 1XPPA 3MKYB 4NUBA 4KT5C 2DK5A 3I53A 4U88A 1BJTA 4XRFA 4M1XA 1J75A 1EK8A 3HKZD 2KZVA 2JA5K 1JKQC 1TWFJ 1SAXA 2NVYC 1G3SA 4CZZA 1QGPA 2X1EA 1JJ6C 3DP7A 1W5TA 1ITYA 3OWTA 3S1MC 1U2WA 1TT0A 3N05A 5HLIA 3JRBA 5ILSA 3LSTA 3DXJA 3CUQB 2ME6A 3OR2C 2FD5A 4NHJA 4A3JC 2CW0F 2LF8A 3KZZA 3V8LA 2E7WA 3EUHC 2RGVA 3F6VA 2EA4A 2XPUA 1ZQ1C 1FBUA 3PNYA 1LB2A 3HOUJ 1AOYA 1T0FC 3G3ZA 2O3FA 4MTDA 2HVRA 4C3JC 4ZDPA 4A3FC 3WGGA 2IRFG 1R4MB 2L9NA 1I3QJ 4YEJA 2ZMEC 1XTAA 4JOMA 3MKZA 5IP9C 2RGRA 2F5FA 2QQAA 1ULYA 1UV7A 2P6TA 4N4NB 4NNJA 1SANA 1Q1HA 2UV1A 3U1KA 3GTKJ 2V1UA 3CO6C 3CF2A 4L0ZB 3J81Z 3EDPA 1R9TK 2NVQK 2TCTA 1H88C 4KIBA 1OLTA 3HHHA 4N0BA 2HOEA 1Y0NA 3FX3A 4HX7A 3GTQA 1BI2A 3HIFA 2DODA 3DFGA 3IH2A 2NS7A 1Z7UA 2YS9A 1MD0A 1VGXA 1JKRC 2DXIA 3MVPA 2UUZA 5FB2A 1TWFA 3NARA 2CG4A 1AKHA 4U7DA 4EMSA 5E3LA 4G8XA 2HWVA 2M8EA 1R7JA 2NVYK 2GIVA 4ZTFA 3U2RA 2A6HF 1IBAA 4PCQA 3ASNH 3R61A 4I6ZA 3S1MK 2LKXA 1HSJA 2F4OB 1HKQA 2OZUA 2VKEA 2ZCWA 2R7DA 1POGA 4EJTA 1OCTC 3MEXA 4U87A 4A3EC 1AWCA 4RB1A 3SFIA 4QWQA 5GAEJ 1B72A 1WORA 3S2HC 3TFIA 2CS3A 3FMRA 5E18F 5IOSA 3H5RA 3A03A 4EATA 2B9SA 4KISA 1GV5A 4C3JK 3RZOC 4A3FK 1SVMA 3G71I 4CUGA 4O2DA 2W7NA 4Y3OA 3GTKA 1IXSB 2O61A 1Y39A 4X6AC 3DQVC 3CC4I 5IP9K 3FXKA 4UUTA 4YG2A 3R4KA 5DCFA 1J98A 2DOFA 2K86A 2B63J 5DD4A 3Q3QA 1Z0XA 4DBQA 4HDUA 5IOZA 5AIPA 1ZREA 4GTAA 4DZJA 2DMQA 2K40A 3CZ6A 2PEXA 5EGOB 2I10A 3HOVJ 2XHKA 3V7SA 2V79A 5BS6A 5HNFA 1XGSA 2FNPA 2X1CA 1HI9A 4RB3C 3HOTA 3HPGA 1Y8QB 5D8KB 2IGNA 2VT2A 4MIMA 3ECHA 3A2KA 3I4MC 3H36A 2HXOA 2G7UA 2M7AA 2G7HA 3BR6A 3BR5A 2NYXA 5TJ3A 2DI3A 2KFDA 1QVUA 4N9HA 3ZMUA 3RIRA 2DA5A 3LQQA 4B47A 4XLPF 4BQAA 1S8NA 1X1AA 2XAJA 2CV1A 2NVXK 1R49A 2K7LA 2MLGA 5C3EC 2GOXB 4HPQA 1JJ8C 2HEOA 3T0YA 1TTYA 1D0XA 1FP2A 4RLQA 1IN4A 4Y4RA 3OYHA 4C45A 1EFWA 5C4XC 2H6BA 2ZFWA 2HKXA 3RTRA 2XGEA 2DPDA 4A3EK 1YJNI 1G4DA 3K4BA 2P5VA 3S2HK 2RDPA 4GGGA 3I59B 4K2EA 4ZJZA 1DPRA 1MGTA 3RZOK 3RKWA 1YE9A 3V8JA 2B63A 2PHCB 2CQXA 5C44C 1OCZH 3DKXA 3RKQA 1ETYA 3F8BA 2E2JC 4KB4A 2JRTA 3H35A 4AD9A 2R7OA 1RETA 1RI7A 3E7LA 3GTPA 2DQLA 2ZXWH 1VQ9I 4PJNA 3W2VA 3S1QK 2OQRA 5B3SH 2NVTC 2ESHA 3FMSA 2E60A 2EFNA 1DPUA 2XB5A 3IKTA 3CCLI 1TWGC 4QPOA 3M7GA 3ZMSA 3U1DA 4GFQA 3HL2A 2I5UA 2VBZA 4PFOA 3K7AC 5GPAA 1VQLI 1MBFA 2GLOA 4LD5A 3GFIA 2ZJRF 3W2AA 4HLXA 3GYHX 2D2WA 1G8XA 3C18A 2GXBA 3KLOA 4XSZA 3S0XA 4HNVA 1O4XA 2HVQA 2BHYA 3GTOA 5FD6A 5C3EK 5JVTA 4YFXA 5EYRA 1YX5A 3AH5A 4A93J 4Y17A 2XPWA 3H1CA 3V8KA 4Q4ZF 1BS2A 4IHTA 2CFAB 2DQRA 4MFEA 1JVIA 5GPCA 3H0GA 1BIBA 1Y1VC 2NS0A 4UUSB 3HM5A 4OMZA 2O8KA 3KLNA 2OZ6A 5J1RA 4G7OF 4ZH4A 3BTJA 2L3DA 4BLBA 2RKHA 1QA6A 4WCGA 1VF9A 4YIFA 1JUPA 3ROUA 1VQ8I 1FOXA 1X19A 1D5VA 5C44K 4G6TB 1UHWA 2JSPA 2B63K 4P5BA 1B9NA 2DCEA 2DN0A 2E2JK 1VRQC 1T98A 3GIRA 3BPXA 3H5AA 1ZXOA 3FHZA 2CUJA 3MN2A 5JFEA 2XSJC 3FMQA 3DU5A 3VSLA 5E3MA 5LBQA 2NVTK 3PFIA 4G0WA 2MGQA 2MG4A 5EGEA 2DOAA 4BY7C 4JX6A 1TWGK 3J80K 2GXAA 4ZZDA 4JX5A 4KYWA 1ZH5A 3GVAA 1IJWC 3W6JB 1FZPB 3FXOA 3NWSA 3K7AK 3ISPA 2ZMEB 3HXLA 1C0WA 2M30A 4MQVA 4CCNA 5GTHC 2X6OA 1I1SA 3BR3A 2ISZA 1W7PB 4PZJA 1N25A 2EINH 4II2A 3DV8A 1J6XA 5M5YK 1ZTRA 4XICA 5FLXK 1TWFC 1YW7A 2ECCA 4XONA 1UG0A 2CJJA 4J01A 4LJZA 1RC9A 1T33A 3E5QA 2ELKA 4OU0A 1NG7A 3E3VA 1PP8F 2EFWA 1RUNA 2FQOA 3VWBA 2HKOA 3RQ4A 2FBHA 2DMPA 2BHZA 1RUOA 3QPTA 4LG0B 3A8KA 1XGOA 2ESNA 2JA7J 4Z6YA 2BOLA 5IP6A 4AIHA 2E2HJ 2Q8KA 1WCMJ 1Y6IA 4XL9A 3HOUC 5M5WK 5IPAA 2KPMA 1JUSA 2QEXI 4KDDA 3G4CA 4RAFA 3OR1C 2LKSA 3QPHA 3FKIJ 3MKLA 4BHBA 4Q5SA 5M3MJ 2ZBKA 1I3QC 2OCEA 3GEZA 1M1EB 3WU1B 2ZUFA 5B1BH 3PO2J 1UHSA 1WJAA 3V7RA 4LB5A 3PUFA 4Y13A 2FEZA 4P96A 3GTKC 2QKLB 2EZLA 1JHFA 2ZXIA 3DWLE 2H27A 1YNJA 1D1BA 2DTZA 3K6GA 5DV5A 3WE3A 2FQTA 1IDZA 1IW7A 1I39A 3RSNA 4BY7K 2IAIA 4XLNA 1U9OA 3AQPA 1R4NB 3KCCA 2QQ9A 5FLMJ 4E7ZA 2K9QA 5F64A 5M3FK 1LUJB 2WWYA 2PMZA 3KIOA 1RESA 3PQKA 4ENNA 4G94A 3FK7A 5F1JA 2IXSA 3GTQK 2HQRA 3O2PE 3WE2A 1R71A 1O2AA 1FPQA 4AIKA 1FIAA 4FISA 1XMKA 5BMZA 1TWFK 5JHFA 1EH8A 4S04A 4GYGA 1Z67A 1VQ7I 2R93J 2XGCA 2KRHA 4E4HA 2JA5A 3A4CA 1PVEA 1ON1A 2ADUA 4F91B 2E2HA 3S3OA 1HW1A 1OYWA 3DPLC 4XLEA 3GEHA 4GTCA 4KIFA 1WCMA 3IP4B 3AFHA 3K69A 2JZYA 4S0HB 4U0YA 4B1RA 3WTXC 2K27A 2LLKA 2ZNZA 3K1PA 3FKIA 4OWRB 3BZKA 1APLC 2PA8L 4E70A 4LMYA 3KFWX 1USOA 4UHTA 2KDOA 4E7IA 4GTLA 1RKTA 4BDYA 1HW2A 2KJBA 1RZ4A 2R7TA 4XLFA 1H9TA 3KZIC 1I3QK 3K70D 4XORA 3C3WA 2JRMA 2KP6A 1QNTA 2P4WA 1T08B 3S17J 2B63C 3GTKK 2D45A 4HNUA 3CAGA 1ZYRF 2EV6A 4ZYHA 2KKOA 1OCPA 3K2ZA 3I64A 4YELA 3SJMA 1J9IA 2PA8D 3MQ0A 5E3NA 3HOVC 3SZZA 3GMEA 3F8NA 4ZDLA 3H0DA 1R9TA 2DA7A 1DUXC 2A69F 3JSTA 2JMWA 2DA1A 2ZFUA 1PDNC 4AWXB 2YX7A 1YNNA 1F7UA 1U5TC 4G7ZF 4HQEA 3X2QH 3CCQI 3CDIA 3S14J 3S2DJ 3BJ6A 4N9IA 2COBA 5HDGA 2CFAA 4UVAA 4EM0B 2R93A 3E6MA 2K5CA 3L7WA 1LVKA 4UY8I 1SMYF 3BG5A 1X1BA 3FWEA 1BA5A 1OCOH 4YRVA 4JK1A 3I56I 3LFUA 3Q0WA 3RZDJ 3Q0VA 4LR2A 2V6UA 2MC4A 3QAHA 4ILDA 1OFCX 1K83J 1Y8RB 2MA3A 1Y56A 3WU2C 3LL7A 3GTOC 1T2KA 4HF1A 3JAMK 1JTXA 2BW3A 1UCRA 1HW5A 4AU7A 4KMAA 3DPUA 3JW4A 9ANTA 3TO9A 1YHQI 2VXZA 3N3YA 3H0GC 1Z6TA 3FIWA 4A3DJ 4YFNF 3BG7A 1A5JA 3P9CA 3L09A 3HUGA 3DKWA 4EEFG 2Y2ZA 3K4KA 5D4RA 2QSHX 4WXCA 2E7XA 2GZWA 3OYMA 4RB0A 1YITI 2JA8J 1OYYA 4PSXA 5HODA 1SMTA 2ZMEA 1QRYA 2R4GA 3RPUA 1ZRCA 5JVOA 2CUEA 3VDXA 1NHAA 4HX8A 5E3OA 3CO7C 1A31A 1W7PA 4CO8A 3ZMTA 3HOVK 1X3ZB 2L01A 4B3AA 4DW6A 2VC1A 3AAFA 2CW0A 4NOIA 3GTPK 2VKVA 1Z05A 4XKWA 3FK6A 2RQPA 2K9LA 4DJAA 2Z16A 4IQJA 2EIMH 1IRZA 1F36A 2XVCA 3L9FA 1FEXA 3SEZA 1MIJA 1MNEA 2IGKA 1N77A 2F5VA 3ZPLA 2VQCA 4KARA 3A01A 2ZFZA 2R7ZJ 4E7KA 3B73A 5D4DA 4A69C 4RB2C 2R7RA 2NOGA 2PLYA 2R7XA 2O7OA 2BE5F 3CDHA 2IT0A 5J8CA 4IHSA 5J8FA 1FLIA 4HF2A 3WHBA 1K83A 1LKXA 1XXCA 4UB8C 2VBYA 2V9VA 2CFOA 2DDAA 1RRJA 4I7HA 4P9UA 1IN8A 2FQ3A 1FOKA 1MJ9A 3M4OJ 3MFKA 3PO3J 4PAAA 4MGRA 4W1UA 2PFBA 1QQIA 1K6OA 3H3VD 4A93C 1J7KA 4GTFA 3GTOK 4HAMA 2FF4A 5B5EC 4D1QA 2A6EA 4KMFA 3GX4X 1GXPA 1J0RA 3H9QA 2DYRH 4BH9A 1J5YA 2VKHA 1WSRA 3G73A 3WG7H 1W36C 3OS2A 4Y15A 5FGMA 1INNA 5LGTA 3H0GK 2IVMA 2AQEA 3CJTB 4WF2A 2L02A 1YFHA 2R7UA 3O8HA 1AKHB 1BI3A 2KHMA 3P5JA 3WTUC 4F52A 4KFCA 2HOSA 1X58A 4WJ4A 1OKRA 1E17A 2A6HA 4MHGA 3TOBA 1KQ0A 3BROA 1FOWA 4ESBA 2VPLA 2OJED 1TW2A 2DLLA 3BTIA 1R58A 1YRNA 5DYMA 3P9IA 4ZDOA 4GDFA 2VT3A 1O3QA 3CD6I 1MNDA 4O3MA 4P55A 1KQ9A 4MTEA 3KP6A 2KZGA 1B72B 4LGWA 2R7ZA 5FLXZ 1WOOA 5IP7J 4C3HJ 2M0MA 3DU6A 4G9YA 1XDUA 3K4NA 2WAQL 3BCAA 2ECBA 5GP9A 3LA2A 3W6KB 1E0EA 2L54A 1MMAA 2NVUB 1O2FB 4BXXJ 4ESJA 4HRIA 1KA8A 4OAZA 1G6NA 4II3A 2VODA 4KM8A 2EFOA 4GO1A 1MMDA 3HOSA 4A93K 5TRDA 3D5LA 2WAQD 2JA7C 2DFHA 3CCEI 5CVRA 1I27A 4C3IJ 1B59A 3P9KA 3RQIA 3PJRA 3F0CA 3H3VK 5HS7A 2E2HC 2HNHA 1WPKA 1IDYA 2KIUA 2XV4S 1R5ID 4MEYF 2L9RA 1WCMC 2OTLI 1JXSA 5K5OA 2O6GE 4HOBA 3HBLA 1ETXA 4V2GA 2NNNA 3FOEA 1V5VA 4BGDA 3FKIC 2PJRA 2JUCA 4L9VA 3GTGJ 3BP3A 1VZ0A 4XLPA 4M9SA 2FSWA 1KYZA 3QPSA 3PO2C 2JPCA 4HW0A 1BJZA 2QGUA 1ZRDA 2EK5A 2WB1A 1RPWA 3OPFA 2BY3A 1FJLA 4R79A 2F5EA 1S7OA 3PNTA 4IHVA 3ULQB 2V1NA 5FROA 2DT5A 1CQTA 4ESFA 3K1MA 3BTLA 2PMZN 3OIQA 4AVPA 2J5PA 2OUMA 5FLMC 1QZYA 1SD4A 1OPCA 4A6EA 1SFXA 1P4XA 3QWLA 3REOA 2EV5A 3MAJA 1ZGAA 2HDCA 1LEAA 4LITA 2D1VA 1QBJA 1HC8A 4KITB 1ENHA 5ICFA 4WILA 3DF8A 1WHUA 4CCKA 3IPJA 2NOJB 5D5UB 1XZPB 2R92J 4P9SA 2R93C 4XRMA 1MSEC 4IRGA 3Q9SA 2QCOA 3CJRB 3DEUA 3OL4A 3F22A 1XZQA 1HXDA 3IKVA 5JI6A 2CUFA 2V26A 1IN5A 5EDNA 1U5TB 1RIOH 2JJ7A 4J19A 3EPZA 2X1DA 2JA7K 4CDGA 2X48A 4M9ZA 2E2HK 3DBHB 4EJUA 2HOTA 4CH7A 1MW7A 2AXTC 1WCMK 3KEQA 1BW6A 2OPTA 2QYOA 3GTGA 2Y0SL 1Y1VA 4KT6A 1BM9A 2PBIA 1LDJA 1V3FA 3KE2A 4M9XA 3FKIK 3B6CA 5M3MK 1F1ZA 1YCLA 4KATA 4GZYA 3DTIA 4CYCA 3PO2K 1JKPC 3S17C 5ICGA 1Z9CA 2HYFA 2RV8A 1VH2A 5D5XB 1YOVB 2AO9A 2L7FP 3RPUD 1QHHD 4WX9A 4ENKA 4Q4ZA 3BT9A 3CDLA 2Y0SD 2BV6A 1W7PD 1ZELA 2VBXA 4A5MA 2Y9ZA 2VUMJ 1STZA 5LGUA 3D5SC 3L1PA 5FLMK 4A3IJ 3UKGA 3MZHA 1U0JA 4G7OA 4A3LJ 5CQEA 3S2DC 3S14C 2H8WA 2LRDA 1WI3A 2P5KA 1I3AA 3B02A 2DW4A 4L9TA 2DFIA 2L4AA 1NG6A 2W4SA 2Y30A 2VXDA 4NC6A 2O5RA 2Z5UA 1T39A 3CJQB 4HQMA 3IRRA 3H92A 5K7ZA 2E1NA 2W48A 4CYDA 4MFDA 2R93K 3GZ5A 3JAMZ 2CMPA 3AD9C 4MQ9F 2M45A 2EIKH 1K83C 1YW8A 3VEPA 2R3SA 1I6HJ 2CGPA 2BY0A 1BDFA 4PJLA 3DTKA 3HJEA 2VE9A 1HQMA 2M87A 3L4KA 1IV8A 3CP2A 2QSGX 3GEIA 3S1RC 2O0YA 5AONA 3H5NA 1K4TA 4A3CJ 3RYRA 2X6YA 4A3DC 1GVDA 1T6SA 3ONQA 3OYBA 1HSTA 2XF5A 3ZN1A 2CV0A 3L00A 2Q0OA 1VQMI 3C2GA 2DTRA 2K9MA 3VYRB 3Q9VA 2GBYA 4A3JK 4BJTA 3BC8A 1J59A 2HDWA 2KLOA 4BXFA 5ILVA 2E1OA 2CQKA 3O6BB 4BKWA 2JA8C 3S17K 2CH0A 5ILUA 1EV7A 2RQQA 1YTYA 4KM9A 1I3QA 2VUMA 5H6RA 2EV0A 3N4MA 5JR3A 2QKMB 3I4NJ 1T38A 4RLFA 1K78A 3NAUA 2K3FA 4PUSA 3OS0A 3G1LA 2DA2A 3ELKA 3ZQLA 3CCVI 4BY1J 2Z3YA 2HDDA 2EBBA 2X6WA 3TMOA 1MH4A 5DTDA 1BOAA 5IOYA 3Q0UA 1IO2A 1XMXA 2EILH 3S2DK 3S14K 1HKSA 2KISA 3FZVA 4WJ3M 3MZ8A 2R7ZC 1IRFA 3KP7A 4D0PA 4GT9A 4M6YA 2YX4A 2HS5A 3F3XA 4P1WA 2E5ZA 2GSUA 4MNUA 2VJ5A 3FXQA 4FHTA 3PO3C 3M4OC 1MKMA 1ACIA 4CICA 3DTEA 1K83K 3WGHA 4GTEA 2OBPA 1BC8C 4WXHA 5IYDJ 2ID3A 1ERDA 1ONVA 2LTPA 1P6RA 1DD5A 2WA0A 1TNSA 2WV1A 3S1RK 2CO5A 1YO5C 4PDKA 4KN4A 2KL4A 2M2EA 2KQRA 2LMDA 4A3DK 1TC3C 1QZZA 2AQFA 4A3MJ 3CCYA 1MJBA 1JGSA 3ZQGA 1VI0A 3AG4H 4X0GA 1GVJA 4IZZA 4KMUX 3S15J 3AQOA 4HG2A 4BDZA 1LVAA 3OYIA 2JA8K 4EV0A 5D6EA 4LK1F 1FC3A 1CGPA 5KAFC 1UZCA 4BEHA 3L2CA 1YLFA 4E7SA 2X9DA 5J6XA 1E3OC 1F4KA 2PN6A 5K5QA 4X6AK 2FBIA 3L2WA 3CC7I 4YIIA 1XZPA 1EQRA 4BS9A 1JHHA 1A6IA 3F6OA 4DQ2A 3W2WA 4ZZLA 5F0CA 2VKDA 4XN0A 2GSOA 1OCCH 1Z77A 1BC7C 5IP7C 4C3HC 1FSHA 4FE4A 3V42A 3ASOH 3BP8A 1LJ9A 2QUFA 5L3EA 1UJ8A 2R7ZK 1U5TA 3LMMA 2CFXA 1P9QC 2Q2EA 2LBFB 3CMMA 3LA3A 4XNFA 2DYSH 4ZYEA 5TISC 3A02A 4FX0A 1ZYRA 1UFMA 1Z6RA 2JA6J 1OCRH 3I4MK 1QZEA 1Z21A 1OR7A 1DCHA 3E5UA 1B4BA 1PJ6A 2OA4A 3BQYA 4RAYA 2A69A 1SAUA 1RU0A 4FX4A 1GXQA 1MBHA 4C3IC 5J4VA 2QA4I 1W0UA 1N75A 4E7JA 4G7ZA 1O3SA 1J09A 2D5VA 3I3LA 1XSVA 5E79C 4FCYA 1ON2A 4AYBA 1WQ2A 4RS8A 3BOQA 1WH7A 3BTCA 1IN6A 2E1CA 3TOAA 1P4WA 1ZGWA 3OY9A 6PAXA 2XDVA 1SMYA 5C4XK 1UB9A 2ISYA 2OC6A 2VPRA 4LLLA 3GTGC 2DFFA 2WB1N 3JRFA 2W1OA 3K1NA 1ODDA 1X2MA 1NTCA 2FMLA 1EA3A 2KIQA 5EEGA 2DFEA 4XCHA 3BZCA 2FQ4A 4ETSA 5KK1A 2XAQA 3ZOBA 1TWAJ 1TWHJ 3ZQQA 5J1UA 1X2NA 4B8XA 4HV6A 4N4OB 3BG3A 4A0XA 1JUMA 1ZVUA 2BW3B 4CGZA 3KP5A 1FP1D 3BUEA 1XXAA 1TBXA 3HPHA 1DU6A 1KU2A 1O26A 3TBIA 5HLGA 1S72I 4YFNA 2ZB9A 5IP7K 2L0KA 4C3HK 4MEXA 1ETOA 2M4GA 1SD6A 2CQ7A 2L7KA 5ED4A 3HUGB 1HLVA 4NBQA 2JA6A 4L9JA 4X1EA 3HYIA 2CWEA 1AA7A 5L3FA 2LNBA 3LAJA 2R92C 2QZ8A 4E7LA 5TJJA 1FT9A 2M9HA 1FYLA 1V4RA 4G12A 1S3JA 2RAEA 3KZYA 1SFEA 4QTRA 5K5RA 4C3IK 1IUYA 1DP3A 2IA0A 4A3KJ 2O5JA 3ERED 2LG4A 1YQAA 3IV5A 2FXAA 3ZQCA 4BBSJ 2DMTA 1BN5A 2DA6A 3E6DA 2UXXA 3S3MA 1R1UA 3J7AO 5EGHA 2CV2A 3OYKA 3A01B 4ENJA 3QQAA 4UVCA 2BE5A 3OYDA 2NAZA 4I0AA 3GTGK 5H20A 1Y1VK 1TL8A 2EJRA 3BCBA 2XROA 3HZJA 1TWHA 4KICA 1HCRA 5LEKA 2Z2SB 5C4JJ 2LD5A 3GTJJ 1ETQA 3VYTB 1ZN2A 2DK8A 3T1BA 1ZR2A 4L9NA 1XSXA 1WSUA 2VUMC 1MBEA 3K10A 5CQGA 1SVLA 4IRHA 4A3IC 1K61A 3LSIA 1Z3YA 1F9NA 3TP0A 5LHHA 4A3LC 3NEUA 5EZGA 5E68A 3T01A 1E2XA 3GZNB 2Z99A 1X31C 3J7ZI 1FY7A 4LG3A 4D5CA 3CJNA 4IHWA 1EH7A 3LSJA 3BR2A 4FE7A 3SZGA 3HTSB 3AG2H 1XSDA 2WY8Q 2WAFA 2P81A 2XB0X 2VIXA 3ABTA 5CVJA 4E7HA 2LY1A 2VQGA 4V19K 2K9SA 2P6SA 5LHIA 4WWCA 1IUFA 2DT6A 3FDYA 4RAZA 1U8BA 1YRNB 1TZLA 1I6HC 2HZDA 1WJCA 1U9NA 4DBRA 2M3AA 5F6FA 3S8PA 4L5JA 3I5UA 1FNNA 1ZKGA 3WG9A 4IL6C 2DMNA 5EF6A 4RGUA 2HQAA 3Q3SA 2ZO4A 2JA7A 1IL2A 2XIGA 4A3CC 3IWFA 3IWZA 2BZTA 2XAHA 4C30A 3IH3A 2LDUA 3WTVC 2GAHC 1T56A 5J47A 1XN7A 2QQ8A 2A05A 3S93A 3GTJA 2M5WA 4V2FA 1J2XA 3HOUK 3HRMA 3VPRA 4WXDA 3QODA 5HL8A 3I4NC 1SEUA 1ZG3A 5L46A 2ZC2A 1L0OC 2LBFA 2VUMK 2N8GA 3QYFA 1D1AA 4BY1C 2L2OA 1X1PA 5JLWA 1S29A 1MMSA 3LPXA 4MEYA 5E17F 4BHPA 2HYGD 2HI3A 3I0TA 5ICCA 1A36A 3A0HC 1WZ2A 4A3LK 1O28A 1XB4A 3GSIA 3AKZA 4G7HF 1FMVA 2FBKA 2IW5A 3IUOA 5F1RA 3UNGC 1DGWY 2LFBA 4EJOA 2JA2A 4XRSA 4KC6A 4JK1X 3F23A 2R7FA 1GDTA 2PJRB 1HF0A 1DQUA 5E1XA 1SFKA 1W5SA 2GAUA 1IE0A 2LR8A 3BP8C 4KNYA 1PYVA 3LWFA 4FQGA 2L9SA 4LLGA 4QIWN 1QO0D 3DPTA 1WVRA 3FBIB 3OV8A 1VJEA 2RNGA 2A68F 1PUEE 1R1VA 4B48A 3MMLB 3RKYA 3CCUI 2CYYA 4I09A 4DYCA 5GADJ 1G59A 3GZ6A 2H09A 3LSHA 2VLAA 1OR7C 5IYDC 1VQ4I 4YFKF 1MMGA 1FMWA 5JHUA 4Y52J 1MMNA 3FOFA 5CYVA 3S3NA 4DNCA 2IA1A 3R0JA 3BJAA 2MD5A 5FKKA 4A3CK 2D1HA 5E20A 5DD8A 1GUUA 4A3MC 2PX9A 5HDNA 1MBKA 4IVNA 1FX7A 3S15C 1WJEA 2DOEA 1R5HA 4AIDA 1UMQA 3L2QA 3IHUA 4I02A 2W25A 4C2MJ 2DAOA 1MNMC 3I4NK 1XZQB 2Y3PA 3A1YA 4S05A 2HQ5A 3CMYA 3VYSB 1BL0A 2A6TA 3I4PA 2L7MP 3HKZA 1CF7A 2M8GX 2W85A 4BY1K 5D6FA 3VOEA 2ME0A 3CQZJ 1FWZA 2BY1A 1R6RA 2M0CA 2X51A 4BXUA 4ZYGA 4QLCU 2O8XA 1QPMA 1O25A 5IT9K 2NVXJ 1S7EA 2FOWA 3KYCB 3IL2A 3GUDA 1B8IB 2CRGA 4LB6B 1WIHA 4OIRF 3OMYA 4XLCA 3JTGA 4KN7A 2XAUA 3ABMH 2HU9A 5BNGA 5KHDA 2KDZA 1FTZA 1QU3A 3SZTA 1R23A 1YJWI 4CYCB 2IGOA 3ERMA 3N97A 2WADA 2CW8A 2F4MB 1Z1DA 3H3VL 3CMEI 2JA6C 4ABZA 2R5YA 2PJPA 1W5CC 3JRCA 5GAGJ 3JRDA 2ZSIB 3S1NJ 4XKCA 3K4MA 5IYDK 4M3DA 1GE9A 2V6SA 3VA7A 4AYBN 2XC7A 1VQ6I 3JR9A 1RKWA 2X4HA 4PGGA 3RI4A 1Z91A 1SD5A 1ZLJA 2Y0MA 1RR7A 4OMYA 3AG1H 2XF7A 3WODF 1MBJA 2DJNA 3RKXA 1UHMA 4H0EA 2Z1DA 5K7HA 4XQFA 3S1QJ 3HSFA 2YSRA 2DO7A 1W36D 2E71A 2Y75A 3BLYA 4CSWA 4EGYA 4PJMA 5GTIC 3RDIA 1FTTA 1E3PA 4KASA 4MQ9A 2FRHA 4ZYDA 4UNOA 4JBAA 2ELJA 3CUOA 3OEPA 3QYEA 3VYUB 4PGHA 3SZYA 4R8HA 1WQHA 4AH6A 1VQPI 2BGCA 5LRRA 4I0BA 4HF0A 5F0FA 1TWAC 1TWHC 4MLOA 3CQZA 4IQ4A 1F43A 4IPAA 2EIJH 2OU2A 2PMZL 2Q1ZB 3HDDA 3OREA 4AC0A 3OYJA 1SFOJ 2VJJA 2A61A 5FFXA 2R7VA 2TRTA 3U21A 2A07F 4BLAA 2IBDA 1P4AA 2DDBA 2B7EA 3BPVA 3OSGA 3M8JA 4XBFA 5CJ9A 4DYQA 1EJ9A 2BXZA 5FRNA 2BBYA 2DBBA 2OF7A 4ENMA 1GT0C 3S16J 2IS4A 5BPIA 3S32A 3J7YJ 1B6AA 1HDPA 4LIVA 2H94A 2HTJA 3KYLA 1T8IA 3A0BC 4OIPF 2P5MA 2DT7B 1LDKB 3MCZA 3NRVA 2IPQX 4XLNF 2PMZD 2JA6K 3SYTA 4ASNA 2E36A 3TQNA 1G3YA 1XCBA 1DU0A 2HR3A 1EI6A 4BQOA 1K78B 5HOOA 1Q1VA 3TO7A 2MW8A 4CCMA 3RCOA 1HQCA 1JE8A 3EQLF 1KU9A 2YR2A 3FXLA 4D7MA 1JGGA 1HBXG 4A3KC 3F21A 1ZK8A 3L2UA 1USSA 3HOWJ 4BBSC 3EYYA 3ECOA 4OIOF 2RVCA 2NS8A 4GXOA 5EG0A 1H89C 3GF2A 1R22A 3KETA 3JCUC 2M1BA 2WY7Q 1MSFC 3HOZJ 2JVHA 4GYIA 3CLQA 3K0LA 5EZHA 5C4JC 3GTJC 2JVGA 2EFPA 3FXJA 5IYCJ 1SFOA 4CCOA 1TWHK 5BQTA 4LIUA 3JRIA 2MFZA 1O7FA 3AD8C 4I99C 3F8FA 4KJZA 4WK8F 1TW3A 1L0WA 3BWGA 3ESWB 1U3EM 5L3CA 5DM7F 1IRGA 4J00A 3KP2A 1IS1A 1U6GA 2IP2A 2FE3A 4GTDA 1G3TA 3NQOA 2H1LA 2L5QA 2XSDC 1C0AA 3GO5A 1WFXA 1IXRC 5JLXA 1YIJI 1B1BA 3SDGA 2EZKA 3B6AA 2ZXHA 3PFYA 4LK1A 2E1MC 1LPQA 4KAWX 2XASA 2JH3A 3NWTA 3R60A 4M6XA 1D1CA 4B43A 3CLOA 2AS5F 3E97A 1TWCJ 3S2WA 4BEHB 3M1EA 3FISA 4O5VA 2BEOA 1WJBA 5CKTA 5GAHJ 3G4SI 3HHGA 4PK4A 4OINF 4CHUA 2JUGA 3WTWC 1O2BA 2Z33A 5TMFA 4A3BJ 4ON0A 1YX3A 3KYDB 1Y1WJ 3AL0C 4BAYA 5LGNA 4Z2YA 3HOXJ 1WKMA 2PG4A 4DYRA 2KRCA 4RGRA 4C2UA 4KDPA 5F27A 1KQ8A 4KMHA 4BBSK 4FZBA 2XPVA 4BQNA 5E8GA 3OYGA 4XR6A 1JTYA 2VB6A 4F7ZA 2IEKA 1FIPA 2HGCA 2XUBA 4LQYA 3W6VA 3OOUA 1XG1A 2ID6A 5D5VB 2Q2EB 5KCMA 3HGGA 1BR1A 3GBGA 5HS9A 4EJVA 2CQNA 3I54A 1XC5A 3LOCA 3GLXA 1R1TA 1B8IA 5C4JK
chains in the Genus database with same CATH topology
4HDVA 3T8RA 4XSXF 1P92A 4LLNA 5H6QA 3LFKA 1H0MA 2A3SA 2ACJA 2GA1A 4IRIA 2P5LC 1YIOA 3WGIA 1ZHFA 5DCMB 5DDGA 2W84A 3I71A 3V7CA 1K79A 3MWMA 2UWMA 4LK0F 3BJOA 4HZFA 1YW9A 1WI9A 4GCVA 2OQGA 3LA7A 3JSOA 3T5XA 3M9AA 3TGNA 3ZQ7A 2NNYA 3IRQA 2STTA 1ZARA 4U0VA 3WTYC 1XD7A 2A6EF 3P7NA 4L5IA 2Y48A 2XKPA 5IT9Z 4OIQF 2STWA 1I6XA 4JQFA 2MC3A 2HZTA 3EYIA 4I01A 3SFZA 5E1WA 5HVQC 4A0ZA 2QWWA 1S6LA 2LF7A 4FT8A 3RPQA 1PP7U 4KA4A 1A04A 2PQ8A 1EH6A 2K4BA 5L3DA 2QM3A 4KN4X 1G3WA 2XAFA 2GA2A 2P7VB 2VC0A 4AIJA 2FMYA 3MZYA 5LEJA 3TKYA 2OD5A 4M73A 1D3YA 3ZP5A 3CTAA 4A0YA 4UVBA 5LHGA 2CSOA 1I1GA 4EGZA 1B9MA 2OAZA 2D6FC 2IA2A 2ZJ2A 3H3ZA 3I58A 2X0LA 2RN7A 1REPC 1OYIA 3KP3A 1FYKA 2ELHA 2ZKZA 1IAWA 4L18B 2KJCA 5BPDA 4HLYA 4RGXA 5K1YA 1ZRFA 4HV5A 1RNLA 2W57A 1FYMA 2F5CA 1TNTA 3GXOA 1R00A 1USTA 5ERIA 1KU7A 3RYPA 2COMA 3E5XA 2B0LA 4NB5A 2EWNA 3VODA 5DUKA 1KGSA 2RNJA 1MDMB 5DCMA 4BNCA 3CUQA 5EEHA 3DXJF 2DU9A 2VBWA 3OOPA 2BYVE 2DPUA 1VTNC 2TDXA 2JT1A 2FA5A 2V6CA 2VN2A 4Q47A 3JSPA 1OMIA 3LQRA 1WRJA 3GW2A 2QBYB 3R0AA 2PMUA 2K02A 4TV7A 3R6SA 4M74A 1SD7A 3TDUC 3E6BA 1CF7B 1FSEA 2NRAC 1LEBA 3D0SA 2C6YA 2EB7A 3HRUA 4NQWA 1ZG5A 2WV0A 2MH2A 2O03A 1I5ZA 2H6CA 4EM2A 4Q48A 4IXAA 3ZMDA 3VFZA 4B09A 5CVUA 1O3RA 4HBLA 1R36A 4M71A 4UV9A 1YG2A 1BIAA 2LSOA 3HSRA 2UXNA 1X3UA 3FM3A 2MH9A 3U9GA 5A2QK 1IN7A 2HFHA 2WC2A 3ZN0A 3TDZC 1MZBA 5LLQA 1TLHB 2FNAA 5ICEA 4EJWA 3C1DA 3HSEA 4YG2F 4HYEA 3GFLA 3HTUA 5HLHA 2UZKA 3M8FA 5AIQA 5D5WB 1XMAA 2EA2A 3QRFF 3E6CC 1KYWA 2QLZA 2P8TA 4EQQA 3COAC 4G6DA 4RMFA 3SXYA 4I2OA 2JTVA 3KEOA 1LNWA 3WTTC 4A5NA 2KIFA 1MJAA 2XRNA 4EM1A 1WWXA 4IJAA 3F8CA 3EETA 5E1ZB 1Y0UA 1BI1A 4UUVA 5CLSA 1GHCA 3I59A 1W4MA 3HRTA 1D8KA 1O57A 3IC7A 2FOKA 5BOXA 1R5GA 3ZMVA 2ZNYA 2MLKA 1YS6A 5FD5A 3K9TA 5D8LB 1L3LA 4M72A 3QU6A 2LKPA 3H3UA 3WU0A 4O6JA 2K4JA 3RJPA 1FBSA 1MDMA 1F5TA 1BJAA 3FF5A 2VOPA 4U0WA 4XSZF 2G9WA 2KIMA 3GFJA 1SFUA 2YPRA 1P2FA 4YFXF 2A5YB 3QOPA 3WTZA 2WTEA 4OOIA 3VB2A 2QBYA 3J81K 4KN7X 3CUQC 2P7CB 1ZLKA 1HKTA 3F8MA 1K7AA 4UV8A 4ZH4F 2ETHA 4EVIA 2FU4A 3JTHA 3C7JA 3PQJA 2ZXJA 2Z9OA 3GFMA 4G6QA 5FFZA 4BYYA 2XAGA 2IJLA 3EUHA 1ZAOA 2V1DA 4P5OA 5KVRA 4MEXF 5FO5A 1T0FA 3QP5A 1LDDA 1ZG1A 3KP4A 2GWRA 4P9FA 4CXFA 3BY6A 3FXRA 3M8EA 1XCVA 3BDDA 4UXNA 1TQPA 2XKOA 5DEQA 2V1XA 3ABUA 4KUMA 2F2EA 3QP6A 4LJZF 5CVIA 2HQNA 3HRSA 4LG0A 5JFRA 2W24A 5CVVA 4KIGA 3ML6A 1IZ1A 1FBQA 2YU3A 4LFUA 5DUIA 4RGSA 4Q5SF 2PMHA 2J5OA 4R1HA 3GWZA 3SZPA 2GXGA 2PI0A 2F5DA 4HA8A 1IW7F 1TQMA 2GQQA 5IT3A 4HX4A 3T8TA 3F72A 3J80Z 2QVOA 3FM5A 4A6DA 1XDSA 3QU3A 2L4MA 2VE8A 1KU3A 3WTSC 1IF1A 3Q5FA 1LQ1A 2AXLA 5HS8A 2MBFA 3SHFA 1YYVA 5A2QZ 1S7AA 5L3GA 1IXCA 1XGMA 1BBYA 3V4GA 1U78A 2VONA 3LAPA 2RC4A 4U7BA 3ZMZA 4IF4A 4L0YB 2XGXA 2JPBA 2JSCA 1B4AA 1H9GA 4A2UA 1G51A 1TQIA 4I98B 4LLGF 5HDKA 2EFQA 1O3TA 5LRSA 1XGNA 2KRFA 1O7LA 1ZGJA 5D4SA 3SQNA 5L3BA 1D8JA 4A12A 5E8IA 2VOOA 2QQBA 3TO6A 1YS7A 4BHCA 1U8RA 3BZ6A 3FXUA 1DP7P 3O3KA 1DDNA 2HTSA 2QENA 1BI0A 4KT5C 2DK5A 3I53A 4U88A 4XRFA 1J75A 1SAXA 1G3SA 4CZZA 1QGPA 3DP7A 1W5TA 1U2WA 5HLIA 5ILSA 3LSTA 3CUQB 4NHJA 3V8LA 3KZZA 2CW0F 2LF8A 2E7WA 2RGVA 3F6VA 2EA4A 1ZQ1C 1FBUA 1LB2A 1AOYA 3G3ZA 2O3FA 4MTDA 3WGGA 2IRFG 2F5FA 2QQAA 1ULYA 2P6TA 1Q1HA 2V1UA 3CO6C 4L0ZB 3J81Z 3EDPA 4KIBA 3HHHA 4N0BA 2HOEA 4HX7A 3FX3A 1BI2A 3HIFA 3DFGA 1Z7UA 1MD0A 5FB2A 2CG4A 4U7DA 4EMSA 4G8XA 2HWVA 2M8EA 1R7JA 2GIVA 3U2RA 2A6HF 4PCQA 3R61A 1HSJA 2OZUA 1HKQA 2ZCWA 2R7DA 4EJTA 3MEXA 1AWCA 4RB1A 4QWQA 3FMRA 5E18F 4O2DA 1IXSB 2O61A 3DQVC 3R4KA 5DCFA 2K86A 5DD4A 4HDUA 1ZREA 5AIPA 2PEXA 2XHKA 3V7SA 2V79A 5BS6A 1XGSA 2FNPA 4RB3C 3HOTA 5D8KB 2VT2A 3ECHA 2G7UA 2G7HA 2NYXA 2DI3A 4N9HA 3ZMUA 4XLPF 3RIRA 3LQQA 4BQAA 1S8NA 2XAJA 2K7LA 2MLGA 2HEOA 3T0YA 1TTYA 1FP2A 1IN4A 1EFWA 2H6BA 2ZFWA 2HKXA 3RTRA 2DPDA 1G4DA 2P5VA 2RDPA 4GGGA 3I59B 4K2EA 1DPRA 1MGTA 3RKWA 3V8JA 3F8BA 2JRTA 4AD9A 1RI7A 2DQLA 2OQRA 2ESHA 3FMSA 2EFNA 1DPUA 3IKTA 3M7GA 3ZMSA 3U1DA 2VBZA 4LD5A 3GFIA 4HLXA 3GYHX 2D2WA 3C18A 2GXBA 3KLOA 5FD6A 5JVTA 4Y17A 3V8KA 4Q4ZF 4IHTA 2DQRA 1BIBA 2NS0A 4OMZA 3KLNA 2OZ6A 4G7OF 2L3DA 2RKHA 4WCGA 4YIFA 3ROUA 1D5VA 1UHWA 1B9NA 1T98A 3BPXA 3FHZA 3FMQA 5LBQA 3PFIA 3J80K 4ZZDA 4KYWA 1ZH5A 3GVAA 3W6JB 1FZPB 3ISPA 2ZMEB 1C0WA 2M30A 4MQVA 1I1SA 2ISZA 1W7PB 4PZJA 3DV8A 5FLXK 1YW7A 3E5QA 4OU0A 3E3VA 1PP8F 2EFWA 1RUNA 2HKOA 2FBHA 1RUOA 3QPTA 4LG0B 1XGOA 2ESNA 4AIHA 2Q8KA 3QPHA 4BHBA 2ZBKA 3GEZA 3WU1B 3V7RA 4LB5A 4Y13A 2FEZA 4P96A 1JHFA 2H27A 5DV5A 3WE3A 3KCCA 2QQ9A 5F64A 2WWYA 3PQKA 4ENNA 4G94A 2HQRA 3O2PE 3WE2A 1FPQA 4AIKA 1XMKA 5BMZA 1EH8A 4S04A 4GYGA 2ADUA 1ON1A 1HW1A 1OYWA 3DPLC 4KIFA 3K69A 2JZYA 4U0YA 3WTXC 2K27A 2ZNZA 3K1PA 4E70A 4LMYA 3KFWX 4UHTA 1HW2A 2KJBA 1RZ4A 1H9TA 3C3WA 2P4WA 1QNTA 2D45A 1ZYRF 2EV6A 4ZYHA 2KKOA 3K2ZA 3I64A 1J9IA 3MQ0A 3F8NA 1DUXC 2A69F 1PDNC 4AWXB 2YX7A 1U5TC 4G7ZF 4HQEA 3BJ6A 4N9IA 5HDGA 4UVAA 4EM0B 3E6MA 3L7WA 1SMYF 3FWEA 3QAHA 2MA3A 1T2KA 4HF1A 3JAMK 1UCRA 1HW5A 3JW4A 3TO9A 2VXZA 1Z6TA 4YFNF 3P9CA 3L09A 3HUGA 3DKWA 5D4RA 4WXCA 2E7XA 2GZWA 4RB0A 1OYYA 1SMTA 2ZMEA 3RPUA 1ZRCA 1NHAA 4HX8A 3CO7C 1W7PA 4CO8A 3ZMTA 2L01A 2VC1A 3AAFA 1Z05A 2RQPA 2XVCA 3L9FA 3ZPLA 3B73A 4RB2C 2PLYA 3CDHA 2BE5F 2IT0A 4IHSA 5J8CA 1FLIA 5J8FA 4HF2A 2VBYA 2V9VA 4I7HA 4P9UA 1IN8A 2FQ3A 1FOKA 1MJ9A 3MFKA 4MGRA 2PFBA 1QQIA 1K6OA 1J7KA 4HAMA 2FF4A 4KMFA 3GX4X 1GXPA 1J0RA 4BH9A 1J5YA 3G73A 4Y15A 5FGMA 5LGTA 2IVMA 4WF2A 2L02A 1YFHA 1BI3A 3WTUC 4KFCA 4WJ4A 1OKRA 1E17A 4MHGA 3TOBA 1KQ0A 3BROA 4ESBA 1TW2A 2DLLA 1R58A 5DYMA 3P9IA 2VT3A 1O3QA 4O3MA 4P55A 1KQ9A 4MTEA 3KP6A 4LGWA 5FLXZ 4G9YA 1XDUA 3LA2A 3W6KB 2L54A 4ESJA 1KA8A 1G6NA 2VODA 2EFOA 4GO1A 3HOSA 5TRDA 3D5LA 5CVRA 1I27A 1B59A 3P9KA 5HS7A 2KIUA 2XV4S 4MEYF 1JXSA 5K5OA 2O6GE 4HOBA 2NNNA 4L9VA 4M9SA 2FSWA 1KYZA 2JPCA 4HW0A 1ZRDA 2EK5A 4R79A 2F5EA 1S7OA 3ULQB 2DT5A 4ESFA 3K1MA 4AVPA 2J5PA 1QZYA 1SD4A 1OPCA 4A6EA 1SFXA 1P4XA 3REOA 2EV5A 3MAJA 1ZGAA 2HDCA 1LEAA 2D1VA 1QBJA 5ICFA 3DF8A 5D5UB 4IRGA 3Q9SA 3DEUA 3F22A 1HXDA 3IKVA 5JI6A 1IN5A 1U5TB 1RIOH 4CDGA 4M9ZA 4EJUA 3KEQA 2QYOA 1BM9A 2PBIA 1LDJA 1V3FA 3KE2A 4M9XA 1F1ZA 5ICGA 1Z9CA 2HYFA 2RV8A 5D5XB 4WX9A 4ENKA 2BV6A 1W7PD 2VBXA 4A5MA 1STZA 5LGUA 3MZHA 2P5KA 4L9TA 3B02A 2DW4A 2DFIA 2L4AA 1T39A 2Z5UA 4HQMA 3IRRA 3H92A 2E1NA 4CYDA 3GZ5A 3JAMZ 4MQ9F 2M45A 1YW8A 3VEPA 2R3SA 2CGPA 2VE9A 2M87A 2O0YA 5AONA 3RYRA 1T6SA 1HSTA 3ZN1A 3L00A 2Q0OA 2DTRA 3Q9VA 1J59A 5ILVA 2CQKA 3O6BB 5ILUA 1YTYA 1EV7A 5H6RA 2EV0A 3N4MA 5JR3A 1T38A 1K78A 3ELKA 2Z3YA 1BOAA 1HKSA 3FZVA 4WJ3M 1IRFA 3KP7A 4D0PA 4M6YA 2YX4A 2HS5A 3F3XA 4MNUA 3FXQA 4FHTA 1MKMA 4CICA 3WGHA 2OBPA 1BC8C 4WXHA 1ONVA 1P6RA 1TNSA 2CO5A 1YO5C 4PDKA 1QZZA 1MJBA 1JGSA 1GVJA 4KMUX 1LVAA 4EV0A 5D6EA 4LK1F 1FC3A 1CGPA 3L2CA 1YLFA 5J6XA 1F4KA 2PN6A 5K5QA 2FBIA 4YIIA 1EQRA 1JHHA 3F6OA 4DQ2A 4ZZLA 1BC7C 1FSHA 3BP8A 1LJ9A 2QUFA 5L3EA 1U5TA 2CFXA 2Q2EA 3LA3A 4ZYEA 4FX0A 1UFMA 1Z6RA 1OR7A 3E5UA 2OA4A 4RAYA 4FX4A 1GXQA 1O3SA 1XSVA 1ON2A 1WQ2A 4RS8A 3BOQA 6PAXA 1IN6A 2E1CA 3TOAA 1P4WA 1UB9A 2ISYA 4LLLA 3K1NA 1ODDA 2FMLA 5EEGA 4ETSA 5KK1A 2XAQA 4B8XA 4HV6A 4A0XA 4CGZA 3KP5A 1FP1D 1TBXA 1KU2A 5HLGA 1SD6A 5ED4A 4L9JA 3HYIA 2CWEA 5L3FA 2LNBA 3LAJA 2QZ8A 5TJJA 1FT9A 1FYLA 1V4RA 1S3JA 3KZYA 1SFEA 5K5RA 1IUYA 2IA0A 3ERED 1YQAA 2FXAA 1BN5A 3E6DA 2UXXA 1R1UA 3J7AO 4ENJA 4UVCA 2NAZA 4I0AA 5H20A 2EJRA 2XROA 4KICA 5LEKA 1ZN2A 2DK8A 3T1BA 4L9NA 1XSXA 1WSUA 4IRHA 1F9NA 5LHHA 3NEUA 1E2XA 2Z99A 1FY7A 3CJNA 1EH7A 3HTSB 1XSDA 5CVJA 3ABTA 2P6SA 5LHIA 4WWCA 4RAZA 5F6FA 4L5JA 3I5UA 1FNNA 3WG9A 4RGUA 2ZO4A 1IL2A 2XIGA 3IWFA 3IWZA 2XAHA 2LDUA 3WTVC 1XN7A 2M5WA 1J2XA 3HRMA 4WXDA 1ZG3A 1L0OC 1S29A 5E17F 4BHPA 2HYGD 3I0TA 5ICCA 1XB4A 4G7HF 2FBKA 2IW5A 5F1RA 4EJOA 4JK1X 3F23A 2R7FA 5E1XA 1W5SA 2GAUA 4KNYA 3LWFA 1QO0D 3DPTA 3OV8A 2A68F 1PUEE 1R1VA 3RKYA 2CYYA 4I09A 3GZ6A 2H09A 4YFKF 5JHUA 5CYVA 4DNCA 2IA1A 3R0JA 3BJAA 2MD5A 2D1HA 5E20A 5DD8A 5HDNA 4IVNA 1FX7A 1R5HA 3IHUA 4I02A 2W25A 2DAOA 4S05A 3I4PA 1CF7A 2W85A 5D6FA 3VOEA 4BXUA 1FWZA 4ZYGA 4QLCU 2O8XA 1QPMA 5IT9K 3IL2A 3GUDA 4LB6B 4OIRF 3JTGA 3SZTA 1R23A 3N97A 1Z1DA 2PJPA 2X4HA 3RI4A 4PGGA 1Z91A 1SD5A 1ZLJA 2Y0MA 4OMYA 3WODF 3RKXA 1UHMA 4H0EA 3HSFA 2YSRA 2DO7A 4EGYA 2Y75A 3RDIA 2FRHA 4ZYDA 4UNOA 4JBAA 3CUOA 4PGHA 4R8HA 4AH6A 2BGCA 5LRRA 4I0BA 4HF0A 4IPAA 2OU2A 2A61A 5FFXA 2A07F 1P4AA 3BPVA 4XBFA 5CJ9A 2BBYA 2DBBA 4ENMA 5BPIA 1B6AA 2H94A 2HTJA 4OIPF 3NRVA 1LDKB 3MCZA 2IPQX 4XLNF 4ASNA 3TQNA 1G3YA 1XCBA 2HR3A 1K78B 5HOOA 3TO7A 1HQCA 1JE8A 3EQLF 1KU9A 2YR2A 1HBXG 3F21A 1USSA 3EYYA 3ECOA 4OIOF 2RVCA 4GXOA 3GF2A 1R22A 3KETA 2M1BA 4GYIA 3K0LA 2EFPA