2P8TA

Hypothetical protein ph0730 from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
184
Chain Sequence
EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical protein PH0730 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0730
total genus 61
structure length 184
sequence length 186
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14544 DUF4443 Domain of unknown function (DUF4443)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p8tA01
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 2p8tA02
1ZREA 4HQMA 3ERED 3LAJA 2CGPA 1Z91A 3BROA 4FT8A 2Z5UA 4MHGA 2VOOA 4LJZF 1HBXG 1O3QA 1IRFA 5FO5A 1XMKA 5BS6A 2WWYA 4QWQA 3WE3A 4Q4ZF 3WTTC 1RZ4A 2VBWA 2GQQA 2O3FA 3BWGA 1YIOA 4G6DA 4IHSA 4ZZDA 5D5WB 3COAC 1Z6TA 3E3VA 1W7PB 4KICA 1YFHA 2XAQA 4HF1A 4M9XA 4L18B 3H92A 1MGTA 5BPDA 4NQWA 2A68F 1ZG5A 2P8TA 3I53A 5ILVA 4JK1X 5ERIA 2MLGA 5DD4A 3BP8A 1XGNA 4FX0A 2F2EA 2L01A 3RDIA 1ZYRF 2DW4A 1HKSA 2KIFA 2XAGA 5J6XA 3F23A 4YIFA 3JSOA 4WCGA 1MJBA 4R8HA 4JBAA 4L9TA 3E6DA 2HOEA 3GLXA 1TTYA 2Y75A 3ZP5A 1SFUA 1XSDA 1ZLJA 1ZRFA 1R1VA 2EA2A 3ZMUA 2EFPA 3W6KB 2IA1A 2YR2A 4DQ2A 2FRHA 1FNNA 4EGYA 2ACJA 3KP5A 2DK5A 2FE3A 1QBJA 5D6FA 4M74A 4AH6A 1LDDA 4RAYA 1FYLA 4N9IA 4HA8A 2VOPA 4GO1A 4CXFA 4ESBA 2V79A 5IT9K 3WU1B 4ZZLA 3CUOA 3RPQA 1K6OA 2LF7A 5HOOA 1R23A 3Q5FA 2OD5A 3FHZA 3KP6A 1ULYA 3KLNA 4I7HA 1MZBA 3I59A 2STWA 3D5LA 1ZH5A 2H94A 2HZTA 4P55A 3VB2A 3TO7A 2D6FC 1U6GA 2EV6A 4G6QA 5L3FA 3CO6C 5AONA 5LGTA 3TDUC 2PLYA 3LAPA 2MBFA 4Z2YA 3BPXA 1F5TA 4B8XA 1UHWA 2FF4A 1BI2A 2E7WA 4EMSA 4UUVA 3F21A 2H6CA 3GFMA 1QQIA 4EM1A 1AWCA 2V6CA 4MGRA 3KP7A 4RB3C 3F6OA 5HVQC 3F22A 2DI3A 2G7UA 3RTRA 4D0PA 4ZH4F 2V1UA 4Q48A 3RIRA 2DQRA 3FM3A 3WODF 3HIFA 1WI9A 4UXNA 4WK8F 2Q2EA 1XCBA 4QLCU 1FPQA 5JFRA 2QVOA 2HR3A 3HSFA 1MDMB 4M9ZA 1FC3A 1KU2A 1IN4A 1UFMA 3SZTA 2HQNA 4LK1F 5D5UB 2XRNA 2ZBKA 2A5YB 1P92A 1HQCA 3Q9SA 3FWEA 3TDZC 3FX3A 4PCQA 2M45A 3C1DA 2F5FA 2LDUA 3LQQA 4KMFA 2IW5A 1YW9A 3BJAA 5DEQA 1H9TA 4LLLA 3QPTA 1SD7A 1ODDA 3PQJA 4A2UA 5LEKA 2VODA 2ESHA 2FQ3A 3JAMZ 1K7AA 4RS8A 2B0LA 1I6XA 2MH9A 1IUYA 2TDXA 4G7ZF 4ENKA 3L09A 4BHBA 4OIOF 1TLHB 2QWWA 4OU0A 3EDPA 5D4SA 5E1WA 1VTNC 5D8KB 3T1BA 2HKOA 3GW2A 3K1MA 2DK8A 1H0MA 4YIIA 1G6NA 5E8IA 1I1GA 3HOTA 2FNAA 3KLOA 1BN5A 5CVVA 4EQQA 4I09A 1O3RA 3TO9A 2O8XA 4YFXF 4HAMA 1XCVA 1Z05A 5HLIA 5F64A 2AXLA 2ZMEB 4XSXF 1W7PA 2XAFA 3RKYA 1XSVA 3DFGA 2RN7A 4E70A 1OYIA 1KU9A 2W25A 2H27A 4G9YA 1IXCA 3E6CC 2COMA 2R7DA 2QLZA 3FMQA 1JGSA 4HX7A 2Z33A 2RGVA 1HXDA 1KYZA 2W24A 1ZRDA 4ZYDA 3DF8A 4CGZA 2E1NA 1IW7F 4OIRF 1WWXA 4XLNF 1KQ8A 1LDJA 4UVAA 1TQMA 1UB9A 5LRSA 4L9JA 1YW7A 3N97A 5L3GA 3R61A 1Z1DA 4YFNF 3WG9A 3N4MA 3FZVA 3SFZA 3E5UA 2HS5A 1G3WA 1IN7A 3KFWX 3BJOA 2CFXA 4U7DA 4WWCA 1OKRA 3EYYA 4HZFA 1R58A 2DTRA 2P6TA 3V4GA 2FBIA 2NYXA 1FP2A 5J8FA 3QP5A 1S7AA 1W5SA 2O03A 4ON0A 1BI3A 4WJ4A 3WTYC 4HF0A 3TO6A 1FLIA 3FXQA 3C7JA 3K1PA 4I01A 3QU6A 1J0RA 1FT9A 1H9GA 1FBQA 3OOPA 4MEYF 3I58A 2LKPA 1TNSA 1HW2A 3F6VA 1FY7A 5FD6A 1DPRA 1XDUA 1GHCA 1WSUA 2VT3A 3CUQA 2MLKA 4BHPA 4NB5A 3I71A 5ILSA 2MH2A 2QQBA 2WV0A 2IT0A 4L0ZB 4RGRA 4KA4A 3W6JB 5K5QA 3CO7C 4U88A 4IF4A 3HHHA 4UVBA 3VODA 5DUKA 5FD5A 3LQRA 1STZA 2K7LA 3CUQB 1WRJA 4KYWA 2IPQX 2KIUA 3P7NA 3F72A 1RUOA 1FX7A 3NRVA 3WE2A 2VE8A 1XN7A 2PFBA 4UHTA 4BQAA 2UZKA 1PDNC 3LWFA 1D5VA 3KP3A 3LA2A 1EH7A 4RB0A 4LG0B 4JQFA 2EFWA 3MAJA 2STTA 1TBXA 4LD5A 2DO7A 1P4AA 1ZLKA 3RI4A 4AVPA 5LGUA 5HLHA 4ETSA 1ZAOA 2X4HA 2GA2A 1MJAA 3GZ5A 3MWMA 2Y0MA 3MCZA 2W57A 2BE5F 4ASNA 2L4MA 2KKOA 2P5LC 3ZPLA 2OBPA 5A2QZ 4LG0A 3WGGA 2IRFG 5KVRA 1REPC 1ON2A 2XHKA 3K0LA 2A07F 1FSHA 3J80K 4K2EA 3REOA 2ISZA 3MQ0A 2PJPA 1FSEA 4XRFA 3OV8A 3RYPA 3GVAA 1QZYA 3JAMK 1QGPA 5LGNA 1LNWA 2VC1A 1L3LA 5KK1A 2MA3A 3GFIA 5E18F 3IWFA 1HSJA 2KIMA 2PQ8A 1YW8A 4HLYA 2DLLA 3P9CA 1I5ZA 1TQPA 3EQLF 5E1XA 3P9KA 1SD6A 3WTXC 1G51A 4ZYHA 4KDPA 3I54A 5DD8A 1S7OA 2JPCA 2IVMA 3T8RA 3TQNA 2PN6A 1C0WA 1F1ZA 1P4WA 3Q9VA 1O7FA 1YLFA 4GYIA 2QZ8A 4RGUA 2VC0A 3I64A 3ROUA 4WXCA 4A6EA 3G3ZA 2Y48A 2DPDA 1J75A 1IL2A 1SD5A 2ZMEA 4S05A 5JR3A 1BJAA 4HOBA 3DPLC 4MEXF 3HOSA 5TJJA 1IAWA 5JVTA 2ZNZA 4EM2A 1ON1A 1ZHFA 1J5YA 3HSRA 2BBYA 2A6HF 3WTZA 5FLXK 3M7GA 4EJWA 4HYEA 2HYFA 3E6MA 5ILUA 5JI6A 2XROA 4N0BA 3E5QA 4EJTA 4P5OA 4OMYA 1YQAA 4I98B 2E7XA 2QYOA 4A0YA 1IN8A 3QP6A 1U5TC 4I0BA 1S3JA 3KZYA 1MDMA 1SD4A 5HS7A 1J59A 4XLPF 4CZZA 1YYVA 4GGGA 2HGCA 2E1CA 4UV8A 3F3XA 2X0LA 4O6JA 5L3CA 3BZ6A 3GO5A 1LDKB 2RDPA 2EFOA 3MZYA 1T2KA 2XASA 4DNCA 2VONA 3ZMVA 1SFXA 4M6YA 4LB6B 5DUIA 3LA7A 1SFEA 4AD9A 1V3FA 2C6YA 3C3WA 2JT1A 3GXOA 1QZZA 2ISYA 1B6AA 5D4RA 1R36A 4HX4A 1W5TA 2CYYA 2XGXA 3CDHA 3CLOA 2O61A 2O6GE 3U2RA 2Q8KA 3LA3A 4G8XA 3RKWA 3WGHA 3EETA 3KP4A 1U8RA 3RKXA 1IZ1A 2IJLA 4KNYA 1K78A 1I27A 2P5KA 2BGCA 3QAHA 5J8CA 3ABUA 1KA8A 1R7JA 1HKQA 2JRTA 3V8JA 2WC2A 4U7BA 4I0AA 3ZQ7A 5BPIA 2K4JA 1R5HA 1BC7C 5BQTA 4WJ3M 4GXOA 1TW3A 4LGWA 5E20A 4RGSA 1K79A 3EYIA 1J7KA 3EUHA 3K69A 1B59A 3HTSB 2GWRA 3RPUA 3R6SA 2EV5A 1JE8A 1WKMA 3SQNA 1C0AA 2OQRA 4MTEA 2ZCWA 3TOBA 4MQVA 1ZARA 2K02A 2PBIA 3DP7A 3VFZA 4L5JA 2EFQA 3WTVC 1EH6A 3E6BA 1PP7U 2P7VB 2R7FA 4HDUA 1EFWA 1ONVA 2NAZA 3L00A 3F8NA 2QENA 1LVAA 2XAHA 2DQLA 4P96A 4MNUA 3WU0A 1G3SA 5K1YA 1BI1A 5L3BA 3JW4A 1BM9A 5FFZA 4GCVA 2VXZA 2PG4A 3AAFA 2EWNA 1CGPA 2F5DA 5L3DA 1ZGJA 3V7CA 1S29A 4OIPF 3K2ZA 4WXDA 1FWZA 1Q1HA 1IRGA 1HKTA 4IPAA 5D5XB 3U1DA 1LEBA 4EV0A 2EFNA 4HV6A 1T38A 3ISPA 4KIBA 1P6RA 2HWVA 1I1SA 3ELKA 3ZMDA 4ENJA 4O5VA 4EJVA 2DPUA 4I02A 3O6BB 1IN6A 3BPVA 4PZJA 3KP2A 1FP1D 2FBHA 5E1ZB 1CF7A 5TRDA 2FNPA 1IXSB 1G3YA 4KN4X 3FMRA 4HDVA 2IA2A 2VN2A 2H6BA 3WTUC 5IT3A 2A69F 2NNYA 3E97A 4IRGA 2ZO4A 5E17F 1HW5A 3R0JA 2EB7A 1A04A 1ZGAA 2FOKA 3MEXA 1RIOH 3R0AA 4OIQF 3RJPA 1YO5C 5FGMA 5DCFA 3GFLA 4CHUA 1PP8F 2GIVA 4M6XA 3S2WA 5D5VB 1YG2A 5CVIA 4L5IA 1TQIA 2DBBA 2W85A 1BBYA 2IP2A 5HLGA 4IJAA 2PEXA 1KYWA 3L2CA 2XUBA 3CUQC 5LHGA 3M1EA 4BNCA 3I0TA 2HDCA 3VOEA 3FXRA 3R60A 3F8BA 1OPCA 4P9FA 2GXGA 3ZN0A 4KFCA 2UXNA 6PAXA 2YX4A 2V1DA 1OYYA 4MQ9F 2MD5A 5LHIA 4UV9A 4KIGA 2PI0A 3DV8A 3J81Z 2VBYA 4FX4A 1R22A 5CVUA 4A0XA 2FBKA 5F6FA 5ICFA 4KIFA 4Y15A 3DXJF 3DQVC 2F5CA 1USTA 2M8EA 4IHTA 1DP7P 2JZYA 1Y0UA 1GXQA 4YFKF 3GWZA 1EH8A 4G94A 4AWXB 3GX4X 2LF8A 3GZ6A 3RYRA 2M5WA 1O7LA 4EGZA 2PMHA 2Q0OA 2JTVA 1XB4A 1E17A 4B09A 3IRRA 3V8KA 1ZG1A 3PFIA 2KJBA 1HW1A 2P6SA 2LNBA 5K5RA 4AIHA 5AIQA 3IWZA 3WGIA 1DUXC 3LFKA 3SXYA 3FM5A 1DPUA 1F4KA 1U5TB 3T8TA 4GYGA 3KE2A 1B1BA 3LSTA 3K9TA 5HS8A 1GXPA 2J5PA 4AIJA 1KU7A 1JHHA 3HHGA 2K27A 1T39A 2UWMA 4F7ZA 2Z3YA 4IRHA 2K86A 1IF1A 1ZQ1C 4UVCA 4YG2F 3HUGA 1MKMA 1ZG3A 1FBSA 4BAYA 2HYGD 3FF5A 1O3SA 4A6DA 4RGXA 2JSCA 2RQPA 3TOAA 4WXHA 4ZYGA 3MZHA 1JHFA 1KQ9A 4M72A 5EEGA 4EVIA 3F8MA 2RC4A 5L3EA 4LMYA 2EJRA 1P2FA 1QPMA 2ZFWA 4CYDA 1F9NA 1Z6RA 4WF2A 3JTGA 1QNTA 5EEHA 4LLGF 3QPHA 4BH9A 1G3TA 4KN7X 1ZRCA 4M73A 3IC7A 1DDNA 2H09A 5DCMB 4A5MA 1FYKA 3BDDA 2FMLA 2OAZA 2W84A 3J81K 4M71A 4WX9A 4M9SA 1UCRA 1EQRA 4O3MA 5ED4A 1B9MA 2F5EA 2NRAC 1W4MA 3DKWA 4HBLA 4IVNA 4CDGA 4LLNA 3HRUA 3QU3A 4H0EA 2FXAA 3R4KA 4CICA 2FEZA 3PQKA 1IXRC 2FSWA 3F8CA 4G7OF 2D2WA 1SMTA 1D8JA 1WQ2A 2GXBA 3ULQB 5BMZA 2RVCA 3M9AA 5IT9Z 1B4AA 2V9VA 3D0SA 3HYIA 4KUMA 3FMSA 5CYVA 2ZKZA 3IRQA 2L02A 5DYMA 2K4BA 4RMFA 3NQOA 1S8NA 2DT5A 4ENNA 4ZYEA 2DFIA 3B02A 3IKVA 2CWEA 4KT5C 4R1HA 1R00A 3J80Z 2G9WA 1U2WA 3DPTA 2EA4A 1YS6A 5AIPA 2HTJA 3J7AO 3HSEA 5LEJA 1U3EM 2VE9A 4LK0F 1E2XA 5LHHA 4Q5SF 3HTUA 3HRTA 1J2XA 1V4RA 4PGHA 3MFKA 1R1UA 2P7CB 2LSOA 3GFJA 4S04A 4A12A 2CSOA 1P4XA 3IKTA 5LLQA 3GYHX 5FB2A 1BI0A 3O3KA 1KU3A 1SAXA 2CO5A 1D8KA 1XGMA 5HDNA 2D45A 3E5XA 1KQ0A 5LRRA 2ELHA 2MC3A 2GA1A 5ICCA 2DAOA 2R3SA 1BIBA 2XV4S 5ICEA 2HFHA 2A61A 1KGSA 4U0VA 3ABTA 2P4WA 1LEAA 4EJUA 2ADUA 1GVJA 3IHUA 3ECOA 3VEPA 1NHAA 1UHMA 4XSZF 4ENMA 3IL2A 3JSPA 2BEOA 4HF2A 2OU2A 5DV5A 4RB1A 3H3ZA 4O2DA 1XMAA 5K5OA 2J5OA 3SHFA 4OMZA 2JPBA 4ESFA 5D8LB 2QUFA 2QBYB 2YX7A 4UNOA 3HRMA 1FZPB 1ZN2A 2QM3A 2HTSA 3K1NA 4A0ZA 1YS7A 1R5GA 2PMUA 1IN5A 4HW0A 1XGOA 3M8FA 2YSRA 2VBXA 4Y17A 3O2PE 4Q47A 4R79A 3SZPA 5E8GA 1MD0A 2XKPA 4N9HA 2HKXA 2VT2A 2FA5A 4AIKA 3F8FA 4EJOA 3KCCA 1EV7A 1LB2A 3GF2A 3I4PA 2FMYA 2RNJA 1QO0D 2ETHA 5HS9A 5H6RA 4HLXA 2Z9OA 1RUNA 1AOYA 3P9IA 2RKHA 1T0FA 4FHTA 1G4DA 1SMYF 3DEUA 2YPRA 1LJ9A 4RAZA 1FYMA 3L9FA 4BHCA 1W7PD 4TV7A 4L0YB 1XGSA 2G7HA 2HEOA 3BOQA 3QOPA 1O3TA 3ZMZA 2L4AA 4HX8A 2XIGA 4XBFA 2CW0F 4IXAA 3CJNA 3H3UA 4OINF 2XVCA 1MJ9A 5HDGA 3TKYA 3HRSA 1K78B 1RI7A 1J9IA 1BIAA 4I2OA 3BJ6A 2ESNA 3T0YA 1OYWA 3B73A 1XD7A 5CLSA 2KJCA 4A5NA 5A2QK 1BOAA 2M30A 1D3YA 5FLXZ 1X3UA 2M87A 3G73A 5ICGA 2NNNA 4RB2C 3ML6A 3ZN1A 5D6EA 2QQ9A 3FXUA 1O57A 1FBUA 1U78A 1YTYA 3ZMSA 4L9VA 2ZJ2A 3M8EA 3TGNA 4IRIA 3ZMTA 5H20A 3I59B 2V1XA 5HDKA 2O0YA 2BV6A 4BYYA 3KZZA 3V8LA 4KMUX 3V7RA 2OZ6A 2AS5F 2FU4A 4HV5A 2XAJA 1XSXA 1RNLA 2RV8A 2CG4A 4PDKA 5LBQA 3KEQA 3U9GA 1HSTA 2OA4A 1T98A 2XKOA 4L9NA 2EV0A 1U5TA 1OR7A 1USSA 1XDSA 3L7WA 5F1RA 1LQ1A 2EK5A 1Z7UA 1TNTA 3CTAA 4LB5A 5CVJA 2A6EF 2A3SA 3KETA 3T5XA 5CJ9A 4OOIA 2HQRA 1FOKA 3WTSC 2CQKA 1R1TA 4U0WA 3GEZA 2ZNYA 1TW2A 1BC8C 2GZWA 4CO8A 2VBZA 1L0OC 5H6QA 5JHUA 3BY6A 2QQAA 3QRFF 3NEUA 2M1BA 2L3DA 4BXUA 4G7HF 2Z99A 3C18A 3KEOA 3V7SA 5CVRA 4P9UA 3GUDA 2D1VA 4EM0B 5DDGA 4U0YA 2KRFA 1T6SA 3WTWC 2D1HA 5BOXA 2UXXA 4PGGA 2WTEA 1L0WA 1S6LA 4Y13A 2GAUA 1OMIA 5DCMA 4ESJA 1PUEE 4MTDA 2IA0A 2ZXJA 3I5UA 1CF7B 2L54A 4HQEA 4NHJA 2BYVE 2OZUA 2P5VA 1JXSA 3JTHA 3ECHA 4LFUA 2NS0A 2OQGA 2YU3A 5FFXA 2QBYA 2DU9A 1B9NA 1Z9CA
chains in the Genus database with same CATH superfamily
5GPAA 1ZREA 4YG2A 4CCNA 4A3BJ 4HQMA 5IP6A 3ERED 3LAJA 3HOWK 2CGPA 1Z91A 2BE5A 3BROA 4FT8A 5FLMC 2Z5UA 2R0QC 2IS4A 4G0WA 1OCTC 2OTJI 4MHGA 1JJ6C 4LJZF 1RETA 2VOOA 4NQWB 5EDNA 1O3QA 1IRFA 1HBXG 5FO5A 3S1RJ 1XMKA 5BS6A 2WWYA 2D5VA 3BC8A 4QWQA 3WE3A 4Q4ZF 3WTTC 2V6SA 1RZ4A 2VBWA 2GQQA 2O3FA 3BWGA 4XM3A 2M7AA 1YIOA 4GZYA 3GTQA 4ZDLA 3H3VL 5EG0B 1YJ9I 2AQFA 4JX6A 4HNVA 4A3KJ 2W48A 3J7AY 4YFNA 4G6DA 1I50A 4KASA 4IHSA 4BQNA 4ZZDA 5TMFA 1BW6A 5D5WB 3JRCA 4E7HA 1I3QJ 3SZGA 2WAQA 3COAC 4M3DA 1Z6TA 4AU7A 2CH0A 3E3VA 2ZUFA 1W7PB 4KICA 1YFHA 4XNFA 2V6TA 3HPHA 2XAQA 1D1CA 1WIHA 4HF1A 4M9XA 3HKZN 1IRXA 4L18B 1B8IB 3GTMC 3OYLA 3UNGC 3K10A 3H92A 3GTQJ 2LH9A 4XRSA 1MGTA 2KDZA 1A35A 2X48A 3HOUK 5BPDA 4GDFA 4NQWA 1SAUA 2A68F 4LOCA 5GAGJ 1ZG5A 4XLPA 2P8TA 3I53A 4A3BK 5ILVA 4BU2A 1ZKGA 4JK1X 5ERIA 3CMMA 2MLGA 1X1PA 4XICA 1GV5A 2DMQA 1WZ2A 4NBQA 3KPHA 4FZBA 5DD4A 3BP8A 1XGNA 4B1RA 3HOXK 3BZKA 4FX0A 2F2EA 2L01A 3RDIA 3GTPC 2GXAA 1ZYRF 2DW4A 3G71I 1K83K 1ZYRA 3JR9A 3TTGA 1HKSA 2KIFA 1S7EA 1HC8A 2XAGA 1T56A 5J6XA 1Z3XA 3F23A 4YIFA 2JRMA 3JSOA 5IP9K 4WCGA 1BDFA 3QOEA 2V9KA 1WQHA 1U9NA 2FQTA 1MJBA 4R8HA 2WADA 3QQAA 5E3NA 1T33A 4JBAA 4L9TA 1X58A 3DEEA 2EIJH 2HOEA 3E6DA 3L2UA 3S1QJ 5JVOA 2B63K 3GLXA 1W5CC 1TTYA 1ETQA 2ZXIA 3EUAA 2Y75A 3ZP5A 3OSFA 1XSDA 1SFUA 2WAQD 3JSTA 3WODA 2LOOA 3HOVK 1B8IA 5JVGF 1ZLJA 1ZRFA 1TWCA 1R1VA 2EA2A 2X1CA 4CH7A 3ZMUA 2IS2A 4EATA 1APLC 2EFPA 3W6KB 2IA1A 2YR2A 4J00A 5FLMK 3T02A 4A3LC 4DQ2A 2FRHA 1FNNA 5EZHA 3RZDJ 4EGYA 4DZJA 2ACJA 3KP5A 2DK5A 2FE3A 1QBJA 5J3LA 1VLOA 4JX4A 1JKPC 2OF7A 1TWAK 5D6FA 3K4NA 3S1NJ 4M74A 4AH6A 1LDDA 1A6QA 4RAYA 1U8BA 4B44A 1RRJA 1FYLA 4N9IA 4HA8A 2VOPA 3K4LA 2VUMC 4GO1A 1XTAA 1JVIA 5EGOB 4CXFA 1XPXA 1G59A 1VQ6I 2JA7J 1WJAA 4A3MC 5FKNA 2HXIA 4ESBA 2OTLI 4D5CA 3TFJA 3RZOK 2V79A 5IT9K 4QPOA 2OC6A 3N05A 4RAFA 2VJ5A 3GTQK 2K3PA 3WU1B 2HNHA 4ZZLA 4BDYA 3CUOA 1JGGA 3H3VD 4AUXA 3RPQA 4C9YA 1K6OA 2LF7A 2B7EA 1ORKA 3BR6A 4GFBA 5FLMJ 3TP3A 5HOOA 1MNMC 3GTGJ 1R23A 3C2HA 3RQ4A 3OS1A 3Q5FA 2Y31A 5JFEA 2OD5A 2MD0A 3FHZA 3KP6A 4DZPA 1WSVA 1ULYA 2NVQK 3KLNA 2VJ4A 4I7HA 1MZBA 3I59A 2STWA 2DFEA 4XCHA 3D5LA 3H9JA 1ZH5A 1QHGA 2GSNA 4XSZA 2H94A 2HZTA 2BY3A 2CUJA 4P55A 3CCMI 3TFHA 3GTMK 3VB2A 3TO7A 4DBRA 3S17J 4AIDA 3LSHA 2D6FC 2NS8A 1U6GA 4IHXA 2R7UA 5B1AH 2EV6A 4G6QA 5L3FA 3S1MK 4A3MK 1LE8A 3CO6C 4YFXA 4L5EA 1Y39A 5AONA 3MVPA 5LGTA 3TDUC 2PLYA 1OR7C 2L5QA 1H89C 2JH3A 4PAAA 4XLFA 3LAPA 2MBFA 1XXAA 2JA7K 2IGMA 3BTCA 4Z2YA 2E2IK 3CAGA 5EGEA 4G12A 2M9HA 3BPXA 5HL8A 5F0CA 2E71A 2NS7A 1F5TA 1D5YA 1FOWA 1UHWA 4B8XA 2KLOA 3LL7A 3L2RA 3BR2A 1BI2A 2FF4A 2E7WA 2PA8L 1OCCH 4EMSA 3G4AA 2NOGA 4UUVA 5CQEA 5F04A 3BTJA 5GPCA 2H6CA 1ZK8A 3GFMA 3F21A 4UUSB 1OISA 2N8GA 4ILDA 2E2IC 1QQIA 4EM1A 1AWCA 2V6CA 3RZDK 1F43A 1Y1WA 3BZCA 4MGRA 2Y9ZA 3KP7A 3KIOA 4RB3C 3BCBA 3F6OA 2GOMA 1IO2A 5HVQC 2BHZA 2P81A 3F22A 3BTLA 2FUG2 2DI3A 1XG1A 4IX7A 2G7UA 2IGNA 3RTRA 3H35A 2ELJA 4D0PA 4UUTA 4ZH4F 4BXFA 2DJIA 2WAQN 3A1YA 4A3KK 3K4JA 2V1UA 1UMQA 2ECBA 3HOUC 4Q48A 4IO9F 2ME6A 1VQ8I 4QSHA 1D0YA 3RIRA 2DQRA 2FQ4A 3FM3A 3WODF 3GTPK 3HIFA 2CFAB 1WI9A 4JX5A 4UXNA 4WK8F 2Q2EA 1XCBA 2QKLB 3ABLH 4QLCU 1FPQA 5JHFA 1EA3A 2H8RA 5L46A 4C3JC 5JFRA 2GBYA 2QVOA 2HR3A 3HSFA 4HPQA 1MDMB 4UUSA 4M9ZA 1MMSA 1FC3A 1KU2A 2EQRA 2GOXB 2K9LA 2PPBA 1IN4A 1UFMA 1A5JA 2JWTA 1X31C 1K83A 4OIPA 4KN4A 3SZTA 1UZCA 3AQPA 2YU9J 2HQNA 3I55I 3GTOJ 4LK1F 4OWRB 3K70C 3CP2A 5D5UB 2XRNA 2DFFA 4V2FA 2ZBKA 2A5YB 1P92A 2XDVA 4F91B 1HQCA 3Q9SA 5HNHA 3FWEA 4F3QA 3TDZC 3FX3A 4PCQA 3FOEA 1RESA 4C2MC 2M45A 1ZQ3P 3C1DA 2F5FA 2LDUA 3LQQA 2X51A 4KMFA 2PHCB 3D5RC 3GTJC 3W2WA 4XLHA 2JJ7A 4A3EC 2IW5A 1YW9A 3AG1H 3BJAA 5DEQA 1H9TA 2ZJPF 4LLLA 1YRNB 3H0GA 1JUSA 1WQGA 3QPTA 2YU9K 3GTOK 1SD7A 2TRTA 4XKBA 1ODDA 3GTLC 1GE9A 2R5YA 5IP7J 4NDLA 3PQJA 4A2UA 1O25A 5LEKA 1Y56A 2VODA 2DA1A 2ESHA 2FQ3A 3FXJA 2R93C 3JAMZ 3HJEA 1K7AA 4OAYA 4KMAA 4RS8A 2KZVA 2B0LA 1I6XA 2E2HC 2MH9A 1IUYA 1O29A 2TDXA 2IGKA 3ASOH 5CPRB 4G7ZF 2WB1D 1R5ID 4ENKA 3L09A 4H4KC 4BHBA 4OIOF 1JUPA 1TLHB 3JRHA 3A03A 1TWHJ 2QWWA 1VQOI 4OU0A 3EDPA 2A6TA 2Y0SL 4KC6A 2XB0X 5D4SA 4UB8C 1VQ4I 5IP7K 3M4OC 2LTPA 5E1WA 1VTNC 2CJJA 4J3NA 5D8KB 4FE4A 2GIZA 1WGXA 4OAZA 3T1BA 1ETOA 2HKOA 1JTYA 3GW2A 2GSUA 3T00A 4IZZA 3K1MA 2QCOA 3OR2C 2DK8A 1H0MA 4YIIA 1ETKA 1G6NA 5E8IA 1I1GA 2R93A 3HOTA 4A3CC 5M5WK 2FNAA 2M0MA 1O28A 3KLOA 1BN5A 5CVVA 2E2IJ 2L7ZA 4EQQA 4A3JK 4I09A 3ZQQA 1X2NA 2KISA 4BE0A 2BXYA 2I8DA 1O3RA 1B72B 3TO9A 5EG0A 4IHYA 4GFQA 4A3LK 2XRLA 2O8XA 5M5YJ 1K4SA 1HDDC 4YFXF 4JK1A 2OCEA 2NVXK 2O8KA 3GTLK 3I4MK 4HAMA 1XCVA 4CUGA 5JLXA 1Z05A 5HLIA 3OYMA 2DA3A 5F64A 2AXLA 3VDXA 3A01B 2ZMEB 4XSXF 2R7ZJ 1WCMA 1W7PA 2XAFA 3RKYA 5M3MJ 2WB1A 1ITYA 3G4SI 1Z3YA 1XXCA 2E2HJ 1XSVA 3DFGA 2F4OB 4A3MJ 1ZR4A 3GEHA 1SFOA 2RN7A 3N3YA 4E70A 4G6TB 1OYIA 1KU9A 2W25A 4EEFG 4F92B 3HL2A 4G9YA 2H27A 4MEXA 1IXCA 3S32A 3CJQB 2COMA 3E6CC 1IS1A 2R7DA 2QLZA 3FMQA 3GTMJ 3QX3A 5E79C 1JGSA 4PJMA 4HX7A 2Z33A 2RGVA 1JKRC 3ASNH 1HXDA 1VQ7I 1KYZA 4A3LJ 2W24A 1ZRDA 4HRIA 3H9QA 4ZYDA 4KDDA 3DF8A 4CGZA 3A2KA 1QPIA 2E1NA 1IW7F 1SFKA 3N0BA 4OIRF 3S15K 1VQMI 4P5BA 1WWXA 4XLNF 1KQ8A 3G1OA 5B3SH 3HKZD 3FKIA 1LDJA 4UVAA 1IBAA 2BOLA 3M07A 1TQMA 1E3HA 1UB9A 4PABA 4NC6A 5LRSA 2JMWA 2BY0A 4L9JA 1YW7A 1VNDA 3N97A 5L3GA 2GAGC 2V7FA 3BG7A 3OIPA 3R61A 2JA5K 2JA7A 4FETA 1Z1DA 4YFNF 2LRDA 3WG9A 3SDBA 3N4MA 3CJTB 1N78A 3FZVA 3SFZA 2B9SA 1BA5A 2JN6A 2F48A 4XOPA 4XRMA 4XORA 3E5UA 1I39A 2HS5A 1G3WA 4BQQA 1N25A 2R7OA 1IN7A 1GV2A 3KFWX 2CW8A 3OL3A 3BJOA 3ZXSA 2EBBA 2CFXA 4U7DA 2R93K 2HU9A 1OKRA 3EYYA 4WWCA 1EF4A 3HXAA 2LLKA 2LVSA 4HZFA 1IRZA 2DYRH 1GT0C 1R58A 2DTRA 2P6TA 2I10A 2ZSHB 3V4GA 1RU0A 2FBIA 3FKIC 3LSKA 3S1QK 2DN0A 1YOVB 2NYXA 1FP2A 1SANA 1PJ7A 2Y0SA 4FCYA 5J8FA 3QP5A 1FJLA 1W5SA 1S7AA 1I6HC 2O03A 4M3BA 3S1NC 4ON0A 5J1UA 2IXSA 2DOFA 1XPPA 3UKGA 4A3GK 2V6EA 1BI3A 1YX3A 4YEJA 2V1NA 1NH3A 1WSRA 1RPWA 4YIRX 2HPMA 3I4NK 5J47A 3OYFA 3HOYJ 2V4JC 4WJ4A 3WTYC 3S2DK 2E2HK 3MMYB 1RR7A 4HF0A 3GTGC 4E7JA 2NOJB 3EPZA 3BQZA 3OR1C 3TO6A 1FLIA 3FXQA 4IEJA 3S14K 4XLEA 3C7JA 3K1PA 3TFIA 1I3QA 4KISA 2KDOA 2E60A 4I01A 1Q1VA 3QU6A 1J0RA 2M8GX 4PUSA 3RCOA 3DBRB 3FDYA 1FT9A 1H9GA 4P9SA 1FBQA 3OOPA 3L2WA 4MEYF 2JA8K 3OPFA 3SYTA 3I58A 2W7VA 2LKPA 1BOBA 1I3AA 1TNSA 1HW2A 2XF7A 1BJZA 1FY7A 3F6VA 4Y7NC 2EZLA 4BL0B 2NVTK 3CDLA 1RKWA 5FD6A 4MFEA 1DPRA 1XDUA 1GHCA 4G7ZA 5IYDK 1NTCA 1SVMA 1V5GA 2VT3A 3CUQA 1WSUA 2VUMJ 5IOSA 2MLKA 2WAFA 5F0FA 4G7HA 4FE7A 4NB5A 4BHPA 3I71A 1FIPA 3HOYK 5ILSA 2BZTA 5M5XK 4C3IK 2MH2A 3FK7A 2QQBA 2WV0A 2IT0A 4BEHA 4L0ZB 4HNUA 4RGRA 3CZ6A 1MMGA 3S16J 1O2FB 2RREA 4KA4A 4C45A 1QHHD 3AG3H 3DTKA 3W6JB 2CUZA 3L2QA 5K5QA 3CO7C 1FOYA 2O7OA 3OYAA 4KN7A 1I3QK 1HLVA 4U88A 1Z77A 1TWCJ 4IF4A 1WJEA 2VKDA 3S3NA 3HHHA 2F4IA 4UVBA 2KMUA 3CQZK 3HPGA 1Y1WC 3VODA 5DUKA 1UJ8A 3UR3C 1E3OC 1IGNA 3A8IA 5IY5H 1B4BA 5C4JK 1BGWA 5FD5A 3FHNA 3LQRA 3HOZC 2XSJC 1STZA 2K7LA 2NXNB 3CUQB 1WRJA 5GTIC 4KYWA 1V5EA 2IPQX 1KQ4A 2KIUA 3P7NA 2XC7A 1ZGWA 2I5UA 3F72A 3U1KA 1RUOA 2CV0A 5FJ8K 1FX7A 3HGGA 3NRVA 3WE2A 2R5ZA 2A68A 2VE8A 1XN7A 2PFBA 4UHTA 1K6YA 4BQAA 3PNTA 1Y1VA 2UZKA 1ZVUA 1PDNC 4LIUA 3LWFA 4RMNA 1D5VA 5C44C 3KP3A 4RLFA 3OYEA 4I99C 3LA2A 1EH7A 4RB0A 2EINH 4LG0B 4IQ4A 3LSMA 4JQFA 1J6XA 1OFCX 2EFWA 3MAJA 1IG7A 1XXBA 2STTA 1TBXA 3B6CA 3G4CA 4KJZA 4LD5A 4X6AK 1T95A 2DO7A 1P4AA 1ZLKA 3QYEA 3IH2A 2WBMA 4IL6C 2VJJA 2M0CA 2OV7A 4BLAA 4DJAA 3RI4A 4AVPA 5LGUA 4GTLA 4C3HK 5HLHA 3CQZC 1RC9A 4ETSA 4XN3A 2R93J 1ZAOA 2X4HA 2L9SA 4A3IK 2GA2A 1Y1VC 4M3FA 2R7ZK 1MJAA 5J4YA 2KPMA 3GZ5A 3MWMA 2Y0MA 3MCZA 2P0WA 2W57A 1TWGK 2MSYA 3OYGA 2BE5F 4ASNA 1WOPA 5HODA 2L4MA 2KKOA 4CCKA 1VQPI 1HI9A 2Y69H 4W1UA 1D0XA 2P5LC 4BBRJ 3ZPLA 2OBPA 5BNGA 5A2QZ 4LG0A 3A0HC 3SEZA 4LK1A 3ONQA 1SFOK 1WJBA 3WGGA 2IRFG 5KVRA 1REPC 1K61A 1ON2A 1AKHA 1FEXA 1T0FC 1X4OA 2IBDA 2XHKA 4XN0A 2JA6K 3K0LA 2QA4I 2A07F 4BY1K 5IYDJ 1FSHA 1WCMK 3J80K 4K2EA 3REOA 1TWGC 2ISZA 3MQ0A 1VQNI 1HQMA 2PJPA 2E2HA 1FSEA 2XGEA 1SFOJ 3KEYA 4XRFA 3OV8A 3RYPA 3NAUA 4DYRA 3BG6A 3GVAA 4IKFA 2W4SA 1D0ZA 4QIWL 1QZYA 2FOWA 3JAMK 1QGPA 2BVLA 5LGNA 2LREA 1LNWA 2VC1A 3DKXA 4HG2A 2XCQA 1R71A 5KK1A 1L3LA 1X1CA 2MA3A 4ZC3A 1DQUA 3AG2H 1NG6A 3GFIA 5E18F 2BHYA 4RM3A 4Y3OA 4JP0A 3IWFA 1HSJA 3PNVA 2KIMA 2PQ8A 3SFIA 3GTMA 1YW8A 3Q0WA 4HLYA 4MEYA 4UY8I 2DLLA 3OYNA 1OCPA 2HQ5A 5EZGA 2IS1A 3P9CA 1I5ZA 1TQPA 3FBIB 3EQLF 2DDAA 2XGDA 5E1XA 3JRIA 1OCZH 3P9KA 1SD6A 3WTXC 1T8IA 1G51A 1TWGA 1VI0A 2KZGA 4ZYHA 2HI3A 4KDPA 3I54A 1VZ0A 2M4KA 3E7LA 3MKWB 1LFBA 2RAEA 5DD8A 3GTLJ 1S7OA 2JQ7A 2JPCA 1I6VA 2Z16A 3K6GA 2IVMA 4E6KG 3T8RA 3TQNA 2PN6A 1C0WA 1WOSA 1F1ZA 1P4WA 3Q9VA 2HZDA 1IE0A 3PO3C 1O7FA 4KMDA 1YLFA 2IGOA 4Q5SA 4GYIA 2QZ8A 1BS2A 2ID6A 4RGUA 2VQLA 2VC0A 3JRAA 1WCMC 1CQTA 3I64A 3ROUA 4M3EA 2R7QA 4BBSK 4WXCA 4A6EA 2O5RA 3MN2A 3G3ZA 4RM2A 5TGTA 2Y48A 2DPDA 1J75A 4DDQA 1IL2A 1SD5A 2ZMEA 1X1DA 1MBFA 4S05A 4BXXC 3S3MA 1JI8A 1SFOC 1J6VA 4A93K 5C3EJ 2EILH 5JR3A 1BJAA 5HNFA 3CCRI 4X0GA 2YU9A 3GTOA 4HOBA 3DTIA 2LR8A 3G1LA 3DPLC 1VFCA 1UAAA 4GTAA 4MEXF 3H5AA 5TJJA 1SVLA 4E7ZA 3HOSA 1XX5A 5C4XJ 1IAWA 5JVTA 2ZNZA 3LOCA 3CCVI 3SDGA 1ON1A 4EM2A 4KAWX 3HG9A 3GBGA 4HEA2 3L4JA 1ZHFA 1F93A 2R7RA 1VQLI 1P7IA 1J5YA 3HSRA 3G2BA 3PO3K 1MBJA 2BBYA 3S2DJ 2A6HF 3WTZA 1TWCK 4PFPA 1IUFA 3S1MJ 5FLXK 3RZOC 3M7GA 4EJWA 2DXIA 4HYEA 1ETXA 4A3GJ 3E6MA 2HYFA 4A3DK 1QVTA 1TWFJ 3A8JA 4ANJA 2X6OA 5ILUA 2ZMEC 3HUGB 2UV1A 4DIQA 5JI6A 2XROA 1YITI 3VWBA 1JUMA 4N0BA 4FASD 5GTHC 3E5QA 4C3IJ 4EJTA 2E19A 4P5OA 2FD5A 4OMYA 1YQAA 4I98B 4E7SA 3S2DC 3H1CA 2E7XA 2QYOA 3AFHA 3ZQFA 4A0YA 1TWHA 1IN8A 2K3FA 3QP6A 1U5TC 3PO3J 1IDYA 4I0BA 1S3JA 5CQGA 4M1XA 2WAEA 3D1NI 3CCEI 3DXJA 3KZYA 3PSIA 1MDMA 2A6HA 1SD4A 1S9HA 3GMEA 4NUBA 4W97A 5HS7A 1Y1WJ 4DGWB 1O4XA 1J59A 4XMYA 2JUGA 4XLPF 2CMPA 4CZZA 1YYVA 4GGGA 2HGCA 2E1CA 5FLVA 3DTEA 4UV8A 4MQ9A 5IOQA 3F3XA 1JTXA 2X0LA 4O6JA 5L3CA 5GP9A 3M3YK 3BZ6A 3GO5A 1LDKB 2CV1A 2RDPA 2EFOA 4PJ0C 2JA6C 2DA2A 3FXMA 5J40A 5C4JC 4JOMA 1LKXA 2WY7Q 3MZYA 3S1QC 3IH4A 1TWHC 4DNCA 2XASA 3ZQIA 1T2KA 1Y1VK 4GTEA 2NVYK 2VONA 5E68A 4C2TA 3ZMVA 2ZUEA 1SFXA 2H1LA 4M6YA 4LB6B 4CCJA 2NVYC 4BY7K 4FISA 5DUIA 3S17K 4C3JJ 3OYHA 3LA7A 1SFEA 4AD9A 3K4BA 4BBRK 3DLAA 4ZH4A 5JLWA 2KQRA 1V3FA 2YUSA 1N77A 2C6YA 3C3WA 2JT1A 3M3YC 4P1WA 3GXOA 1SMYA 1QZZA 2ISYA 1U0JA 1B6AA 5D4RA 4C30A 2E2IA 3JCUC 4XLCA 1R36A 4KM9A 3BT9A 4HX4A 1W5TA 2CYYA 3I3LA 4A3IJ 1FMWA 3SJMA 3CDHA 2XGXA 5GAHJ 2FJ1A 2CQQA 3CLOA 2O61A 2VXDA 2R7VA 2O6GE 3LMMA 4G0VA 3U2RA 4II3A 2Q8KA 3K70D 5FRMA 1Z21A 3LA3A 3M4OJ 2JUCA 2F6CA 3CF2A 3IH3A 4G8XA 1OJLA 2M3AA 3RKWA 1VF9A 1D1AA 3WGHA 3BUEA 2NVYA 3EETA 3L2VA 1VH2A 3KP4A 4XRSG 2GAHC 3S1RK 4CZCA 1IV6A 2FX0A 2CUFA 3RKXA 1IZ1A 2IJLA 1U8RA 2JA5J 4KNYA 2BY1A 1K78A 4A3GC 4Y33A 3TL4X 4A3JJ 3PO2J 1I27A 3GCMA 2P5KA 3EUHC 3CCUI 2BGCA 2XSDC 4BJ6C 4KM8A 3QAHA 5J8CA 2P5MA 4BKWA 3ABUA 3CMAI 1ZR2A 4AM3A 4OIOA 1KA8A 3EUKL 1R7JA 1U9OA 1J6WA 1HKQA 2JRTA 3O8HA 1MMNA 3V8JA 4QPQA 3WHCA 2WC2A 4U7BA 4XL9A 4I0AA 1WFXA 3ZQ7A 5BPIA 2K4JA 1R5HA 1BC7C 1BR2A 2ECCA 5BQTA 3S0XA 1OCRH 2LY9A 4C2MJ 4XONA 4WJ3M 4GXOA 1FTTA 2HQAA 1TW3A 4ZJZA 1LUJB 4LGWA 5E20A 4RGSA 5IYBC 1MBEA 2EZHA 1K79A 4A93C 3EYIA 2A69A 1J7KA 3EUHA 3K69A 1B59A 3HTSB 2GWRA 3RPUA 2A05A 2LC2A 1DCHA 5GAEJ 1W0TA 3R6SA 2EV5A 1J09A 2L0KA 1JE8A 1WKMA 3SQNA 1ZBSA 2OPTA 3Q3SA 2ME0A 1C0AA 2LBFB 3PUBA 2ELKA 2OQRA 3B6AA 4C3JK 4MTEA 2ZCWA 3TOBA 1WHUA 2Q1ZB 4XSXA 1WOOA 2HDWA 3CC7I 5M5WJ 3KYCB 4MQVA 1ZARA 3ZOBA 2K02A 2LKXA 4QIWN 1J98A 2DOAA 4N4OB 2AQEA 3P5JA 2PBIA 3HC7A 2LFBA 3DP7A 3G1MA 3VFZA 1VQKI 4L5JA 2EFQA 4Z6YA 9ANTA 1WH7A 3HB9A 2VASA 3WTVC 1EH6A 1DD5A 3E6BA 2EIKH 1PP7U 2IEKA 4XKVA 4WILA 1XZQA 1W1WE 2P7VB 2R7FA 3GLLA 5IYCJ 4BY1J 4HDUA 1USMA 1EFWA 1X3WB 1ONVA 2DYSH 2NAZA 2W00A 3L00A 3F8NA 2QENA 1LVAA 2XAHA 2H1KA 2LBFA 3RPUD 1WJFA 5C44J 4XLNA 2DQLA 4P96A 2Y0SN 4MNUA 3WU0A 1O24A 2KFDA 1G3SA 5K1YA 1BI1A 2ZFUA 5L3BA 3JW4A 1BM9A 2OUMA 5FFZA 4GCVA 3A4CA 3QYBA 3DBHB 3QODA 3FXKA 2ZC2A 5GADJ 4X6AJ 3GDZA 1AA7A 2VXZA 2PG4A 2AXTC 5KAFC 3AAFA 4BACA 3GSIA 3NUHA 2EWNA 3LNQA 1CGPA 2F5DA 5L3DA 2E34A 1ZGJA 3ZCOA 2M2EA 3V7CA 3OIOA 4C3HJ 1MSFC 1S29A 4OIPF 3K2ZA 3TEDA 4WXDA 3CJRB 1Y1VJ 1LE8B 2CU7A 2CQ7A 1FWZA 1DCOA 1Q1HA 4QTRA 3VYUB 2JA6J 1IRGA 1HKTA 3VA7A 1XZPA 5EJCA 4A3CJ 1MNEA 3MD2A 4IPAA 5D5XB 3U1DA 1LEBA 2MFZA 4EV0A 2EFNA 2X85A 3MKLA 1ZXOA 3JRDA 4HV6A 5H2FC 1T38A 3ISPA 4KITB 1I50C 1IV8A 4KIBA 1P6RA 2HWVA 1Y8RB 1I1SA 3SZZA 5D4DA 3ELKA 3ZMDA 2LG4A 3ZQCA 4ENJA 3BR3A 3S3OA 4O5VA 3HKZA 4CCOA 4EJVA 2DPUA 1MMAA 1PJ6A 1T08B 3HDDA 3HOZJ 4I02A 4B4CA 2Z2SB 4GRIA 3O6BB 1A6IA 1X4PA 4IHWA 2KRCA 3MMLB 2GLOA 4NC7A 1IN6A 3BPVA 4BQOA 3VPRA 4C2MK 4PZJA 3GTPJ 3PIOF 3H5RA 1RR8C 3KP2A 3S16K 2E35A 3E1SA 1TWFK 3U21A 1FP1D 2FBHA 3I56I 2YU9C 3GTOC 5E1ZB 1CF7A 5TRDA 5M3FK 1BW5A 3BR5A 2FNPA 2CUEA 4AC0A 2CFAA 2Y30A 2O5IA 2K85A 3HOWC 2PMZA 2Q2EB 1IXSB 1G3YA 4KN4X 2K9QA 3FMRA 3H0GJ 3I4MC 1E3PA 2X1DA 4LG3A 1FOXA 2WAQL 4XK4A 2VKHA 2Y0SD 3S1RC 2MGQA 1X2MA 4HDVA 1SC7A 3V42A 5J4VA 2IA2A 2VN2A 4DOZA 1XMXA 2H6BA 3WTUC 2XF6A 2DA5A 5IT3A 5F08A 1MSEC 1PJ5A 2PX9A 3OOUA 2A69F 2NNYA 3E97A 2XB5A 3IV5A 4E7KA 5IP7C 4IRGA 4KB4A 3M4OK 2ZO4A 5E17F 2R5ZB 2BW3A 1HW5A 4A3CK 1WCMJ 2R7ZA 3R0JA 2EB7A 4PJJA 1A04A 3IUOA 2V26A 1BL0A 3LSJA 4B43A 1ZGAA 2FOKA 3MEXA 1RIOH 4G0UA 3PFYA 3R0AA 4OIQF 1VRQC 3RJPA 4BY1C 2HOAA 1YO5C 5FGMA 2PMZN 3C2BA 5DCFA 3GFLA 3BQYA 3OYDA 4CHUA 1YRNA 1PP8F 2B63A 3W2VA 2GIVA 4M6XA 5IYBK 2W1OA 3S2WA 5D5VB 1USOA 1YG2A 5CVIA 1A31A 4L5IA 4NOIA 4Y7NK 2LYCA 1TQIA 2GM4A 2DBBA 4BS9A 2W85A 3ZQLA 1BBYA 2IP2A 1RKTA 4RA2A 3KYDB 3WG7H 4B47A 5HLGA 4IJAA 2PEXA 3IAM2 2R7ZC 1KYWA 3CDIA 3L2CA 2XUBA 3CUQC 4AYBN 5CHPA 4ITVA 5LHGA 2QSGX 3M1EA 4BNCA 3I0TA 2HDCA 4OIQA 1R49A 3VOEA 4A3DJ 2AHQA 3ZQGA 3FXRA 4C3HC 4PJLA 2TCTA 1IW7A 3NWTA 3R60A 3F8BA 1DCPA 1OPCA 2E2JC 5C4XC 4P9FA 3K2AA 2HXOA 2GXGA 4NC8A 1TWAC 3ZN0A 4KFCA 2VIXA 3QWLA 2B63C 5EYRA 2UXNA 4X6AC 2VQHA 5IPAA 6PAXA 2YX4A 2V1DA 1OYYA 4BXXJ 4MQ9F 2MD5A 2DDBA 5LHIA 1GDTA 3TMOA 4UV9A 5C4XK 4KIGA 3RQIA 4FM9A 3AD8C 2PI0A 2XAUA 3DV8A 2ZXWH 2ZJRF 3J81Z 2VBYA 5C3EK 4FX4A 1R22A 4XQFA 1TT0A 2W82A 3GEEA 1OLTA 5CVUA 4DW6A 3TP0A 4A0XA 2LD5A 1JKOC 2RGRA 1LFUP 5B1BH 2FBKA 1PYVA 3IP4B 5F6FA 3W3CA 2DOEA 5ICFA 4KIFA 4Y15A 3DXJF 1POGA 2DT6A 3DQVC 5FKKA 2VPRA 2F5CA 1USTA 4RAGA 3H0GK 2M8EA 4IHTA 2ZFZA 4A3BC 2HVQA 1DP7P 4XLAA 2JZYA 1Y0UA 3CC2I 4IQJA 1TWAA 2L9VA 3ABKH 1GXQA 4YFKF 3BG9A 3GWZA 5C4JJ 2DA4A 1EH8A 2W7NA 2IAIA 4G94A 2EH3A 4AWXB 2NVQC 1HCRA 3GX4X 1TWFA 2LF8A 3GZ6A 3RYRA 2M5WA 1O7LA 2R7XA 3HGYA 5M3MK 3BLYA 4EGZA 1DP3A 2PMHA 2Q0OA 2JTVA 1XB4A 2K40A 1E17A 4Y52C 4B09A 3W6VA 4A3FJ 4G7OA 4QJVB 1YX2A 3IRRA 3V8KA 2RNGA 2NVXJ 1ZG1A 1YI2I 3PFIA 3H0GC 2KJBA 2E1MC 1HW1A 2P6SA 4GTCA 2LNBA 5K5RA 4AIHA 1TL8A 1MNDA 5IORA 1MMDA 3BG3A 4CCMA 2M4GA 3RSNA 1H88C 2ZXHA 5AIQA 3IWZA 5EEAA 3PIPF 4A3IC 3HEFA 2K9MA 4AYBL 4XR6A 3WGIA 3HOYC 2VUMK 1R6RA 1R9TC 2VKVA 5TISC 1DUXC 5E3OA 3SZYA 1JOEA 3LFKA 1TWFC 3LSGA 3SXYA 2PMZL 3FM5A 4D7MA 4F93B 4YRVA 1DPUA 3QYFA 1F4KA 4Y4RA 1U5TB 5LFAA 4MLOA 3T8TA 2XCOA 4GYGA 3KE2A 1YIJI 1B1BA 3DU6A 2M34A 3AL0B 3LSTA 3K9TA 4PSXA 5HS8A 1QZEA 1GXPA 2X6YA 1IC8A 5J1YA 2J5PA 3AL0C 5KCMA 4AIJA 1KU7A 4DYQA 1BJTA 1R9TK 1K83C 3HOVC 4F55A 3FIWA 2XF5A 3CQZJ 1JHHA 2MC4A 3HHGA 2K27A 2MABA 1OQYA 1T39A 2UWMA 3DCFA 4F7ZA 2Z3YA 3IPJA 3NARA 4PSWA 4IRHA 5IYCK 3FKJA 3M1CA 2K86A 1TWGJ 1IF1A 3VSKA 1ZQ1C 1E0EA 1V5VA 4LK0A 1K83J 4UVCA 4KB2A 4YG2F 3HUGA 2KT0A 4D9JA 2JA5A 2DMUA 1MKMA 1ZG3A 3HOZK 1FBSA 3AQOA 5KNLA 4A3DC 4BAYA 2HYGD 3FF5A 1O3SA 4A6DA 4RGXA 5K7FA 2JSCA 3FKIK 2RQPA 3TOAA 3GTLA 3BP3A 4WXHA 2HOTA 4ZYGA 4IHVA 5K7HA 1R4MB 3MZHA 1NG7A 1JHFA 1KQ9A 1LFPA 3GTQC 2WA0A 4M72A 5EEGA 4EVIA 3F8MA 2RC4A 5L3EA 2RQQA 4LMYA 2JK3A 2E1MB 3RZOJ 2EJRA 1P2FA 1QPMA 5KHDA 2VLAA 3GIRA 2ZFWA 2X6WA 4A3EJ 4CYDA 1F9NA 3F0CA 1Z6RA 3W2AA 3RZDC 4BXXK 1YE9A 3A8KA 4WF2A 3JTGA 1QNTA 5EEHA 5DM7F 1BR4A 1UV7A 1ETYA 5FJ8J 2HVSA 1W0UA 3ADAC 2JSPA 2BY2A 4LLGF 3QPHA 4QIWD 4BH9A 3K7AJ 2NVTC 1G3TA 3LPXA 4KN7X 1ZRCA 1GVDA 4M73A 4BUPA 4D5FA 3IC7A 1DDNA 3H36A 4XOTA 5KAIC 3S8PA 2X9DA 2H09A 4MIMA 5DCMB 3CF5F 2JA7C 2DODA 4A5MA 4BEHB 1ETWA 2E2JJ 2EBIA 1FYKA 3DBLB 1WH5A 4LIVA 3KYLA 3BDDA 2FMLA 2OAZA 2W84A 3HOXC 1YX5A 3J81K 4HNTA 4M71A 4WX9A 2PJRB 4KARA 4DYCA 4M9SA 1UCRA 2KIQA 1EQRA 4O3MA 5ED4A 3BTIA 1B9MA 1H8AC 1DU6A 2F5EA 2NRAC 3DU5A 3HXLA 3RKQA 1W4MA 3DKWA 1UG2A 3K4MA 1AU7A 1HA8A 3HM5A 4HBLA 4IVNA 4CDGA 4LLNA 1ISEA 5DM6F 4J01A 2WV1A 3HRUA 3QU3A 3CCSI 4H0EA 2DT7B 2L7MP 3KZIC 2JVHA 3CC4I 2LKSA 2FXAA 4A93J 1YJWI 5M5YK 3PL8A 3DPUA 3R4KA 2QQ8A 1TWCC 4CICA 1MH4A 4BKXA 2FEZA 3PQKA 3OMYA 4RDUA 1IXRC 2FSWA 4UB6C 3F8CA 3VSLA 3ZRGA 4BJTA 4G7OF 3GTJJ 2K9NA 2D2WA 1SMTA 5B66C 3CCQI 3LSPA 2R5YB 1D8JA 1O27A 1WQ2A 5IYCC 3ZGKA 2GXBA 3ULQB 2HOSA 2K9SA 5BMZA 3K7AC 1F7VA 1AB4A 2RVCA 1EKEA 4A3FK 2NVUB 3M9AA 3I9V2 5E3LA 4BDZA 1B4AA 5IT9Z 1WORA 3AH5A 4CSWA 2PJRA 4OIRA 3GZNB 2V9VA 1FIAA 4Y52J 3D0SA 3PM1A 1WVRA 3HYIA 4KUMA 3FMSA 2VB6A 5CYVA 3S14J 1F7UA 5B5EC 4LR2A 1MBGA 1ETVA 1S5LC 5M5XJ 2ZKZA 3IRQA 2L02A 3H3VK 5CKTA 2K4BA 5DYMA 5FKLA 2NVYJ 3GTJK 4RMFA 3NQOA 1S8NA 2DT5A 4ENNA 1X1AA 4F52A 4ZYEA 2L2OA 2V9PA 2JA6A 1MBHA 2DFIA 3B02A 3IKVA 2L7FP 1KZHA 1QVUA 2CWEA 2MG4A 4B48A 4KT5C 4CYCB 2DA6A 4R1HA 3CCLI 1VQ5I 3OIQA 1R00A 3OEPA 2BXZA 4GT9A 3J80Z 4KMUA 2G9WA 1U2WA 1Z7LA 2ID3A 2XPWA 3DPTA 3OYJA 1BR1A 3LSIA 1V54H 1JKQC 2EA4A 1YS6A 5AIPA 3F9KA 3HOWJ 1EK8A 2HTJA 4IOCF 3HKZL 1OCOH 3J7AO 2F5VA 3HSEA 1Z67A 5LEJA 3A0BC 3OL4A 3M3YJ 1U3EM 2CQNA 3JRBA 3S15J 1MBKA 2VE9A 3KX2A 3OS2A 2R7TA 4GTDA 4LK0F 1E2XA 5LHHA 2X1EA 1LVKA 3M8JA 2JA8J 1WPKA 2GSOA 3A01A 4Q5SF 2CRGA 1PUFA 2VQCA 2L9NA 3E0JB 2R7WA 2E5ZA 2NVXC 3HTUA 3HRTA 1QRYA 2R4GA 1J2XA 1V4RA 2R92C 4PGHA 3MFKA 1TWHK 3Q3QA 1R1UA 2P7CB 3OWTA 3L1PA 5EGHA 2LSOA 1O2AA 3GFJA 4S04A 2ZJQF 4OINA 4XKWA 3CMYA 2CSOA 4A12A 1P4XA 2VJIA 3IKTA 3I4NJ 5LLQA 2ICWG 2MW8A 5FB2A 1BI0A 3GYHX 3O3KA 4E7LA 2BVMA 3Q0UA 3PO2C 1I50J 1KU3A 1SAXA 1ENHA 2CO5A 1D8KA 1XGMA 1O2BA 5IP9J 2LY1A 1YJNI 5HDNA 2D45A 2OCCH 1MH3A 2DMTA 3E5XA 4J19A 4DBQA 1KQ0A 1A36A 1EH1A 4B3AA 5LRRA 3ZQHA 2ELHA 2MC3A 2GA1A 2DAOA 2R3SA 2XV4S 1BIBA 3K4CA 5ICEA 2HFHA 1DGWY 5ICCA 3OYCA 2A61A 3N0CA 2R92A 1JT0A 4BBSJ 1KGSA 2G0EA 4U0VA 1PUFB 2R92K 3ABTA 4E7IA 1WJCA 4XKCA 2P4WA 1FMVA 1LEAA 1KONA 1WI3A 4EJUA 2ADUA 3CMEI 3CQZA 1GVJA 3IHUA 3ECOA 3VEPA 5FRNA 1NHAA 1UHMA 4XSZF 4ENMA 1VGXA 3IL2A 3JSPA 1XZPB 4GTBA 1I6HJ 2BEOA 2UUZA 3S1MC 3DLLF 4HF2A 2OU2A 5DV5A 3FBNB 4RB1A 3H3ZA 1Y8QB 4O2DA 1EJ9A 1P9QC 3ZR8X 2CS3A 1XMAA 2LP0A 2DMNA 2J5OA 5K5OA 1QU3A 3SHFA 4OMZA 4YELA 4M3GA 4ZDOA 1YNNA 2WB1L 3VYTB 2R92J 1ACIA 3PSFA 2JPBA 3ERMA 4ESFA 5D8LB 5M3FJ 3PJRA 2QUFA 2QBYB 2YX7A 1R9TJ 4UNOA 2DFHA 1S72I 3QPLA 4BY7C 4YFKA 4NNJA 3HRMA 4RBOA 3MKYB 3L4KA 4I6ZA 2HYJA 1FZPB 2Y2ZA 1ZN2A 5DTDA 3BG5A 3NWSA 2QM3A 2HTSA 3K1NA 4N4NB 4A0ZA 3K7AK 1YS7A 1R5GA 2Y9YA 4D1QA 1PVEA 2PMUA 3MZ8A 4LITA 3AG4H 5DS9A 5TMCA 4CCLA 1IN5A 4BJ5C 4HW0A 2CW7A 1XGOA 3M8FA 2YSRA 2VBXA 4LQYA 5F0HA 4Y17A 3WHBA 3HBLA 2A5WA 3O2PE 4Q47A 4R79A 3A02A 3H5NA 3SZPA 5E8GA 3PO2K 3OSGA 1MD0A 4A3FC 2XKPA 2V6UA 4N9HA 2HKXA 4BE2A 1MW7A 3JRGA 2VT2A 1M1EB 2FA5A 4PFOA 1W36D 1UG0A 2YS9A 4A3KC 3J7ZI 1Y0NA 4KMHA 1YHQI 3FKIJ 4AIKA 3F8FA 2L9RA 4FQGA 2O5JA 4EJOA 2JA5C 2F4MB 1HDPA 3KCCA 4BLBA 2E2JK 2BW3B 1EV7A 2E36A 1LB2A 4PJNA 3X2QH 3OYBA 3GF2A 3I4PA 3DWLE 1HOMA 2FMYA 2RNJA 1QO0D 2E1OA 3MKZA 2ETHA 4ZDPA 5HS9A 5H6RA 4HLXA 2Z9OA 5J1RA 4E4HA 3AD7C 3BCAA 3FK6A 1RUNA 3DEWA 1AOYA 1G2HA 2H8WA 2E5NA 2RKHA 1T0FA 3P9IA 4FHTA 1G4DA 3J7YJ 1SMYF 2QGUA 3DEUA 3HZJA 1UELB 3DKYA 1INNA 2YPRA 1LJ9A 4RAZA 1FYMA 3L9FA 5C44K 2DA7A 2ZSIB 4U87A 4BHCA 1W7PD 3BP8C 3HOVJ 2KL4A 1DU0A 1YNJA 2KRHA 3GTPA 4TV7A 4L0YB 1XGSA 1TT5B 1ERDA 1PJRA 2G7HA 1Z0XA 3OREA 2CFOA 5F27A 3S16C 2HEOA 3BOQA 3QOPA 4PK4A 5LD2C 1O3TA 2VPLA 3ZMZA 3GTKC 2NVTJ 2L4AA 4HX8A 3S2HJ 4S0HB 4MFDA 1P7JA 2OJED 2XIGA 4XBFA 3AD9C 2CW0F 4IXAA 1I6HK 3CJNA 3ESWB 3FISA 5IP9C 3H3UA 4OINF 2XVCA 1MJ9A 4V19K 3O8GA 2QF7A 5HDGA 2IS6A 4ABZA 2PMZD 3TKYA 1V55H 3K4KA 3FOFA 3OYIA 1Y1WK 2PA8D 1LPQA 3HRSA 1K78B 3S2HC 3H9GA 1RI7A 2EZIA 4MO7A 1J9IA 4FTHA 1BIAA 1TP4A 4I2OA 3BJ6A 4GTFA 2ESNA 3T0YA 1OYWA 4LJZA 3B73A 1XD7A 5CLSA 1IDZA 3Q0VA 2KJCA 4A5NA 1V5FA 1IQ0A 5A2QK 3GTKA 2KP6A 2DCEA 5EGOA 1BOAA 5FROA 1W36C 3GTKK 2M30A 1D3YA 5FLXZ 4BE1A 1X3UA 4LOWA 2M87A 3G73A 3H0DA 5ICGA 5FKOA 2VUMA 2NNNA 4RB2C 3D5SC 3ML6A 2L7KA 1MIJA 1YCLA 3PNYA 5IYDC 3BR0A 3ZN1A 3G6EI 5D6EA 2NVQJ 2QQ9A 3FXUA 2VKEA 2LK2A 2CQXA 2HPIA 4KT6A 1O57A 2B63J 1FBUA 3CCYA 1U78A 1YTYA 1R4NB 4L9VA 3ZMSA 4JYKA 1WQFA 3ABMH 2ZJ2A 3M8EA 2HVRA 1FTZA 3TGNA 4IRIA 3GTKJ 3ZMTA 5H20A 3CD6I 1IJWC 5TJ3A 3I59B 1AKHB 1JT6A 2V1XA 3GEIA 3CLQA 1JQWA 4QJVA 5HDKA 2O0YA 2BV6A 3HOXJ 2VQGA 4Q4ZA 4BYYA 5IOTA 3LFUA 3KZZA 1G8XA 3V8LA 1B72A 2DMPA 3WU2C 1HF0A 4KMUX 4CA0A 4X1EA 3V7RA 2EPFA 3C2GA 2OZ6A 2A6EA 2AS5F 4A3JC 2FU4A 5E3MA 4HV5A 4P5AA 2XAJA 4D7NA 4RLQA 1XSXA 2QSFX 3HOUJ 1RNLA 2WY8Q 1TWAJ 5EF6A 2RV8A 3T01A 2CG4A 4PDKA 1Y6IA 4M6VA 5LBQA 2VL8A 3KEQA 4XIDA 3U9GA 4ZYAA 1HSTA 2OA4A 1T98A 2XKOA 1XS9A 4L9NA 2EV0A 1U5TA 3GTGA 3S2HK 1OR7A 1USSA 1UHSA 1XDSA 2XPVA 3L7WA 2COBA 5F1RA 3JREA 3CESA 1LQ1A 2EK5A 2O9LA 1Z7UA 1TNTA 4C2UA 4LLGA 3CTAA 2HDDA 1I3QC 1SEUA 1NK3P 2LMDA 1XZQB 4CYCA 4LB5A 1GUUA 5CVJA 2A6EF 1X19A 2A3SA 4C3IC 3KETA 3T5XA 5CJ9A 4OOIA 5IYBJ 2HQRA 1FOKA 4AYBD 4V2GA 3OS0A 3WTSC 2ZB9A 2DJNA 2CQKA 1K4TA 1R1TA 4U0WA 2VI6A 3GEZA 1AHDP 2RH6A 1WJ5A 4HSRA 2M7BA 1X3ZB 1SVOA 2ZNYA 1TW2A 1BC8C 3AKZA 3JRFA 2MYSA 2NVXA 2FQOA 5IOZA 4I76A 3S93A 4A69C 3GTGK 1GLNA 2GZWA 1WJDA 1N75A 2X6XA 2QEXI 4CO8A 1VQ9I 2XCRB 4A3EK 4II2A 1JJ8C 2VBZA 1L0OC 5H6QA 3I4NC 2R7SA 5JHUA 3TW7A 2EIMH 3BY6A 2QQAA 3QRFF 1TC3C 3S1NK 3NEUA 2M1BA 3FXLA 2KWAA 1ZTRA 3EQLA 5C3EC 1VJEA 3S14C 1O26A 2L3DA 4BXUA 3PUFA 1XC5A 4IOAF 2Y3PA 3CP8A 4G7HF 1F36A 2LY2A 2Z99A 3C18A 2QSHX 3KEOA 1TZLA 3V7SA 4HSTA 2XPUA 5CVRA 3OY9A 3IAS2 3VYRB 4P9UA 3GUDA 2D1VA 5FKMA 2QKMB 1DGRM 5F1JA 5HLTA 2CW0A 4AYBA 4EM0B 2CV2A 4ZTJA 2JVGA 5DDGA 4Y7NJ 4U0YA 2KRFA 1T6SA 4ZTFA 3WTWC 2D1HA 5BOXA 1ZELA 1R9TA 2UXXA 4PGGA 4Y52K 2WTEA 4B3XA 1L0WA 2AO9A 1S6LA 4AVZA 4BY7J 2K5CA 2Z1DA 4Y13A 2GAUA 2WB1N 1OMIA 1I50K 4BBSC 5DCMA 4KATA 3LSRA 4ESJA 1PUEE 3GTJA 4MTDA 2IA0A 2ZXJA 1EI6A 3I5UA 4BGDA 1CF7B 3CCJI 2L54A 2BYVE 2OZUA 2P5VA 4HQEA 4NHJA 3FXOA 1JXSA 3JTHA 3ECHA 2DTZA 4LFUA 3TW6A 1NK2P 2JA8C 2NS0A 4BBRC 2OQGA 3S17C 3I4MJ 1X1BA 2JA2A 3OYKA 1D1BA 2YU3A 1QA6A 5K7ZA 3BR1A 2KHMA 5FFXA 3QPSA 2QBYA 3TBIA 2DU9A 1B9NA 3S15C 3VYSB 5IOYA 1Z9CA 2XGCA 3SEQA 2EZKA
chains in the Genus database with same CATH topology
1ZREA 4HQMA 3ERED 3LAJA 2CGPA 1Z91A 3BROA 4FT8A 2Z5UA 4MHGA 2VOOA 4LJZF 1HBXG 1O3QA 1IRFA 5FO5A 1XMKA 5BS6A 2WWYA 4QWQA 3WE3A 4Q4ZF 3WTTC 1RZ4A 2VBWA 2GQQA 2O3FA 3BWGA 1YIOA 4G6DA 4IHSA 4ZZDA 5D5WB 3COAC 1Z6TA 3E3VA 1W7PB 4KICA 1YFHA 2XAQA 4HF1A 4M9XA 4L18B 3H92A 1MGTA 5BPDA 4NQWA 2A68F 1ZG5A 2P8TA 3I53A 5ILVA 4JK1X 5ERIA 2MLGA 5DD4A 3BP8A 1XGNA 4FX0A 2F2EA 2L01A 3RDIA 1ZYRF 2DW4A 1HKSA 2KIFA 2XAGA 5J6XA 3F23A 4YIFA 3JSOA 4WCGA 1MJBA 4R8HA 4JBAA 4L9TA 3E6DA 2HOEA 3GLXA 1TTYA 2Y75A 3ZP5A 1SFUA 1XSDA 1ZLJA 1ZRFA 1R1VA 2EA2A 3ZMUA 2EFPA 3W6KB 2IA1A 2YR2A 4DQ2A 2FRHA 1FNNA 4EGYA 2ACJA 3KP5A 2DK5A 2FE3A 1QBJA 5D6FA 4M74A 4AH6A 1LDDA 4RAYA 1FYLA 4N9IA 4HA8A 2VOPA 4GO1A 4CXFA 4ESBA 2V79A 5IT9K 3WU1B 4ZZLA 3CUOA 3RPQA 1K6OA 2LF7A 5HOOA 1R23A 3Q5FA 2OD5A 3FHZA 3KP6A 1ULYA 3KLNA 4I7HA 1MZBA 3I59A 2STWA 3D5LA 1ZH5A 2H94A 2HZTA 4P55A 3VB2A 3TO7A 2D6FC 1U6GA 2EV6A 4G6QA 5L3FA 3CO6C 5AONA 5LGTA 3TDUC 2PLYA 3LAPA 2MBFA 4Z2YA 3BPXA 1F5TA 4B8XA 1UHWA 2FF4A 1BI2A 2E7WA 4EMSA 4UUVA 3F21A 2H6CA 3GFMA 1QQIA 4EM1A 1AWCA 2V6CA 4MGRA 3KP7A 4RB3C 3F6OA 5HVQC 3F22A 2DI3A 2G7UA 3RTRA 4D0PA 4ZH4F 2V1UA 4Q48A 3RIRA 2DQRA 3FM3A 3WODF 3HIFA 1WI9A 4UXNA 4WK8F 2Q2EA 1XCBA 4QLCU 1FPQA 5JFRA 2QVOA 2HR3A 3HSFA 1MDMB 4M9ZA 1FC3A 1KU2A 1IN4A 1UFMA 3SZTA 2HQNA 4LK1F 5D5UB 2XRNA 2ZBKA 2A5YB 1P92A 1HQCA 3Q9SA 3FWEA 3TDZC 3FX3A 4PCQA 2M45A 3C1DA 2F5FA 2LDUA 3LQQA 4KMFA 2IW5A 1YW9A 3BJAA 5DEQA 1H9TA 4LLLA 3QPTA 1SD7A 1ODDA 3PQJA 4A2UA 5LEKA 2VODA 2ESHA 2FQ3A 3JAMZ 1K7AA 4RS8A 2B0LA 1I6XA 2MH9A 1IUYA 2TDXA 4G7ZF 4ENKA 3L09A 4BHBA 4OIOF 1TLHB 2QWWA 4OU0A 3EDPA 5D4SA 5E1WA 1VTNC 5D8KB 3T1BA 2HKOA 3GW2A 3K1MA 2DK8A 1H0MA 4YIIA 1G6NA 5E8IA 1I1GA 3HOTA 2FNAA 3KLOA 1BN5A 5CVVA 4EQQA 4I09A 1O3RA 3TO9A 2O8XA 4YFXF 4HAMA 1XCVA 1Z05A 5HLIA 5F64A 2AXLA 2ZMEB 4XSXF 1W7PA 2XAFA 3RKYA 1XSVA 3DFGA 2RN7A 4E70A 1OYIA 1KU9A 2W25A 2H27A 4G9YA 1IXCA 3E6CC 2COMA 2R7DA 2QLZA 3FMQA 1JGSA 4HX7A 2Z33A 2RGVA 1HXDA 1KYZA 2W24A 1ZRDA 4ZYDA 3DF8A 4CGZA 2E1NA 1IW7F 4OIRF 1WWXA 4XLNF 1KQ8A 1LDJA 4UVAA 1TQMA 1UB9A 5LRSA 4L9JA 1YW7A 3N97A 5L3GA 3R61A 1Z1DA 4YFNF 3WG9A 3N4MA 3FZVA 3SFZA 3E5UA 2HS5A 1G3WA 1IN7A 3KFWX 3BJOA 2CFXA 4U7DA 4WWCA 1OKRA 3EYYA 4HZFA 1R58A 2DTRA 2P6TA 3V4GA 2FBIA 2NYXA 1FP2A 5J8FA 3QP5A 1S7AA 1W5SA 2O03A 4ON0A 1BI3A 4WJ4A 3WTYC 4HF0A 3TO6A 1FLIA 3FXQA 3C7JA 3K1PA 4I01A 3QU6A 1J0RA 1FT9A 1H9GA 1FBQA 3OOPA 4MEYF 3I58A 2LKPA 1TNSA 1HW2A 3F6VA 1FY7A 5FD6A 1DPRA 1XDUA 1GHCA 1WSUA 2VT3A 3CUQA 2MLKA 4BHPA 4NB5A 3I71A 5ILSA 2MH2A 2QQBA 2WV0A 2IT0A 4L0ZB 4RGRA 4KA4A 3W6JB 5K5QA 3CO7C 4U88A 4IF4A 3HHHA 4UVBA 3VODA 5DUKA 5FD5A 3LQRA 1STZA 2K7LA 3CUQB 1WRJA 4KYWA 2IPQX 2KIUA 3P7NA 3F72A 1RUOA 1FX7A 3NRVA 3WE2A 2VE8A 1XN7A 2PFBA 4UHTA 4BQAA 2UZKA 1PDNC 3LWFA 1D5VA 3KP3A 3LA2A 1EH7A 4RB0A 4LG0B 4JQFA 2EFWA 3MAJA 2STTA 1TBXA 4LD5A 2DO7A 1P4AA 1ZLKA 3RI4A 4AVPA 5LGUA 5HLHA 4ETSA 1ZAOA 2X4HA 2GA2A 1MJAA 3GZ5A 3MWMA 2Y0MA 3MCZA 2W57A 2BE5F 4ASNA 2L4MA 2KKOA 2P5LC 3ZPLA 2OBPA 5A2QZ 4LG0A 3WGGA 2IRFG 5KVRA 1REPC 1ON2A 2XHKA 3K0LA 2A07F 1FSHA 3J80K 4K2EA 3REOA 2ISZA 3MQ0A 2PJPA 1FSEA 4XRFA 3OV8A 3RYPA 3GVAA 1QZYA 3JAMK 1QGPA 5LGNA 1LNWA 2VC1A 1L3LA 5KK1A 2MA3A 3GFIA 5E18F 3IWFA 1HSJA 2KIMA 2PQ8A 1YW8A 4HLYA 2DLLA 3P9CA 1I5ZA 1TQPA 3EQLF 5E1XA 3P9KA 1SD6A 3WTXC 1G51A 4ZYHA 4KDPA 3I54A 5DD8A 1S7OA 2JPCA 2IVMA 3T8RA 3TQNA 2PN6A 1C0WA 1F1ZA 1P4WA 3Q9VA 1O7FA 1YLFA 4GYIA 2QZ8A 4RGUA 2VC0A 3I64A 3ROUA 4WXCA 4A6EA 3G3ZA 2Y48A 2DPDA 1J75A 1IL2A 1SD5A 2ZMEA 4S05A 5JR3A 1BJAA 4HOBA 3DPLC 4MEXF 3HOSA 5TJJA 1IAWA 5JVTA 2ZNZA 4EM2A 1ON1A 1ZHFA 1J5YA 3HSRA 2BBYA 2A6HF 3WTZA 5FLXK 3M7GA 4EJWA 4HYEA 2HYFA 3E6MA 5ILUA 5JI6A 2XROA 4N0BA 3E5QA 4EJTA 4P5OA 4OMYA 1YQAA 4I98B 2E7XA 2QYOA 4A0YA 1IN8A 3QP6A 1U5TC 4I0BA 1S3JA 3KZYA 1MDMA 1SD4A 5HS7A 1J59A 4XLPF 4CZZA 1YYVA 4GGGA 2HGCA 2E1CA 4UV8A 3F3XA 2X0LA 4O6JA 5L3CA 3BZ6A 3GO5A 1LDKB 2RDPA 2EFOA 3MZYA 1T2KA 2XASA 4DNCA 2VONA 3ZMVA 1SFXA 4M6YA 4LB6B 5DUIA 3LA7A 1SFEA 4AD9A 1V3FA 2C6YA 3C3WA 2JT1A 3GXOA 1QZZA 2ISYA 1B6AA 5D4RA 1R36A 4HX4A 1W5TA 2CYYA 2XGXA 3CDHA 3CLOA 2O61A 2O6GE 3U2RA 2Q8KA 3LA3A 4G8XA 3RKWA 3WGHA 3EETA 3KP4A 1U8RA 3RKXA 1IZ1A 2IJLA 4KNYA 1K78A 1I27A 2P5KA 2BGCA 3QAHA 5J8CA 3ABUA 1KA8A 1R7JA 1HKQA 2JRTA 3V8JA 2WC2A 4U7BA 4I0AA 3ZQ7A 5BPIA 2K4JA 1R5HA 1BC7C 5BQTA 4WJ3M 4GXOA 1TW3A 4LGWA 5E20A 4RGSA 1K79A 3EYIA 1J7KA 3EUHA 3K69A 1B59A 3HTSB 2GWRA 3RPUA 3R6SA 2EV5A 1JE8A 1WKMA 3SQNA 1C0AA 2OQRA 4MTEA 2ZCWA 3TOBA 4MQVA 1ZARA 2K02A 2PBIA 3DP7A 3VFZA 4L5JA 2EFQA 3WTVC 1EH6A 3E6BA 1PP7U 2P7VB 2R7FA 4HDUA 1EFWA 1ONVA 2NAZA 3L00A 3F8NA 2QENA 1LVAA 2XAHA 2DQLA 4P96A 4MNUA 3WU0A 1G3SA 5K1YA 1BI1A 5L3BA 3JW4A 1BM9A 5FFZA 4GCVA 2VXZA 2PG4A 3AAFA 2EWNA 1CGPA 2F5DA 5L3DA 1ZGJA 3V7CA 1S29A 4OIPF 3K2ZA 4WXDA 1FWZA 1Q1HA 1IRGA 1HKTA 4IPAA 5D5XB 3U1DA 1LEBA 4EV0A 2EFNA 4HV6A 1T38A 3ISPA 4KIBA 1P6RA 2HWVA 1I1SA 3ELKA 3ZMDA 4ENJA 4O5VA 4EJVA 2DPUA 4I02A 3O6BB 1IN6A 3BPVA 4PZJA 3KP2A 1FP1D 2FBHA 5E1ZB 1CF7A 5TRDA 2FNPA 1IXSB 1G3YA 4KN4X 3FMRA 4HDVA 2IA2A 2VN2A 2H6BA 3WTUC 5IT3A 2A69F 2NNYA 3E97A 4IRGA 2ZO4A 5E17F 1HW5A 3R0JA 2EB7A 1A04A 1ZGAA 2FOKA 3MEXA 1RIOH 3R0AA 4OIQF 3RJPA 1YO5C 5FGMA 5DCFA 3GFLA 4CHUA 1PP8F 2GIVA 4M6XA 3S2WA 5D5VB 1YG2A 5CVIA 4L5IA 1TQIA 2DBBA 2W85A 1BBYA 2IP2A 5HLGA 4IJAA 2PEXA 1KYWA 3L2CA 2XUBA 3CUQC 5LHGA 3M1EA 4BNCA 3I0TA 2HDCA 3VOEA 3FXRA 3R60A 3F8BA 1OPCA 4P9FA 2GXGA 3ZN0A 4KFCA 2UXNA 6PAXA 2YX4A 2V1DA 1OYYA 4MQ9F 2MD5A 5LHIA 4UV9A 4KIGA 2PI0A 3DV8A 3J81Z 2VBYA 4FX4A 1R22A 5CVUA 4A0XA 2FBKA 5F6FA 5ICFA 4KIFA 4Y15A 3DXJF 3DQVC 2F5CA 1USTA 2M8EA 4IHTA 1DP7P 2JZYA 1Y0UA 1GXQA 4YFKF 3GWZA 1EH8A 4G94A 4AWXB 3GX4X 2LF8A 3GZ6A 3RYRA 2M5WA 1O7LA 4EGZA 2PMHA 2Q0OA 2JTVA 1XB4A 1E17A 4B09A 3IRRA 3V8KA 1ZG1A 3PFIA 2KJBA 1HW1A 2P6SA 2LNBA 5K5RA 4AIHA 5AIQA 3IWZA 3WGIA 1DUXC 3LFKA 3SXYA 3FM5A 1DPUA 1F4KA 1U5TB 3T8TA 4GYGA 3KE2A 1B1BA 3LSTA 3K9TA 5HS8A 1GXPA 2J5PA 4AIJA 1KU7A 1JHHA 3HHGA 2K27A 1T39A 2UWMA 4F7ZA 2Z3YA 4IRHA 2K86A 1IF1A 1ZQ1C 4UVCA 4YG2F 3HUGA 1MKMA 1ZG3A 1FBSA 4BAYA 2HYGD 3FF5A 1O3SA 4A6DA 4RGXA 2JSCA 2RQPA 3TOAA 4WXHA 4ZYGA 3MZHA 1JHFA 1KQ9A 4M72A 5EEGA 4EVIA 3F8MA 2RC4A 5L3EA 4LMYA 2EJRA 1P2FA 1QPMA 2ZFWA 4CYDA 1F9NA 1Z6RA 4WF2A 3JTGA 1QNTA 5EEHA 4LLGF 3QPHA 4BH9A 1G3TA 4KN7X 1ZRCA 4M73A 3IC7A 1DDNA 2H09A 5DCMB 4A5MA 1FYKA 3BDDA 2FMLA 2OAZA 2W84A 3J81K 4M71A 4WX9A 4M9SA 1UCRA 1EQRA 4O3MA 5ED4A 1B9MA 2F5EA 2NRAC 1W4MA 3DKWA 4HBLA 4IVNA 4CDGA 4LLNA 3HRUA 3QU3A 4H0EA 2FXAA 3R4KA 4CICA 2FEZA 3PQKA 1IXRC 2FSWA 3F8CA 4G7OF 2D2WA 1SMTA 1D8JA 1WQ2A 2GXBA 3ULQB 5BMZA 2RVCA 3M9AA 5IT9Z 1B4AA 2V9VA 3D0SA 3HYIA 4KUMA 3FMSA 5CYVA 2ZKZA 3IRQA 2L02A 5DYMA 2K4BA 4RMFA 3NQOA 1S8NA 2DT5A 4ENNA 4ZYEA 2DFIA 3B02A 3IKVA 2CWEA 4KT5C 4R1HA 1R00A 3J80Z 2G9WA 1U2WA 3DPTA 2EA4A 1YS6A 5AIPA 2HTJA 3J7AO 3HSEA 5LEJA 1U3EM 2VE9A 4LK0F 1E2XA 5LHHA 4Q5SF 3HTUA 3HRTA 1J2XA 1V4RA 4PGHA 3MFKA 1R1UA 2P7CB 2LSOA 3GFJA 4S04A 4A12A 2CSOA 1P4XA 3IKTA 5LLQA 3GYHX 5FB2A 1BI0A 3O3KA 1KU3A 1SAXA 2CO5A 1D8KA 1XGMA 5HDNA 2D45A 3E5XA 1KQ0A 5LRRA 2ELHA 2MC3A 2GA1A 5ICCA 2DAOA 2R3SA 1BIBA 2XV4S 5ICEA 2HFHA 2A61A 1KGSA 4U0VA 3ABTA 2P4WA 1LEAA 4EJUA 2ADUA 1GVJA 3IHUA 3ECOA 3VEPA 1NHAA 1UHMA 4XSZF 4ENMA 3IL2A 3JSPA 2BEOA 4HF2A 2OU2A 5DV5A 4RB1A 3H3ZA 4O2DA 1XMAA 5K5OA 2J5OA 3SHFA 4OMZA 2JPBA 4ESFA 5D8LB 2QUFA 2QBYB 2YX7A 4UNOA 3HRMA 1FZPB 1ZN2A 2QM3A 2HTSA 3K1NA 4A0ZA 1YS7A 1R5GA 2PMUA 1IN5A 4HW0A 1XGOA 3M8FA 2YSRA 2VBXA 4Y17A 3O2PE 4Q47A 4R79A 3SZPA 5E8GA 1MD0A 2XKPA 4N9HA 2HKXA 2VT2A 2FA5A 4AIKA 3F8FA 4EJOA 3KCCA 1EV7A 1LB2A 3GF2A 3I4PA 2FMYA 2RNJA 1QO0D 2ETHA 5HS9A 5H6RA 4HLXA 2Z9OA 1RUNA 1AOYA 3P9IA 2RKHA 1T0FA 4FHTA 1G4DA 1SMYF 3DEUA 2YPRA 1LJ9A 4RAZA 1FYMA 3L9FA 4BHCA 1W7PD 4TV7A 4L0YB 1XGSA 2G7HA 2HEOA 3BOQA 3QOPA 1O3TA 3ZMZA 2L4AA 4HX8A 2XIGA 4XBFA 2CW0F 4IXAA 3CJNA 3H3UA 4OINF 2XVCA 1MJ9A 5HDGA 3TKYA 3HRSA 1K78B 1RI7A 1J9IA 1BIAA 4I2OA 3BJ6A 2ESNA 3T0YA 1OYWA 3B73A 1XD7A 5CLSA 2KJCA 4A5NA 5A2QK 1BOAA 2M30A 1D3YA 5FLXZ 1X3UA 2M87A 3G73A 5ICGA 2NNNA 4RB2C 3ML6A 3ZN1A 5D6EA 2QQ9A 3FXUA 1O57A 1FBUA 1U78A 1YTYA 3ZMSA 4L9VA 2ZJ2A 3M8EA 3TGNA 4IRIA 3ZMTA 5H20A 3I59B 2V1XA 5HDKA 2O0YA 2BV6A 4BYYA 3KZZA 3V8LA 4KMUX 3V7RA 2OZ6A 2AS5F 2FU4A 4HV5A 2XAJA 1XSXA 1RNLA 2RV8A 2CG4A 4PDKA 5LBQA 3KEQA 3U9GA 1HSTA 2OA4A 1T98A 2XKOA 4L9NA 2EV0A 1U5TA 1OR7A 1USSA 1XDSA 3L7WA 5F1RA 1LQ1A 2EK5A 1Z7UA 1TNTA 3CTAA 4LB5A 5CVJA 2A6EF 2A3SA 3KETA 3T5XA 5CJ9A 4OOIA 2HQRA 1FOKA 3WTSC 2CQKA 1R1TA 4U0WA 3GEZA 2ZNYA 1TW2A 1BC8C 2GZWA 4CO8A 2VBZA 1L0OC 5H6QA 5JHUA 3BY6A 2QQAA 3QRFF 3NEUA