2P8TA

Hypothetical protein ph0730 from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
184
Chain Sequence
EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0730
publication title Hypothetical protein PH0730 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 61
structure length 184
sequence length 186
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14544 DUF4443 Domain of unknown function (DUF4443)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p8tA01
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 2p8tA02
1R1TA 2NYXA 3I4PA 1PUEE 3T8TA 2O8XA 5DDGA 1GXQA 4EVIA 4HYEA 5FB2A 3WTYC 1WQ2A 2QUFA 2M45A 4PGGA 4EM2A 5DV5A 1ZRFA 5E1ZB 4Q4ZF 1C0AA 3R61A 2XAQA 1YIOA 3E5UA 1W7PD 4M9SA 5E8GA 3ZMVA 1MGTA 5BQTA 2D1VA 2XRNA 3ZMDA 2DT5A 3WGGA 1FYMA 2HDCA 3J7AO 3LA7A 3KCCA 2A68F 3WE2A 2HKOA 2MH2A 2QZ8A 4G9YA 1FP2A 4RB2C 3GZ5A 3VB2A 1G4DA 4UVAA 1E17A 4A0YA 1MZBA 5LHIA 1HW2A 2K02A 2D6FC 4MHGA 2ACJA 2CSOA 3K1NA 3MFKA 1Z6TA 1OMIA 4B8XA 2KIMA 2GA2A 2QM3A 4GO1A 3WG9A 2MBFA 1BC8C 5E1XA 1UB9A 4LGWA 3V7CA 5FLXK 2WTEA 3V4GA 5AIPA 4I0AA 5DYMA 3KP5A 2QWWA 2O6GE 1MD0A 5BOXA 1UFMA 3ZPLA 1B4AA 4L0YB 3RYRA 3K1PA 3VEPA 5ICGA 4F7ZA 2IA1A 1R7JA 2F2EA 4PDKA 4OIOF 1JHHA 3CUQB 1D3YA 2H27A 5J8FA 5ICFA 2M30A 4XBFA 4KICA 4HLXA 2JRTA 3ECOA 1RUOA 1R1UA 4G7OF 1OR7A 2FMLA 2MA3A 3F8NA 1PP7U 1HSJA 2RKHA 4CICA 2KIUA 2HS5A 4EM0B 1KYWA 2YX7A 3DFGA 2VOPA 3LA2A 2PLYA 3ZMTA 1S6LA 2JT1A 4IPAA 3RTRA 1JXSA 1QZYA 2QYOA 3U2RA 1FSEA 3PQJA 1O7LA 4RB1A 4KFCA 3GW2A 1I1GA 1MJ9A 5IT3A 5D6EA 4ESFA 1RNLA 2HYGD 5ICEA 4OMZA 5HS8A 4HF1A 1ODDA 3J80K 3ABTA 2A6HF 1YW9A 2AXLA 4KN7X 2EFOA 5A2QZ 4G8XA 4A0XA 1L0WA 3QU6A 2CYYA 2EFWA 1Z9CA 3DPLC 5CVVA 2CWEA 1Z6RA 2LSOA 2BEOA 4OINF 1U3EM 1F4KA 1OYYA 5DD4A 4LLNA 6PAXA 2UZKA 2HKXA 2L4AA 2ZNYA 1YFHA 4XSZF 2Z33A 1Z05A 2P7CB 5J8CA 2ISYA 1ULYA 4KT5C 3ML6A 3KP4A 1XB4A 4AWXB 1FY7A 2A69F 2XASA 1MKMA 2CO5A 5E1WA 5ICCA 4ENNA 2DPDA 1W5TA 2FEZA 4XLPF 1C0WA 4ENKA 3JAMK 3JTHA 3MCZA 2VODA 3BZ6A 4IXAA 4S05A 5ILVA 1CGPA 4UVCA 1VTNC 2BYVE 2DPUA 4WXDA 1FX7A 1IXCA 1TNTA 4M6YA 1IN6A 2ZNZA 3I58A 2CW0F 1HQCA 3ROUA 4CYDA 3RDIA 3I64A 4EMSA 4YIIA 1I27A 2RDPA 2FQ3A 3QU3A 3BY6A 3RKWA 1S8NA 4BH9A 4UV8A 3REOA 4IRIA 1D8KA 4EJUA 3SQNA 2W24A 4OIRF 3IRRA 2HTSA 4CZZA 3KFWX 2FBIA 1K78B 2Z9OA 4XLNF 4UVBA 3DPTA 4O5VA 2LNBA 1IRFA 1KGSA 2OZ6A 4HOBA 1HW1A 3ZN1A 5CLSA 4CO8A 2Q2EA 2RVCA 3CTAA 3CUQA 2HEOA 3P9KA 1DPRA 5DCFA 1KYZA 3K69A 1FYKA 4P55A 4IF4A 1A04A 4HQEA 2W25A 3GVAA 4FHTA 3SZTA 3J81Z 3R60A 1YYVA 3L7WA 3KEOA 3K1MA 4I09A 4RGXA 2OZUA 1UHMA 5HDGA 1T0FA 2F5DA 3I5UA 2YR2A 4M71A 5KK1A 2KJBA 4WF2A 4Y17A 2D45A 3WU1B 1SD5A 3U1DA 2PJPA 2H6CA 2RN7A 1F9NA 5CVRA 4EGYA 4CDGA 5TRDA 1R5GA 3I53A 3IC7A 3V8KA 5L3BA 5D5VB 3GFJA 1DPUA 4MQ9F 3R0AA 1J0RA 4FT8A 3ERED 3TO7A 2DTRA 3I0TA 1ZAOA 5LRRA 2R3SA 3WTZA 2PN6A 3LAJA 1HKQA 5D5UB 2K86A 3F6VA 2LF7A 4HQMA 4L5IA 2X4HA 2E7WA 4I02A 1G3YA 2JZYA 4N9HA 2FRHA 1ZREA 1KQ8A 1GHCA 3E6MA 3SHFA 2DO7A 1SMYF 4MEYF 3BPVA 3R0JA 1D5VA 1ZLKA 2ZMEB 3CLOA 4LJZF 4LMYA 3FXQA 3L09A 4EJVA 4OIQF 2NNYA 2EFQA 4KYWA 2L4MA 5JVTA 4M9ZA 4LLLA 1BOAA 5D8KB 4BNCA 4UV9A 3WTTC 2OA4A 1XMKA 2P5VA 4WCGA 2GA1A 5K5OA 4U0VA 2O0YA 2V1XA 4LK0F 5ED4A 4PZJA 3GX4X 3FXRA 2R7FA 5HLHA 1BI0A 5F64A 1P4AA 1SAXA 1U8RA 1O3RA 4G6QA 2GZWA 4ETSA 3OOPA 3WTWC 2RV8A 3HSRA 3GXOA 1K78A 2D1HA 3SFZA 4A6EA 2HTJA 4G7ZF 3RIRA 3FMSA 5KVRA 5D5XB 3FZVA 3TO9A 4MGRA 5BS6A 3C18A 4ZYGA 1Y0UA 3MEXA 3V7SA 2EFNA 1FBQA 1SD4A 1ZN2A 1J2XA 1STZA 4KA4A 2FU4A 3F22A 1F5TA 2VONA 1BI2A 4ZZDA 2NRAC 2H94A 1IUYA 4EJWA 3GFMA 1WSUA 2E1NA 4GCVA 4IRHA 4Z2YA 3TDUC 3RYPA 4ENJA 2EK5A 3NQOA 2J5PA 4JK1X 4A5MA 1EV7A 1IL2A 3MAJA 5HLGA 3RJPA 4NQWA 4NHJA 2QVOA 4UUVA 2IJLA 3ZMSA 1I6XA 3M8FA 1ZLJA 5ERIA 3VFZA 4N9IA 1J9IA 1YO5C 5H20A 3ISPA 3WTUC 2JPBA 3K2ZA 3BJ6A 3G73A 1HKTA 1KA8A 1ZGAA 5K5QA 2FMYA 1FP1D 3IRQA 2MH9A 4GYGA 4EQQA 3KP6A 1T38A 1L0OC 4Y13A 1EH6A 4U0YA 4GXOA 4ZH4F 3F72A 4WK8F 2VE9A 1W5SA 4BQAA 3RKYA 1P4XA 3IKVA 1QBJA 1QPMA 3J80Z 2CG4A 1B9MA 4R1HA 3WODF 4HAMA 1YW8A 3FF5A 2KIFA 1MJBA 4HBLA 4M74A 3CO6C 1J59A 2ETHA 4L18B 2JTVA 3QRFF 1P2FA 4RB3C 1XMAA 1XSXA 3Q9SA 1BBYA 3RPUA 1SD6A 1YG2A 1I1SA 2QQBA 2IP2A 1BC7C 4BXUA 2K27A 4WXCA 1XDSA 2ZMEA 4HLYA 4MEXF 4P9FA 3U9GA 1XGNA 3H92A 2L54A 4L9JA 1FSHA 2HQRA 1ZG5A 4MTEA 3FHZA 3L00A 2EFPA 2CQKA 1P6RA 3RPQA 3HTUA 3ECHA 4FX0A 3LQRA 2OD5A 4EJTA 5F1RA 5E18F 1H9TA 2IA0A 4O3MA 3BDDA 4IHTA 2XIGA 1IZ1A 4EGZA 3TDZC 4D0PA 2LDUA 4H0EA 2K7LA 5DD8A 3JAMZ 2UXNA 1B1BA 3M9AA 3OV8A 1YLFA 1U6GA 3NEUA 3GFIA 1MDMB 1JE8A 3O2PE 2Q0OA 3LQQA 3P7NA 3DQVC 4XRFA 2XUBA 5LRSA 2NAZA 2ZCWA 2VN2A 3KLNA 4RAYA 5DCMB 3WU0A 1G6NA 4A2UA 5DUIA 3B02A 4ON0A 4HDVA 3COAC 4RGRA 1KU7A 1LDKB 4LLGF 5LHGA 5L3DA 1LDJA 1ZG1A 1IN5A 2ZFWA 3E97A 1K7AA 2KRFA 2BBYA 3LWFA 3H3UA 1FT9A 3LA3A 1OYWA 2GXBA 5IT9Z 1RIOH 4BHCA 4BHPA 1HXDA 1BN5A 2HQNA 3NRVA 3E6DA 3KLOA 1EFWA 4HDUA 2HWVA 4RS8A 4G6DA 4R8HA 1R58A 2LF8A 4IHSA 2OAZA 2ADUA 4GYIA 3CUQC 1J7KA 3QPTA 2KJCA 4BHBA 1QO0D 5LBQA 2QBYB 2BV6A 2P5KA 2F5EA 3SZPA 1DP7P 5A2QK 1SFUA 4I01A 2PMUA 5ILUA 1XCBA 5FD5A 1R1VA 5FD6A 3JSOA 3R6SA 3BP8A 1WKMA 1USSA 3IL2A 4WWCA 5LEJA 1KQ9A 2ESNA 3ZMZA 3IWFA 2VC0A 4PCQA 1P4WA 1SFXA 3FM3A 5CVIA 1XGSA 1HW5A 5D6FA 1WWXA 3LSTA 4HX7A 1B59A 3M1EA 1JGSA 3BOQA 3LAPA 2FSWA 5EEHA 3ELKA 3O6BB 1B9NA 1QGPA 1ZRCA 4YFXF 1HBXG 4ESJA 3KZYA 4AIKA 3PFIA 4IJAA 3H3ZA 1H9GA 2DFIA 2NNNA 4MQVA 3M8EA 1LVAA 1ZYRF 4LFUA 2HR3A 4KMUX 3K9TA 1FBSA 2E1CA 3GO5A 2DQRA 3IHUA 1W4MA 3E5QA 1IXRC 2DBBA 3HHHA 2VBWA 3MZYA 5JR3A 4ENMA 2VBZA 1TW2A 2CGPA 2Y75A 2QLZA 4Y15A 3TQNA 3WGIA 4U0WA 3ULQB 2FBHA 3V8JA 3TKYA 2ESHA 3F6OA 2VE8A 2ZXJA 3HRTA 3C7JA 3F8BA 4KN4X 1O3QA 1FBUA 1K79A 2XGXA 1MDMA 1IAWA 1X3UA 1XDUA 2YPRA 3L2CA 1RZ4A 4YFKF 5DCMA 2A07F 4A12A 4IVNA 2WC2A 1DUXC 1FWZA 4CHUA 1TW3A 4U88A 3KEQA 1CF7B 1YS7A 5DUKA 3W6JB 2W84A 5FFZA 4Q5SF 1O3SA 4E70A 2IT0A 1USTA 4JBAA 3CUOA 2STTA 3WTXC 2ZO4A 2MLKA 3I59B 3M7GA 1T6SA 3G3ZA 1RI7A 5L3GA 1YS6A 5H6RA 2B0LA 4QLCU 5HS7A 3TO6A 3KETA 2EV0A 1R5HA 3V8LA 2D2WA 4AVPA 3F3XA 2ISZA 3DKWA 2K4JA 2BE5F 2M87A 3C3WA 5D5WB 3FWEA 2V1UA 2W57A 2XV4S 2YSRA 4RGUA 2AS5F 4QWQA 3ZQ7A 1SMTA 2FE3A 5DEQA 5CYVA 1IRGA 1XGOA 2FOKA 1MJAA 3WGHA 2QBYA 1U5TA 4MTDA 1O57A 2M1BA 3FX3A 3HRSA 2UXXA 1Q1HA 1FOKA 1YTYA 2PBIA 1T2KA 4L9TA 4M73A 1LJ9A 1W7PB 3E5XA 2PMHA 2Z3YA 2GQQA 2HYFA 3TGNA 2MD5A 4KDPA 3FM5A 1V3FA 4EV0A 3N4MA 2VT2A 3DEUA 5LGTA 2F5FA 3DF8A 3HOSA 2GWRA 3B73A 1G3SA 4YFNF 3KP3A 4JQFA 2W85A 4BAYA 2DAOA 2XAHA 2F5CA 4LD5A 4UHTA 4EM1A 3RKXA 2P6SA 4KNYA 1RUNA 1XCVA 1L3LA 3AAFA 3E6BA 3P9CA 3T5XA 2JPCA 2VXZA 2QENA 4B09A 5J6XA 1IF1A 4IRGA 1DDNA 4UXNA 2STWA 1TQPA 2PFBA 1XSVA 5FLXZ 1G3WA 1V4RA 2JSCA 1PP8F 2XAJA 4CGZA 1PDNC 4HZFA 3QOPA 5L3CA 1JHFA 5K1YA 1IW7F 4WXHA 3RI4A 4WJ3M 2P8TA 1Z1DA 1FLIA 2R7DA 2IVMA 1LEBA 4LG0B 4S04A 3HSFA 2C6YA 2A61A 1U78A 3JTGA 1U2WA 1EH7A 2YX4A 2M8EA 2A6EF 2O61A 3ZN0A 3DV8A 2MC3A 1KU3A 2A5YB 4I0BA 1J75A 1S29A 5LGNA 4L9VA 3W6KB 5JI6A 3BWGA 1S7AA 1O7FA 2P7VB 3IWZA 3FMQA 1ZG3A 2V79A 3R4KA 1P92A 3GLXA 4KIBA 1QZZA 2J5OA 1QQIA 4Q48A 4CXFA 4HV5A 4HF0A 2RNJA 4L9NA 1TQMA 3MWMA 4EJOA 1EH8A 5LLQA 2IA2A 4LB6B 1CF7A 1FZPB 4K2EA 2XKPA 3TOBA 2FXAA 4DNCA 4HA8A 2O03A 5HDNA 3KP2A 3O3KA 4OMYA 3EQLF 1SD7A 3HYIA 3I59A 3SXYA 1BIBA 1T98A 1OYIA 3FMRA 2DQLA 4KMFA 2A3SA 4HF2A 1LDDA 5CJ9A 1FC3A 3Q9VA 3HRUA 2EV6A 3MZHA 4KIFA 2Z99A 2Z5UA 3BROA 4MNUA 4GGGA 4KIGA 3GWZA 2ELHA 1G3TA 2FBKA 3EYIA 2HZTA 2DU9A 1XGMA 5FFXA 4BYYA 3L9FA 4G94A 1B6AA 2Y0MA 4G7HF 5BPDA 1WRJA 5JFRA 4RB0A 1W7PA 1TTYA 1XSDA 1LNWA 4U7BA 3CDHA 1I5ZA 3GF2A 3QPHA 2ZBKA 2PEXA 2XHKA 5K5RA 2G9WA 4U7DA 2XAGA 1UHWA 1R22A 5ILSA 2PG4A 2V9VA 4OIPF 3JW4A 1BIAA 1ONVA 2OBPA 2DK5A 2VBXA 1SFEA 3GEZA 4KUMA 5E17F 4ESBA 2GXGA 2DK8A 1KU2A 2GIVA 5LHHA 2LKPA 1LEAA 3V7RA 2EV5A 3GYHX 2NS0A 4WX9A 1E2XA 1YQAA 2COMA 3QP5A 3HHGA 2EB7A 3D5LA 2HGCA 3N97A 1ZARA 3GFLA 2P4WA 1K6OA 1R23A 2QQ9A 2VOOA 4AIJA 2FNPA 3TOAA 1J5YA 1ZRDA 4LG0A 4PGHA 2GAUA 1BI1A 2FA5A 2RQPA 5HOOA 1U5TB 5HS9A 3ABUA 2Y48A 1F1ZA 3GZ6A 3BPXA 2OU2A 1GVJA 2CFXA 1IN8A 1XD7A 3C1DA 2WV0A 3D0SA 1XN7A 4TV7A 1LB2A 4WJ4A 1ON2A 2H09A 1Z7UA 3F23A 3HRMA 4P96A 5HLIA 3F8CA 1WI9A 2HOEA 2IRFG 1KQ0A 5D4SA 2Q8KA 2RGVA 3FXUA 5TJJA 2MLGA 4HV6A 3E3VA 4A0ZA 3KE2A 5BMZA 3DXJF 2UWMA 3HSEA 5FO5A 5D8LB 4AIHA 5IT9K 5HDKA 1FPQA 3HOTA 1EQRA 1HKSA 2E7XA 4YIFA 4M6XA 1OPCA 4L0ZB 2V6CA 4A6DA 4RMFA 2O3FA 4N0BA 2EJRA 4LB5A 3E6CC 3JSPA 4OOIA 3I54A 2IW5A 5L3FA 2HFHA 4I7HA 1D8JA 2EA4A 1QNTA 5JHUA 2KKOA 1OKRA 4HX8A 1AWCA 2EA2A 4YG2F 3VOEA 3IKTA 4AH6A 2IPQX 1FYLA 4L5JA 4OU0A 2PQ8A 2WWYA 4RAZA 5CVUA 1HSTA 1Z91A 1FNNA 4ZZLA 1TQIA 4FX4A 2G7HA 4P5OA 5H6QA 5FGMA 5E20A 1R36A 2P6TA 3WTSC 3BJAA 3HIFA 3WE3A 3T8RA 4P9UA 1R00A 2ZJ2A 2X0LA 3LFKA 2YU3A 1G51A 4O2DA 2XROA 1KU9A 4I98B 5AONA 3KP7A 1ZGJA 2OQGA 1TLHB 2DI3A 2BGCA 2L01A 1ZH5A 3T1BA 5EEGA 4HW0A 2PI0A 1U5TC 4AD9A 4ASNA 3DP7A 4R79A 3HTSB 1IN7A 1ON1A 1ZHFA 1TNSA 1BJAA 1O3TA 4HX4A 2DLLA 2FF4A 3K0LA 5E8IA 4ZYHA 4M72A 1IXSB 3J81K 3EETA 1T39A 2VT3A 1ZQ1C 3P9IA 3GUDA 2QQAA 1H0MA 3F21A 1GXPA 3S2WA 2OQRA 1LQ1A 3EUHA 5BPIA 4ZYEA 3QP6A 5HVQC 2K4BA 4ZYDA 2DW4A 3CJNA 1TBXA 3I71A 4A5NA 1REPC 1AOYA 5LGUA 5AIQA 2P5LC 2L3DA 1BI3A 3EDPA 3WTVC 3ZMUA 2XVCA 1UCRA 3HUGA 4DQ2A 3T0YA 4NB5A 3VODA 3F8FA 1BM9A 2EWNA 3MQ0A 2H6BA 3BJOA 4XSXF 1S7OA 5L3EA 3CO7C 3Q5FA 5D4RA 4M9XA 3EYYA 1S3JA 2FNAA 2M5WA 1NHAA 1YW7A 4LK1F 3QAHA 4RGSA 4UNOA 2XAFA 3F8MA 4I2OA 2XKOA 5LEKA 2TDXA 1IN4A 3KZZA 2ZKZA 2VBYA 2G7UA 2V1DA 4Q47A 4O6JA 3PQKA 3ZP5A 2L02A 5F6FA 2RC4A 5CVJA 2VC1A
chains in the Genus database with same CATH superfamily
4PJ0C 1R1TA 1K83J 2NYXA 4DJAA 3I4PA 1PUEE 2L7FP 1R9TK 3T8TA 2O8XA 2GAHC 2VKEA 2RREA 5DDGA 1GXQA 4ITVA 2KMUA 4EVIA 2ZJRF 4HYEA 2KDZA 1I39A 4W1UA 5J1YA 2E2IJ 2R7UA 5FB2A 1MMDA 2EZKA 3H36A 3WTYC 3BZCA 1WQ2A 2QUFA 2M45A 2QF7A 4PABA 4XKCA 1YIJI 1IV8A 4KN4A 1E3HA 4PGGA 1K83A 4EM2A 2ZJPF 5B66C 5DV5A 1ZRFA 1HDPA 3S17J 2EBBA 5E1ZB 4Q4ZF 3D1NI 3R61A 1C0AA 3GTLA 3G1LA 2XAQA 5EG0A 2V6EA 1YIOA 3E5UA 1AKHB 5FKLA 3OYEA 4BKWA 4DGWB 5JVOA 3DPUA 4LG3A 1W7PD 3HKZL 4M9SA 1VQ7I 5E8GA 4CCJA 4YIRX 3ZMVA 1MGTA 2KZGA 5BQTA 2R92C 4PJNA 1QZEA 2D1VA 3H1CA 5LD2C 1JT0A 2XRNA 2VLAA 3IH2A 3ZMDA 1FTTA 3I4NJ 2DT5A 3OYNA 3WGGA 1I6HC 1FYMA 4IOCF 2HDCA 3J7AO 3LA7A 3KCCA 3FDYA 2A68F 2MSYA 4DW6A 4G6TB 2NVQC 3WE2A 2I10A 2HKOA 2ID3A 2MH2A 2QZ8A 3A0HC 4G9YA 1FP2A 4XRSG 2I5UA 4RB2C 3GZ5A 3DKXA 4II3A 3VB2A 2E60A 2OCEA 3ONQA 1K61A 1TWFK 1G4DA 3BR1A 5GAGJ 1LFBA 1OR7C 1K4SA 2DA5A 4UVAA 4FETA 4XMYA 4MQ9A 1E17A 2EH3A 1MZBA 4A0YA 5LHIA 1HW2A 4XRSA 2ELKA 2K02A 3ZGKA 1Y1WK 2D6FC 2NVTJ 1JKRC 4MHGA 2ACJA 2X6OA 2CSOA 2ZC2A 5C4JK 4GTAA 4Y33A 1BR4A 3K1NA 3MFKA 4YFKA 1Z6TA 1OMIA 4B8XA 2KIMA 2GA2A 5CPRB 2QM3A 2HI3A 3S8PA 2YS9A 4GO1A 3BC8A 4F52A 5C4XC 3WG9A 2MBFA 1BC8C 2LY1A 5E1XA 3M3YC 1UB9A 4LGWA 5EGEA 3V7CA 3OYFA 1ZR4A 2V9PA 5FLXK 2WTEA 1VRQC 4XORA 4NC7A 3ABLH 4I0AA 5AIPA 5DYMA 3V4GA 4N4OB 1FJLA 3KP5A 2QWWA 3RZDK 2O6GE 1MD0A 5BOXA 1ETYA 1UFMA 2R7ZC 2VQHA 2CQXA 4RAFA 1B4AA 2XSDC 3ZPLA 4ABZA 4J19A 3GTGC 4L0YB 3RYRA 3K1PA 3VEPA 5ICGA 1R71A 4X6AJ 4F7ZA 5C3EK 2L7MP 5JVGF 4A93C 2IA1A 3PNYA 1R7JA 2F2EA 4PDKA 4OIOF 1M1EB 2WAFA 1JKPC 3L2VA 1UHSA 1JHHA 2Q2EB 3CQZC 5F27A 3CUQB 1D3YA 2H27A 1XX5A 2IGNA 5J8FA 5ICFA 1NH3A 3CD6I 3DTIA 1F36A 2M30A 4XBFA 4Y52J 4KICA 4BEHB 1UAAA 1SMYA 4MEYA 2EIMH 1WSVA 2XCOA 3VYTB 4HLXA 2DDAA 1BL0A 4FCYA 2JRTA 3ECOA 1RUOA 1R1UA 4G7OF 1OR7A 2FMLA 2MA3A 3F8NA 3C2GA 2FD5A 2R7TA 3BQZA 5FJ8K 4FQGA 1INNA 4RMNA 2L9SA 1PP7U 3S1QC 3DWLE 4X0GA 3H3VK 1Y1VC 4A3FK 3DLAA 1HSJA 2RKHA 4LJZA 3LSJA 4CICA 2KIUA 2HS5A 4UUTA 3W2WA 4CCLA 4EM0B 4I76A 4YRVA 1KYWA 1I3QK 2YX7A 3DFGA 3RQIA 3RZOC 2VOPA 3LA2A 1S72I 1K6YA 2PLYA 3ZMTA 1S6LA 2JT1A 3VYRB 4IPAA 3RTRA 1UJ8A 1WVRA 1JXSA 1QZYA 2FQ4A 2QYOA 1F93A 3H0GK 2V9KA 1X4OA 3U2RA 3OR1C 2FOWA 1FSEA 3BCBA 1O7LA 2KFDA 3PQJA 3GW2A 4RB1A 4E7HA 1OCTC 4KFCA 1WQGA 1I1GA 1FIPA 1MJ9A 2AQEA 1BS2A 3OYJA 3H5NA 4A3EJ 5IT3A 5D6EA 4ESFA 4A93J 2KPMA 3LFUA 1RNLA 3Q0UA 4A3IC 4DZPA 2Y2ZA 4LK0A 2R7ZA 2VPRA 2HYGD 1VQPI 5ICEA 2R93J 4OMZA 5HS8A 4HF1A 3GTGA 4QIWN 1ODDA 2M34A 3J80K 3ABTA 1A6QA 2A6HF 3OYGA 1YW9A 2AXLA 4BL0B 4A3MJ 3A01B 3S1MJ 2N8GA 4S0HB 3L2QA 4KN7X 3CMMA 1VQOI 1XTAA 2JA8J 4YFNA 4A3JK 1QVUA 2EFOA 3GMEA 1J6VA 3AH5A 4C3HJ 2R93A 5KCMA 4V19K 1D0XA 4KATA 3K2AA 5LFAA 4BBRJ 5A2QZ 1U8BA 1F7VA 4G8XA 4A0XA 1O25A 1L0WA 3H9GA 1IO2A 3DEEA 3QU6A 2ZJQF 2CYYA 3GTOJ 4BY1C 2DMUA 4XLCA 2ICWG 2EFWA 1Z9CA 2G0EA 3DPLC 5EZHA 5CVVA 2HOTA 4G7ZA 4LOWA 1WCMC 2CWEA 1Z6RA 2LSOA 5JFEA 2BEOA 2M7BA 3PUFA 4OINF 4BE1A 1U3EM 1F4KA 2NVXJ 1OYYA 1K83K 4NDLA 5DD4A 4LLNA 6PAXA 2UZKA 3GTOA 2HKXA 2MD0A 2L4AA 4CA0A 2YUSA 2E2IK 3IUOA 2E2HJ 2VJIA 3FK6A 2ZNYA 1YFHA 5L46A 5FLMJ 3F0CA 1WI3A 2M8GX 4XSZF 2V6SA 2Z33A 1Z05A 2P5MA 1R6RA 2P7CB 5IORA 3AG2H 1PJ5A 1TWCJ 2ISYA 5J8CA 1ULYA 4D1QA 4KT5C 3ML6A 3S17K 3KP4A 3DU6A 1RPWA 1XB4A 1X31C 4AWXB 4C3JJ 1FY7A 2DMQA 2JA6J 2A69F 3HOVC 2XASA 1MKMA 2CO5A 5E1WA 5ICCA 4ENNA 3OS0A 2DPDA 3L1PA 3JR9A 1W5TA 1R5ID 2FEZA 2TCTA 4Y7NJ 4XLPF 2M4KA 3HOZC 1TWCA 5M5XK 3I3LA 1AKHA 3JSTA 4P9SA 1VI0A 1C0WA 2BY1A 4ENKA 2JJ7A 1OCZH 3JAMK 3I4NK 3JTHA 5EF6A 3MCZA 2IXSA 2VODA 3BZ6A 2RQQA 4IXAA 3L2RA 4S05A 4XLAA 1WORA 5ILVA 4A3LC 1CGPA 3NAUA 2RAEA 4UVCA 2PPBA 1VTNC 2BYVE 1D1BA 2DPUA 3OYCA 2JA7J 2QQ8A 4WXDA 1FX7A 4E4HA 1IXCA 1TNTA 5M5WK 2MYSA 4M6YA 1IN6A 1K4TA 5IYCJ 2DOFA 2ZNZA 3ZQQA 2NVTK 4QSHA 3I58A 1R9TC 1G8XA 2XCQA 2JA7A 3ZQGA 3D5RC 2L2OA 4KARA 3LSRA 2CW0F 3M4OJ 1HQCA 3FHNA 2XGEA 3ROUA 3JCUC 4CYDA 2CUFA 3RDIA 3BTCA 1YX5A 3PFYA 3I64A 1LUJB 4EMSA 4YIIA 1HOMA 4KDDA 5GPCA 4BXXJ 1I27A 3OS2A 2RDPA 3CMYA 2CQQA 2FQ3A 4UY8I 2O9LA 3QU3A 3BY6A 3RKWA 1S8NA 2ECBA 4BH9A 2HOSA 4XL9A 4ZH4A 4UV8A 3REOA 2WAQL 2IGKA 4IRIA 1VJEA 3GZNB 3HOWJ 3K4CA 1D8KA 4QPQA 5M3MJ 2VASA 4EJUA 3RSNA 3SQNA 2W24A 4OIRF 4A3LJ 3IRRA 2HTSA 4X6AK 1DCOA 2QA4I 3DBRB 4CZZA 3KFWX 4RM2A 3L2UA 2FBIA 2XPWA 1K78B 2Z9OA 2HZDA 4XLNF 3EQLA 4UVBA 3DPTA 4O5VA 2LG4A 2LNBA 4P1WA 5C44K 1IRFA 1KGSA 2OZ6A 1TT0A 4HOBA 2K3PA 1HW1A 1J6WA 4Y52K 3ZN1A 5CLSA 4CO8A 4NOIA 2Q2EA 2RVCA 3CTAA 3CUQA 1TWFC 4HNTA 2HEOA 3HG9A 1E3OC 3P9KA 2BVLA 1DPRA 3FXKA 3HGGA 4KB2A 5DCFA 4F93B 1KYZA 3W6VA 1IRXA 1J09A 3K69A 4BEHA 1FYKA 1E0EA 4V2FA 2LFBA 1NG6A 1Y1WC 4P55A 2EZIA 1A04A 2X1CA 2B7EA 4IF4A 2A6TA 4HQEA 2DJIA 3M1CA 3ABMH 2W25A 2E71A 3GVAA 5EG0B 3SEQA 4FHTA 3SZTA 3OSFA 1MH4A 3QYFA 4MEXA 5C4JC 1ACIA 3GEEA 1O2AA 4JOMA 3H3VD 4H4KC 3J81Z 1TP4A 3R60A 3PIOF 1YYVA 3L7WA 3KEOA 1W1WE 5KAIC 1X3WB 4BS9A 5B5EC 3A0BC 3K1MA 4I09A 3VPRA 2KDOA 4RGXA 2OZUA 2GLOA 4KMAA 1UHMA 1V5VA 3G2BA 2LY9A 2W1OA 5HDGA 1T0FA 4M3DA 4BQQA 2F5DA 3GSIA 3I5UA 2YR2A 4M71A 3WU2C 2Y3PA 5KK1A 1TL8A 1LPQA 2KJBA 4WF2A 2OJED 2WB1N 4A3EK 4Y17A 3RZDC 2D45A 1ETOA 3K10A 3WU1B 4A3GJ 1SD5A 2HPMA 3U1DA 1SVMA 3A1YA 3DCFA 4IEJA 1O2BA 2GOMA 2XB0X 4GTFA 1RETA 3BCAA 4BJ5C 3FISA 2R93K 2PJPA 5C3EC 1MBKA 2WAEA 2H6CA 3OR2C 1F7UA 1I50J 1RU0A 2ZB9A 2RN7A 1YX2A 1F9NA 4A3MK 3S1MK 5CVRA 4EGYA 4CDGA 4NQWB 1V55H 1HLVA 1ZELA 3N0BA 5TMCA 2JA8K 5TRDA 4C3HK 3BG5A 3W2VA 3LSHA 1R5GA 3I53A 3A01A 3IC7A 3V8KA 5L3BA 2XGDA 2DMNA 5D5VB 1LFUP 3GFJA 2B63J 1DPUA 4BBRK 4XN0A 4YEJA 1I50A 4M6VA 4MQ9F 3GEIA 3R0AA 1J0RA 4XLHA 4GFBA 3GTOK 2NXNB 4XN3A 2K9LA 4LLGA 3Q0VA 1JGGA 4A3FC 1Y8QB 5B3SH 4FT8A 2B63A 3CP2A 3ERED 2NVXK 1FOYA 3TO7A 3IAM2 2DTRA 4RBOA 4ZDOA 1I3QC 3I0TA 1ZAOA 5LRRA 2VQCA 2R3SA 4MFDA 3OYDA 2E2HK 3WTZA 3LPXA 2PN6A 2Y0SN 1LKXA 3K4BA 3K4MA 5FLMK 5H2FC 3LAJA 2YU9J 3H0GC 2D5VA 1VQ8I 5FLVA 2P81A 2DYRH 1HKQA 3QQAA 1DD5A 1TWCK 1FTZA 4LIUA 2EIKH 5D5UB 2K86A 3F6VA 4RM3A 2LF7A 4IQ4A 1OCOH 5EGOB 4C3JK 2JA6K 1SFKA 4HQMA 4L5IA 3TP0A 4Z6YA 3KYCB 2X4HA 3KPHA 4JX6A 3S3OA 1SEUA 2E7WA 4I02A 4Y7NK 1G3YA 1VF9A 1WGXA 2JZYA 4PSWA 4N9HA 4XIDA 2FRHA 2KWAA 1ZREA 3BP3A 3F9KA 2VJ4A 4MLOA 4B4CA 1KQ8A 2OUMA 1GHCA 2Q1ZB 3E6MA 2HXOA 3SHFA 2DDBA 1OFCX 3M07A 3GDZA 2DO7A 2NOJB 4A3JC 1Y6IA 2FUG2 1SMYF 1A36A 2BXZA 3EUAA 3HZJA 4MEYF 3BPVA 3R0JA 1D5VA 1ZLKA 2NS7A 2ZMEB 3CLOA 4RDUA 4AYBN 5HLTA 2JA7K 2VI6A 1GT0C 1VFCA 1EKEA 3ZQFA 1OQYA 1W36D 1EJ9A 4LJZF 4LMYA 2ZXHA 3FXQA 3L09A 4EJVA 4OIQF 3PM1A 5IYCK 2NNYA 2EFQA 4KYWA 1K83C 2L4MA 4D9JA 4BACA 5JVTA 3ERMA 4M9ZA 4LLLA 1BOAA 3BQYA 3HOUJ 1I3QA 1BJTA 2L7KA 2ZUFA 3M4OK 4IHVA 2E2IC 5D8KB 3A4CA 5B1AH 4BNCA 4UV9A 2KL4A 5M5YJ 3WTTC 2OA4A 5TMFA 1XMKA 4B1RA 2P5VA 2R7RA 5M3FJ 1IG7A 4WCGA 2GA1A 4BXXK 5K5OA 3S15J 1WIHA 4U0VA 3S17C 4M1XA 2O0YA 2QSFX 2E35A 1X1DA 2V1XA 4C2UA 4KMUA 1WJAA 4LK0F 5ED4A 4GTLA 4PZJA 1GLNA 3GX4X 3DXJA 1RR8C 4GT9A 3FXRA 2R7FA 4DYRA 4A3JJ 3HOWK 5HLHA 3N3YA 3ZXSA 1BI0A 5F64A 3H0DA 1Z3YA 2XGCA 3TL4X 3LSKA 1P4AA 1SAXA 1S9HA 3CZ6A 3NARA 3FIWA 1U8RA 3V42A 2JUCA 1IGNA 1F43A 1O3RA 3I4NC 5KAFC 3TFJA 4G6QA 3D5SC 1H89C 5TISC 1WOPA 3VYSB 5GADJ 3VWBA 3TW6A 2DA3A 1N78A 2GZWA 4ETSA 3OOPA 2VKDA 5IOTA 1UG0A 1V54H 1AU7A 4XLFA 1JVIA 3JRIA 3U1KA 3WTWC 2RV8A 3HSRA 3GXOA 1H88C 1K78A 2D1HA 4E7KA 3SFZA 4A6EA 3VA7A 1ETQA 2HTJA 4G7ZF 1W36C 1X2NA 3RIRA 3W2AA 5HNFA 3FMSA 5KVRA 5D5XB 3FBNB 3HKZN 2VL8A 2P0WA 1DU6A 3HPHA 2L9NA 1ZKGA 3FZVA 1FEXA 3OEPA 2CW7A 3TO9A 2GOXB 4MGRA 5BS6A 1MSFC 2DT6A 1ZYRA 3C18A 4ZYGA 2NVTC 3A8JA 1Y0UA 4G0WA 3MEXA 2KQRA 3HEFA 3V7SA 2EFNA 3CDIA 1WJ5A 5IOYA 5IOZA 1FBQA 2QSGX 1SD4A 4NC6A 1ZN2A 4BY7J 2E2IA 3HPGA 1UG2A 1J2XA 1STZA 3MN2A 2GIZA 4AUXA 1JUMA 3BZKA 4KA4A 3HL2A 4YG2A 1MBEA 4B48A 5IYBJ 2FU4A 3F22A 2M9HA 1F5TA 4A3BJ 2HNHA 2E2JJ 5M5XJ 2VONA 4MFEA 3S2DJ 3BG7A 5IOQA 1BI2A 3OREA 4ZZDA 2QSHX 2NRAC 4KM8A 1XXBA 1V5GA 2NOGA 2H94A 4U87A 1MH3A 1IUYA 1U0JA 4A3GK 3AD9C 4EJWA 1VQ9I 4OAZA 2V6TA 3GFMA 3SDBA 1WSUA 4E7IA 2WB1A 3BLYA 4CUGA 2E1NA 3PIPF 4GCVA 2K3FA 4X6AC 1TWHJ 4IRHA 4Z2YA 2A05A 3CJTB 3TDUC 4GRIA 4D7MA 1EH1A 3RYPA 2E1MB 2HOAA 4ENJA 1I50K 2O7OA 1POGA 2EK5A 2HQ5A 3NQOA 2J5PA 4JK1X 5M5WJ 4P5BA 4A5MA 2E1OA 2ZFZA 5C44C 1EV7A 1IL2A 1X1AA 3T02A 2X9DA 3MAJA 2AQFA 4Y52C 5E79C 5HLGA 3LSIA 3RJPA 3DBLB 4NQWA 4NHJA 1TWHA 2QVOA 2B63K 3H5AA 4UUVA 4FZBA 2IJLA 3ZMSA 1XXCA 3SZYA 3B6CA 1I6XA 3M8FA 1DCHA 1VQ6I 1WSRA 1ZLJA 5ERIA 2DXIA 3VFZA 3O8HA 4N9IA 5EZGA 1YO5C 1J9IA 5H20A 1BR2A 1ETXA 3CF2A 1X19A 2LR8A 3ISPA 3WTUC 2R7WA 2JPBA 1EK8A 1BA5A 2KHMA 1PYVA 5IY5H 3K2ZA 3T01A 2RGRA 3BJ6A 1YOVB 3BR6A 3G73A 1KA8A 1HKTA 1ZGAA 2X1DA 2FMYA 5K5QA 1YHQI 2LRDA 1O2FB 1FP1D 4D7NA 3IRQA 3P5JA 1SAUA 2MH9A 4GYGA 4EQQA 3KP6A 1N25A 1DQUA 1T38A 2YU9K 4Q5SA 1S7EA 2IS1A 1L0OC 4Y13A 1EH6A 1VQMI 4QJVB 4U0YA 2XF6A 2Y0SA 4GXOA 4ZH4F 3F72A 4WK8F 2VE9A 1W5SA 4BQAA 2V26A 3RKYA 1ZXOA 4ZDPA 5IOSA 4A3EC 4CZCA 1P4XA 3CCUI 1Y39A 3IKVA 2MG4A 1QPMA 4CH7A 4ZTFA 1QBJA 3J80Z 1OJLA 1J98A 2CG4A 1B9MA 3DKYA 4R1HA 3WODF 4HAMA 1YW8A 1PUFB 5EGOA 3FF5A 5C44J 4KMHA 2R5ZB 2KIFA 1MJBA 4HBLA 3CCMI 2R93C 4M74A 4G0UA 4B3XA 3CO6C 1J59A 2XCRB 1XS9A 2ETHA 2JSPA 3ZQIA 4L18B 2JTVA 3ASOH 3QRFF 1R49A 1P2FA 4RB3C 4A3MC 2MC4A 3OYKA 1MMSA 3S1MC 1XMAA 1XSXA 3OIQA 2BE5A 1VNDA 2JA8C 3Q9SA 2ZXWH 4C3HC 1E3PA 1BBYA 1NG7A 3RPUA 1SD6A 1YG2A 5JLXA 1YNNA 1I1SA 1O27A 1YX3A 2QQBA 4BBRC 2AXTC 2IP2A 3BR0A 1BC7C 3GTOC 2CUZA 1EI6A 2XF5A 4BXUA 1YJNI 3DU5A 2K27A 4WXCA 1XDSA 2ZMEA 2BZTA 1KZHA 3JRAA 4HLYA 4MEXF 4P9FA 4AYBA 3U9GA 1XGNA 3H92A 2L54A 4L9JA 2LD5A 1FSHA 1QHGA 1SFOJ 2NVXC 2HQRA 1ZG5A 5FRMA 4MTEA 3FHZA 3L00A 2EFPA 2CQKA 1P6RA 3FXOA 5F08A 4KC6A 3HOUK 3RPQA 2LC2A 3HTUA 5K7FA 1MNMC 3ECHA 3MD2A 2E2HC 4FX0A 1MBFA 3LQRA 4G0VA 2OD5A 4EJTA 5F1RA 5M5YK 2R0QC 5FLMC 5E18F 1H9TA 5M3FK 2IA0A 4O3MA 1NK2P 1SFOA 3BDDA 4IHTA 4GTBA 2XIGA 1FMWA 3L4KA 3S15K 1IZ1A 1T33A 4EGZA 1TWCC 3TDZC 4D0PA 4AU7A 1ERDA 1DCPA 1PJ7A 4I6ZA 3CCLI 4C3JC 2LDUA 4XK4A 1O24A 4DIQA 4H0EA 2K7LA 2JA6C 5DD8A 4F3QA 1D0YA 2KISA 5F1JA 4BUPA 2XPVA 3JAMZ 3K4KA 4KASA 2UXNA 1B1BA 1KONA 2BY3A 4Y7NC 3M9AA 4Y4RA 4PK4A 1VZ0A 3OV8A 4HSRA 4NUBA 1YLFA 1U6GA 4BE2A 3NEUA 1W0UA 3FOFA 2ZFUA 3GFIA 1MDMB 1JE8A 3CCRI 3O2PE 1XZPB 3N0CA 2Q0OA 3LQQA 3P7NA 1X2MA 3DQVC 4XRFA 4KB4A 2XUBA 4NBQA 5LRSA 3QX3A 2NAZA 1TZLA 2ZCWA 2E36A 2HYJA 3HB9A 2VN2A 3KLNA 4RAYA 3ZCOA 3CCJI 5DCMB 2OTLI 3WU0A 2VKHA 3G6EI 1G6NA 2CQNA 1X4PA 2DA2A 3CCYA 4M3FA 4A2UA 5DUIA 2E1MC 2CRGA 2RH6A 3JRFA 4PFOA 3B02A 4ON0A 4HDVA 2DN0A 3COAC 3GBGA 4RGRA 1BW6A 1KU7A 1SC7A 1LDKB 2CW8A 4LLGF 5LHGA 2JA7C 1ZBSA 3OOUA 5L3DA 5J3LA 1LDJA 3BR2A 3MZ8A 4PJJA 5F0FA 1ZG1A 1IN5A 1IV6A 2ZFWA 5IYCC 3E97A 4J01A 4DYQA 3HKZA 1IC8A 1K7AA 2NVXA 2KRFA 3DTKA 4HPQA 1XXAA 2WBMA 2PMZL 2VUMJ 4E6KG 2BBYA 3LWFA 3H3UA 3M4OC 1FT9A 3LA3A 1OYWA 1VLOA 2NVYJ 4BY7K 2VQLA 2E2HA 1IRZA 2GXBA 5IT9Z 1RIOH 4BHCA 4BHPA 1HXDA 5IYBK 1IW7A 4BXXC 2K9NA 4BDYA 2VUMA 4A3BK 1BN5A 3HOXJ 2E2JK 3KIOA 3AD8C 3S2DK 2HQNA 3NRVA 3E6DA 2KZVA 3OL4A 3KLOA 3NWTA 4BXFA 1EFWA 2JA6A 4BLBA 5D4DA 4HDUA 2HWVA 4RS8A 4G6DA 4R8HA 1FIAA 3OIPA 1R58A 3AG4H 1TWAJ 4B43A 1JUSA 1XPPA 3K7AJ 4B47A 2OPTA 4E7ZA 3N05A 2CUEA 3HOWC 2W7VA 2LF8A 4IHSA 1P7JA 2R4GA 1SVLA 2ADUA 2OAZA 4GYIA 1TWHK 4QIWD 3ESWB 3CUQC 2IS4A 1J7KA 3QPTA 1EA3A 2A68A 1TWAA 5K7HA 2KJCA 4BHBA 5GAHJ 2A6EA 1QO0D 5LBQA 4PFPA 4C3IJ 4GDFA 2QBYB 3GTPJ 4DBRA 1WH7A 1IJWC 2BV6A 3S1NJ 4IHYA 2P5KA 2F5EA 3SZPA 1DP7P 3PL8A 5A2QK 1SFUA 4I01A 1Y8RB 2EBIA 2PMUA 4BBSJ 1B4BA 2COBA 5ILUA 3QODA 2ME6A 3FXMA 1XCBA 9ANTA 2VXDA 2XSJC 3OPFA 5CHPA 4XRMA 2OV7A 5FD5A 1R1VA 4XCHA 1Z77A 5FD6A 3JSOA 3OIOA 3LSPA 1D5YA 3R6SA 3BP8A 3OL3A 1WKMA 1T0FC 1USSA 3IL2A 4WWCA 3GTMJ 3TEDA 3BT9A 3FKIJ 5LEJA 1KQ9A 2ESNA 3ZMZA 3IWFA 3GTJJ 2IS2A 1JTXA 2VC0A 4I99C 4PCQA 3MKYB 1P4WA 3WG7H 1SFXA 3FM3A 3W3CA 2W82A 1XGSA 5CVIA 1DP3A 2JQ7A 1BW5A 1HW5A 5D6FA 3GTKJ 4CCNA 2H8WA 3CP8A 3H3VL 5DTDA 1WWXA 2EZLA 3FKIA 3OMYA 4ANJA 3JRCA 3K4NA 2HDWA 3LSTA 4HX7A 1B59A 3M1EA 4IKFA 1LE8B 4QJVA 1TWGJ 4JX5A 1JGSA 3BOQA 3LAPA 4IOAF 4A3GC 2FSWA 5EEHA 3ELKA 3I55I 3PO2J 3O6BB 2LBFB 1B9NA 1QGPA 4LITA 4QTRA 1ZRCA 4ZJZA 4YFXF 1HBXG 1WQHA 3L2WA 4RA2A 4ESJA 2FQTA 1PUFA 1BOBA 4BU2A 1I50C 4C2MJ 2L7ZA 2R5ZA 1TWGA 2DMTA 2OTJI 3KZYA 2DTZA 2X51A 4AIKA 4V2GA 1N77A 3PFIA 4IJAA 3H3ZA 3CC4I 1H9GA 2B63C 3LSGA 2DFIA 1JJ8C 2NNNA 4MQVA 3M8EA 2F5VA 3JRBA 1B8IB 1LVAA 1ZYRF 3G4SI 4XM3A 2LY2A 3BG3A 4HNVA 2BOLA 4LFUA 2HR3A 4JP0A 4KMUX 3ABKH 3K9TA 4XKVA 3ZQCA 1A31A 1FBSA 4KN7A 2E1CA 3BTJA 2WADA 3GO5A 3RQ4A 2DQRA 3IHUA 1VQNI 1SFOK 3AG1H 3PUBA 1WJBA 4A3DJ 1W4MA 1I3AA 3E5QA 1IXRC 3K4LA 2TRTA 3FBIB 2DBBA 3HHHA 1MBHA 1UZCA 2VBWA 3C2BA 3MZYA 5JR3A 4J3NA 2JUGA 3UNGC 4DBQA 4F92B 1T95A 4G7HA 5B1BH 4P5AA 4ENMA 2VBZA 1HA8A 1TW2A 2CGPA 3S2HJ 2YU9C 2Y75A 5IPAA 4JYKA 2JH3A 4NNJA 3A2KA 2QLZA 4Y15A 5GTIC 4A3KJ 1USOA 3A03A 3TQNA 3S16J 2MFZA 4DOZA 4LQYA 3WGIA 4U0WA 4M3BA 4E7LA 2BY2A 3ULQB 2FBHA 2OCCH 3V8JA 2Y30A 3TKYA 2ESHA 3S1RJ 3F6OA 2VE8A 2ZXJA 2W48A 3HRTA 2A6HA 3C7JA 3F8BA 4KN4X 2DODA 1O3QA 4KISA 2L5QA 2QCOA 1FBUA 4OIPA 2GSUA 1K79A 1ORKA 2XGXA 1MDMA 1IAWA 1USMA 1XZPA 1X3UA 1XDUA 2H1LA 2YPRA 5GP9A 3L2CA 3DLLF 4J00A 1RZ4A 3GEHA 4YFKF 3CCEI 1OCPA 2PMZA 5DCMA 5F0HA 2R7VA 3B6AA 2A07F 1S5LC 4A12A 1WQFA 3IV5A 2XPUA 4IVNA 5J1UA 2WC2A 3RCOA 2CS3A 3A8IA 2V7FA 1DUXC 1FWZA 5CQGA 4CHUA 4OINA 4FTHA 2LTPA 3HOYJ 1TW3A 3CJQB 4U88A 3KEQA 1CF7B 1YS7A 4ILDA 2VUMK 5DUKA 3W6JB 3HOUC 4M3GA 1WH5A 2W84A 3O8GA 1HCRA 2MGQA 2H1KA 3OYHA 5DM7F 2NVYK 1VGXA 2ID6A 3MVPA 5FFZA 4Q5SF 4N4NB 4XKWA 1O3SA 5FRNA 4E70A 2IT0A 3K6GA 1USTA 4JBAA 3CUOA 1HDDC 3DBHB 2ZSIB 5EGHA 3GTQJ 1X58A 2YU9A 2DFHA 2STTA 4II2A 3WTXC 2L9VA 2ZO4A 3MMYB 3S15C 2MLKA 3HOXK 2VIXA 3I59B 2LOOA 1T6SA 1ZTRA 3M7GA 1PJRA 2JN6A 3G3ZA 1RI7A 3U21A 4BDZA 5L3GA 5FKOA 1YS6A 3TFHA 3BTLA 2WB1D 5H6RA 3G71I 2B0LA 1LFPA 4QLCU 5HS7A 3TO6A 4XLPA 3KETA 2EV0A 3ZQLA 1TWAK 2FQOA 3K7AK 1WJFA 1JUPA 1R5HA 3V8LA 2D2WA 2BXYA 4AVPA 1RC9A 3F3XA 2ISZA 2MW8A 3G1OA 2HQAA 3DKWA 2EQRA 2LH9A 1TC3C 2K4JA 2V6UA 3QYEA 2BE5F 1MIJA 2L9RA 4E7SA 3LOCA 3T00A 2M87A 2DFFA 1JKQC 3C3WA 3AQOA 5D5WB 3FWEA 1WJDA 4XOTA 2V1UA 5IYDJ 4KAWX 4C3IK 2W57A 2XV4S 2YSRA 4RGUA 2AS5F 3GTPK 4QWQA 3ZQ7A 1SMTA 2FE3A 5DEQA 5CYVA 1IRGA 1XGOA 2FOKA 4ZC3A 3S1NK 3HJEA 3Q3QA 1FOWA 2M0MA 2KRCA 1MJAA 2R7OA 3WGHA 1ZGWA 3S3MA 2QBYA 1U5TA 1QVTA 4BBSK 4MTDA 3JRDA 1O57A 2M1BA 3FX3A 3HRSA 2UXXA 1Q1HA 2HU9A 1FOKA 2CFOA 2WAQA 2Y9ZA 2R7XA 1YTYA 4G12A 2QEXI 2PBIA 1T2KA 3SYTA 4L9TA 1VH2A 4M73A 1LJ9A 1DGWY 1W7PB 3E5XA 2CV1A 3IAS2 2PMHA 4D5FA 2Z3YA 5IP9J 4BY7C 3GTMK 2CFAB 4HEA2 2GQQA 2HYFA 3TGNA 1AHDP 3FKIK 3GTJK 4KM9A 3I4MJ 1TT5B 1HQMA 1Z7LA 3K70D 2Y0SD 2MD5A 4KDPA 5IYBC 3FM5A 2CV0A 1V3FA 4EV0A 3C2HA 3N4MA 2VT2A 4EATA 2PJRB 2E2JC 3GTKK 4A3BC 3CC7I 3DEUA 5GTHC 4OAYA 2JA5J 5LGTA 4FISA 2F5FA 1YRNA 3S2DC 3DF8A 3HOSA 2GWRA 3B73A 4FE7A 4KT6A 3S14J 3NUHA 1G3SA 4YFNF 3KP3A 4JQFA 2W85A 4BAYA 4XQFA 2DAOA 1TWGK 2XAHA 2F5CA 2XB5A 4EEFG 4WILA 3PO2K 4LD5A 4UHTA 2PA8D 2JA5A 4EM1A 2WV1A 1LE8A 3K4JA 2KRHA 2VJJA 3RKXA 1TWHC 2P6SA 2DJNA 2KP6A 4KNYA 4CSWA 4C2MK 2LBFA 1JTYA 1XCVA 2JK3A 3RPUD 2W7NA 3AAFA 1L3LA 3MKZA 1RUNA 2CJJA 2LVSA 3PO3J 1X1BA 3E6BA 1H8AC 4NC8A 2QGUA 3P9CA 4IX7A 3T5XA 1V5FA 2JPCA 4CYCB 3SJMA 2VPLA 2VXZA 5HL8A 2QENA 1MSEC 2DCEA 4B09A 5J6XA 1IF1A 4IRGA 3VSLA 1DDNA 4UXNA 1O4XA 2ZSHB 4AYBD 2STWA 5GPAA 1TQPA 2PFBA 2K9SA 1AA7A 1XSVA 5IP7J 5FLXZ 1I6VA 1G3WA 5J4VA 3CJRB 1B8IA 1V4RA 3GTLJ 2GSNA 3IP4B 3S3NA 2JSCA 4F91B 1PP8F 3E7LA 2XAJA 4CGZA 1PDNC 4A3DK 1JKOC 4XONA 4HZFA 4XOPA 3QOPA 4UB8C 3K70C 5L3CA 1JHFA 3OYMA 5K1YA 3TP3A 1IW7F 1BGWA 4WXHA 3RI4A 3G1MA 4WJ3M 2P8TA 1GE9A 3S93A 1Z1DA 2WY7Q 3S2HK 2NVUB 2XF7A 1OCCH 2R7DA 1FLIA 3FXLA 2IVMA 4FE4A 1LEBA 3TFIA 4BQOA 2M3AA 4LG0B 4A3KK 3OYLA 3HM5A 2ZXIA 3S16K 2EZHA 4S04A 5J1RA 3HSFA 4FM9A 2C6YA 2A61A 3M8JA 1U78A 1OCRH 1SANA 2R7QA 1ENHA 3S1RK 4L5EA 2EILH 3JTGA 1U2WA 1EH7A 2YX4A 1UMQA 2M8EA 4XNFA 3ZQHA 2A6EF 4BQNA 2O61A 3ZN0A 5K7ZA 3UR3C 2OF7A 2CV2A 3TW7A 2ZMEC 3AL0B 5HNHA 3DV8A 1R4MB 2MC3A 2LKXA 1KU3A 2A5YB 1N75A 4I0BA 5EYRA 1WOSA 1J75A 2GAGC 1S29A 5LGNA 4L9VA 2L0KA 1X1PA 2VB6A 3W6KB 4DYCA 5JI6A 3BWGA 5KHDA 1S7AA 2EIJH 2F6CA 1O7FA 2P7VB 3J7ZI 3IWZA 2BHYA 2JVHA 3FMQA 3Q0WA 1ZG3A 4GFQA 2F48A 3HKZD 2V79A 5EJCA 3R4KA 1P92A 3GLXA 3J7YJ 4KIBA 1QZZA 3HOYK 2J5OA 1QQIA 1YNJA 2XRLA 2PHCB 3UKGA 4Q48A 4CXFA 1SFOC 4HV5A 4HF0A 2RNJA 3G4CA 3PNTA 4L9NA 1IBAA 2B9SA 1TQMA 3MWMA 4EJOA 4DZJA 2R5YB 2JA2A 1EH8A 2LYCA 3LL7A 5LLQA 2AHQA 2IA2A 2EINH 3OY9A 4LB6B 2R92J 1CF7A 1FZPB 4AM3A 1YE9A 1EF4A 1X1CA 4K2EA 3GTQK 2XKPA 1R4NB 2HVQA 3TOBA 2FXAA 4DNCA 4HA8A 1X3ZB 2O03A 2IGMA 3KP2A 5HDNA 5CQEA 2XDVA 1I6HJ 3TMOA 4KITB 3O3KA 4OMYA 2R7SA 2NVQJ 3EQLF 4C9YA 1SD7A 4KJZA 2R92A 2Y31A 2HXIA 3HYIA 1RKTA 3I59A 3SXYA 2M4GA 2UUZA 1BIBA 1ETKA 3HXLA 1T98A 1OYIA 3FMRA 2DQLA 1V5EA 4KMFA 1LVKA 2DA1A 2A3SA 2X85A 1ZQ3P 4XICA 4HF2A 1LDDA 3H35A 5CJ9A 1IE0A 4ZYAA 1FC3A 3OS1A 3FOEA 3GLLA 4IZZA 3Q9VA 3QWLA 1W5CC 5KNLA 4C45A 3HRUA 2EV6A 3MZHA 4LOCA 4KIFA 1ETVA 2DYSH 3JREA 2Z99A 5IYDK 1VQKI 2Z5UA 3BROA 4MNUA 4XKBA 1QU3A 1Q1VA 5CKTA 1ITYA 4GGGA 4KIGA 2LMDA 4IHWA 3GWZA 4C2TA 4CCKA 1IDZA 2ELHA 1G3TA 5C4XJ 1YCLA 2E5ZA 2FBKA 3EYIA 4OIQA 3BR3A 3M3YJ 1YI2I 2HZTA 2E5NA 2Y69H 2DU9A 1XGMA 4HNUA 4A3CK 1MNEA 5FFXA 1Z67A 3ZOBA 3NWSA 4BYYA 1WZ2A 2VUMC 1ISEA 1A35A 3BUEA 3L9FA 3GIRA 4G94A 1B6AA 2Y0MA 4G7HF 5IP9K 5BPDA 2GSOA 2NVYC 2R7ZJ 2EPFA 2NS8A 4XSXA 1WRJA 5JHFA 4W97A 3OSGA 3I4MK 4HG2A 3GTGJ 1B72B 5JFRA 4RB0A 3SEZA 1W7PA 5TGTA 1TTYA 2CFAA 4LK1A 1XSDA 1LNWA 4U7BA 3HOXC 2E34A 1I5ZA 3CDHA 2HDDA 3GF2A 2JA5K 3QPHA 2ZBKA 3HBLA 2IEKA 2PEXA 2XHKA 3CQZJ 4A69C 4IO9F 3KEYA 3S14K 5J40A 4AC0A 2PJRA 5K5RA 2G9WA 4U7DA 4PAAA 2PMZN 1TWAC 4LIVA 2XAGA 1UHWA 3K7AC 2HPIA 1R22A 5ILSA 1QPIA 2XAUA 2PG4A 3CLQA 2V9VA 2QKMB 3J7AY 4OIPF 3JW4A 3CQZA 1BIAA 1HF0A 1ONVA 2OBPA 2BW3B 4UUSB 2DK5A 1J6XA 1ZVUA 3S1QJ 4BKXA 3L4JA 2BHZA 1XC5A 1Y1VJ 2VBXA 2Y9YA 1SFEA 3ASNH 4CCMA 3HC7A 3GEZA 4C3IC 4KUMA 3WHCA 1GDTA 3PO3K 4OWRB 5E17F 3GTPC 1XMXA 4JX4A 4ESBA 4GTEA 2GXGA 3DTEA 2DK8A 3S1NC 1GV2A 1KU2A 1DU0A 3RZOJ 4QIWL 3AL0C 2GIVA 5LHHA 3BP8C 2LKPA 1G59A 1LEAA 1Y1VA 4CYCA 3V7RA 4BBSC 2EV5A 3GYHX 5E68A 2ECCA 1D0ZA 2GM4A 2NS0A 2W4SA 3H9QA 4WX9A 5IP7K 4JK1A 3E1SA 1XZQA 3QOEA 1UELB 5DM6F 1E2XA 2Z16A 1NK3P 3GTLK 1YQAA 2COMA 1PJ6A 4ZDLA 3QP5A 1WPKA 4Q4ZA 3HHGA 3CMAI 2DA4A 2EB7A 4A3IJ 3D5LA 3GTMC 2Z2SB 2NVYA 3FKIC 2HGCA 3GTJC 3N97A 1A6IA 1ZARA 4BE0A 3X2QH 1MW7A 3GFLA 2P4WA 2WA0A 3GTKC 1VQ4I 1K6OA 1R23A 1O28A 2QQ9A 3BTIA 2VOOA 4AIJA 2FNPA 3TOAA 1J5YA 1IS1A 5E3LA 2IBDA 4PSXA 1ZRDA 1VQ5I 2JVGA 4X1EA 1TWGC 4LG0A 3A02A 3KYDB 4RLQA 3PO2C 4PGHA 2GAUA 1BI1A 2KLOA 2FA5A 2MABA 2RQPA 5HOOA 4BY1J 1U5TB 5HS9A 4MO7A 3ABUA 2Y48A 1F1ZA 2JWTA 5J4YA 1WCMJ 1WHUA 3GZ6A 4C2MC 2WAQN 3AG3H 3BPXA 2V1NA 2OU2A 2ME0A 4MIMA 1HI9A 1U9NA 4QPOA 3JRGA 3OYAA 2X6WA 2PMZD 3HUGB 2KT0A 1GVJA 1RESA 1U9OA 2CFXA 1IN8A 3GTPA 1XD7A 3C1DA 2WV0A 3D0SA 1XN7A 2F4OB 4TV7A 1MBJA 4YELA 5F0CA 1LB2A 1ON2A 2H09A 1Z7UA 4WJ4A 3F23A 1WCMA 3HRMA 3BR5A 4IL6C 1W0TA 2X1EA 1P9QC 4P96A 5HLIA 3TTGA 3F8CA 2E19A 3LNQA 1Z21A 4PJLA 3CF5F 1WI9A 2GXAA 2HOEA 2X48A 2IRFG 1KQ0A 2FJ1A 5D4SA 3I56I 1YRNB 3PSFA 2BY0A 2Q8KA 1O29A 2H8RA 4A3DC 2RGVA 3HOVJ 1KQ4A 3FXUA 5TJJA 4FASD 2MLGA 4HV6A 3CCSI 4XLEA 3E3VA 2O5JA 3GTMA 4A0ZA 2M7AA 3KE2A 5BMZA 4DDQA 3DXJF 3GTJA 3FKJA 3KYLA 2UWMA 1SVOA 3HSEA 5FO5A 1QA6A 3HOZJ 5D8LB 2R92K 3CC2I 2W00A 3PJRA 4AIHA 2R5YA 5IT9K 3BG9A 5HDKA 3S2HC 3GTKA 5FKNA 1FPQA 1I6HK 4A3KC 2A5WA 2CQ7A 1DGRM 3HOTA 3S16C 4OIOA 1EQRA 2NVQK 4B44A 1D1AA 3WODA 1MMAA 5DS9A 1HKSA 3HGYA 2E7XA 4YIFA 4PUSA 3FK7A 1OPCA 4M6XA 3IPJA 5E3MA 3S1RC 4L0ZB 1Z0XA 2V6CA 3CCVI 4A6DA 5TJ3A 4KMDA 1Y56A 2RNGA 3SDGA 4RMFA 1IQ0A 2O3FA 2HVSA 4N0BA 4G7OA 1A5JA 2EJRA 4LB5A 1XG1A 2LP0A 2DFEA 3CESA 2Z1DA 1WJEA 2LREA 1R9TJ 2ELJA 4XR6A 3E6CC 3JSPA 3Q3SA 4OOIA 3I54A 3E0JB 5FROA 2IW5A 2X6XA 2DA7A 2F4IA 2M0CA 5L3FA 2HFHA 3CDLA 5EDNA 1WOOA 3AQPA 1QHHD 1P7IA 4I7HA 1YITI 2VQGA 4D5CA 2K85A 1D8JA 2K9QA 2EA4A 1QNTA 5JHUA 3S0XA 2KKOA 1OKRA 4HX8A 5E3OA 2WAQD 2VJ5A 1AWCA 2EA2A 5C4XK 4YG2F 1NTCA 1OISA 3ZRGA 3SZGA 3MMLB 1R9TA 1QRYA 3VOEA 2O5RA 3IKTA 1JQWA 1GUUA 2IPQX 4AH6A 3M3YK 1FYLA 1RR7A 4L5JA 4OU0A 3HOYC 2PQ8A 2WWYA 4AIDA 4RAZA 5CVUA 3KZIC 1HSTA 1D1CA 3H9JA 1Z91A 4HSTA 3HXAA 5HODA 1FNNA 2UV1A 4ZZLA 5E3NA 2R7ZK 2XC7A 4LR2A 1TQIA 4FX4A 1YJ9I 2G7HA 4P5OA 3LSMA 5H6QA 3GTGK 3EUHC 5FGMA 3GTQC 5E20A 4AVZA 2CUJA 1R36A 2P6TA 3WTSC 3IH4A 2DMPA 3BJAA 4A93K 2LKSA 1B72A 3HIFA 3WE3A 4BJTA 3MKWB 1APLC 3CQZK 3T8RA 4P9UA 1R00A 2ZJ2A 3BG6A 2X0LA 2IAIA 3LFKA 1FMVA 1MNDA 1PVEA 2YU3A 1G51A 4O2DA 3CMEI 4GTDA 1TWFJ 2KIQA 2XROA 3EPZA 2K40A 1KU9A 4I98B 5AONA 3KP7A 1ZGJA 3VSKA 2OQGA 1TLHB 2DI3A 2BGCA 2L01A 1ZH5A 3T1BA 5GAEJ 2BVMA 5EEGA 1Y1WJ 4GTCA 2K9MA 4HW0A 2WB1L 2PI0A 1G2HA 1UV7A 3S1QK 1U5TC 1T8IA 1CQTA 1Y1VK 2DA6A 4AD9A 3CCQI 4ASNA 3DP7A 1ZR2A 1TWFA 4R79A 2JMWA 2BW3A 4UUSA 3HTSB 5C4JJ 5IYDC 1Y0NA 1IN7A 1ON1A 1ZHFA 3QPSA 1TNSA 1RKWA 1BJAA 1OLTA 1O3TA 4HX4A 4B3AA 3RZOK 2X6YA 2DLLA 1IUFA 3AD7C 3AFHA 1Y1WA 2FF4A 4C30A 2HVRA 1WJCA 3K0LA 5E8IA 2IS6A 4GZYA 4ZYHA 4M72A 1IXSB 3J81K 3EETA 2O5IA 1WFXA 1T39A 3I9V2 4BJ6C 4XSZA 4A3CC 2VT3A 3G4AA 4Y3OA 5FKKA 3RZDJ 1ZQ1C 4BGDA 1JT6A 3P9IA 5IP9C 4F55A 4A3IK 1IDYA 2DT7B 3GUDA 2LLKA 2AO9A 2QQAA 4ZTJA 1O26A 4PJMA 2A69A 2O8KA 1H0MA 3HDDA 3I4MC 3F21A 4IQJA 1GXPA 5IP6A 4RAGA 3S2WA 2OQRA 1LQ1A 3EUHA 3GCMA 2IGOA 3OWTA 5C3EJ 5BPIA 3GTQA 4ZYEA 5FKMA 4BLAA 3IH3A 1Z3XA 3QP6A 3S32A 5HVQC 1JOEA 2JA5C 1MMNA 1HC8A 2K4BA 4ZYDA 2DW4A 1T08B 3S14C 2CH0A 2ZUEA 4CCOA 3AKZA 3ADAC 3JRHA 2LK2A 3CJNA 1TBXA 3I71A 2Y0SL 1YJWI 4A5NA 1REPC 5J47A 1AOYA 2QKLB 4BY1K 1JJ6C 5LGUA 5AIQA 4M3EA 3RKQA 5FJ8J 3TBIA 2P5LC 1WCMK 2L3DA 2CMPA 1BI3A 1GVDA 4A3FJ 3ZR8X 3LMMA 3EDPA 1BDFA 1MMGA 3PO3C 2JRMA 4IHXA 3WTVC 2FX0A 3EUKL 2PA8L 1I3QJ 2I8DA 3ZMUA 1RRJA 2XVCA 3SFIA 3SZZA 4A3CJ 1UCRA 2M2EA 1MBGA 3HUGA 2V4JC 2CW0A 2GBYA 3H0GJ 4DQ2A 3OYIA 3T0YA 4NB5A 5IP7C 3VODA 3F8FA 4HRIA 3CAGA 1BM9A 2K5CA 2PX9A 3GTLC 1BJZA 2EWNA 3MQ0A 2H6BA 3BJOA 1BR1A 3PSIA 4UB6C 4XSXF 3OYBA 1ETWA 1S7OA 5L3EA 3CO7C 3HOVK 3Q5FA 4AYBL 5D4RA 3H0GA 4M9XA 3EYYA 1S3JA 2FNAA 2M5WA 1NHAA 1YW7A 3VYUB 2DOAA 4LK1F 3HOZK 5JLWA 3QAHA 4RLFA 5BNGA 4E7JA 2VKVA 4RGSA 4UNOA 2XAFA 3FXJA 3F8MA 1ZK8A 2DOEA 4I2OA 2XKOA 5F04A 3A8KA 4OIRA 5LEKA 1JI8A 3DEWA 2CU7A 1T56A 2TDXA 1FOXA 5M3MK 1IN4A 3KZZA 2ZKZA 2OC6A 1XPXA 4XLNA 2VBYA 3MKLA 4A3LK 3VDXA 5EEAA 2G7UA 2V1DA 2F4MB 3QYBA 1GV5A 3KX2A 2WY8Q 3PNVA 4Q47A 4O6JA 4YFXA 3PQKA 3ZP5A 2L02A 5F6FA 3H5RA 2RC4A 3WHBA 3QPLA 5CVJA 2VC1A 1AB4A 1VQLI 1XZQB
chains in the Genus database with same CATH topology
1R1TA 2NYXA 3I4PA 1PUEE 3T8TA 2O8XA 5DDGA 1GXQA 4EVIA 4HYEA 5FB2A 3WTYC 1WQ2A 2QUFA 2M45A 4PGGA 4EM2A 5DV5A 1ZRFA 5E1ZB 4Q4ZF 1C0AA 3R61A 2XAQA 1YIOA 3E5UA 1W7PD 4M9SA 5E8GA 3ZMVA 1MGTA 5BQTA 2D1VA 2XRNA 3ZMDA 2DT5A 3WGGA 1FYMA 2HDCA 3J7AO 3LA7A 3KCCA 2A68F 3WE2A 2HKOA 2MH2A 2QZ8A 4G9YA 1FP2A 4RB2C 3GZ5A 3VB2A 1G4DA 4UVAA 1E17A 4A0YA 1MZBA 5LHIA 1HW2A 2K02A 2D6FC 4MHGA 2ACJA 2CSOA 3K1NA 3MFKA 1Z6TA 1OMIA 4B8XA 2KIMA 2GA2A 2QM3A 4GO1A 3WG9A 2MBFA 1BC8C 5E1XA 1UB9A 4LGWA 3V7CA 5FLXK 2WTEA 3V4GA 5AIPA 4I0AA 5DYMA 3KP5A 2QWWA 2O6GE 1MD0A 5BOXA 1UFMA 3ZPLA 1B4AA 4L0YB 3RYRA 3K1PA 3VEPA 5ICGA 4F7ZA 2IA1A 1R7JA 2F2EA 4PDKA 4OIOF 1JHHA 3CUQB 1D3YA 2H27A 5J8FA 5ICFA 2M30A 4XBFA 4KICA 4HLXA 2JRTA 3ECOA 1RUOA 1R1UA 4G7OF 1OR7A 2FMLA 2MA3A 3F8NA 1PP7U 1HSJA 2RKHA 4CICA 2KIUA 2HS5A 4EM0B 1KYWA 2YX7A 3DFGA 2VOPA 3LA2A 2PLYA 3ZMTA 1S6LA 2JT1A 4IPAA 3RTRA 1JXSA 1QZYA 2QYOA 3U2RA 1FSEA 3PQJA 1O7LA 4RB1A 4KFCA 3GW2A 1I1GA 1MJ9A 5IT3A 5D6EA 4ESFA 1RNLA 2HYGD 5ICEA 4OMZA 5HS8A 4HF1A 1ODDA 3J80K 3ABTA 2A6HF 1YW9A 2AXLA 4KN7X 2EFOA 5A2QZ 4G8XA 4A0XA 1L0WA 3QU6A 2CYYA 2EFWA 1Z9CA 3DPLC 5CVVA 2CWEA 1Z6RA 2LSOA 2BEOA 4OINF 1U3EM 1F4KA 1OYYA 5DD4A 4LLNA 6PAXA 2UZKA 2HKXA 2L4AA 2ZNYA 1YFHA 4XSZF 2Z33A 1Z05A 2P7CB 5J8CA 2ISYA 1ULYA 4KT5C 3ML6A 3KP4A 1XB4A 4AWXB 1FY7A 2A69F 2XASA 1MKMA 2CO5A 5E1WA 5ICCA 4ENNA 2DPDA 1W5TA 2FEZA 4XLPF 1C0WA 4ENKA 3JAMK 3JTHA 3MCZA 2VODA 3BZ6A 4IXAA 4S05A 5ILVA 1CGPA 4UVCA 1VTNC 2BYVE 2DPUA 4WXDA 1FX7A 1IXCA 1TNTA 4M6YA 1IN6A 2ZNZA 3I58A 2CW0F 1HQCA 3ROUA 4CYDA 3RDIA 3I64A 4EMSA 4YIIA 1I27A 2RDPA 2FQ3A 3QU3A 3BY6A 3RKWA 1S8NA 4BH9A 4UV8A 3REOA 4IRIA 1D8KA 4EJUA 3SQNA 2W24A 4OIRF 3IRRA 2HTSA 4CZZA 3KFWX 2FBIA 1K78B 2Z9OA 4XLNF 4UVBA 3DPTA 4O5VA 2LNBA 1IRFA 1KGSA 2OZ6A 4HOBA 1HW1A 3ZN1A 5CLSA 4CO8A 2Q2EA 2RVCA 3CTAA 3CUQA 2HEOA 3P9KA 1DPRA 5DCFA 1KYZA 3K69A 1FYKA 4P55A 4IF4A 1A04A 4HQEA 2W25A 3GVAA 4FHTA 3SZTA 3J81Z 3R60A 1YYVA 3L7WA 3KEOA 3K1MA 4I09A 4RGXA 2OZUA 1UHMA 5HDGA 1T0FA 2F5DA 3I5UA 2YR2A 4M71A 5KK1A 2KJBA 4WF2A 4Y17A 2D45A 3WU1B 1SD5A 3U1DA 2PJPA 2H6CA 2RN7A 1F9NA 5CVRA 4EGYA 4CDGA 5TRDA 1R5GA 3I53A 3IC7A 3V8KA 5L3BA 5D5VB 3GFJA 1DPUA 4MQ9F 3R0AA 1J0RA 4FT8A 3ERED 3TO7A 2DTRA 3I0TA 1ZAOA 5LRRA 2R3SA 3WTZA 2PN6A 3LAJA 1HKQA 5D5UB 2K86A 3F6VA 2LF7A 4HQMA 4L5IA 2X4HA 2E7WA 4I02A 1G3YA 2JZYA 4N9HA 2FRHA 1ZREA 1KQ8A 1GHCA 3E6MA 3SHFA 2DO7A 1SMYF 4MEYF 3BPVA 3R0JA 1D5VA 1ZLKA 2ZMEB 3CLOA 4LJZF 4LMYA 3FXQA 3L09A 4EJVA 4OIQF 2NNYA 2EFQA 4KYWA 2L4MA 5JVTA 4M9ZA 4LLLA 1BOAA 5D8KB 4BNCA 4UV9A 3WTTC 2OA4A 1XMKA 2P5VA 4WCGA 2GA1A 5K5OA 4U0VA 2O0YA 2V1XA 4LK0F 5ED4A 4PZJA 3GX4X 3FXRA 2R7FA 5HLHA 1BI0A 5F64A 1P4AA 1SAXA 1U8RA 1O3RA 4G6QA 2GZWA 4ETSA 3OOPA 3WTWC 2RV8A 3HSRA 3GXOA 1K78A 2D1HA 3SFZA 4A6EA 2HTJA 4G7ZF 3RIRA 3FMSA 5KVRA 5D5XB 3FZVA 3TO9A 4MGRA 5BS6A 3C18A 4ZYGA 1Y0UA 3MEXA 3V7SA 2EFNA 1FBQA 1SD4A 1ZN2A 1J2XA 1STZA 4KA4A 2FU4A 3F22A 1F5TA 2VONA 1BI2A 4ZZDA 2NRAC 2H94A 1IUYA 4EJWA 3GFMA 1WSUA 2E1NA 4GCVA 4IRHA 4Z2YA 3TDUC 3RYPA 4ENJA 2EK5A 3NQOA 2J5PA 4JK1X 4A5MA 1EV7A 1IL2A 3MAJA 5HLGA 3RJPA 4NQWA 4NHJA 2QVOA 4UUVA 2IJLA 3ZMSA 1I6XA 3M8FA 1ZLJA 5ERIA 3VFZA 4N9IA 1J9IA 1YO5C 5H20A 3ISPA 3WTUC 2JPBA 3K2ZA 3BJ6A 3G73A 1HKTA 1KA8A 1ZGAA 5K5QA 2FMYA 1FP1D 3IRQA 2MH9A 4GYGA 4EQQA 3KP6A 1T38A 1L0OC 4Y13A 1EH6A 4U0YA 4GXOA 4ZH4F 3F72A 4WK8F 2VE9A 1W5SA 4BQAA 3RKYA 1P4XA 3IKVA 1QBJA 1QPMA 3J80Z 2CG4A 1B9MA 4R1HA 3WODF 4HAMA 1YW8A 3FF5A 2KIFA 1MJBA 4HBLA 4M74A 3CO6C 1J59A 2ETHA 4L18B 2JTVA 3QRFF 1P2FA 4RB3C 1XMAA 1XSXA 3Q9SA 1BBYA 3RPUA 1SD6A 1YG2A 1I1SA 2QQBA 2IP2A 1BC7C 4BXUA 2K27A 4WXCA 1XDSA 2ZMEA 4HLYA 4MEXF 4P9FA 3U9GA 1XGNA 3H92A 2L54A 4L9JA 1FSHA 2HQRA 1ZG5A 4MTEA 3FHZA 3L00A 2EFPA 2CQKA 1P6RA 3RPQA 3HTUA 3ECHA 4FX0A 3LQRA 2OD5A 4EJTA 5F1RA 5E18F 1H9TA 2IA0A 4O3MA 3BDDA 4IHTA 2XIGA 1IZ1A 4EGZA 3TDZC 4D0PA 2LDUA 4H0EA 2K7LA 5DD8A 3JAMZ 2UXNA 1B1BA 3M9AA 3OV8A 1YLFA 1U6GA 3NEUA 3GFIA 1MDMB 1JE8A 3O2PE 2Q0OA 3LQQA 3P7NA 3DQVC 4XRFA 2XUBA 5LRSA 2NAZA 2ZCWA 2VN2A 3KLNA 4RAYA 5DCMB 3WU0A 1G6NA 4A2UA 5DUIA 3B02A 4ON0A 4HDVA 3COAC 4RGRA 1KU7A 1LDKB 4LLGF 5LHGA 5L3DA 1LDJA 1ZG1A 1IN5A 2ZFWA 3E97A 1K7AA 2KRFA 2BBYA 3LWFA 3H3UA 1FT9A 3LA3A 1OYWA 2GXBA 5IT9Z 1RIOH 4BHCA 4BHPA 1HXDA 1BN5A 2HQNA 3NRVA 3E6DA 3KLOA 1EFWA 4HDUA 2HWVA 4RS8A 4G6DA 4R8HA 1R58A 2LF8A 4IHSA 2OAZA 2ADUA 4GYIA 3CUQC 1J7KA 3QPTA 2KJCA 4BHBA 1QO0D 5LBQA 2QBYB 2BV6A 2P5KA 2F5EA 3SZPA 1DP7P 5A2QK 1SFUA 4I01A 2PMUA 5ILUA 1XCBA 5FD5A 1R1VA 5FD6A 3JSOA 3R6SA 3BP8A 1WKMA 1USSA 3IL2A 4WWCA 5LEJA 1KQ9A 2ESNA 3ZMZA 3IWFA 2VC0A 4PCQA 1P4WA 1SFXA 3FM3A 5CVIA 1XGSA 1HW5A 5D6FA 1WWXA 3LSTA 4HX7A 1B59A 3M1EA 1JGSA 3BOQA 3LAPA 2FSWA 5EEHA 3ELKA 3O6BB 1B9NA 1QGPA 1ZRCA 4YFXF 1HBXG 4ESJA 3KZYA 4AIKA 3PFIA 4IJAA 3H3ZA 1H9GA 2DFIA 2NNNA 4MQVA 3M8EA 1LVAA 1ZYRF 4LFUA 2HR3A 4KMUX 3K9TA 1FBSA 2E1CA 3GO5A 2DQRA 3IHUA 1W4MA 3E5QA 1IXRC 2DBBA 3HHHA 2VBWA 3MZYA 5JR3A 4ENMA 2VBZA 1TW2A 2CGPA 2Y75A 2QLZA 4Y15A 3TQNA 3WGIA 4U0WA 3ULQB 2FBHA 3V8JA 3TKYA 2ESHA 3F6OA 2VE8A 2ZXJA 3HRTA 3C7JA 3F8BA 4KN4X 1O3QA 1FBUA 1K79A 2XGXA 1MDMA 1IAWA 1X3UA 1XDUA 2YPRA 3L2CA 1RZ4A 4YFKF 5DCMA 2A07F 4A12A 4IVNA 2WC2A 1DUXC 1FWZA 4CHUA 1TW3A 4U88A 3KEQA 1CF7B 1YS7A 5DUKA 3W6JB 2W84A 5FFZA 4Q5SF 1O3SA 4E70A 2IT0A 1USTA 4JBAA 3CUOA 2STTA 3WTXC 2ZO4A 2MLKA 3I59B 3M7GA 1T6SA 3G3ZA 1RI7A 5L3GA 1YS6A 5H6RA 2B0LA 4QLCU 5HS7A 3TO6A 3KETA 2EV0A 1R5HA 3V8LA 2D2WA 4AVPA 3F3XA 2ISZA 3DKWA 2K4JA 2BE5F 2M87A 3C3WA 5D5WB 3FWEA 2V1UA 2W57A 2XV4S 2YSRA 4RGUA 2AS5F 4QWQA 3ZQ7A 1SMTA 2FE3A 5DEQA 5CYVA 1IRGA 1XGOA 2FOKA 1MJAA 3WGHA 2QBYA 1U5TA 4MTDA 1O57A 2M1BA 3FX3A 3HRSA 2UXXA 1Q1HA 1FOKA 1YTYA 2PBIA 1T2KA 4L9TA 4M73A 1LJ9A 1W7PB 3E5XA 2PMHA 2Z3YA 2GQQA 2HYFA 3TGNA 2MD5A 4KDPA 3FM5A 1V3FA 4EV0A 3N4MA 2VT2A 3DEUA 5LGTA 2F5FA 3DF8A 3HOSA 2GWRA 3B73A 1G3SA 4YFNF 3KP3A 4JQFA 2W85A 4BAYA 2DAOA 2XAHA 2F5CA 4LD5A 4UHTA 4EM1A 3RKXA 2P6SA 4KNYA 1RUNA 1XCVA 1L3LA 3AAFA 3E6BA 3P9CA 3T5XA 2JPCA 2VXZA 2QENA 4B09A 5J6XA 1IF1A 4IRGA 1DDNA 4UXNA 2STWA 1TQPA 2PFBA 1XSVA 5FLXZ 1G3WA 1V4RA 2JSCA 1PP8F 2XAJA 4CGZA 1PDNC 4HZFA 3QOPA 5L3CA 1JHFA 5K1YA 1IW7F 4WXHA 3RI4A 4WJ3M 2P8TA 1Z1DA 1FLIA 2R7DA 2IVMA 1LEBA 4LG0B 4S04A 3HSFA 2C6YA 2A61A 1U78A 3JTGA 1U2WA 1EH7A 2YX4A 2M8EA 2A6EF 2O61A 3ZN0A 3DV8A 2MC3A 1KU3A 2A5YB 4I0BA 1J75A 1S29A 5LGNA 4L9VA 3W6KB 5JI6A 3BWGA 1S7AA 1O7FA 2P7VB 3IWZA 3FMQA 1ZG3A 2V79A 3R4KA 1P92A 3GLXA 4KIBA 1QZZA 2J5OA 1QQIA 4Q48A 4CXFA 4HV5A 4HF0A 2RNJA 4L9NA 1TQMA 3MWMA 4EJOA 1EH8A 5LLQA 2IA2A 4LB6B 1CF7A 1FZPB 4K2EA 2XKPA 3TOBA 2FXAA 4DNCA 4HA8A 2O03A 5HDNA 3KP2A 3O3KA 4OMYA 3EQLF 1SD7A 3HYIA 3I59A 3SXYA 1BIBA 1T98A 1OYIA 3FMRA 2DQLA 4KMFA 2A3SA 4HF2A 1LDDA 5CJ9A 1FC3A 3Q9VA 3HRUA 2EV6A 3MZHA 4KIFA 2Z99A 2Z5UA 3BROA 4MNUA 4GGGA 4KIGA 3GWZA 2ELHA 1G3TA 2FBKA 3EYIA 2HZTA 2DU9A 1XGMA 5FFXA 4BYYA 3L9FA 4G94A 1B6AA 2Y0MA 4G7HF 5BPDA 1WRJA 5JFRA 4RB0A 1W7PA 1TTYA 1XSDA 1LNWA 4U7BA 3CDHA 1I5ZA 3GF2A 3QPHA 2ZBKA 2PEXA 2XHKA 5K5RA 2G9WA 4U7DA 2XAGA 1UHWA 1R22A 5ILSA 2PG4A 2V9VA 4OIPF 3JW4A 1BIAA 1ONVA 2OBPA 2DK5A 2VBXA 1SFEA 3GEZA 4KUMA 5E17F 4ESBA 2GXGA 2DK8A 1KU2A 2GIVA 5LHHA 2LKPA 1LEAA 3V7RA 2EV5A 3GYHX 2NS0A 4WX9A 1E2XA 1YQAA 2COMA 3QP5A 3HHGA 2EB7A 3D5LA 2HGCA 3N97A 1ZARA 3GFLA 2P4WA 1K6OA 1R23A 2QQ9A 2VOOA 4AIJA 2FNPA 3TOAA 1J5YA 1ZRDA 4LG0A 4PGHA 2GAUA 1BI1A 2FA5A 2RQPA 5HOOA 1U5TB 5HS9A 3ABUA 2Y48A 1F1ZA 3GZ6A 3BPXA 2OU2A 1GVJA 2CFXA 1IN8A 1XD7A 3C1DA 2WV0A 3D0SA 1XN7A 4TV7A 1LB2A 4WJ4A 1ON2A 2H09A 1Z7UA 3F23A 3HRMA 4P96A 5HLIA 3F8CA 1WI9A 2HOEA 2IRFG 1KQ0A 5D4SA 2Q8KA 2RGVA 3FXUA 5TJJA 2MLGA 4HV6A 3E3VA 4A0ZA 3KE2A 5BMZA 3DXJF 2UWMA 3HSEA 5FO5A 5D8LB 4AIHA 5IT9K 5HDKA 1FPQA 3HOTA 1EQRA 1HKSA 2E7XA 4YIFA 4M6XA 1OPCA 4L0ZB 2V6CA 4A6DA 4RMFA 2O3FA 4N0BA 2EJRA 4LB5A 3E6CC 3JSPA 4OOIA 3I54A 2IW5A 5L3FA 2HFHA 4I7HA 1D8JA 2EA4A 1QNTA 5JHUA 2KKOA 1OKRA 4HX8A 1AWCA 2EA2A 4YG2F 3VOEA 3IKTA 4AH6A 2IPQX 1FYLA 4L5JA 4OU0A 2PQ8A 2WWYA 4RAZA 5CVUA 1HSTA 1Z91A 1FNNA 4ZZLA 1TQIA 4FX4A 2G7HA 4P5OA 5H6QA 5FGMA 5E20A 1R36A 2P6TA 3WTSC 3BJAA 3HIFA 3WE3A 3T8RA 4P9UA 1R00A 2ZJ2A 2X0LA 3LFKA 2YU3A 1G51A 4O2DA 2XROA 1KU9A 4I98B 5AONA 3KP7A 1ZGJA 2OQGA 1TLHB 2DI3A 2BGCA 2L01A 1ZH5A 3T1BA 5EEGA 4HW0A 2PI0A 1U5TC 4AD9A 4ASNA 3DP7A 4R79A 3HTSB 1IN7A 1ON1A 1ZHFA 1TNSA 1BJAA 1O3TA 4HX4A 2DLLA 2FF4A 3K0LA 5E8IA 4ZYHA 4M72A 1IXSB 3J81K 3EETA 1T39A 2VT3A 1ZQ1C 3P9IA 3GUDA 2QQAA 1H0MA 3F21A 1GXPA 3S2WA 2OQRA 1LQ1A 3EUHA 5BPIA 4ZYEA 3QP6A 5HVQC 2K4BA 4ZYDA 2DW4A 3CJNA 1TBXA 3I71A 4A5NA 1REPC 1AOYA 5LGUA 5AIQA 2P5LC 2L3DA 1BI3A