2P8TA

Hypothetical protein ph0730 from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
184
Chain Sequence
b'EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0730
publication title Hypothetical protein PH0730 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 61
structure length 184
sequence length 186
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14544 DUF4443 Domain of unknown function (DUF4443)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p8tA01
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 2p8tA02
1HXDA 2EV5A 2PN6A 4ESFA 3DP7A 3C7JA 4L0ZB 4HA8A 1OYIA 2FNPA 3K1PA 1I1GA 2HTJA 4L9NA 1L3LA 1T0FA 1XGMA 2A5YB 4UXNA 3GO5A 1U5TC 4KIBA 2Y48A 2NYXA 5L3DA 2VONA 3C18A 3RKYA 3K1MA 1R23A 3ULQB 1R36A 2KIUA 4M73A 2BYVE 2MH9A 2QYOA 1I1SA 1XDSA 2EK5A 4P9UA 4I0AA 2XKOA 2ZBKA 2VBWA 4YFNF 4QLCU 2PI0A 1OPCA 2LKPA 3KLOA 1R1UA 4FHTA 4MEYF 3GXOA 4CXFA 2X4HA 5D5VB 3L9FA 1QO0D 2PG4A 1O3QA 4WJ3M 3CO7C 1ZGAA 1FBSA 2IJLA 2P7VB 3K9TA 5FGMA 2D2WA 2RKHA 2VE9A 4N9IA 3DV8A 4AIHA 5ICFA 2NS0A 5LHGA 4WXCA 3I54A 4WXDA 4UV8A 1TQIA 3R60A 3VODA 4ENMA 1E2XA 1J5YA 1RZ4A 2W24A 4WXHA 2J5OA 2CWEA 3B02A 2LDUA 4IXAA 1TQPA 2P7CB 2IRFG 3SQNA 4M71A 4HF2A 3QU3A 3ZMDA 2NRAC 2IP2A 3MCZA 4A12A 1A04A 1YTYA 2M8EA 2P8TA 3BJ6A 3FWEA 3V4GA 2FEZA 3E5XA 1JHFA 4M9SA 2DQRA 1H9GA 3GZ5A 4L5JA 1RNLA 3PQKA 5HDGA 5E18F 1IN5A 4G8XA 5ICEA 3T8RA 2QM3A 1XN7A 1QNTA 3MZHA 1QPMA 2KIFA 2R7FA 3R0AA 2DBBA 3VOEA 5D8LB 4TV7A 2O3FA 2VBXA 5L3CA 1KQ9A 1ZG1A 4LLNA 2QVOA 1P4AA 4LMYA 4ZYGA 3MEXA 3VFZA 1D3YA 2K27A 4KFCA 1WKMA 1SFEA 2KKOA 4OIQF 1U2WA 2K4BA 3ECHA 4OIOF 1ZG3A 5J8CA 1LDJA 4FX0A 1JGSA 5H20A 3K2ZA 1O3SA 2X0LA 3IWFA 5K1YA 5D6FA 4WF2A 1TQMA 2L54A 2K86A 3KZYA 4ESJA 1SD5A 2JT1A 2JPCA 4GCVA 2FBHA 3F6VA 4AIKA 2UXNA 2O0YA 1HKTA 2QUFA 2E7XA 3P7NA 3JAMK 3V8KA 2KRFA 1USTA 4EQQA 5H6RA 3RYRA 3W6JB 2FA5A 5BPDA 3FM3A 1G3YA 1PUEE 1YW9A 1R00A 2OZUA 5HLHA 3SZPA 1REPC 3HRSA 1FWZA 2EA2A 2HDCA 2DFIA 1KU2A 1MJBA 4G9YA 5FLXZ 3CUQA 2J5PA 2XUBA 3SXYA 1G6NA 2DPUA 3E3VA 2L3DA 3N97A 4IRHA 1WQ2A 1P2FA 3HHGA 3BPXA 3O2PE 2PFBA 3LWFA 1P6RA 1QBJA 4NB5A 2PQ8A 4D0PA 3KZZA 5L3GA 5LLQA 3WTWC 2CO5A 2CQKA 4K2EA 2V1DA 5HS7A 1KGSA 1K79A 4OIRF 5J8FA 4F7ZA 2OU2A 1TNTA 2IA1A 4ZZDA 2OA4A 1ON2A 4LLGF 2PMHA 3ZMZA 1OMIA 3I64A 2E7WA 3BJAA 2GXBA 1Z7UA 2QLZA 4G94A 2Z33A 1BJAA 1XDUA 2FBIA 2XGXA 4L9JA 1EFWA 2OD5A 3ZMUA 4U7DA 3J81Z 2BV6A 1JXSA 3MWMA 2V1UA 1KQ8A 3RDIA 2JSCA 3BZ6A 2ACJA 2K02A 1CGPA 1W7PD 3GFMA 1Z6RA 2LNBA 2IA0A 1U78A 4IRGA 5F1RA 1FT9A 2MLGA 4ON0A 5HDNA 3GVAA 3KLNA 2Q8KA 5DDGA 1SMYF 1IXRC 3TO9A 1J9IA 4A6DA 3E6CC 3U9GA 3GFIA 3HRMA 4KMFA 3Q9SA 2A61A 5D4RA 3FM5A 4O5VA 3DF8A 2HQRA 4KYWA 1RUOA 4DNCA 1G51A 3QU6A 3EQLF 2G7HA 1GXQA 4S04A 4U0YA 3CTAA 1HKQA 1LEAA 3F72A 2GZWA 4GGGA 5H6QA 3ISPA 4OOIA 1ZHFA 3JSPA 1Z1DA 4MHGA 3FHZA 2DO7A 1BC8C 4OIPF 2EV6A 2O6GE 5E8GA 4E70A 1B6AA 3KP4A 1MDMA 1HSTA 2F5EA 1PP8F 5D5UB 4I2OA 4LK1F 2DPDA 5E20A 1IN4A 3OOPA 4AWXB 1ULYA 4Y17A 3BWGA 2G7UA 4GYIA 2XROA 4EMSA 3I59B 1R58A 5BPIA 3P9CA 4EM2A 1I6XA 1UHWA 4ENNA 1B1BA 5FO5A 2EWNA 3K1NA 2M30A 1J0RA 3RKWA 2Q0OA 3F23A 4UVBA 1MZBA 1DDNA 1HBXG 3HUGA 4RB1A 3GZ6A 1OR7A 4XLNF 2JTVA 2GXGA 1HSJA 5HLIA 4BNCA 2W85A 5EEHA 2DLLA 2NNNA 5HS9A 2EA4A 5K5QA 2ZNYA 5HLGA 4RGUA 1IN7A 1DP7P 3GX4X 3GWZA 3BY6A 4CHUA 2DTRA 4CYDA 2H94A 1W4MA 5HS8A 5HOOA 5D5XB 2TDXA 1U6GA 1SD4A 1ZN2A 2JPBA 1FLIA 4PCQA 1R5GA 3HOTA 1UCRA 3E5QA 4LJZF 2ZO4A 1IZ1A 4UHTA 1ZRFA 1R7JA 3GYHX 1YW7A 3ECOA 1OYWA 5ILUA 5A2QZ 1KYZA 2CG4A 3WE3A 1E17A 4ZZLA 3J80Z 2EFQA 1B4AA 4EJVA 3S2WA 2HEOA 2YSRA 1BI1A 1XSDA 4MEXF 2M5WA 2B0LA 4I0BA 1MD0A 3CUQB 2NNYA 1G3WA 2L01A 3L00A 1ONVA 3I4PA 4IPAA 1I5ZA 5CVJA 1USSA 4M72A 3CUOA 2HOEA 2RGVA 5E17F 3NQOA 4M6YA 2PJPA 3ZN0A 1J7KA 4GXOA 2HTSA 1IL2A 2HQNA 3P9KA 2E1CA 4MQVA 1T39A 3TGNA 5DV5A 3O6BB 1S7AA 2JRTA 5ICCA 3KP7A 3ROUA 4HZFA 4RS8A 2FBKA 3TO6A 4Y15A 1XB4A 2IW5A 2VE8A 3WTUC 3K0LA 2WV0A 3LFKA 1SFXA 4AVPA 4I01A 1RIOH 3F8FA 1XD7A 3RJPA 3RKXA 2GIVA 3H92A 1P4XA 2MH2A 4YIIA 4Q4ZF 3KP2A 4L9VA 3KFWX 4KMUX 4HLYA 2ZXJA 3T5XA 4HBLA 1C0WA 5F6FA 4JBAA 1RUNA 1ZQ1C 1B59A 3R0JA 3R4KA 1BI2A 1MGTA 3L7WA 4BH9A 1FP2A 2ADUA 3HYIA 2EB7A 2Z9OA 1ODDA 2A6HF 4A5NA 4IF4A 4CO8A 4U0WA 1ZYRF 2CGPA 1ZLJA 4EV0A 3BDDA 3M7GA 3JTHA 2XAFA 5FB2A 2YX7A 1BI3A 3RI4A 4IVNA 3F8BA 2DW4A 3F8NA 3EYIA 2RNJA 5AIQA 1EH7A 2H6BA 4L9TA 4ASNA 1FYKA 2CFXA 5E1ZB 2QQAA 2IT0A 3ML6A 4LG0B 3TKYA 4CICA 2DT5A 4R79A 3I59A 3M1EA 1ZH5A 2O03A 4KIFA 5JVTA 3IL2A 3DKWA 2MLKA 2EFNA 3WTXC 3WODF 4RAZA 5CVIA 1MDMB 3E6DA 5DD8A 2HGCA 2GAUA 3WU0A 2F5CA 1VTNC 1KA8A 2F5FA 4CGZA 4JQFA 1ZRDA 2O61A 3RPQA 3HTUA 4BHBA 3AAFA 1O3RA 1FYLA 5LGNA 4QWQA 1FC3A 4HQEA 1T2KA 2VT2A 3BROA 2VBZA 1MKMA 4KUMA 2D45A 4LB6B 5L3BA 2A69F 2Z3YA 1YFHA 3TOAA 3DQVC 3KETA 1KU9A 3RPUA 1ZGJA 3F3XA 2Y75A 5K5OA 1U5TB 2FE3A 1TTYA 1O3TA 5E1XA 3FMRA 5AONA 1LJ9A 5FLXK 1ZARA 3ZMVA 3IWZA 2FMYA 1TNSA 5HVQC 3H3ZA 5EEGA 2XAQA 1IN8A 3ELKA 1LDKB 4CZZA 2D6FC 3LQRA 1YLFA 3ZMSA 2DU9A 4EJTA 4HF1A 1KYWA 4R8HA 4G6DA 3IRQA 4I7HA 3TQNA 4RGXA 2AS5F 4PGGA 3SHFA 2ZMEB 2YR2A 3MFKA 2ESNA 5D8KB 2W25A 1K78B 4BXUA 3GW2A 3H3UA 3MQ0A 1T6SA 3ABUA 2YU3A 3PQJA 4OINF 3EETA 5ICGA 2EFWA 2XAJA 3SFZA 1SD7A 2ETHA 4M74A 4XRFA 1QZYA 4N9HA 3KP3A 2BBYA 4KNYA 2RV8A 3NRVA 3R61A 4PDKA 2OQRA 3KCCA 4NQWA 4XLPF 2JZYA 3J81K 1G4DA 3GEZA 3E6MA 4U7BA 2BEOA 3WG9A 2Z99A 3F22A 4O6JA 3TDUC 3M9AA 1FNNA 2M1BA 3QPHA 4IHSA 4HX7A 2OBPA 5K5RA 1T38A 2FRHA 2K7LA 3G73A 2P4WA 3R6SA 3I5UA 2ZJ2A 3V8LA 2COMA 2FOKA 2XV4S 2MA3A 3CJNA 4ESBA 1PP7U 1DPRA 3WTSC 1L0OC 2A68F 3LAPA 1P92A 1YG2A 1J59A 4L18B 2ESHA 4BAYA 2XKPA 4OU0A 6PAXA 3HSFA 2D1HA 1Q1HA 1TW2A 3M8EA 4G7ZF 1F1ZA 3FXQA 2YX4A 3QP6A 2GQQA 3DFGA 1W5SA 3E5UA 2QBYB 2EV0A 1B9NA 2QQ9A 2VT3A 1Y0UA 5D4SA 5LRSA 4RB3C 3TDZC 4I98B 1HKSA 1V4RA 3N4MA 5DCFA 1PDNC 1JE8A 2QENA 5ILVA 1ZLKA 1FBQA 3M8FA 1P4WA 4ZYHA 4LG0A 1XMAA 1F9NA 4NHJA 4PZJA 2FQ3A 3ABTA 2UZKA 4OMZA 1ZRCA 1IXCA 1IW7F 1Z91A 2ZCWA 1KU7A 5IT9Z 1S6LA 3CDHA 3BJOA 2HS5A 3V7CA 2EFOA 4HAMA 4LLLA 3P9IA 4AD9A 1EQRA 4XSZF 4A0XA 2VOPA 5J6XA 3CO6C 1KQ0A 5D6EA 4HV6A 3WTYC 5JFRA 5F64A 3FXUA 5CJ9A 4IRIA 5CYVA 4BHPA 3T0YA 4N0BA 3C3WA 3V7RA 5E8IA 3WTZA 4A0YA 2GWRA 4A2UA 4MTEA 4P9FA 1D8JA 4OMYA 3GLXA 5BOXA 1UHMA 3HSEA 1U5TA 5TJJA 1ON1A 3RTRA 1FBUA 5FD5A 3W6KB 2XVCA 4LK0F 4R1HA 1FX7A 1XCVA 2R3SA 4ZYEA 4WCGA 1MJ9A 4ENJA 5LGTA 1IRGA 4KT5C 4Q5SF 2QWWA 1EV7A 1ZREA 4YFXF 1FP1D 1S29A 3E97A 1W5TA 1V3FA 4KIGA 2CSOA 1BC7C 5A2QK 2ZMEA 4I02A 1R22A 3J80K 1K78A 2HYGD 3MZYA 3JW4A 4P96A 4ZH4F 2UWMA 1XGNA 5LHHA 1LVAA 1Z9CA 1BBYA 2XRNA 1Z6TA 1NHAA 4EM0B 1YQAA 3RIRA 1YIOA 3HOSA 4LD5A 3JSOA 3ZP5A 3I0TA 2FXAA 5IT3A 4O2DA 2P5LC 2ZNZA 5CVRA 2GA1A 1BI0A 1LNWA 2UXXA 1G3TA 3FXRA 1ZG5A 1CF7A 2E1NA 4LFUA 1L0WA 1QZZA 1R1VA 1FOKA 3QRFF 2OAZA 2WC2A 4M6XA 4EVIA 1STZA 3KP6A 2RVCA 2EJRA 2M45A 4EM1A 1H0MA 3QP5A 3REOA 2FU4A 2F2EA 4B8XA 4AH6A 4G7OF 1G3SA 5DUKA 1FPQA 4BYYA 3DXJF 1LDDA 2A3SA 2NAZA 1J75A 3DEUA 1H9TA 2BE5F 4P5OA 3L09A 3CLOA 2PMUA 2QZ8A 4BQAA 4HV5A 4H0EA 4EJWA 4HDUA 4I09A 4YIFA 2HKXA 2XASA 2WWYA 4KICA 5DCMB 1K6OA 5BQTA 2QBYA 3LQQA 2XAGA 1EH6A 4EGZA 3WU1B 4WX9A 4Q48A 3F8CA 1DUXC 4YG2F 3IHUA 1D8KA 3ZN1A 2GA2A 1AWCA 5LBQA 4XBFA 4MNUA 1J2XA 1TLHB 2DQLA 3OV8A 3BOQA 2STTA 5DEQA 2HWVA 2ISZA 3D0SA 2Y0MA 2BGCA 4HW0A 3F6OA 5JR3A 1IUYA 3LA7A 5L3FA 1FSHA 4A0ZA 3KEOA 4Q47A 3EUHA 4HOBA 1W7PB 4KN4X 4G7HF 3V7SA 4UVAA 5KVRA 2OZ6A 1OYYA 1AOYA 3QOPA 2V9VA 1GXPA 1XGOA 4MGRA 1LQ1A 1ZAOA 5D5WB 5DD4A 3TO7A 1OKRA 5FD6A 4Y13A 3IKTA 4S05A 2VOOA 3QPTA 4KA4A 1HW1A 4HLXA 5KK1A 1WRJA 3HRTA 3D5LA 1Z05A 2W84A 2STWA 2V6CA 3JTGA 3HRUA 2IVMA 2VN2A 5LEJA 3Q5FA 3DPTA 1YS6A 2W57A 4DQ2A 4HX8A 5CVVA 4EJUA 5LEKA 4HDVA 1SD6A 2KJCA 5LGUA 2DAOA 1O7LA 2HYFA 2MC3A 3FF5A 3LA3A 3IC7A 4L5IA 2WTEA 2P6SA 3U1DA 1R1TA 1X3UA 2H6CA 3LAJA 2EFPA 1R5HA 2RC4A 3WTVC 3NEUA 2QQBA 4LB5A 5DUIA 1UFMA 1D5VA 4P55A 1F5TA 1BOAA 1MJAA 5CLSA 3WGIA 2O8XA 4GO1A 4PGHA 1XGSA 2L4MA 2VODA 1XMKA 5JI6A 3C1DA 3K69A 3L2CA 1FSEA 2XAHA 3FMSA 2Q2EA 4Z2YA 2P5KA 2R7DA 2HKOA 2YPRA 2DI3A 2ELHA 3HSRA 3E6BA 2XHKA 1DPUA 5FFXA 4FT8A 2KIMA 4HQMA 1GHCA 2IA2A 4UUVA 4RGRA 4O3MA 1IF1A 3JAMZ 4HX4A 4UNOA 2LSOA 2L02A 2OQGA 5E1WA 3Q9VA 2DK8A 1LEBA 3V8JA 2VC0A 1FZPB 1EH8A 4LGWA 1S8NA 4IHTA 2C6YA 4RB0A 3F21A 3WGGA 1YW8A 2A07F 4MTDA 4L0YB 1BM9A 2AXLA 3ZQ7A 3WTTC 4UVCA 2H27A 4RB2C 2A6EF 2RQPA 2FNAA 1RI7A 2VC1A 2HR3A 1CF7B 5ERIA 3EDPA 2FMLA 2P5VA 4EGYA 4RAYA 4WWCA 1YO5C 2Z5UA 2H09A 3ERED 4YFKF 4G6QA 1U3EM 2MBFA 1XSXA 3IKVA 4WJ4A 5DCMA 2P6TA 2VBYA 2FF4A 5AIPA 3J7AO 3I58A 1TW3A 1KU3A 4KN7X 2ZFWA 4KDPA 3CUQC 2L4AA 4A5MA 4HYEA 3LSTA 1HQCA 3WGHA 3EYYA 3GF2A 3GFLA 1IAWA 3O3KA 4U0VA 4MQ9F 2V1XA 1HW5A 1FY7A 1IXSB 2VXZA 3MAJA 3PFIA 4EJOA 1IN6A 3I53A 5BS6A 5JHUA 2ISYA 4HF0A 1BN5A 3GUDA 1W7PA 5L3EA 4JK1X 1U8RA 4ZYDA 4IJAA 3HTSB 2V79A 1O57A 1QQIA 1QGPA 2MD5A 3I71A 3IRRA 2CW0F 3HHHA 1SMTA 2FSWA 3BP8A 1LB2A 3FZVA 3QAHA 5HDKA 5IT9K 2F5DA 5BMZA 2RDPA 4XSXF 4RGSA 3HIFA 1BIAA 1GVJA 5TRDA 2PBIA 2HFHA 4AIJA 3GFJA 2PLYA 3BPVA 3T1BA 3U2RA 1IRFA 1XSVA 2ZKZA 4RMFA 3WE2A 3ZMTA 5DYMA 1F4KA 4M9XA 1FYMA 1WWXA 4BHCA 3TOBA 1UB9A 1YS7A 2HZTA 5LRRA 4CDGA 1B9MA 3VB2A 3FMQA 5ILSA 3DPLC 2LF8A 2G9WA 1O7FA 2D1VA 1K7AA 2DK5A 2PEXA 4GYGA 3LA2A 1I27A 1S3JA 3F8MA 2KJBA 5FFZA 4U88A 3B73A 4B09A 3T8TA 2RN7A 4FX4A 1YYVA 1WI9A 1S7OA 4ENKA 3FX3A 1TBXA 1C0AA 3ZPLA 2XIGA 2CYYA 4A6EA 5ED4A 3RYPA 3SZTA 2M87A 4ETSA 3COAC 4M9ZA 4WK8F 3KEQA 5CVUA 3KE2A 1XCBA 1SFUA 2LF7A 1JHHA 3KP5A 4UV9A 2IPQX 1HW2A 3G3ZA 1BIBA 1T98A 1SAXA 5LHIA 1WSUA 3VEPA 2K4JA
chains in the Genus database with same CATH superfamily
1HXDA 1ZYRA 2B63A 2EV5A 2PN6A 4ESFA 4XIDA 4A3DJ 1IE0A 2RNGA 1R49A 2WY7Q 3C7JA 3DP7A 4A3EJ 3AL0C 4L0ZB 3JCUC 2EPFA 4HA8A 2OC6A 4A3KJ 2LBFA 2HOTA 4AUXA 1OYIA 5IYBJ 2X1CA 4KM8A 2FNPA 4F52A 3JSTA 2MSYA 2GAHC 3K1PA 5IORA 2CUZA 2KRHA 1I1GA 3K4NA 2HTJA 4L9NA 4RA2A 5CQGA 1T0FA 1OR7C 1L3LA 1IC8A 2OJED 2DOFA 1XGMA 1MBEA 2A5YB 4UXNA 1VQPI 3GO5A 3G1OA 1U5TC 2NVYC 4KIBA 2Y48A 3BR6A 2NYXA 2JA6C 5L3DA 1QRYA 3RSNA 3ADAC 1Z7LA 3A03A 1CQTA 3K70C 4IX7A 2VONA 3C18A 1FEXA 3K10A 4D7MA 2BW3A 3OIPA 3L2UA 2VKDA 3K1MA 1R23A 3RKYA 2HXIA 3ULQB 1R36A 1Z0XA 2KIUA 4M73A 2BYVE 2MH9A 4KM9A 2QYOA 2IEKA 1RC9A 3W2AA 1I1SA 1XDSA 1X3WB 4GTCA 1H8AC 4IOAF 2HXOA 3GTMA 4D5FA 4KN4A 3CZ6A 2EK5A 3VDXA 4P9UA 1X19A 4I0AA 2XKOA 3ZXSA 5IOZA 4B43A 3CMAI 2ZBKA 2VBWA 4YFNF 4QLCU 2PI0A 1TWFK 2XPWA 3NWTA 1OPCA 2LKPA 1IRZA 1OFCX 5DM6F 5KCMA 2XCQA 3G4SI 3KLOA 4OIOA 1R1UA 4A93J 4FHTA 1U0JA 1UELB 3BC8A 1MBKA 1T33A 1K6YA 2BVMA 3LPXA 1ISEA 4C3IJ 4MEYF 2IS2A 3RZOJ 3GXOA 4CXFA 3K4CA 2X4HA 1RKWA 5D5VB 3L9FA 1QO0D 2PG4A 1O3QA 4A3FC 4JX6A 4WJ3M 3CO7C 1ZGAA 5FLVA 1LPQA 3FDYA 1FBSA 2JK3A 4S0HB 2IJLA 3A1YA 2P7VB 2VIXA 2DYSH 2DJIA 2JVGA 3K9TA 5FGMA 2D2WA 2RKHA 3OSFA 2VE9A 4BDYA 3HOZJ 4N9IA 4BL0B 3DV8A 2NVQJ 2CRGA 4AIHA 4PABA 5ICFA 2NS0A 5LHGA 2LTPA 4WXCA 4CUGA 3Q0WA 4BJ6C 3I54A 4WXDA 4UV8A 2M34A 1I3AA 1TQIA 2VJJA 1DU6A 3HXAA 2A69A 3R60A 3OIQA 3S93A 3VODA 4ENMA 1E2XA 1J5YA 1RZ4A 4GRIA 2W24A 4WXHA 3AKZA 2J5OA 3B02A 2CWEA 2CQQA 2LDUA 4II3A 4IXAA 3OOUA 1TT5B 1TQPA 4M3EA 4MLOA 2P7CB 2X6YA 2IRFG 4KASA 3PFYA 3M8JA 3SQNA 4A3JC 1HDPA 1Z67A 1I50K 4A3GK 4M71A 1WHUA 3H0GA 4RAGA 4HF2A 3QU3A 1HLVA 3ZMDA 2V7FA 2NRAC 3AD8C 2E71A 2IP2A 3MCZA 2LD5A 2L5QA 5C4JK 3DBRB 4A12A 1A04A 3N0BA 1YTYA 1HI9A 4HNTA 4A3DC 1XZQB 2M8EA 4PJLA 2P8TA 4BJ5C 1VNDA 3S1NK 4DOZA 2JSPA 4AVZA 1WJFA 3BJ6A 4A3KC 3FWEA 3KIOA 2JA7K 5IYBC 3V4GA 3DTKA 2GOMA 3OWTA 2FEZA 1ETQA 2ZXIA 4QIWD 1XXCA 3E5XA 3OYHA 3WHCA 1JHFA 3HEFA 2R4GA 1Y1WK 4A3LJ 3ABKH 3AQPA 2H8RA 1S7EA 4M9SA 2DQRA 1H9GA 3GZ5A 2HVSA 2CV2A 4L5JA 1RNLA 3PQKA 5HDGA 5E18F 1UV7A 1IN5A 1TWHK 4G8XA 1GDTA 5ICEA 1YX3A 3T8RA 2L7ZA 2QM3A 4CSWA 2CUFA 4KB4A 1XN7A 4Y7NC 3DBHB 4OINA 3HDDA 4A3GJ 1WCMK 1QNTA 3H3VL 2F4OB 5LFAA 3MZHA 1QPMA 2RREA 2RGRA 2KIFA 2IGKA 2R7FA 5M5WJ 3R0AA 2NVXA 5C4JJ 2DBBA 1VRQC 3W6VA 3GTQC 3VOEA 5D8LB 2E1MB 4FE4A 1LKXA 4TV7A 2PA8D 2O3FA 2VBXA 3CMEI 5L3CA 4KDDA 2X48A 5D4DA 1KQ9A 1DGWY 2G0EA 1ZG1A 4LLNA 2P5MA 1IQ0A 2QVOA 4A93C 1P4AA 3A0BC 2H1LA 4OIRA 4LMYA 3TEDA 2XRLA 3D1NI 2FQOA 4ZYGA 3BR1A 5B5EC 2QQ8A 3MEXA 4C3IC 1RRJA 3RZOC 4XLPA 3VFZA 1D3YA 1TWHJ 2WB1L 4LLGA 1EH1A 3ZQQA 2M4GA 4E7KA 3GEHA 2EQRA 2K27A 4HRIA 4DW6A 1WQFA 2MG4A 1O26A 4AM3A 3T00A 1JUSA 4KFCA 4PJMA 4OAZA 4N4NB 5F0FA 3GTKC 4FASD 2Q1ZB 3BTCA 1WKMA 1SFEA 1Z3XA 2KKOA 3AG1H 1MSEC 4OIQF 1U2WA 1N25A 2K4BA 3ECHA 3S3OA 2H8WA 4OIOF 1SFOK 1ZG3A 2EBIA 3P5JA 2EIJH 2HDWA 2NVQC 3HOZC 5J8CA 5HL8A 3FXMA 1LDJA 1ENHA 4FX0A 1JGSA 2MC4A 3JRDA 4IQJA 2JA5A 5H20A 2OPTA 2ELKA 3MD2A 1SC7A 3ZGKA 1W0TA 3K2ZA 3EUHC 1RR8C 3HXLA 1O3SA 2X0LA 4GTLA 3IWFA 2CS3A 5K1YA 4A3MK 5D6FA 2E1OA 3QODA 5CPRB 4WF2A 2R0QC 1TQMA 2VQLA 3BR2A 2L54A 3M07A 2K86A 5H2FC 1AKHA 2A68A 3QWLA 4BGDA 2JA7A 3KZYA 3F0CA 2HQ5A 2WB1A 4D5CA 4BE2A 4ESJA 2TRTA 1SD5A 3A01A 1J09A 2JT1A 2JPCA 4GCVA 2FBHA 4E6KG 3F6VA 1VF9A 4AIKA 4ZTFA 2UXNA 2VB6A 4AYBL 3S1QJ 2O0YA 1HKTA 4YG2A 2QUFA 3TP3A 4KT6A 4XRSA 2GBYA 2IGMA 2E7XA 5C44J 5KAIC 2R7UA 2M2EA 3P7NA 3JAMK 4KN7A 2OV7A 3V8KA 4A3LC 1UZCA 2KRFA 4J3NA 1USTA 4EQQA 5H6RA 2PX9A 3RYRA 2I8DA 3W6JB 1Y1VK 2WADA 2L7FP 2FA5A 2F6CA 5BPDA 1B72B 2WB1N 4BS9A 2LP0A 2CQXA 3FM3A 2LKSA 4NNJA 1G3YA 1PUEE 4FISA 3HOYK 1ETKA 2O7OA 3NUHA 1YW9A 1R00A 1AB4A 1BW6A 3MKLA 2OZUA 5HLHA 3DEWA 3SZPA 1REPC 3HRSA 2QGUA 1FWZA 4A3GC 2DYRH 2EA2A 2KIQA 4J00A 4GTDA 2HDCA 2GSOA 1WJEA 1GLNA 2DFIA 2R92J 4KISA 1O2AA 1KU2A 3HBLA 1MJBA 1X58A 4G9YA 3O8HA 2D5VA 4BBSK 2JUGA 2QCOA 4W97A 4AYBA 5FLXZ 3IPJA 3HOXJ 4HPQA 4HNUA 2GXAA 3CUQA 2J5PA 3RZDJ 3CCYA 3OSGA 1S72I 2HVRA 3S17J 2XUBA 3SXYA 3AD9C 1G6NA 2DPUA 4B47A 3E3VA 4AU7A 2L3DA 3N97A 3A4CA 4DIQA 4IRHA 2XF5A 2MGQA 4E7IA 1WQ2A 4V2GA 1P2FA 3PM1A 4OIPA 3HHGA 2X6WA 2X1EA 1LVKA 3BPXA 4JK1A 3O2PE 2PFBA 3LWFA 2LBFB 2IAIA 2XGEA 1P6RA 1V5EA 5HNFA 3HOYJ 1QBJA 1IW7A 3K2AA 4NB5A 1BGWA 4G0WA 1T08B 2PQ8A 5J3LA 4D0PA 3KZZA 1X4PA 5L3GA 5LLQA 1A35A 3WTWC 4C3JK 3LSMA 2ZSIB 2CO5A 1AHDP 1O2FB 2CQKA 4AYBN 4K2EA 3OYCA 3UKGA 4KMHA 3T01A 2V1DA 3QPLA 5HS7A 1R9TK 1KGSA 3DEEA 2L9VA 3W2WA 2BW3B 1K79A 3HPGA 4OIRF 4IL6C 3ZQHA 5J8FA 1XG1A 4PJJA 4BBSJ 4F7ZA 3CQZA 2OU2A 1TNTA 2IA1A 2JA8K 3G2BA 1MNEA 4ZZDA 1VQMI 2OA4A 1ON2A 4BKXA 3S1RK 4LLGF 2PMHA 3PL8A 2CV0A 3ZMZA 2DA6A 1OMIA 3I64A 2E7WA 3BJAA 2A5WA 2VLAA 2GXBA 1TT0A 1ZR2A 2CW8A 5IP7K 1Z7UA 1VQ7I 2QLZA 4G94A 2Y0SL 1Y8QB 2Z33A 1X2MA 1BJAA 1XDUA 2FBIA 3IH3A 1U9OA 2LRDA 2Y9YA 3IUOA 2ECBA 2W4SA 2XGXA 2Y31A 4L9JA 4CCKA 1F7UA 3S0XA 1X1BA 1EFWA 2OD5A 4NC6A 4FETA 2CMPA 3ZMUA 4PFPA 4C30A 4U7DA 1Y1VA 3FBNB 3J81Z 2BV6A 4XLNA 2TCTA 3N3YA 1MIJA 3JRIA 1VQ8I 1JXSA 3BG9A 3MWMA 3TBIA 2V1UA 5M5YK 1KQ8A 3S1QC 3RDIA 2JSCA 3BZ6A 1TWGJ 2ACJA 2K02A 5B3SH 5C44C 1DCPA 2CFOA 1CGPA 1W7PD 1QHHD 2KHMA 1Z6RA 2GOXB 2IA0A 2LNBA 1LFBA 3GFMA 1VFCA 1U78A 3BP3A 1X1CA 4PJNA 1A6QA 4IRGA 4M1XA 5F1RA 5IP9K 3GTGJ 4DBRA 1FT9A 1ORKA 2MLGA 4ON0A 3SZZA 5HDNA 3PO3K 3GVAA 3KLNA 1IGNA 4NDLA 5IP7J 5C3EK 2Q8KA 2Y0SA 4XMYA 5DDGA 3LSJA 1OCTC 1SMYF 4YFXA 3OYKA 1IXRC 3TO9A 3BG6A 1J9IA 5HNHA 4A6DA 3K4BA 3M3YJ 1VQKI 2R92C 1RPWA 3E6CC 3GIRA 3HKZL 3U9GA 3GFIA 4LJZA 3HRMA 3LL7A 4ABZA 4KMFA 3Q9SA 1UG2A 1V5VA 3OR1C 3HOXC 3C2BA 4ZH4A 2A61A 3RZDC 5D4RA 3S17C 4D1QA 2NVYK 3EUKL 3FM5A 2JA6K 5E3MA 1FJLA 4O5VA 3DF8A 2COBA 2A05A 2PHCB 2HQRA 1D0XA 1P7IA 5EYRA 4BEHB 4KARA 5IYDJ 1QPIA 4KYWA 1E3OC 2OTJI 2VASA 2NOGA 1RUOA 3G4CA 5HODA 4DNCA 4NOIA 1N78A 2OCEA 1G51A 2O9LA 3PO3J 3QU6A 1R9TA 3EQLF 3BR0A 2G7HA 4I99C 3HOYC 5C3EJ 3M1CA 1GXQA 1VQ4I 4S04A 4U0YA 3FKIK 3CTAA 3LSHA 2MABA 1NH3A 1HKQA 1LEAA 3F72A 2GZWA 4GGGA 5H6QA 3S3MA 3ISPA 2ZSHB 1YCLA 4OOIA 1ZHFA 3FBIB 1Z1DA 3O8GA 4MHGA 3JSPA 2PMZD 3FHZA 2DO7A 3HKZA 1BC8C 4OIPF 3IV5A 3S2HJ 4II2A 3HOWJ 2EV6A 2WAQD 2O6GE 2L0KA 4BBSC 4HSRA 5E8GA 4E70A 1ZELA 2E2HA 1B6AA 2KISA 4MO7A 1IG7A 2E2IA 1XTAA 3KP4A 1ITYA 1MDMA 1HSTA 2F5EA 3CJQB 1PP8F 4IHWA 5D5UB 1I3QA 4I2OA 1PVEA 4U87A 1JKRC 4LK1F 3ZOBA 2DPDA 5FLMK 4GTFA 1PJ6A 5E20A 1IN4A 3OOPA 3H5AA 2R7RA 4AWXB 1ULYA 4FZBA 4Y17A 3BWGA 3FKIJ 1JKPC 1D5YA 2G7UA 4GYIA 5GTHC 5FRNA 3HKZN 2XROA 4EMSA 2K9LA 2X85A 3HZJA 3I59B 2EBBA 1R58A 1TWAJ 1D0ZA 1UHSA 5BPIA 3SZGA 3P9CA 2LVSA 4XL9A 5EJCA 4EM2A 4FTHA 1I6XA 1UHWA 2VI6A 4ENNA 3GTPA 1TWGC 4Y52K 1B1BA 3HG9A 4G7OA 5FO5A 2EWNA 3K1NA 5EDNA 2X9DA 2DCEA 3GMEA 2M30A 3DXJA 1R5ID 1J0RA 3RKWA 2Q0OA 2H1KA 3BP8C 3GTGC 1K83A 3F23A 4UVBA 2BE5A 1MZBA 2EZKA 3ZQIA 3IH2A 1DDNA 3CC2I 4A3JK 2L2OA 1HBXG 2AXTC 3HUGA 3KZIC 1X1AA 4RB1A 9ANTA 2KZVA 3AH5A 5IP7C 3VYSB 2Z16A 4AIDA 3GZ6A 1OR7A 1ETYA 4XLNF 2JTVA 2GXGA 2XB0X 1HSJA 5HLIA 5FLMJ 4H4KC 2NVYA 4HNVA 2JA6A 1PUFA 4BNCA 5K7ZA 3S16J 2VODA 2V6EA 2W85A 5EEHA 2DLLA 2OCCH 1K4SA 4Q4ZA 3M3YC 2B63J 2NNNA 5HS9A 2EA4A 3H36A 3TTGA 4A3KK 5K5QA 4BY7J 2ZNYA 5HLGA 5IYBK 4RGUA 4ITVA 1A31A 1IN7A 1DP7P 1OCOH 2DA2A 4Y33A 3B6CA 2UV1A 1ZBSA 3ZR8X 3GX4X 3GWZA 3BY6A 4MFDA 5CKTA 2DTRA 4CYDA 4CHUA 2H94A 4CCJA 4Y52J 1ZGWA 3A01B 1W4MA 3AD7C 2DA3A 5HS8A 1YITI 3MZ8A 1NG6A 5HOOA 5D5XB 2TDXA 2KZGA 2K9QA 1U6GA 1K4TA 5IYDC 4IHYA 1SD4A 4E7SA 2F4MB 2HPMA 1ZN2A 3PO3C 2JPBA 1JTYA 3E0JB 5F0HA 4A3JJ 4Y7NK 3I4MJ 1FLIA 1W5CC 5J4YA 4PCQA 4JX4A 4ZTJA 3KYCB 2BXYA 1R5GA 4CCOA 3HOTA 2GM4A 1UCRA 3E5QA 4LJZF 1LUJB 1ZTRA 2ZO4A 1IZ1A 4UHTA 3E1SA 1ZRFA 5GAHJ 2AQEA 3GTQK 3S14K 3DTIA 2R5YB 1R7JA 3TL4X 2ZJPF 4J01A 3GYHX 1YW7A 2ZXHA 3ECOA 3W3CA 1DCHA 1OYWA 4BXFA 5ILUA 2RQQA 3S2HC 2R93C 5KHDA 4G7HA 2DOAA 3HOWC 5TISC 3I9V2 5A2QZ 1F7VA 1KYZA 2CG4A 4A93K 3WE3A 1E17A 4ZZLA 3J80Z 1WH5A 2EFQA 1LFPA 4C3IK 5HLTA 1B4AA 3X2QH 3N05A 4EJVA 4DDQA 3RZOK 4XLHA 3S2WA 3LNQA 4F55A 2HEOA 3AFHA 2YSRA 1FMVA 1BI1A 1GV5A 1MMNA 1XSDA 4MEXF 5E79C 2M5WA 1Y8RB 2B0LA 4D9JA 4I0BA 1TWCJ 1MD0A 2ZJRF 3GTOJ 3CUQB 2NNYA 3QX3A 1G3WA 2L01A 2L7KA 3AG4H 3HC7A 4PFOA 4Y7NJ 2E35A 3L00A 3LSKA 1ONVA 3GTKK 3FKIC 4Y4RA 3I4PA 4IPAA 4C3HK 1D0YA 2WAFA 1I5ZA 2LK2A 5CVJA 1USSA 4M72A 1TWAC 3CUOA 2HOEA 4M6VA 3GTQJ 3S14J 2NVQK 3HOZK 5KNLA 2YUSA 4BUPA 2E36A 1JT6A 2RGVA 3NQOA 5E17F 3WODA 2EZHA 1PJ5A 1ACIA 4M6YA 3BG7A 5EG0B 4E7HA 2EIKH 2PJPA 2LY1A 1ZK8A 3ZN0A 1J7KA 1SVLA 3PO2J 3DKYA 4GXOA 1FIAA 2HTSA 2ZMEC 1IL2A 2FJ1A 1O27A 2HQNA 3P9KA 3SDBA 2E1CA 4MQVA 1T95A 1T39A 4F3QA 3TGNA 4XCHA 4KC6A 5DV5A 3O6BB 3OIOA 3S1MJ 1S7AA 3LSGA 2JRTA 4RLFA 3JRGA 1ETVA 5FLMC 3KYLA 4NQWB 3SEZA 5ICCA 3KP7A 1E3HA 1G59A 3ROUA 4HZFA 4RS8A 3GTKJ 3S16C 1D1BA 2FBKA 1VZ0A 2FQTA 2B63C 3TO6A 4Y15A 1XB4A 4C3HJ 4WILA 5TMCA 4BY7C 2VUMA 2IW5A 2VE8A 3WTUC 1FTTA 3K0LA 2WV0A 3H1CA 3LFKA 1J6VA 1SFXA 3S15K 4C2MJ 4AVPA 4A3LK 4Y52C 2ZFZA 4I01A 2NVUB 3HOUJ 1HCRA 1USMA 2XSJC 1RIOH 3QYEA 2KP6A 3F8FA 1XD7A 3RJPA 3RKXA 2GIVA 3LFUA 3H92A 1P4XA 2MH2A 1GT0C 1XXAA 4FE7A 4YIIA 3QYBA 4Q4ZF 3I4MC 1FMWA 3KP2A 2P81A 4XORA 4L9VA 5M5WK 1DQUA 3KFWX 3S8PA 4KMUX 4HLYA 2ZXJA 1Y39A 3T5XA 2PJRA 2CJJA 4HBLA 1C0WA 4BEHA 3H9QA 5F6FA 4JBAA 1RUNA 1ZQ1C 1VGXA 4PJ0C 3FOEA 4NC8A 2L9NA 1B59A 3R0JA 3R4KA 1OCZH 1JUPA 1BI2A 1MGTA 3L7WA 1HOMA 2M7AA 5GAGJ 4BH9A 1FP2A 1DP3A 1LE8A 2ADUA 3CCRI 3HYIA 3PIPF 3S15J 4X1EA 2EB7A 4YEJA 4KMDA 2Z9OA 3SZYA 4DYRA 1ODDA 3VWBA 1NTCA 3HOVJ 2A6HF 4PSXA 3Q3QA 4PK4A 4A5NA 3HL2A 2DMQA 4IF4A 4CO8A 1QZEA 1K61A 2V6UA 4U0WA 1TL8A 2R7SA 2R7XA 1ZYRF 3QQAA 1MSFC 1VI0A 2CGPA 4BY1K 1ZLJA 1SFKA 4EV0A 1TWCC 3GTOC 3BDDA 3M7GA 3K4LA 1UJ8A 4XQFA 5EGEA 4PSWA 3FXOA 3BTIA 2M3AA 4XRMA 1TWFA 3JTHA 2XAFA 5FB2A 1HC8A 2YX7A 2DMPA 4AC0A 1BI3A 2E5NA 3RI4A 4IVNA 3F8BA 2JUCA 2DW4A 3L2RA 2IGNA 3F8NA 3FHNA 3Q3SA 3RQ4A 2B9SA 3J7ZI 3EYIA 3S14C 2RNJA 5AIQA 2VKVA 1EH7A 2H6BA 3GDZA 3PNTA 4L9TA 4XN3A 1O2BA 4ASNA 4HSTA 1FYKA 2BY1A 2CFXA 5E1ZB 2L9RA 2JJ7A 2QQAA 2IT0A 3PO2C 3ML6A 4W1UA 3H3VD 4LG0B 3TKYA 1MMGA 4CICA 4CH7A 2DT5A 4CCLA 4R79A 3I59A 2DMUA 3M1EA 1ZH5A 2ZUEA 2O03A 4LIVA 1Q1VA 3GEEA 4KIFA 3GTJK 5JVTA 4IZZA 1G8XA 3IL2A 3DKWA 2MLKA 4BJTA 4BY1J 3FIWA 2A6EA 3S1MC 3G1MA 2EFNA 1XS9A 3WTXC 2Y30A 2HQAA 3WODF 2K85A 4RAZA 5CVIA 1MDMB 3E6DA 3LSIA 5TJ3A 3S1QK 2DDAA 5DD8A 2V6TA 3K4KA 2HGCA 2ZB9A 5CHPA 5C44K 2GAUA 1SAUA 3WU0A 4C2UA 3OL3A 3PUBA 2F5CA 1I50A 4C2MC 5F27A 1VTNC 4BE1A 2XPUA 4XLAA 1KA8A 2F5FA 4CGZA 3HOUC 4JQFA 1JJ8C 1WQGA 2XPVA 2R7TA 1ZRDA 4A3BJ 3TW7A 2O61A 3VA7A 3RPQA 3HTUA 1DU0A 4BHBA 3AAFA 1O3RA 3OYBA 4P5BA 3CC7I 1FYLA 1ERDA 3PUFA 3CCUI 5F08A 4XK4A 5LGNA 3GTJJ 4QWQA 1FC3A 1SEUA 2WV1A 4QJVA 4HQEA 1T2KA 2VT2A 1Y1WA 2R92K 3BROA 3AL0B 3F9KA 2VBZA 2KWAA 1MKMA 5IOYA 4KUMA 2R5ZB 2D45A 4LB6B 5C4XJ 5L3BA 2A69F 2LY2A 1TWHA 3HOXK 3HUGB 2Z3YA 3A0HC 3TOAA 3DQVC 1YFHA 3RZDK 2L7MP 4MQ9A 2KL4A 3KETA 1KU9A 3S17K 3RPUA 2ZJQF 4G7ZA 1ZGJA 3F3XA 2W1OA 5GADJ 2Y75A 5K5OA 3S15C 1U5TB 1PYVA 1POGA 2FE3A 1TTYA 2EZLA 1WCMA 3TFHA 1UMQA 3HM5A 3D5RC 3HOVC 1PUFB 2Y9ZA 3JR9A 1O3TA 2JH3A 3M4OJ 5E1XA 2R5YA 2P0WA 3FMRA 2I5UA 5AONA 2X1DA 1WJ5A 1LJ9A 4GT9A 5FLXK 1ZARA 3ZMVA 3IWZA 1B8IA 2FMYA 1TNSA 1XZPB 5HVQC 3LOCA 3H3ZA 5EEGA 2XAQA 1PJ7A 4DBQA 1IN8A 1Z77A 3BG5A 3ELKA 1LDKB 5DM7F 2WBMA 4CZZA 2D6FC 3LQRA 4UY8I 2LG4A 1YLFA 2W82A 2WA0A 5F0CA 3ZMSA 1NK2P 2DU9A 4XLFA 4EJTA 4HF1A 3K7AJ 1KYWA 2VJ4A 4G6DA 4R8HA 3IRQA 4D7NA 3CCLI 1WJAA 4I7HA 3TQNA 4RGXA 2AS5F 5L46A 4PGGA 4XICA 3G71I 3SHFA 4X6AK 2ZMEB 2YR2A 3MFKA 2ESNA 4XN0A 3CQZJ 2W25A 5D8KB 1K78B 4XSXA 4BXUA 3CESA 3GW2A 3H3UA 3MQ0A 1T6SA 1GV2A 1O28A 1D1AA 3ABUA 2YU3A 3PQJA 4OINF 2V1NA 3EETA 5ICGA 4F93B 2NXNB 2EFWA 1SFOA 1JTXA 2R7OA 2XAJA 5KAFC 3SFZA 1I6HJ 1FIPA 5EG0A 4BY1C 1SD7A 5EGHA 2YU9J 2ETHA 4FQGA 4I76A 4M74A 1KONA 4XRFA 2W48A 1FOXA 1QZYA 4N9HA 4DJAA 3OYIA 3KP3A 5EEAA 1XX5A 1TWGK 2BBYA 3HGGA 1ZVUA 3JRBA 4KNYA 2RV8A 3MVPA 4LOCA 4XSZA 3NRVA 3R61A 4PDKA 3E7LA 2O5RA 1WJBA 2OQRA 3KCCA 1MH3A 5K7HA 4BXXJ 3PJRA 2VQHA 4NQWA 4XLPF 1DD5A 2JZYA 2BVLA 3KX2A 2M8GX 4X6AJ 3GTGK 3J81K 1G4DA 1EJ9A 4A3BC 1YJNI 2FOWA 3GEZA 3OPFA 2JN6A 4A3IK 4GTAA 3E6MA 4U7BA 2BEOA 3WG9A 1H88C 5EF6A 1OJLA 2LY9A 3GTJC 2O5JA 2E60A 2Z99A 3F22A 1BOBA 3KEYA 5IOTA 4O6JA 3CDLA 1YJWI 3MKYB 3TDUC 3M9AA 1EF4A 3MKWB 1I39A 3M3YK 4DYCA 1FNNA 2M1BA 3QPHA 5F1JA 4IHSA 1VH2A 3VPRA 2VPLA 4LIUA 4HX7A 2OBPA 2VQCA 5K5RA 1VQNI 2FD5A 1T38A 2FRHA 2K7LA 2VKHA 5C4XC 3G73A 2Y0SD 2LKXA 4FM9A 3C2HA 2QSFX 2P4WA 3R6SA 3I5UA 4KB2A 2IS6A 2ZJ2A 3V8LA 2COMA 2FOKA 4LK0A 2XV4S 2MA3A 3CJNA 4ESBA 4MFEA 3U21A 1PP7U 3ERMA 1DPRA 2IBDA 3WTSC 1L0OC 2A68F 2CUEA 5M3MJ 1P92A 3LAPA 1YG2A 5IYDK 5JFEA 3IP4B 1ZQ3P 3M4OC 1J59A 2V9PA 4L18B 2ESHA 1H89C 1VQ9I 4BAYA 2ME0A 2XKPA 4QTRA 3FISA 3GTLJ 2VJ5A 4A3IJ 4Q5SA 1AA7A 5JVOA 2BHYA 2QKLB 1Y0NA 4OU0A 6PAXA 4A3CJ 4KJZA 3HSFA 5J1UA 4E4HA 2D1HA 1HF0A 3CAGA 3OYLA 1Q1HA 1TW2A 3Q0UA 3M8EA 4G7ZF 3NWSA 1F1ZA 3FXQA 1V5FA 1MBHA 4ZJZA 2YX4A 3QP6A 2O8KA 2DFHA 2GQQA 3AG2H 3S2HK 3HOWK 2R93K 3K7AC 1O4XA 3DFGA 1W5SA 3E5UA 4M3DA 2QBYB 4QPOA 4BBRJ 2EV0A 4CYCB 3OY9A 2ID6A 1B9NA 2QQ9A 2VT3A 4GTBA 5EZGA 1Y0UA 4Z6YA 5D4SA 1MNDA 5LRSA 3CQZC 4RB3C 4RDUA 2PJRB 3TDZC 4I98B 1O25A 1HKSA 1V4RA 2E2IJ 4BQQA 2XGDA 3N4MA 1USOA 5DCFA 3L2QA 1NK3P 1VQ5I 1TWGA 3CF5F 2CUJA 4IEJA 1PDNC 4LOWA 5M5XJ 2HVQA 3HB9A 1JE8A 2QENA 1I6HC 1NG7A 1EA3A 2R7QA 5ILVA 1FBQA 5F04A 1LE8B 1ZLKA 1HQMA 2XCRB 3M8FA 2YU9C 5JVGF 3OYNA 2JRMA 1P4WA 4ZYHA 3CP8A 1BJTA 4LG0A 2OF7A 1EKEA 1TWAK 3GTGA 1XC5A 1XMAA 4XKVA 1F9NA 2GAGC 3SEQA 4NHJA 3BCBA 1T8IA 4EATA 4PZJA 1TC3C 2R93J 2FQ3A 3GEIA 3ABTA 2NOJB 3TW6A 5IYCJ 2UZKA 3ZQLA 4OMZA 2DA4A 3PNVA 4BXXC 1ZRCA 1I6VA 1IXCA 2ID3A 1IW7F 4X6AC 1OLTA 1Z91A 2ZCWA 1A36A 3V42A 1KU7A 3IAM2 5IT9Z 2MD0A 2BZTA 1A6IA 1S6LA 3CDHA 2O5IA 2AO9A 3BJOA 2HS5A 1K83J 2IGOA 2VQGA 2EFOA 3V7CA 2RAEA 4HAMA 3C2GA 1BJZA 4LLLA 3P9IA 4AD9A 1EQRA 3S16K 2HPIA 3WHBA 2B63K 4XSZF 4ZDPA 4A0XA 2VOPA 5J6XA 4JYKA 4BY7K 3CO6C 4IQ4A 1KQ0A 1PJRA 4C3HC 3NARA 5D6EA 4HV6A 3WG7H 4YFNA 3WTYC 5JFRA 1YX5A 3JRAA 5IY5H 1JOEA 4BACA 3B6AA 1Z3YA 2K3FA 1BDFA 1QVTA 5F64A 3FXUA 2R7ZJ 1BS2A 3LSPA 5CJ9A 4IRIA 4MEYA 5CYVA 4BHPA 1BR2A 3T0YA 3VYUB 4N0BA 3C3WA 5M3FJ 3V7RA 4YELA 3TMOA 5E8IA 5LD2C 3WTZA 4A0YA 2GWRA 3DKXA 3A8IA 4ILDA 2R5ZA 4OWRB 3GCMA 4A2UA 4MTEA 1JVIA 3I4MK 4P9FA 3S3NA 2QF7A 3GTLC 4A3IC 1MNMC 1D8JA 3KYDB 4OMYA 2DMTA 3GLXA 2E1MC 2HYJA 5BOXA 4A3CC 1UHMA 3HSEA 3BLYA 4KITB 1U5TA 4M3BA 3I56I 5TJJA 3DU6A 2XAUA 1SVOA 1ON1A 3RTRA 2PMZN 4G0UA 1FBUA 1OCPA 2LC2A 5FD5A 3W6KB 2XVCA 3CMMA 4LK0F 4R1HA 1FX7A 2E2JJ 1XCVA 2WAQN 1GUUA 2R3SA 4ZYEA 4WCGA 1MJ9A 5E3NA 4ENJA 1YNJA 1JQWA 2DA1A 4BBRC 5LGTA 4ANJA 3J7YJ 3FKIA 4QJVB 1XZPA 1IRGA 3K6GA 4KT5C 4Q5SF 2QWWA 1YX2A 1EV7A 1ZREA 4YFXF 1RESA 1TWAA 1ZR4A 2E5ZA 1FP1D 1S29A 3H5RA 4XKWA 1X4OA 3L1PA 2E2IC 3E97A 4C9YA 4YIRX 2YS9A 1UAAA 1N75A 1TWCK 3GTOK 4XOTA 1WVRA 1W5TA 2E34A 1V3FA 2LLKA 2E19A 3VSKA 4KIGA 1QVUA 3H9GA 3BG3A 2HNHA 2CSOA 1BC7C 5A2QK 1MBFA 1DCOA 1QU3A 2ZMEA 4G12A 1R22A 4I02A 2ME6A 2V26A 3I3LA 3J80K 1K78A 2HYGD 2QKMB 3MZYA 3JW4A 3OEPA 3ABLH 4P96A 4ZH4F 2UWMA 3G6EI 1XGNA 5LHHA 2KLOA 1P9QC 4BQOA 1LVAA 3WU2C 4EEFG 2NVTJ 3GTMJ 4NUBA 4B44A 2DTZA 1Z9CA 1BBYA 2HOAA 4Y3OA 1B8IB 1APLC 1HA8A 5IYCC 3PO2K 2XSDC 4DGWB 2KRCA 1Z6TA 1NHAA 2XRNA 2LFBA 4EM0B 1YQAA 3RIRA 1YIOA 3HOSA 4LD5A 3JSOA 3CJRB 3ZP5A 4KMUA 4DYQA 2DODA 3I0TA 3S1MK 2CQ7A 2FXAA 2HI3A 5IT3A 1TP4A 1K83C 2M9HA 4CCNA 1KZHA 4O2DA 5GPAA 1YNNA 2P5LC 2ZNZA 3S2DJ 2DOEA 3FXKA 3H0GK 1ETXA 5CVRA 1BA5A 2GA1A 2BHZA 1BI0A 1LNWA 2JWTA 2UXXA 4KMAA 4BQNA 3G1LA 1G3TA 1U9NA 3FXRA 3K4MA 4RBOA 1ZG5A 1CF7A 2E1NA 4LFUA 1L0WA 1QZZA 4RAFA 4C2MK 1R1VA 2VUMJ 1FOKA 1IJWC 3HOUK 1BR4A 3QRFF 1XMXA 4XONA 2OAZA 1J6WA 2R7ZC 2DFFA 2WC2A 2IS1A 4GZYA 4M6XA 2DMNA 4EVIA 1STZA 2EZIA 2GSNA 3KP6A 1X31C 3LSRA 2RVCA 2AHQA 2EJRA 4M3GA 5EGOB 1E3PA 4HEA2 3I4NK 3CCVI 4IOCF 4B4CA 3OYGA 2M45A 4EM1A 1H0MA 3QP5A 1VQLI 3OYJA 4LITA 3REOA 2FU4A 2F2EA 4B8XA 4OIQA 1TZLA 3H0GJ 4NBQA 4AH6A 5FROA 1OCRH 1U8BA 4G7OF 4UUSA 2AQFA 3H9JA 1G3SA 3MKZA 2NVXK 5DUKA 4E7JA 1FPQA 3HPHA 4NC7A 4BYYA 3L4KA 2E2JC 3DXJF 1TWCA 2ZC2A 1LDDA 3GTOA 1GE9A 2A3SA 2K9MA 2NAZA 1J75A 2EINH 3DEUA 1H9TA 2BE5F 3HOVK 3A8JA 4P5OA 3ONQA 3L09A 3CLOA 3DBLB 1W0UA 1T0FC 2PMUA 5J4VA 2QZ8A 2W7VA 4BQAA 3GTQA 4HV5A 4H0EA 1YOVB 4EJWA 1HDDC 4HDUA 4I09A 4YIFA 2HKXA 2XASA 3CLQA 2WWYA 4KICA 1RU0A 4IHXA 5DCMB 2MFZA 1K6OA 5BQTA 2QBYA 3I4NJ 5B66C 3LQQA 2XAGA 4CYCA 5FKLA 1EH6A 4EGZA 3WU1B 3K4JA 3KPHA 2HDDA 4WX9A 4Q48A 1TWFJ 3F8CA 1DUXC 3H3VK 4YG2F 3IHUA 1D8KA 2RH6A 3D5SC 1X2NA 2Z1DA 3ZN1A 2BY2A 4B1RA 1IDYA 2NVXJ 1EK8A 2NVTC 2GA2A 3GTMC 1BW5A 1AWCA 4CCMA 5LBQA 4XBFA 2JA5K 3A2KA 4MNUA 4QIWL 1J2XA 1TLHB 2LYCA 2DQLA 3OV8A 2R7WA 3BOQA 1OQYA 3ZCOA 3CCEI 2STTA 3GTKA 5DEQA 2HWVA 2ISZA 3D0SA 2Y0MA 1W36D 5FRMA 4UUTA 2BGCA 3A02A 1RETA 4HW0A 3CC4I 3F6OA 4A3EC 5JR3A 2MYSA 1IUYA 3LA7A 5L3FA 1FSHA 4A0ZA 3AQOA 2ICWG 3KEOA 2HOSA 4Q47A 3S2DC 3EUHA 4HOBA 3DU5A 1W7PB 4KN4X 4G7HF 3BT9A 3V7SA 1LFUP 1MW7A 4UVAA 2Y2ZA 5KVRA 2JMWA 2OZ6A 1OYYA 1AOYA 3BZCA 2X6XA 2R7VA 3QOPA 2VUMC 4BLAA 2V9VA 2PA8L 1GXPA 1XGOA 4MGRA 1R4MB 4P1WA 1LQ1A 2JA5J 1I50J 1ZAOA 3DWLE 2JVHA 2K9NA 4A3BK 4XR6A 4X0GA 5D5WB 5DD4A 2L9SA 1WOPA 3TO7A 3VYRB 1R71A 3BR5A 2LR8A 3GZNB 4C45A 4IO9F 4KAWX 1OKRA 5FD6A 4Y13A 3IKTA 2LH9A 3S1NJ 4S05A 2VOOA 3QPTA 4DZPA 3EUAA 1M1EB 4KA4A 3RQIA 1HW1A 4HLXA 2JA7J 2JQ7A 5KK1A 1WRJA 5B1AH 2GLOA 2JA2A 2ZFUA 3HRTA 3H0GC 3D5LA 1Z05A 2W84A 3RKQA 3SYTA 4MIMA 1Y1WJ 2STWA 1X1DA 5C4XK 2V6CA 1SVMA 3JTGA 3HRUA 2IVMA 1WFXA 4G0VA 2VN2A 3FKJA 5LEJA 3Q5FA 4QIWN 5FKOA 5E3LA 2QEXI 4V19K 2WB1D 3OYFA 3DPTA 1YS6A 1S5LC 4YFKA 1V54H 3BTLA 2W57A 1V55H 2XCOA 3M4OK 3FXJA 3ZQFA 4HX8A 5CVVA 4DQ2A 4EJUA 5LEKA 4B48A 2Y3PA 2XB5A 4HDVA 1SD6A 1WCMJ 2I10A 2M7BA 2Z2SB 4QSHA 2KJCA 3OR2C 2DAOA 5IPAA 5LGUA 1O7LA 2HYFA 4N4OB 2MC3A 5J1RA 3FF5A 3LA3A 2FX0A 5JHFA 1YE9A 3IC7A 3N0CA 2NS7A 1ZKGA 4L5IA 3RPUD 4CZCA 2WTEA 2P6SA 1INNA 3U1DA 3I4NC 1R1TA 3CCMI 1YI2I 3PSFA 2XF6A 1X3UA 2HU9A 2H6CA 2BOLA 3LAJA 2EFPA 2K9SA 4XM3A 1TWFC 1YRNA 1R5HA 2RC4A 2DJNA 3WTVC 3NEUA 3K7AK 1FTZA 2QQBA 4LB5A 5DUIA 2NVXC 3J7AY 3DLLF 1W36C 5IOSA 1UFMA 3IAS2 1D5VA 3L2WA 4P55A 1F5TA 4UB8C 1BOAA 1MJAA 5CLSA 4CA0A 3WGIA 3CQZK 3L2VA 2O8XA 4GO1A 1WZ2A 4PGHA 4E7LA 4ZDOA 1XGSA 2L4MA 5DTDA 1XMKA 1IRXA 3C1DA 3K69A 5JI6A 3ZRGA 1FSEA 3IH4A 3L2CA 2N8GA 2CFAA 1SMYA 5K7FA 1A5JA 3SDGA 2W7NA 2DA5A 4AYBD 1I6HK 5GAEJ 3NAUA 5CQEA 4BKWA 1J98A 2YU9K 1SFOJ 2DN0A 2XAHA 3FMSA 2Q2EA 4Z2YA 1J6XA 1MMSA 2P5KA 3GLLA 2ZXWH 2R7DA 3ASOH 2HKOA 2YPRA 2DI3A 2LREA 5FKMA 2ELHA 3HSRA 3E6BA 2XHKA 3H5NA 1DPUA 2CW0A 3SJMA 2VPRA 3MMLB 3TFIA 5FFXA 3CMYA 2MW8A 5E3OA 4FT8A 3GTJA 3TFJA 2KIMA 4A3MJ 4HQMA 3OYMA 2KDOA 1GHCA 2IA2A 1WORA 4BXXK 4UUVA 2DT6A 3CP2A 5GPCA 4RGRA 4O3MA 3GSIA 4IHVA 2IS4A 4P9SA 1IF1A 2JA5C 2VXDA 3JAMZ 4HX4A 5BNGA 1IS1A 1I50C 4UNOA 1XXBA 2LSOA 4XNFA 2L02A 2OQGA 3ABMH 5DS9A 5E1WA 3EQLA 3Q9VA 4A69C 2DK8A 4RM3A 1LEBA 5C4JC 3ESWB 3V8JA 2VC0A 1EI6A 2QSGX 1E0EA 1FZPB 1EH8A 2ECCA 2M0MA 3A8KA 4LGWA 1S8NA 3S1NC 3H0DA 1WOOA 2JA7C 4IHTA 2C6YA 4RB0A 2QA4I 2EIMH 3F21A 3OMYA 5B1BH 3UR3C 3MMYB 3WGGA 4B3AA 4JP0A 5EZHA 1Y1WC 1WJDA 1YW8A 2DA7A 3SFIA 3AG3H 1Y1VJ 2KMUA 1WIHA 5TGTA 5EGOA 2A07F 4MTDA 3VYTB 4L0YB 1BM9A 1WJCA 2AXLA 1TWHC 2V9KA 3ZQ7A 3WTTC 4E7ZA 2DT7B 4UVCA 2H27A 4LG3A 5M3MK 2X6OA 1IBAA 1WH7A 2R92A 4RB2C 2A6EF 2RQPA 2FNAA 4LK1A 3ASNH 1WCMC 2XC7A 4XLCA 1ETOA 1RI7A 2VC1A 3ZQCA 2HR3A 3GTLK 1CF7B 4XKBA 2ELJA 3PSIA 5ERIA 2HZDA 4A3CK 2CQNA 3EDPA 2BY3A 2FMLA 2P5VA 4EGYA 4OAYA 4RAYA 4WWCA 2VL8A 2DFEA 1YO5C 3DTEA 2Z5UA 3FK7A 5IOQA 2H09A 3OYAA 4GFQA 3ERED 4YFKF 4G6QA 1U3EM 2MBFA 1XSXA 3IKVA 3QYFA 3BQZA 4WJ4A 3FXLA 5DCMA 2P6TA 4BBRK 2VBYA 2FF4A 2XDVA 5AIPA 4M3FA 2CV1A 3J7AO 2YU9A 3I58A 1TW3A 1KU3A 4KN7X 1ETWA 1WSVA 1WQHA 2ZFWA 4KDPA 2WY8Q 3CUQC 2L4AA 2DXIA 2E2HK 3QOEA 1WSRA 4A5MA 2E2IK 4ZDLA 4HYEA 3LSTA 4UUSB 4XRSG 3U1KA 2VKEA 4C3JJ 4BLBA 3DPUA 2CU7A 1HQCA 5M5XK 4RLQA 1I3QK 3WGHA 2K3PA 3EYYA 5JLWA 1RKTA 2OTLI 2IXSA 3GF2A 2BY0A 3GFLA 4GTEA 1SFOC 4UB6C 1R9TJ 5FJ8K 3OS1A 1IAWA 2PPBA 3O3KA 3I55I 1OCCH 5J47A 4U0VA 3TP0A 1X1PA 4MQ9F 3FOFA 1JT0A 1Y56A 2JA8J 1RR7A 3BCAA 3S32A 2V1XA 1YHQI 3S1RJ 2LOOA 1HW5A 1XZQA 1O29A 1FY7A 3HJEA 1FOWA 4XLEA 4C2TA 1IXSB 2VXZA 3MAJA 3PFIA 5IYCK 4EJOA 3FK6A 4PUSA 3GTPK 1IN6A 1SANA 4A3MC 2V4JC 1XPPA 3I53A 1QHGA 3PIOF 1BL0A 3OREA 5BS6A 2VJIA 5JHUA 2ISYA 4HF0A 1BN5A 3GUDA 1WPKA 1IUFA 2E2HJ 1W7PA 5L3EA 3LMMA 1JGGA 4JK1X 1U8RA 1JUMA 4HG2A 1JKQC 4ZYDA 2FUG2 4IJAA 1K83K 3HTSB 3HKZD 2V79A 3T02A 1O57A 1QQIA 5IP6A 3QPSA 1QGPA 1I3QJ 4L5EA 2LMDA 4G6TB 2MD5A 3I71A 5M5YJ 3IRRA 3CDIA 1WI3A 1W1WE 4JX5A 3VSLA 2CW0F 2K5CA 3HHHA 4RM2A 5FJ8J 1Z21A 3BQYA 1YJ9I 1IDZA 1SMTA 2FSWA 3BP8A 1LB2A 3CCSI 3FZVA 3QAHA 2Y0SN 2UUZA 1ZXOA 5HDKA 5IT9K 2PMZL 1V5GA 2F5DA 5BMZA 1Y1VC 3CD6I 3GTLA 2RDPA 4F91B 5IP9J 2DDBA 4XSXF 5J1YA 2OUMA 1R6RA 4RGSA 2WAQL 2R7ZK 3GTPJ 4IKFA 2GIZA 3CJTB 3HIFA 1XPXA 1BIAA 2M0CA 4LR2A 1GVJA 2KFDA 5TRDA 5M3FK 2PBIA 1QA6A 4J19A 4MEXA 3JRFA 2HFHA 2F48A 3OL4A 4AIJA 1X3ZB 2EH3A 3GFJA 3RCOA 3OS2A 3ZQGA 3JREA 2PLYA 3UNGC 4FCYA 3BPVA 3T1BA 3G4AA 3U2RA 4B3XA 1IRFA 1XSVA 5J40A 2ZKZA 4RMFA 1Y6IA 3WE2A 3ZMTA 2CH0A 3H35A 4BU2A 4ZYAA 2NS8A 5DYMA 4PAAA 5E68A 1AU7A 1F4KA 4M9XA 4JOMA 1VLOA 2NVYJ 2JA6J 1FYMA 2E2JK 1VQOI 2B7EA 4DZJA 3OYEA 1MMDA 1WWXA 2EILH 2PMZA 4BHCA 4BDZA 1O24A 4GFBA 3BZKA 4A3FK 3DCFA 3TOBA 3GBGA 3OS0A 1UB9A 1YS7A 1YIJI 2WAQA 2HZTA 1F43A 5LRRA 2KDZA 1MBJA 1OISA 4CDGA 1B9MA 3VB2A 3K70D 3FMQA 4XOPA 1FOYA 5ILSA 2XF7A 3BUEA 2K40A 4C3JC 3DPLC 1GVDA 5TMFA 4V2FA 2F4IA 2LF8A 1UG0A 3CF2A 3L4JA 2M4KA 2R93A 1JI8A 4QPQA 5FKKA 1T56A 2G9WA 4YRVA 3DLAA 1O7FA 2D1VA 3JRHA 1K7AA 1JKOC 1VQ6I 1R9TC 4LQYA 2DK5A 2PEXA 3W2VA 4RMNA 1P7JA 4GYGA 3LA2A 4F92B 1I27A 1S3JA 3MN2A 3F8MA 2QSHX 4P5AA 5FKNA 2KJBA 2JA8C 2Y69H 4U88A 5FFZA 2F5VA 2NVTK 3S1RC 3GTMK 1DGRM 3B73A 4B09A 3T8TA 2RN7A 1VJEA 2KT0A 3EPZA 3JRCA 4FX4A 1YYVA 1F93A 1WOSA 4ZC3A 5GTIC 1MBGA 3BTJA 3CCJI 1WI9A 4A3FJ 1S7OA 4ENKA 1KQ4A 3HGYA 3FX3A 1TBXA 1N77A 1C0AA 3ZPLA 4A3DK 3BR3A 2XIGA 1YRNB 1IV8A 2CYYA 4A6EA 2E2HC 5JLXA 2CW7A 4A3EK 5ED4A 5GP9A 1MMAA 1B72A 1MH4A 2V6SA 1IO2A 1BR1A 3RYPA 2WAEA 3SZTA 2M87A 1D1CA 1I3QC 4ETSA 1AKHB 3S2DK 3COAC 4M9ZA 2ZUFA 4WK8F 3OYDA 2R7ZA 4BE0A 4I6ZA 1IV6A 3KEQA 1G2HA 5CVUA 1S9HA 1JJ6C 2W00A 1WGXA 4XKCA 3KE2A 1R4NB 1XCBA 2X51A 1SFUA 2LF7A 1JHHA 1B4BA 2CFAB 3KP5A 2KPMA 2FQ4A 4UV9A 3CCQI 1F36A 2A6TA 2VUMK 2IPQX 5IP9C 1HW2A 3G3ZA 1BIBA 2KQRA 1T98A 2GSUA 2XGCA 1SAXA 2A6HA 3Q0VA 5LHIA 1WSUA 2BXZA 5C3EC 3GTPC 2Q2EB 4KATA 4GDFA 3VEPA 3PNYA 2K4JA
chains in the Genus database with same CATH topology
1HXDA 2EV5A 2PN6A 4ESFA 3DP7A 3C7JA 4L0ZB 4HA8A 1OYIA 2FNPA 3K1PA 1I1GA 2HTJA 4L9NA 1L3LA 1T0FA 1XGMA 2A5YB 4UXNA 3GO5A 1U5TC 4KIBA 2Y48A 2NYXA 5L3DA 2VONA 3C18A 3RKYA 3K1MA 1R23A 3ULQB 1R36A 2KIUA 4M73A 2BYVE 2MH9A 2QYOA 1I1SA 1XDSA 2EK5A 4P9UA 4I0AA 2XKOA 2ZBKA 2VBWA 4YFNF 4QLCU 2PI0A 1OPCA 2LKPA 3KLOA 1R1UA 4FHTA 4MEYF 3GXOA 4CXFA 2X4HA 5D5VB 3L9FA 1QO0D 2PG4A 1O3QA 4WJ3M 3CO7C 1ZGAA 1FBSA 2IJLA 2P7VB 3K9TA 5FGMA 2D2WA 2RKHA 2VE9A 4N9IA 3DV8A 4AIHA 5ICFA 2NS0A 5LHGA 4WXCA 3I54A 4WXDA 4UV8A 1TQIA 3R60A 3VODA 4ENMA 1E2XA 1J5YA 1RZ4A 2W24A 4WXHA 2J5OA 2CWEA 3B02A 2LDUA 4IXAA 1TQPA 2P7CB 2IRFG 3SQNA 4M71A 4HF2A 3QU3A 3ZMDA 2NRAC 2IP2A 3MCZA 4A12A 1A04A 1YTYA 2M8EA 2P8TA 3BJ6A 3FWEA 3V4GA 2FEZA 3E5XA 1JHFA 4M9SA 2DQRA 1H9GA 3GZ5A 4L5JA 1RNLA 3PQKA 5HDGA 5E18F 1IN5A 4G8XA 5ICEA 3T8RA 2QM3A 1XN7A 1QNTA 3MZHA 1QPMA 2KIFA 2R7FA 3R0AA 2DBBA 3VOEA 5D8LB 4TV7A 2O3FA 2VBXA 5L3CA 1KQ9A 1ZG1A 4LLNA 2QVOA 1P4AA 4LMYA 4ZYGA 3MEXA 3VFZA 1D3YA 2K27A 4KFCA 1WKMA 1SFEA 2KKOA 4OIQF 1U2WA 2K4BA 3ECHA 4OIOF 1ZG3A 5J8CA 1LDJA 4FX0A 1JGSA 5H20A 3K2ZA 1O3SA 2X0LA 3IWFA 5K1YA 5D6FA 4WF2A 1TQMA 2L54A 2K86A 3KZYA 4ESJA 1SD5A 2JT1A 2JPCA 4GCVA 2FBHA 3F6VA 4AIKA 2UXNA 2O0YA 1HKTA 2QUFA 2E7XA 3P7NA 3JAMK 3V8KA 2KRFA 1USTA 4EQQA 5H6RA 3RYRA 3W6JB 2FA5A 5BPDA 3FM3A 1G3YA 1PUEE 1YW9A 1R00A 2OZUA 5HLHA 3SZPA 1REPC 3HRSA 1FWZA 2EA2A 2HDCA 2DFIA 1KU2A 1MJBA 4G9YA 5FLXZ 3CUQA 2J5PA 2XUBA 3SXYA 1G6NA 2DPUA 3E3VA 2L3DA 3N97A 4IRHA 1WQ2A 1P2FA 3HHGA 3BPXA 3O2PE 2PFBA 3LWFA 1P6RA 1QBJA 4NB5A 2PQ8A 4D0PA 3KZZA 5L3GA 5LLQA 3WTWC 2CO5A 2CQKA 4K2EA 2V1DA 5HS7A 1KGSA 1K79A 4OIRF 5J8FA 4F7ZA 2OU2A 1TNTA 2IA1A 4ZZDA 2OA4A 1ON2A 4LLGF 2PMHA 3ZMZA 1OMIA 3I64A 2E7WA 3BJAA 2GXBA 1Z7UA 2QLZA 4G94A 2Z33A 1BJAA 1XDUA 2FBIA 2XGXA 4L9JA 1EFWA 2OD5A 3ZMUA 4U7DA 3J81Z 2BV6A 1JXSA 3MWMA 2V1UA 1KQ8A 3RDIA 2JSCA 3BZ6A 2ACJA 2K02A 1CGPA 1W7PD 3GFMA 1Z6RA 2LNBA 2IA0A 1U78A 4IRGA 5F1RA 1FT9A 2MLGA 4ON0A 5HDNA 3GVAA 3KLNA 2Q8KA 5DDGA 1SMYF 1IXRC 3TO9A 1J9IA 4A6DA 3E6CC 3U9GA 3GFIA 3HRMA 4KMFA 3Q9SA 2A61A 5D4RA 3FM5A 4O5VA 3DF8A 2HQRA 4KYWA 1RUOA 4DNCA 1G51A 3QU6A 3EQLF 2G7HA 1GXQA 4S04A 4U0YA 3CTAA 1HKQA 1LEAA 3F72A 2GZWA 4GGGA 5H6QA 3ISPA 4OOIA 1ZHFA 3JSPA 1Z1DA 4MHGA 3FHZA 2DO7A 1BC8C 4OIPF 2EV6A 2O6GE 5E8GA 4E70A 1B6AA 3KP4A 1MDMA 1HSTA 2F5EA 1PP8F 5D5UB 4I2OA 4LK1F 2DPDA 5E20A 1IN4A 3OOPA 4AWXB 1ULYA 4Y17A 3BWGA 2G7UA 4GYIA 2XROA 4EMSA 3I59B 1R58A 5BPIA 3P9CA 4EM2A 1I6XA 1UHWA 4ENNA 1B1BA 5FO5A 2EWNA 3K1NA 2M30A 1J0RA 3RKWA 2Q0OA 3F23A 4UVBA 1MZBA 1DDNA 1HBXG 3HUGA 4RB1A 3GZ6A 1OR7A 4XLNF 2JTVA 2GXGA 1HSJA 5HLIA 4BNCA 2W85A 5EEHA 2DLLA 2NNNA 5HS9A 2EA4A 5K5QA 2ZNYA 5HLGA 4RGUA 1IN7A 1DP7P 3GX4X 3GWZA 3BY6A 4CHUA 2DTRA 4CYDA 2H94A 1W4MA 5HS8A 5HOOA 5D5XB 2TDXA 1U6GA 1SD4A 1ZN2A 2JPBA 1FLIA 4PCQA 1R5GA 3HOTA 1UCRA 3E5QA 4LJZF 2ZO4A 1IZ1A 4UHTA 1ZRFA 1R7JA 3GYHX 1YW7A 3ECOA 1OYWA 5ILUA 5A2QZ 1KYZA 2CG4A 3WE3A 1E17A 4ZZLA 3J80Z 2EFQA 1B4AA 4EJVA 3S2WA 2HEOA 2YSRA 1BI1A 1XSDA 4MEXF 2M5WA 2B0LA 4I0BA 1MD0A 3CUQB 2NNYA 1G3WA 2L01A 3L00A 1ONVA 3I4PA 4IPAA 1I5ZA 5CVJA 1USSA 4M72A 3CUOA 2HOEA 2RGVA 5E17F 3NQOA 4M6YA 2PJPA 3ZN0A 1J7KA 4GXOA 2HTSA 1IL2A 2HQNA 3P9KA 2E1CA 4MQVA 1T39A 3TGNA 5DV5A 3O6BB 1S7AA 2JRTA 5ICCA 3KP7A 3ROUA 4HZFA 4RS8A 2FBKA 3TO6A 4Y15A 1XB4A 2IW5A 2VE8A 3WTUC 3K0LA 2WV0A 3LFKA 1SFXA 4AVPA 4I01A 1RIOH 3F8FA 1XD7A 3RJPA 3RKXA 2GIVA 3H92A 1P4XA 2MH2A 4YIIA 4Q4ZF 3KP2A 4L9VA 3KFWX 4KMUX 4HLYA 2ZXJA 3T5XA 4HBLA 1C0WA 5F6FA 4JBAA 1RUNA 1ZQ1C 1B59A 3R0JA 3R4KA 1BI2A 1MGTA 3L7WA 4BH9A 1FP2A 2ADUA 3HYIA 2EB7A 2Z9OA 1ODDA 2A6HF 4A5NA 4IF4A 4CO8A 4U0WA 1ZYRF 2CGPA 1ZLJA 4EV0A 3BDDA 3M7GA 3JTHA 2XAFA 5FB2A 2YX7A 1BI3A 3RI4A 4IVNA 3F8BA 2DW4A 3F8NA 3EYIA 2RNJA 5AIQA 1EH7A 2H6BA 4L9TA 4ASNA 1FYKA 2CFXA 5E1ZB 2QQAA 2IT0A 3ML6A 4LG0B 3TKYA 4CICA 2DT5A 4R79A 3I59A 3M1EA 1ZH5A 2O03A 4KIFA 5JVTA 3IL2A 3DKWA 2MLKA 2EFNA 3WTXC 3WODF 4RAZA 5CVIA 1MDMB 3E6DA 5DD8A 2HGCA 2GAUA 3WU0A 2F5CA 1VTNC 1KA8A 2F5FA 4CGZA 4JQFA 1ZRDA 2O61A 3RPQA 3HTUA 4BHBA 3AAFA 1O3RA 1FYLA 5LGNA 4QWQA 1FC3A 4HQEA 1T2KA 2VT2A 3BROA 2VBZA 1MKMA 4KUMA 2D45A 4LB6B 5L3BA 2A69F 2Z3YA 1YFHA 3TOAA 3DQVC 3KETA 1KU9A 3RPUA 1ZGJA 3F3XA 2Y75A 5K5OA 1U5TB 2FE3A 1TTYA 1O3TA 5E1XA 3FMRA 5AONA 1LJ9A 5FLXK 1ZARA 3ZMVA 3IWZA 2FMYA 1TNSA 5HVQC 3H3ZA 5EEGA 2XAQA 1IN8A 3ELKA 1LDKB 4CZZA 2D6FC 3LQRA 1YLFA 3ZMSA 2DU9A 4EJTA 4HF1A 1KYWA 4R8HA 4G6DA 3IRQA 4I7HA 3TQNA 4RGXA 2AS5F 4PGGA 3SHFA 2ZMEB 2YR2A 3MFKA 2ESNA 5D8KB 2W25A 1K78B 4BXUA 3GW2A 3H3UA 3MQ0A 1T6SA 3ABUA 2YU3A 3PQJA 4OINF 3EETA 5ICGA 2EFWA 2XAJA 3SFZA 1SD7A 2ETHA 4M74A 4XRFA 1QZYA 4N9HA 3KP3A 2BBYA 4KNYA 2RV8A 3NRVA 3R61A 4PDKA 2OQRA 3KCCA 4NQWA 4XLPF 2JZYA 3J81K 1G4DA 3GEZA 3E6MA 4U7BA 2BEOA 3WG9A 2Z99A 3F22A 4O6JA 3TDUC 3M9AA 1FNNA 2M1BA 3QPHA 4IHSA 4HX7A 2OBPA 5K5RA 1T38A 2FRHA 2K7LA 3G73A 2P4WA 3R6SA 3I5UA 2ZJ2A 3V8LA 2COMA 2FOKA 2XV4S 2MA3A 3CJNA 4ESBA 1PP7U 1DPRA 3WTSC 1L0OC 2A68F 3LAPA 1P92A 1YG2A 1J59A 4L18B 2ESHA 4BAYA 2XKPA 4OU0A 6PAXA 3HSFA 2D1HA 1Q1HA 1TW2A 3M8EA 4G7ZF 1F1ZA 3FXQA 2YX4A 3QP6A 2GQQA 3DFGA 1W5SA 3E5UA 2QBYB 2EV0A 1B9NA 2QQ9A 2VT3A 1Y0UA 5D4SA 5LRSA 4RB3C 3TDZC 4I98B 1HKSA 1V4RA 3N4MA 5DCFA 1PDNC 1JE8A 2QENA 5ILVA 1ZLKA 1FBQA 3M8FA 1P4WA 4ZYHA 4LG0A 1XMAA 1F9NA 4NHJA 4PZJA 2FQ3A 3ABTA 2UZKA 4OMZA 1ZRCA 1IXCA 1IW7F 1Z91A 2ZCWA 1KU7A 5IT9Z 1S6LA 3CDHA 3BJOA 2HS5A 3V7CA 2EFOA 4HAMA 4LLLA 3P9IA 4AD9A 1EQRA 4XSZF 4A0XA 2VOPA 5J6XA 3CO6C 1KQ0A 5D6EA 4HV6A 3WTYC 5JFRA 5F64A 3FXUA 5CJ9A 4IRIA 5CYVA 4BHPA 3T0YA 4N0BA 3C3WA 3V7RA 5E8IA 3WTZA 4A0YA 2GWRA 4A2UA 4MTEA 4P9FA 1D8JA 4OMYA 3GLXA 5BOXA 1UHMA 3HSEA 1U5TA 5TJJA 1ON1A 3RTRA 1FBUA 5FD5A 3W6KB 2XVCA 4LK0F 4R1HA 1FX7A 1XCVA 2R3SA 4ZYEA 4WCGA 1MJ9A 4ENJA 5LGTA 1IRGA 4KT5C 4Q5SF 2QWWA 1EV7A 1ZREA 4YFXF 1FP1D 1S29A 3E97A 1W5TA 1V3FA 4KIGA 2CSOA 1BC7C 5A2QK 2ZMEA 4I02A 1R22A 3J80K 1K78A 2HYGD 3MZYA 3JW4A 4P96A 4ZH4F 2UWMA 1XGNA 5LHHA 1LVAA 1Z9CA 1BBYA 2XRNA 1Z6TA 1NHAA 4EM0B 1YQAA 3RIRA 1YIOA 3HOSA 4LD5A 3JSOA 3ZP5A 3I0TA 2FXAA 5IT3A 4O2DA 2P5LC 2ZNZA 5CVRA 2GA1A 1BI0A 1LNWA 2UXXA 1G3TA 3FXRA 1ZG5A 1CF7A 2E1NA 4LFUA 1L0WA 1QZZA 1R1VA 1FOKA 3QRFF 2OAZA 2WC2A 4M6XA 4EVIA 1STZA 3KP6A 2RVCA 2EJRA 2M45A 4EM1A 1H0MA 3QP5A 3REOA 2FU4A 2F2EA 4B8XA 4AH6A 4G7OF 1G3SA 5DUKA 1FPQA 4BYYA 3DXJF 1LDDA 2A3SA 2NAZA 1J75A 3DEUA 1H9TA 2BE5F 4P5OA 3L09A 3CLOA 2PMUA 2QZ8A 4BQAA 4HV5A 4H0EA 4EJWA 4HDUA 4I09A 4YIFA 2HKXA 2XASA 2WWYA 4KICA 5DCMB 1K6OA 5BQTA 2QBYA 3LQQA 2XAGA 1EH6A 4EGZA 3WU1B 4WX9A 4Q48A 3F8CA 1DUXC 4YG2F 3IHUA 1D8KA 3ZN1A 2GA2A 1AWCA 5LBQA 4XBFA 4MNUA 1J2XA 1TLHB 2DQLA 3OV8A 3BOQA 2STTA 5DEQA 2HWVA 2ISZA 3D0SA 2Y0MA 2BGCA 4HW0A 3F6OA 5JR3A 1IUYA 3LA7A 5L3FA 1FSHA 4A0ZA 3KEOA 4Q47A 3EUHA 4HOBA 1W7PB 4KN4X 4G7HF 3V7SA 4UVAA 5KVRA 2OZ6A 1OYYA 1AOYA 3QOPA 2V9VA 1GXPA 1XGOA 4MGRA 1LQ1A 1ZAOA 5D5WB 5DD4A 3TO7A 1OKRA 5FD6A 4Y13A 3IKTA 4S05A 2VOOA 3QPTA 4KA4A 1HW1A 4HLXA 5KK1A 1WRJA 3HRTA 3D5LA 1Z05A 2W84A 2STWA 2V6CA 3JTGA 3HRUA 2IVMA 2VN2A 5LEJA 3Q5FA 3DPTA 1YS6A 2W57A 4DQ2A 4HX8A 5CVVA 4EJUA 5LEKA 4HDVA 1SD6A 2KJCA 5LGUA 2DAOA 1O7LA 2HYFA 2MC3A 3FF5A 3LA3A 3IC7A 4L5IA 2WTEA 2P6SA 3U1DA 1R1TA 1X3UA 2H6CA 3LAJA 2EFPA 1R5HA 2RC4A 3WTVC 3NEUA 2QQBA 4LB5A 5DUIA 1UFMA 1D5VA 4P55A 1F5TA 1BOAA 1MJAA 5CLSA 3WGIA 2O8XA 4GO1A 4PGHA 1XGSA 2L4MA 2VODA 1XMKA 5JI6A 3C1DA 3K69A 3L2CA 1FSEA 2XAHA 3FMSA 2Q2EA 4Z2YA 2P5KA 2R7DA 2HKOA 2YPRA 2DI3A 2ELHA 3HSRA 3E6BA 2XHKA 1DPUA 5FFXA 4FT8A 2KIMA 4HQMA 1GHCA 2IA2A 4UUVA 4RGRA 4O3MA 1IF1A 3JAMZ 4HX4A 4UNOA 2LSOA 2L02A 2OQGA 5E1WA 3Q9VA 2DK8A 1LEBA 3V8JA 2VC0A 1FZPB 1EH8A 4LGWA 1S8NA 4IHTA 2C6YA 4RB0A 3F21A 3WGGA 1YW8A 2A07F 4MTDA 4L0YB 1BM9A 2AXLA 3ZQ7A 3WTTC 4UVCA 2H27A 4RB2C 2A6EF 2RQPA 2FNAA 1RI7A 2VC1A 2HR3A 1CF7B 5ERIA 3EDPA 2FMLA 2P5VA 4EGYA 4RAYA 4WWCA 1YO5C 2Z5UA 2H09A 3ERED 4YFKF 4G6QA 1U3EM 2MBFA 1XSXA 3IKVA 4WJ4A 5DCMA 2P6TA 2VBYA 2FF4A 5AIPA 3J7AO 3I58A 1TW3A 1KU3A 4KN7X 2ZFWA 4KDPA 3CUQC 2L4AA 4A5MA 4HYEA 3LSTA 1HQCA 3WGHA 3EYYA 3GF2A 3GFLA 1IAWA 3O3KA 4U0VA 4MQ9F 2V1XA 1HW5A 1FY7A 1IXSB 2VXZA 3MAJA 3PFIA 4EJOA 1IN6A 3I53A 5BS6A 5JHUA 2ISYA 4HF0A 1BN5A 3GUDA 1W7PA 5L3EA 4JK1X 1U8RA 4ZYDA 4IJAA 3HTSB 2V79A 1O57A 1QQIA 1QGPA 2MD5A 3I71A 3IRRA 2CW0F 3HHHA 1SMTA 2FSWA 3BP8A 1LB2A 3FZVA 3QAHA 5HDKA 5IT9K 2F5DA 5BMZA 2RDPA 4XSXF 4RGSA 3HIFA 1BIAA 1GVJA 5TRDA 2PBIA 2HFHA 4AIJA 3GFJA 2PLYA 3BPVA 3T1BA 3U2RA 1IRFA 1XSVA 2ZKZA 4RMFA 3WE2A 3ZMTA 5DYMA 1F4KA 4M9XA 1FYMA 1WWXA 4BHCA 3TOBA 1UB9A 1YS7A 2HZTA 5LRRA 4CDGA 1B9MA 3VB2A 3FMQA 5ILSA 3DPLC 2LF8A 2G9WA 1O7FA 2D1VA