2P8TA

Hypothetical protein ph0730 from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
184
Chain Sequence
EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical protein PH0730 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0730
total genus 61
structure length 184
sequence length 186
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14544 DUF4443 Domain of unknown function (DUF4443)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p8tA01
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 2p8tA02
1KQ9A 3O6BB 2LSOA 1I1GA 3T8TA 4KMUX 1C0WA 5LBQA 3KP2A 5ILVA 1GXQA 1R22A 2DAOA 3R4KA 4LB6B 5EEHA 1LNWA 1UHWA 4E70A 1OMIA 1BI2A 1MKMA 3VODA 4WCGA 1O3QA 1FYKA 2XROA 3F3XA 5JHUA 1Z91A 2BYVE 4MQ9F 2FXAA 3DEUA 4UUVA 1FZPB 3KLNA 1F1ZA 1O7FA 5LGTA 1B4AA 2D1VA 2K86A 2XKOA 2Q2EA 1SD5A 4Q48A 4U7DA 1PP8F 2QLZA 1J59A 1B9MA 4I7HA 3BDDA 1GXPA 5F1RA 2W57A 4RMFA 3HRUA 3FM5A 3WU1B 2FBIA 4EVIA 5AIQA 2EA4A 1IN6A 1IZ1A 4A2UA 2HKXA 2CGPA 4IXAA 1STZA 2OZUA 3BROA 1JHFA 2Z5UA 5D8LB 3C1DA 4P5OA 4RGUA 1BI0A 5EEGA 2D6FC 1U2WA 3JSOA 1XSXA 2PEXA 2RVCA 3QP6A 5LHIA 3ABUA 5AIPA 2EA2A 3MZYA 2STTA 3MWMA 3GW2A 1DP7P 4WJ3M 5K1YA 4L5JA 2VT2A 2YR2A 5E18F 2OQRA 2EJRA 2DK8A 2CW0F 2A07F 3HTSB 2L4MA 1IL2A 3PQKA 3R60A 1D5VA 4UVBA 4GGGA 1BBYA 3IRQA 2AS5F 4MNUA 1CF7B 4HBLA 1JXSA 1OKRA 3K1NA 4L9TA 1LDKB 1C0AA 4K2EA 1J0RA 2P5LC 2FQ3A 3QU6A 5D5UB 2ZFWA 2M8EA 5FLXZ 3M8FA 2CYYA 1FC3A 5L3DA 3CUQA 5E1WA 5E8GA 4B09A 2VOPA 4ZZDA 1BOAA 1FOKA 4WXHA 4U0YA 1O3RA 4RB3C 4LFUA 2M45A 3IWZA 3K1MA 4A5NA 4BHCA 3W6KB 2OA4A 1XCVA 3EYYA 3WTWC 5ICGA 4P96A 4ESBA 2PMUA 3T1BA 1FY7A 4XLNF 4RB2C 1T39A 2PQ8A 2XGXA 2M87A 3EQLF 3I0TA 3MCZA 1D3YA 3GFMA 3WTSC 4U0WA 1BIAA 3J81Z 3ZMVA 1HW2A 1DPUA 3JAMK 2EV5A 5HDGA 5IT3A 1OYYA 3W6JB 3K69A 4OIQF 3LAPA 2IRFG 4QLCU 3QOPA 1S7OA 2NAZA 2R7DA 4RAZA 4LJZF 1FP1D 2L54A 2XUBA 1T38A 5BPIA 5DCMA 5HOOA 4L0YB 1J75A 4BHBA 4KN7X 2P6TA 3FXRA 5L3FA 4KT5C 1BM9A 2DPUA 3IC7A 1L0OC 3IRRA 2MH2A 4NB5A 1R1TA 4BAYA 4KN4X 1FYMA 5LHHA 4I0AA 5LHGA 2WTEA 4LGWA 3WODF 4N0BA 5LGUA 3CUOA 1P4AA 5FO5A 3ZMTA 1W7PD 2RNJA 3ZMUA 2VBXA 3DXJF 3R61A 2UZKA 1S29A 4S05A 1XDUA 2Q8KA 4L9NA 4FX0A 2FBHA 4Z2YA 2DTRA 3HSEA 2BBYA 1BN5A 2H6CA 1FX7A 2FA5A 3CLOA 4HLYA 1GHCA 1L0WA 4UVCA 4AWXB 3CJNA 1TQPA 3KZZA 1UHMA 2ZXJA 3HRTA 5D5XB 1YTYA 2V9VA 3I53A 2PJPA 1UCRA 4A12A 3J7AO 4FX4A 3P9KA 3IL2A 4ZYDA 1UFMA 2ACJA 4Q47A 4KYWA 4WK8F 4HOBA 2FBKA 3R0JA 2HYFA 2G9WA 3M1EA 1Z05A 4EJTA 1T98A 3WGGA 5LGNA 4M6YA 1ZG1A 3WGIA 5D4SA 4HQEA 4G7HF 4OINF 3HHHA 2CWEA 2V1XA 3EYIA 5CJ9A 3ZMZA 3FMSA 3GLXA 2BE5F 2IA0A 4PZJA 3M9AA 1W4MA 1LDJA 2IA2A 4OMYA 1ZHFA 5JR3A 1S3JA 2WC2A 3WE3A 4O3MA 3ML6A 5BPDA 1D8KA 1ZGAA 2B0LA 2P7VB 4PDKA 4UXNA 5JI6A 2BV6A 4TV7A 4A5MA 4LMYA 4BXUA 1E2XA 3Q9VA 1IRFA 4IHTA 1ZGJA 1K79A 1R1VA 3HRSA 2RDPA 2UXNA 5LLQA 1WRJA 2O03A 2X4HA 1YIOA 3TQNA 2E7WA 4ETSA 1Q1HA 3WU0A 3RIRA 2IA1A 5KK1A 1BJAA 4M9ZA 2FEZA 1YQAA 2W24A 2EWNA 4OMZA 3K9TA 3GZ6A 3R0AA 4M72A 1RUNA 1R23A 3S2WA 3QAHA 4OIOF 3ZN0A 2QENA 1WKMA 3IHUA 3ECHA 1K78A 3U9GA 2XASA 1K78B 5CVRA 4M74A 4BNCA 2RV8A 4M71A 3L9FA 5HLHA 1LJ9A 2VBZA 1RUOA 1EH6A 2JPBA 1KYWA 5FFXA 2UWMA 1QZYA 2HWVA 3F6VA 1KQ0A 1O3TA 3DQVC 2PI0A 1ZREA 1I27A 4L0ZB 3LQQA 4I98B 1TW3A 2OAZA 2FSWA 3BPXA 1QQIA 3GFJA 5J6XA 2ZNYA 3NQOA 4UNOA 4KIBA 3LA2A 3G73A 2Y48A 1G6NA 3M8EA 2P5VA 2L4AA 3QPHA 4RB0A 3K2ZA 3I5UA 2LF8A 3QU3A 2TDXA 4G7ZF 2K27A 1H0MA 5A2QZ 4G6QA 3R6SA 3F8FA 3GYHX 4N9IA 4XSXF 1CF7A 1YO5C 1IW7F 3L00A 4ASNA 2JZYA 2PFBA 2HQNA 4A0YA 3HSFA 4DNCA 1DUXC 3GZ5A 3WGHA 1G4DA 2DQRA 3KP6A 2V6CA 2ZCWA 1PDNC 2F5DA 4Y13A 2EFWA 3IKVA 5LRRA 3LFKA 1IN4A 5CVIA 2R7FA 4CHUA 3K0LA 3P9CA 1MGTA 1O7LA 3SHFA 3JAMZ 4GO1A 2ZNZA 4WXCA 3MQ0A 1MJBA 1O57A 5FFZA 3CUQB 2G7HA 1MDMA 4M73A 2FRHA 3GUDA 4HDVA 5L3EA 1G3YA 4OIRF 2OBPA 3M7GA 4CGZA 3BJ6A 2JRTA 4LG0A 4KDPA 3H3UA 4RGXA 4R79A 1SD4A 3GWZA 1HKQA 5D6FA 4HF2A 1Z7UA 4O6JA 2DO7A 2O61A 4L5IA 1J2XA 2C6YA 1K7AA 1FWZA 3KFWX 2EK5A 1T0FA 4A0XA 4O5VA 2D1HA 3KCCA 5DYMA 3HUGA 4YIFA 1U6GA 2OQGA 2DLLA 3I59B 3SZTA 3EETA 1ON1A 1YS7A 3FM3A 2P8TA 3D0SA 3RYRA 3WTYC 2KRFA 2VC0A 4FHTA 3VOEA 4HX8A 4EJVA 3WTVC 3B73A 3I58A 2UXXA 3FMRA 3GFLA 1IN7A 3HOTA 2Q0OA 2PLYA 3DFGA 2W85A 5HDNA 3CTAA 2OD5A 2VN2A 3E6MA 3LWFA 3DF8A 1HW5A 2CO5A 2GXBA 2JTVA 1W7PB 3JSPA 2DPDA 2FOKA 3BPVA 2QYOA 2COMA 4XLPF 2VBWA 3P9IA 4EM1A 2EV6A 2PMHA 2HQRA 3E5QA 4EQQA 4YFXF 1IXSB 1XDSA 2YU3A 2H27A 4KMFA 3IWFA 2P7CB 4OU0A 1XMKA 5H6RA 2VXZA 1P92A 3F8MA 4ZZLA 3V7SA 1USSA 1F5TA 1QNTA 3V4GA 4ZYGA 4U7BA 4EM2A 1HSTA 5DDGA 3K1PA 4QWQA 2A3SA 1TTYA 4I2OA 1T6SA 4F7ZA 1XSDA 3J81K 5ILSA 2A68F 3F72A 3ROUA 2IPQX 1KU9A 2HTJA 3WE2A 3LSTA 3FHZA 5FB2A 1WWXA 4YFNF 1TNTA 1OYIA 2H94A 3RI4A 2FNAA 2VONA 4B8XA 3KZYA 2DT5A 3WTUC 2V79A 5HLIA 1P4XA 3DP7A 1G3TA 4BYYA 1XGOA 2F2EA 3J80K 1HBXG 3G3ZA 4DQ2A 3BY6A 2XAQA 3V8LA 3ECOA 3CUQC 2ELHA 1SFUA 3ZMDA 4PCQA 4G7OF 4GYGA 2IVMA 5D8KB 3KP5A 1ZARA 1S7AA 2J5OA 4CO8A 3DPTA 2V1UA 3C3WA 2XKPA 4ENJA 1P6RA 3ZMSA 1CGPA 2YPRA 3TGNA 3NEUA 3U2RA 4GXOA 1H9GA 3DKWA 3E6DA 2NNYA 1R36A 2CG4A 3BJOA 3O3KA 3L2CA 1DPRA 3H3ZA 2F5CA 1FP2A 2ZMEA 4G9YA 5ED4A 2GQQA 1XMAA 2QZ8A 2KIFA 1ZLJA 2P6SA 1SFXA 5A2QK 4EJOA 3HHGA 3TOBA 5FD6A 1KA8A 2K4JA 4P9UA 4CZZA 2VBYA 5E17F 2HTSA 5CYVA 4AIHA 4ON0A 2IJLA 1X3UA 4WX9A 2RC4A 2E1NA 3T8RA 3N97A 3ZQ7A 2EB7A 3KE2A 2O6GE 2ZKZA 2YX4A 4I09A 5CVUA 4IRGA 5CVJA 3MAJA 2GIVA 3WTTC 3BP8A 4OIPF 1RI7A 5ICEA 2RKHA 2VT3A 2HKOA 1MD0A 2Z9OA 2LDUA 2EFPA 2KJBA 4UV9A 2Z33A 2HGCA 2MBFA 2MD5A 1U8RA 2RQPA 1OR7A 1PP7U 3TO7A 1R5GA 4ENKA 5ILUA 2QWWA 5DEQA 1J5YA 2H6BA 3OOPA 3F23A 3BJAA 5L3CA 2HFHA 2ZJ2A 3RDIA 3CO7C 3KP3A 2VOOA 4HAMA 3RTRA 1TQMA 1ZLKA 3F21A 4Y15A 3I64A 4MGRA 2Z3YA 4WWCA 1AWCA 4CICA 2RN7A 3BOQA 1ZN2A 2P5KA 1ZQ1C 2HZTA 1RNLA 3LA3A 1YLFA 3E5UA 2STWA 2EFQA 2E1CA 2OZ6A 2MLKA 5JVTA 1LDDA 4AIJA 2KIMA 3I54A 2ZMEB 3JW4A 4UHTA 3F8NA 3MFKA 2HR3A 3E97A 5TRDA 3QPTA 1FBSA 3MEXA 1U5TB 2XVCA 2IP2A 4IHSA 3V7CA 1XGMA 1RIOH 5DCFA 2HS5A 1WSUA 2WWYA 4U88A 3VFZA 4R1HA 3E3VA 5BS6A 3BZ6A 3TO6A 2CFXA 1I6XA 1LQ1A 1LEBA 3C7JA 1F9NA 1SMYF 4KIGA 5ICFA 1BI3A 1EH8A 1OPCA 3JTHA 2F5EA 1KU2A 2KKOA 1XCBA 1ZH5A 4HA8A 1ODDA 3C18A 4LK0F 2VE8A 1T2KA 1LEAA 5D5WB 1EFWA 3O2PE 2M30A 1J7KA 3SZPA 1FLIA 4PGGA 2GWRA 3I71A 3FX3A 2WV0A 1IN8A 4BHPA 3EDPA 4RGRA 5BQTA 1XN7A 4A6DA 1QO0D 1L3LA 2PBIA 2Y75A 3F6OA 4L18B 1IXRC 4CDGA 4IVNA 3HSRA 4PGHA 2QQAA 3P7NA 1YS6A 1ZRFA 5F6FA 1K6OA 3BWGA 3I4PA 2O3FA 4S04A 3ERED 2LKPA 1R00A 1P2FA 1TNSA 2G7UA 5DD8A 4N9HA 5IT9K 3LAJA 1XGSA 5HLGA 2XAFA 5F64A 3E6CC 1B1BA 2ESNA 1TLHB 2O8XA 1NHAA 3CDHA 3VB2A 2QVOA 5HS9A 2BEOA 2GZWA 1XGNA 2ISZA 4JBAA 2EFOA 1ONVA 1ZG3A 3KETA 4KICA 4YG2F 1SAXA 3AAFA 3F8BA 3V7RA 4M9SA 1TBXA 1U5TC 5FD5A 1MDMB 3TOAA 2KIUA 1EV7A 2V1DA 2ZO4A 5LEKA 4IPAA 2IT0A 4RAYA 2L01A 3RKYA 1ZYRF 4HYEA 1XSVA 3MZHA 2XIGA 1DDNA 1R58A 1JHHA 2GAUA 4AD9A 1U3EM 1FSEA 1G3SA 1QBJA 2AXLA 1IXCA 4HV5A 1MJ9A 2VODA 5FGMA 4LB5A 4EGYA 4MTDA 2P4WA 2L3DA 4ZH4F 3T0YA 4YFKF 2W84A 1WI9A 1TQIA 4A6EA 2A61A 3IKTA 3T5XA 4MTEA 5HDKA 4WJ4A 4L9JA 1O3SA 4WF2A 3KEQA 3HTUA 2K02A 4LLLA 2IW5A 2DBBA 1B59A 4IRIA 4ESFA 3ZPLA 4KNYA 1AOYA 1Z1DA 2XAJA 2Y0MA 1MZBA 2E7XA 3F22A 1ZRDA 1KGSA 3GO5A 4P9FA 3FXQA 3F8CA 4A0ZA 4D0PA 3Q5FA 4IRHA 2DW4A 3SFZA 1J9IA 2RGVA 3V8KA 1D8JA 3HRMA 1V4RA 1FSHA 2A6HF 2NS0A 1E17A 4EV0A 2QUFA 1FBQA 1HKSA 5TJJA 4I02A 3TDUC 3E5XA 2JT1A 1HKTA 4ENMA 4G94A 1BIBA 3WTXC 1SD6A 4HDUA 3REOA 3KP7A 1REPC 3RKXA 4P55A 4M9XA 1XD7A 5J8CA 4HX4A 1IAWA 2HYGD 4LD5A 5BMZA 4EJUA 5H20A 1B6AA 1ULYA 1FT9A 3WTZA 4MEXF 1EH7A 4ZYEA 4KA4A 4LLNA 1G3WA 4GYIA 4WXDA 3DPLC 6PAXA 1USTA 2BGCA 3FXUA 3QRFF 3KLOA 3SXYA 3KEOA 2VC1A 2XAGA 3LA7A 2JPCA 1QGPA 1EQRA 1LB2A 2YX7A 4MEYF 3ZP5A 2A69F 1XB4A 1FPQA 1YFHA 2Z99A 1LVAA 3B02A 2XV4S 5DUKA 5DV5A 2M1BA 2LF7A 5LEJA 4CXFA 1HSJA 2JSCA 4Q5SF 4JQFA 2FE3A 2MH9A 5JFRA 2NRAC 4AIKA 4G8XA 1S8NA 5K5RA 5IT9Z 4R8HA 2H09A 4EJWA 5BOXA 4UVAA 4OOIA 2HEOA 1HQCA 1ZG5A 2D45A 1GVJA 4HF1A 2A6EF 4EM0B 3SQNA 1BC7C 2LNBA 2M5WA 1IN5A 2MLGA 2OU2A 2MC3A 4HLXA 1IUYA 2GXGA 4LLGF 2FU4A 4AH6A 3FZVA 4AVPA 2YSRA 2ETHA 4JK1X 5E20A 1VTNC 4I01A 3KP4A 5E1ZB 1RZ4A 1SD7A 1IRGA 1FBUA 3PFIA 3GXOA 1OYWA 1YW9A 4LK1F 4KFCA 2A5YB 4I0BA 4LG0B 4ENNA 3TKYA 2L02A 5CVVA 3HYIA 2ZBKA 2NYXA 4ESJA 4RB1A 2W25A 2QQ9A 4ZYHA 3HIFA 1BI1A 2D2WA 3OV8A 1I5ZA 4HX7A 2FMYA 3WG9A 2ESHA 1Z6TA 3ULQB 3FWEA 1ZAOA 4Q4ZF 4EGZA 3J80Z 3L7WA 3GVAA 1SFEA 4XBFA 2DFIA 3TO9A 1A04A 2EFNA 3EUHA 2QBYB 1U5TA 2FNPA 3ELKA 1IF1A 1R5HA 4Y17A 1FNNA 2XHKA 2PN6A 2GA2A 2DQLA 4KIFA 5D6EA 2R3SA 4HZFA 1W5SA 1Z6RA 1HXDA 3E6BA 3QP5A 1KYZA 1MJAA 1TW2A 3Q9SA 3LQRA 4IJAA 3RPUA 3NRVA 1W5TA 5DD4A 2FF4A 2K4BA 1SMTA 1B9NA 3CO6C 4M6XA 5ERIA 1F4KA 3JTGA 3RPQA 1Y0UA 3I59A 1H9TA 1KU7A 2KJCA 2NNNA 4O2DA 2DK5A 2DU9A 4BH9A 5HS7A 4UV8A 1KQ8A 4NHJA 2ADUA 1QPMA 5AONA 5HS8A 1YW8A 5D4RA 5E8IA 4H0EA 5L3BA 1HW1A 2CQKA 3N4MA 3DV8A 1R1UA 2VE9A 4RGSA 4EMSA 5K5OA 3U1DA 2HOEA 5HVQC 1P4WA 5CLSA 2QBYA 2EV0A 3GEZA 4IF4A 1ON2A 3ABTA 1JGSA 5H6QA 1WQ2A 1YYVA 1JE8A 4XSZF 5L3GA 3RYPA 3RJPA 2CSOA 1I1SA 3FF5A 4MHGA 2HDCA 3ZN1A 4BQAA 1PUEE 5KVRA 1KU3A 2FMLA 2DI3A 3RKWA 4U0VA 2X0LA 4XRFA 1YG2A 4HW0A 4RS8A 4YIIA 5K5QA 4NQWA 1FYLA 3H92A 2O0YA 1BC8C 1ZRCA 3ISPA 4L9VA 1R7JA 4KUMA 2QM3A 3FMQA 2K7LA 1U78A 1S6LA 3GF2A 2XAHA 5J8FA 3TDZC 5ICCA 3PQJA 4FT8A 4HF0A 1V3FA 5E1XA 3VEPA 5DCMB 4HV6A 2QQBA 2ISYA 4G6DA 4HQMA 3L09A 1W7PA 4MQVA 3V8JA 3HOSA 5DUIA 4GCVA 4CYDA 2XRNA 5D5VB 2GA1A 5FLXK 3COAC 2MA3A 1UB9A 3D5LA 1YW7A 1G51A 1Z9CA 2F5FA 2PG4A 5LRSA 2J5PA 3GFIA 1QZZA 3GX4X
chains in the Genus database with same CATH superfamily
5M3MJ 1MBHA 2R4GA 3FBNB 4BLBA 3H0DA 2JA5A 1KQ9A 2IS2A 3O6BB 2ZJPF 2LSOA 2W00A 4XONA 4Y33A 1I1GA 4ABZA 3T8TA 2NVQC 3W3CA 2E2IK 2P0WA 3OYLA 4KMUX 1C0WA 5LBQA 1LE8A 1Z77A 3KP2A 2CFOA 3P5JA 1YIJI 2NVYA 1IE0A 4C2UA 2DA5A 5ILVA 1GXQA 1R22A 2DAOA 3BR0A 3R4KA 4LB6B 5EEHA 4DZPA 1LNWA 1UHWA 3DBLB 4E70A 1OMIA 1BI2A 1MKMA 3VODA 4WCGA 1O3QA 1FYKA 2LY9A 3S1RK 3A8JA 2XROA 1WH7A 3K4NA 1TWHK 2XPVA 2YU9A 3F3XA 4KMAA 2NS7A 5CQGA 5F04A 2E2HC 3NARA 2CRGA 4NC7A 2EIMH 3BUEA 4B48A 1WOPA 1J09A 5JHUA 4XOPA 3OYIA 4X6AK 1Z91A 1JVIA 1JOEA 2BYVE 4MQ9F 2FXAA 4A3GC 2NS8A 3DEUA 4UUVA 4OIOA 2VKVA 1FZPB 1MMAA 4AU7A 3KLNA 2L7MP 1F1ZA 2FD5A 4XLNA 3ZRGA 1XXAA 2V9PA 3SZGA 1O7FA 1WJDA 5LGTA 1OCRH 1B4AA 1B72A 2D1VA 3QYFA 2K86A 2XKOA 4AYBL 2VL8A 1F93A 2QQ8A 2Q2EA 2FUG2 1IRZA 1RU0A 1SD5A 1Y8RB 4Q48A 4U7DA 1AU7A 5IOTA 1PP8F 2QLZA 3ERMA 5C4JC 1OCOH 4RAGA 1J59A 4CCKA 1B9MA 5M5XJ 2VJJA 4I7HA 3BDDA 2MW8A 1FTZA 4BBSJ 5GPAA 2G0EA 3G4CA 3FKIC 1GXPA 2CV0A 3FISA 5F1RA 4LIUA 2W57A 3NUHA 4C3HC 4F93B 1S7EA 4BDZA 2LY1A 4RMFA 2LKXA 3HRUA 3L2WA 3FM5A 4X1EA 4QIWL 1WIHA 3PUFA 2FJ1A 3WU1B 1X19A 1WSVA 3JRGA 4A3EC 2FBIA 2I8DA 4EVIA 5AIQA 2V26A 2EA4A 1IN6A 2H1LA 1IZ1A 4A2UA 2HKXA 4XN3A 1Y56A 2CGPA 4IXAA 1STZA 5M5XK 3O8HA 3GTKJ 2VKHA 2OZUA 2VLAA 3TP0A 4QJVA 3BROA 1JHFA 2Z5UA 3BTJA 5D8LB 3C1DA 4P5OA 3HOXK 3RZOC 4RGUA 1BI0A 5EEGA 1EH1A 1YNJA 1U2WA 2Y0SL 2D6FC 2LBFB 3IAM2 3DWLE 3A4CA 3JSOA 3S3NA 3M4OJ 3JRHA 1XSXA 4A3CC 3CQZA 2PEXA 2RVCA 4U87A 3QP6A 3W2WA 1WQHA 2M3AA 4AUXA 4DGWB 3ABUA 5LHIA 3G4SI 5AIPA 2EA2A 3G6EI 4LK1A 3MZYA 2STTA 3MWMA 3ASNH 2VJ5A 3GIRA 3FHNA 4A3BJ 4XSXA 3GW2A 1VRQC 3K2AA 1N78A 1DP7P 4WJ3M 1PJ7A 3I4NJ 4LR2A 2CQ7A 5K1YA 4L5JA 1Y6IA 2VT2A 4XORA 4CCNA 2CUFA 3HOVC 3H0GJ 2LP0A 2AO9A 2YR2A 3H36A 5E18F 2VUMJ 2JA8K 2EH3A 2OQRA 2P81A 4A3GJ 3L4KA 1Y1WJ 2EJRA 2DK8A 3A03A 4J01A 2CW0F 2A07F 2OUMA 4MFDA 3LOCA 3HTSB 3S2HC 2L4MA 1IL2A 3PQKA 3R60A 2WV1A 2XDVA 2HXIA 1DP3A 3DLAA 1D5VA 4UVBA 3NWSA 2NVXC 3KX2A 3GTQJ 2R7ZK 4GGGA 5IY5H 1BBYA 1PUFB 1VGXA 3H3VL 3IRQA 1Y1WA 2AS5F 2EPFA 3SEQA 4RM3A 2K5CA 4MNUA 5GADJ 1CF7B 3IV5A 4HBLA 2E19A 4YEJA 1JXSA 1OKRA 3K1NA 4L9TA 1DCOA 1LDKB 1MMNA 4B1RA 2NVYC 3PL8A 1C0AA 4K2EA 1J0RA 2P5LC 1VNDA 1SFOJ 2FQ3A 3QU6A 2LY2A 4KMHA 4NUBA 5D5UB 2B7EA 2X6XA 4DIQA 1JQWA 2ZFWA 1O24A 2M8EA 3TFHA 5FLXZ 3M8FA 3S2DJ 4HG2A 2CYYA 3QPSA 1FC3A 3E7LA 5L3DA 3CUQA 5E1WA 5E8GA 4B09A 2VOPA 2DT6A 4ZZDA 2LTPA 2GSNA 3ZQQA 1O25A 2O5RA 1JUSA 1BOAA 4M6VA 1FOKA 1NG6A 4RM2A 4WXHA 1WZ2A 4C3IK 4U0YA 2WAFA 2V6SA 1O3RA 2KT0A 4RB3C 3GLLA 4LFUA 2M45A 1XZPA 4Y52K 3IWZA 3K1MA 4A5NA 4BHCA 1WGXA 2BVLA 3W6KB 5EF6A 2ID3A 2OA4A 3H0GC 4FCYA 1XCVA 2EZLA 3IUOA 3EYYA 3WTWC 1WCMA 2E2IJ 2F4IA 5ICGA 3BR5A 5B1BH 1G8XA 4BE1A 4P96A 4ESBA 4E7HA 4Y3OA 2PMUA 3IAS2 1FY7A 3T1BA 2B63J 3C2GA 1I6HJ 3H5AA 4XLNF 1SVMA 1E3OC 1T0FC 2LG4A 5IP9C 4RB2C 1T39A 2PQ8A 2XGXA 3HXLA 4HNTA 2M87A 3EQLF 3I0TA 1VQLI 3MCZA 1D3YA 3GFMA 1JT6A 1WJEA 3WTSC 4U0WA 1BIAA 5EGEA 3J81Z 4PFOA 3ZMVA 1HW2A 2WBMA 2L7KA 3MKWB 1WORA 1DPUA 3JAMK 3PIOF 1Y1VJ 2EV5A 5HDGA 1OYYA 2WY8Q 3K69A 1GUUA 3W6JB 5IT3A 4I6ZA 4OIQF 3LAPA 1TWAJ 2IRFG 2X6YA 3QOPA 4QLCU 2H8RA 3S15K 5FLMJ 3CCJI 4ZYAA 1S7OA 2NAZA 2B63K 3RZDJ 2R7DA 4RAZA 3FIWA 4BS9A 4LJZF 3ONQA 1FP1D 2L54A 1BA5A 2XUBA 2O9LA 5HL8A 2COBA 2XGCA 1T38A 5BPIA 4LJZA 4BJ5C 5DCMA 2VUMC 5HOOA 4L0YB 1J75A 1BDFA 4BHBA 1U9OA 3HUGB 4KN7X 3DEWA 2P6TA 4WILA 4V19K 1GV2A 3FXRA 3GTJK 4C2MK 5L3FA 4KT5C 2K3FA 1BM9A 3DU5A 1WH5A 3IC7A 2DPUA 2XCOA 4ANJA 1K6YA 3J7ZI 1L0OC 2IS6A 1HOMA 3ABKH 4S0HB 3IRRA 2HQAA 2MH2A 4NB5A 1R1TA 4BAYA 4KN4X 1FYMA 5LHHA 4I0AA 1TWGA 4NNJA 2Y3PA 2ZC2A 3GTMA 5LHGA 2WTEA 4LGWA 1D0YA 2V4JC 2E34A 3WODF 4N0BA 2NVYJ 2K9NA 5LGUA 3OYDA 1IDZA 3CUOA 1P4AA 4NC6A 5FO5A 3ZMTA 4IHVA 3W6VA 4MEYA 1Y1VA 5F0FA 1I6HK 1W7PD 2DOAA 2RNJA 3OYGA 2R7ZA 5J4YA 3ZMUA 3JREA 1A6IA 2VBXA 3B6AA 4KB4A 5F1JA 3CMEI 3DXJF 3R61A 2VIXA 5EDNA 2UZKA 2E2JK 1MMGA 1JTXA 1BJTA 5E3NA 1S29A 4S05A 3HOZK 1VQ5I 2DA3A 3ABMH 4BY1C 3K4LA 4A3LC 1XDUA 3CP8A 3Q0WA 2Q8KA 2JH3A 4L9NA 4FX0A 2FBHA 3OYNA 1VH2A 1AB4A 4Z2YA 4X0GA 2DTRA 3HSEA 2BBYA 1WCMJ 1BN5A 1TWAA 2H6CA 1FX7A 4BBSC 2FA5A 3CLOA 4HLYA 1GHCA 1L0WA 3AFHA 2GOXB 4UVCA 5C4JJ 2DXIA 1TZLA 4BE2A 4AWXB 3CJNA 1TQPA 4E7SA 1PJ5A 4W1UA 3KZZA 1UHMA 2ZXJA 3BTCA 3HRTA 5D5XB 4A3IJ 4CCOA 2CQNA 5FJ8J 2OCEA 5EG0A 1YTYA 2NXNB 2V9VA 3I53A 2PJPA 1UCRA 5FROA 4A12A 4XIDA 3J7AO 1EA3A 4FX4A 3Q3QA 3P9KA 1VQKI 3IL2A 4YFXA 2HZDA 4ZYDA 1UFMA 2ACJA 4Q47A 2A6EA 4KYWA 4WK8F 1WCMK 5HLTA 2E2HA 4HOBA 1LFUP 3PSIA 4I99C 3ADAC 2FBKA 2KISA 4A3MC 5FKOA 2YU9C 2MSYA 3R0JA 2HYFA 4FE7A 2KP6A 4BEHB 2G9WA 3A0HC 1Z05A 3M1EA 3QODA 4B44A 4ITVA 1T98A 4XICA 4EJTA 2IEKA 3AD9C 4G7HA 3WGGA 3GTKC 2EINH 3S3OA 1SEUA 2IGKA 5LGNA 1DCPA 3GTOA 2L7FP 4M6YA 2JN6A 3WGIA 1ZG1A 5D4SA 1VQ9I 1D1AA 3OWTA 5FLVA 3A02A 4HQEA 4G7HF 1LKXA 4OINF 4RBOA 1J98A 3ASOH 5TJ3A 4CYCB 1TWHA 1K83A 3HHHA 4BDYA 2CWEA 2V1XA 1TC3C 3EYIA 3S14K 1GLNA 5CJ9A 3ZMZA 3FMSA 4KAWX 3GLXA 4XLPA 2BE5F 2IA0A 2WY7Q 5E3LA 4PZJA 1ITYA 2QF7A 3M9AA 1BL0A 3HXAA 1W4MA 3DKYA 3OIPA 1LDJA 4GTFA 2IA2A 3FKIJ 5EG0B 2VKEA 4OMYA 3GTKK 4KM8A 3CMYA 1ZR4A 1IW7A 1JI8A 1ZHFA 2CV2A 2KRHA 5JR3A 3ESWB 1YJNI 4PFPA 1W36D 3J7YJ 5C3EK 1S3JA 2WC2A 5IP9J 5E68A 3WE3A 4O3MA 3ML6A 5BPDA 1D8KA 1EKEA 1TT0A 1ZGAA 2B0LA 2P7VB 4PDKA 5IYCK 4UXNA 3DKXA 2BV6A 5JI6A 4TV7A 3CC4I 4A5MA 3VSKA 4LMYA 4BXUA 2DA4A 2K85A 3GTQA 1E2XA 3Q9VA 1IRFA 4GFQA 4IHTA 2CW8A 3H3VD 3FXLA 1ZGJA 3S1QC 2ECCA 5EZHA 3CJRB 1R1VA 3A01A 1K79A 3HRSA 1Y1WC 1R4MB 1T56A 2Y30A 2RDPA 2XGEA 3Q0VA 2UXNA 5LLQA 1VFCA 1WRJA 2O03A 2MABA 1NH3A 4BBRK 1R71A 2QEXI 3OYCA 5F27A 4KMDA 2W7VA 2X4HA 3BR2A 4XK4A 1GDTA 3S1RC 2M9HA 2LKSA 4DBRA 1YIOA 3TQNA 5B66C 2E7WA 1I3QJ 4ETSA 1Q1HA 4M3BA 1BR1A 3WU0A 1VQOI 1TT5B 3RIRA 4B43A 1X1AA 2IA1A 1J6VA 1U0JA 2R7OA 2X9DA 5KK1A 4A93K 1F43A 1BJAA 4M9ZA 3LSHA 3I4MK 2DJNA 1MW7A 1G2HA 5GAEJ 2KHMA 3CF2A 4BEHA 3M4OC 2FEZA 1YQAA 4PJJA 1MSFC 4C30A 5M5YK 2KZVA 1GE9A 4OAZA 2W24A 5JVGF 2EWNA 4OMZA 3GEHA 3K9TA 2IS4A 4RA2A 3GZ6A 5J1UA 1J6XA 2E36A 3R0AA 4EATA 2XF7A 4M72A 2ZMEC 1POGA 2L5QA 3ABLH 4C3JJ 2RAEA 1BW5A 5K7HA 1O27A 1RUNA 1R23A 3S2WA 3QAHA 2LMDA 4OIOF 3ZN0A 2MFZA 2QENA 1WKMA 3IHUA 3ECHA 1K78A 1MSEC 2DFFA 1IGNA 3U9GA 2R7XA 3OYJA 3CC7I 2XASA 4G7OA 1ZQ3P 1K78B 2WB1A 3GCMA 4M74A 5CVRA 3WHCA 4BNCA 2RV8A 2WB1D 2AHQA 2QCOA 3SEZA 4BY7C 1WVRA 4C2TA 4M71A 3L9FA 1WJFA 3KYLA 5HLHA 2JA2A 2LFBA 1LJ9A 2DOEA 2VBZA 1RUOA 1EH6A 3EQLA 1BGWA 1S9HA 2JPBA 1KYWA 5FFXA 3Q3SA 2UWMA 1N75A 1U8BA 1I50J 1QZYA 2HWVA 3F6VA 4QTRA 3W2VA 1KQ0A 1O3TA 1ETWA 3DQVC 1ZREA 2PI0A 1I27A 1SFOC 3M8JA 4L0ZB 1T8IA 3LQQA 4I98B 4HPQA 1YX5A 1V5VA 2Y9YA 1IDYA 4CH7A 1WFXA 1TW3A 2OAZA 5KNLA 2FSWA 2NVQJ 2JA5K 2OC6A 3BPXA 1VQPI 3M1CA 3GTOK 1MBFA 2CFAB 1QQIA 3GFJA 2E5NA 3H9GA 2B9SA 3GEEA 5J6XA 3WODA 3OSGA 4XRSA 3H3VK 4AYBD 2ZNYA 5TMFA 3NQOA 3I3LA 5C4XC 1I3QA 2A05A 4UNOA 1SVLA 3BR1A 4ZDOA 4KIBA 3AG4H 3LA2A 4A3DJ 3UR3C 2R92J 3HOUJ 5IP7C 1JKOC 3G73A 3G1OA 2Y48A 2ZJQF 2H1KA 1G6NA 3K7AJ 3M8EA 4HNVA 1YHQI 2K40A 2HDDA 2K9SA 2K3PA 1R9TJ 4A3IK 2P5VA 3K10A 1GVDA 4PJLA 1O28A 2L4AA 1T95A 3QPHA 4ZJZA 2FX0A 3GTOC 4RB0A 5C4JK 4FQGA 3BCBA 3I5UA 2LF8A 3K2ZA 5K7ZA 4GTBA 3CCEI 3G1MA 3RZDK 2LREA 1YX3A 3QU3A 2TDXA 4G7ZF 2JA8C 2K27A 1H0MA 3SZZA 3CCMI 5A2QZ 5TISC 1SANA 4G6QA 3R6SA 3F8FA 3GYHX 4N9IA 4XSXF 1CF7A 3GMEA 3PM1A 4M3DA 2CMPA 1YO5C 4A3IC 3LSPA 3OOUA 4J19A 3CCLI 1XMXA 5LD2C 1IW7F 5GTHC 1HDDC 4LOWA 4M3FA 3BG6A 3M3YC 2Y0SN 3L00A 4JX4A 4ASNA 1B8IB 1XXCA 2HU9A 2JZYA 2PFBA 2HQ5A 2HQNA 4FZBA 5IOQA 4G0WA 1A35A 4A0YA 1ETQA 3WG7H 3HSFA 3QWLA 4DNCA 3HOYJ 3LPXA 2R7QA 3JCUC 3HOXJ 1DUXC 2W48A 3GZ5A 3WGHA 2BOLA 4XKVA 1F7UA 3DCFA 1MBGA 3FBIB 1G4DA 2DQRA 3KP6A 2V6CA 2ZCWA 2JA8J 3GTOJ 1PDNC 2F5DA 1D0XA 4UUTA 4Y13A 3AL0B 4A3EK 2EFWA 3HOWJ 3IKVA 3JSTA 2M8GX 1KONA 3M3YK 3RQ4A 1U9NA 5LRRA 1ZELA 1TL8A 2LYCA 3LFKA 2R92K 5GP9A 3HOUK 2X6WA 1IN4A 5CVIA 2BE5A 3ZQIA 1S72I 2R7FA 2KDZA 4CHUA 4DYCA 2V6EA 3FK7A 2ZFZA 3K0LA 3P9CA 1ISEA 1MGTA 3HOVK 4A3JJ 3DBRB 1JUMA 1O7LA 2CH0A 4XKWA 3SHFA 3JAMZ 3VYRB 3GTMK 4GO1A 2ZNZA 1RR7A 4XKBA 1X3WB 4WXCA 3MQ0A 1KZHA 3QQAA 4IOCF 2M2EA 3GTLK 1MJBA 2DCEA 4V2GA 2KIQA 1ETXA 1O57A 1V54H 5FFZA 3JRDA 4KN7A 3CUQB 2R7ZC 2G7HA 1MDMA 1VQ6I 1DU6A 4M73A 2FRHA 3GUDA 2XC7A 4HDVA 5L3EA 1G3YA 4OIRF 2OBPA 1E3PA 3BTIA 2BY3A 2OTLI 5FLMK 1TP4A 3D5SC 3M7GA 4CGZA 3BJ6A 2JRTA 1TWFC 2ZXIA 4AM3A 1JKQC 4A3KK 3GTLC 4LG0A 4KDPA 1QVUA 1A5JA 3H3UA 1RPWA 4A3MK 2LOOA 2ZXHA 4RGXA 5J3LA 4R79A 1SD4A 2NVXK 1EF4A 3MKYB 2VI6A 3GWZA 1I6VA 1AKHB 1HKQA 2E1OA 3PUBA 2NVXA 5D6FA 2DDAA 4HF2A 4IHWA 1Z7UA 4O6JA 1Z3YA 1TWGJ 3HOWK 2DO7A 2O61A 4L5IA 1PYVA 1J2XA 2C6YA 2R5YB 1FWZA 1K7AA 1AA7A 4KATA 1YX2A 3IH2A 3TEDA 3KFWX 3CCRI 2EK5A 3VYSB 5F0HA 1T0FA 1WQGA 4OIPA 2KRCA 4JP0A 2RGRA 4A0XA 2HPMA 4O5VA 2JA5J 2IGMA 1VQ4I 2D1HA 3KCCA 3K6GA 2NVXJ 1XS9A 3MVPA 5DYMA 2PX9A 3N0CA 3HUGA 3ZQCA 4B4CA 2R0QC 4YIFA 1U6GA 2OQGA 2DLLA 3I59B 3SZTA 4BQOA 5DM7F 4NBQA 2IS1A 1UG0A 5IP9K 5C3EC 1TWGK 2DYRH 3EETA 1ON1A 4D1QA 2OTJI 1YS7A 3FM3A 2P8TA 3D0SA 3RYRA 3WTYC 2KWAA 3I4NK 2CUEA 3S16K 2KRFA 2UV1A 5FKLA 3GSIA 3OMYA 2VC0A 1APLC 4FHTA 1XXBA 4Y7NK 2Z2SB 3VOEA 4HX8A 4EJVA 3WTVC 3B73A 3I58A 3MMYB 2UXXA 1ORKA 1VF9A 3FMRA 3JRFA 3GFLA 4B47A 4OAYA 3RQIA 1IN7A 3HOTA 3S15J 1TWHJ 2Q0OA 5B3SH 3EUHC 1ERDA 2PLYA 3DFGA 2RNGA 5KAIC 3S93A 3HOZC 2W85A 2DMPA 5HDNA 3CTAA 3AH5A 3N05A 1G59A 1J6WA 3GTLA 3RCOA 3CCSI 2OD5A 1K4SA 1D5YA 1A36A 4BJ6C 2VN2A 4XRSG 3K7AK 2PMZN 2EZHA 5FKNA 3E6MA 3OSFA 3LWFA 3OYEA 3S16C 3DF8A 2Y0SD 2B63A 3WU2C 1HW5A 4ZC3A 1FIPA 1JJ8C 2CO5A 2GXBA 1Q1VA 2JTVA 3GEIA 1W7PB 3PO2K 1A6QA 2ELKA 4JOMA 1YOVB 3JSPA 4B3XA 3UNGC 2HOSA 2V6UA 2DPDA 4HSRA 3S1NJ 4PJMA 3FKJA 3CMAI 2FOKA 3S2HJ 1GV5A 3BPVA 2HVRA 1I50C 2F6CA 1YE9A 2QYOA 3HOYK 3I9V2 4IL6C 1OR7C 4BKWA 2COMA 2XPWA 4XLPF 4GTCA 2DFHA 2VBWA 3LSKA 3TFJA 5H2FC 2BZTA 3P9IA 2WA0A 5M5WK 1DU0A 4EM1A 3PO2J 1F7VA 2EV6A 1MIJA 2IBDA 4C2MC 4NQWB 2VPRA 2PMHA 2HQRA 3E5QA 4EQQA 4YFXF 1IXSB 4OWRB 1XDSA 1R49A 3M3YJ 2YU3A 1BW6A 3OYKA 2EILH 3LSRA 2H27A 4KMFA 3IWFA 4OU0A 1XMKA 5H6RA 2P7CB 2OV7A 3CQZC 2VXZA 3K4JA 1P92A 3F8MA 2TCTA 4ZZLA 2HVSA 1ETOA 3V7SA 3IPJA 1USSA 2X51A 3CD6I 3PSFA 3KIOA 1F5TA 1QNTA 2E71A 3V4GA 3ZR8X 3FXOA 3GZNB 3OR2C 3DU6A 4ZYGA 2KL4A 4U7BA 2BY2A 1F36A 2R7WA 1JGGA 4EM2A 1HSTA 5DDGA 2WADA 1FJLA 3AD7C 2NVQK 3K1PA 3HL2A 3GTMJ 5EGOB 3A01B 4QWQA 2A3SA 1SMYA 1X4OA 1TTYA 1BR2A 3OR1C 4BY1J 4I2OA 4BY7J 2DODA 3LSIA 1T6SA 4F7ZA 1XSDA 3L2QA 3J81K 3S1RJ 5ILSA 3HDDA 2A68F 2CFAA 3F72A 2WB1N 3ROUA 4GT9A 2IPQX 5IYBC 1P9QC 1KU9A 2HTJA 3WE2A 3LSTA 3JRCA 3FHZA 5FB2A 2A68A 1WWXA 2UUZA 1R9TK 4YFNF 1USOA 1TNTA 1OYIA 2H94A 4LK0A 3HGYA 4E7IA 3RI4A 2FNAA 2VQCA 5JLXA 2VONA 3FKIA 3HPGA 4BBRC 4B8XA 3KZYA 2DT5A 4JX6A 3WTUC 3S0XA 3MKZA 2M0MA 4C9YA 1DGWY 2V79A 1P4XA 2KMUA 5HLIA 3BZCA 5K7FA 5M3MK 3CQZJ 3DP7A 1G3TA 4BYYA 1XGOA 2F2EA 4QPOA 1IV8A 3OREA 3J80K 1R6RA 1HBXG 3G3ZA 1K61A 5FRNA 2HNHA 2ZSIB 3PO3C 4XNFA 1FIAA 1UZCA 4IQ4A 3S14C 3S2DK 5KCMA 4DQ2A 3LNQA 3I4MC 4P5AA 4A3FK 3BY6A 3J7AY 2XAQA 3T01A 3S32A 3V8LA 3OL4A 3AD8C 2WB1L 3ECOA 3EUKL 3X2QH 4A3LJ 1ACIA 1I3QC 4XOTA 3TBIA 3MD2A 3CUQC 2ELHA 4C3JK 4MLOA 3ZMDA 1SFUA 2R5ZA 1HC8A 4PCQA 3OPFA 2Z16A 2R93A 1UELB 4G7OF 3OEPA 3HGGA 4GYGA 2V1NA 5JHFA 1YJ9I 2IVMA 5D8KB 4UB6C 3SJMA 4E7LA 3KP5A 1ZARA 1S7AA 3BTLA 5IYCJ 2J5OA 2R93J 5HODA 5IYCC 4CO8A 3DPTA 2V1UA 3S2DC 2Y69H 3S17K 3C3WA 3GTGJ 2XKPA 3HKZN 4E7JA 2HI3A 1P6RA 4ENJA 3ZMSA 1CGPA 2JWTA 2YPRA 3NEUA 3TGNA 3U2RA 5DS9A 4GXOA 3A8IA 1H9GA 3IH4A 4DYQA 3TL4X 4G6TB 2EQRA 3MN2A 3DKWA 3H5RA 2LK2A 1OCCH 4P1WA 3E6DA 2NNYA 1R36A 2CG4A 3BJOA 3O3KA 4D7NA 3L2CA 3KYCB 1HQMA 1TWCK 2R7RA 1DPRA 1HLVA 3H3ZA 2GM4A 2F5CA 5M5YJ 4D9JA 1PUFA 2JK3A 4IEJA 5DTDA 1FP2A 2ZMEA 4G9YA 4XRMA 2R7TA 2FOWA 2GQQA 1XMAA 2QZ8A 5ED4A 2KIFA 1ZLJA 1MMSA 2HYJA 4A3JK 4C3HK 2P6SA 1KQ4A 3OS0A 1SFXA 2VB6A 5A2QK 4EJOA 3HHGA 3TOBA 5FD6A 1KA8A 2WAEA 1WOOA 2K4JA 2E2IC 4P9UA 1DCHA 4CZZA 4XLCA 5FJ8K 1D1CA 2JA6A 2VBYA 4BXXC 4F91B 5E17F 2HTSA 5CYVA 4AIHA 2MC4A 4ON0A 5M3FJ 1SC7A 4LQYA 2IJLA 1X3UA 4WX9A 2VJ4A 3QYEA 3N0BA 2RC4A 4DYRA 2E1NA 3T8RA 2F5VA 2MYSA 4IO9F 3L4JA 5C44C 4FASD 2M7AA 1MBJA 1VI0A 3N97A 3ZQ7A 4C3IC 2EZIA 3M07A 5GTIC 2EB7A 3KE2A 2O6GE 4AVZA 2ZKZA 1XPPA 4BACA 3OYHA 2CUJA 4C3HJ 2YX4A 4I09A 5CVUA 4IRGA 1X58A 2GAGC 5CVJA 4KASA 3OL3A 1IJWC 2NVTK 3MAJA 2MGQA 2GIVA 2JVGA 3WTTC 2CUZA 4A3CK 3BP8A 4OIPF 2R5ZB 2KPMA 1RI7A 4CCJA 5ICEA 3DPUA 2RKHA 2VT3A 2VXDA 2IAIA 4XSZA 4YG2A 4KN4A 2HKOA 1MD0A 5E3OA 4RDUA 2Z9OA 4DZJA 2X1DA 2LDUA 2EFPA 2KJBA 4UV9A 2CW7A 2LR8A 5IORA 4CCMA 1HI9A 3BG3A 2Z33A 3GTQC 1JKRC 2HGCA 2MBFA 2MD5A 4Y4RA 1U8RA 2NVYK 2O5IA 2RQPA 1OR7A 1B72B 4XLEA 2E2HK 3NWTA 4FM9A 1V5EA 3K70C 2R93C 1PP7U 2ZUFA 3TO7A 1R5GA 5CKTA 4BKXA 4ENKA 5ILUA 3D1NI 2QWWA 1I50A 1O2FB 1YCLA 4IOAF 5DEQA 1J5YA 3EPZA 2H6BA 3OOPA 3F23A 3BJAA 5L3CA 1TWFJ 1ZYRA 2BHZA 2HFHA 2ZJ2A 3RDIA 3CO7C 3TW7A 3KP3A 2VOOA 4HAMA 4C3IJ 1JKPC 3RTRA 4C45A 1V5GA 3LSGA 1TQMA 3H5NA 4A3DK 2IXSA 4E7ZA 3AQPA 1ZLKA 5KHDA 4F55A 4RLQA 2JRMA 3F21A 2L9NA 4Y15A 3I64A 1WJBA 4MGRA 1D1BA 2Z3YA 4WWCA 4HEA2 1AWCA 4CICA 2L9VA 2JA6C 2RN7A 3BOQA 5IOZA 1ZN2A 2P5KA 2MG4A 1B8IA 5LFAA 1OISA 2E2IA 2RH6A 1ZQ1C 2HVQA 2M34A 2HZTA 1RNLA 1Z3XA 3LA3A 3RPUD 3E0JB 2MD0A 2QSFX 4GRIA 2O5JA 1YLFA 3E5UA 4LIVA 2STWA 2EFQA 2E1CA 2OZ6A 3CMMA 4LLGA 2MLKA 5JVTA 1LDDA 4AIJA 3VSLA 3BG9A 2HPIA 4FE4A 2KIMA 2FQTA 3I54A 2FQOA 2Y9ZA 2ZMEB 3JW4A 4UHTA 3F8NA 3L1PA 2ID6A 3MFKA 1TWHC 5EJCA 2HR3A 3E97A 5TRDA 2X48A 3QPTA 1FBSA 3MEXA 1U5TB 2XVCA 2QSGX 4KMUA 4A3FJ 2IP2A 3ZQGA 2DFEA 1I3AA 3RZOK 3F0CA 2GLOA 3S1NK 4IHSA 4AYBA 3V7CA 3RZDC 4A3LK 1PJRA 1XGMA 1RIOH 4EEFG 5DCFA 1UV7A 4YFNA 2JVHA 3TW6A 4BQNA 2GOMA 2A6TA 1FOWA 4HRIA 4GTEA 2HS5A 3QPLA 1WSUA 3FOFA 3S1MJ 2OCCH 2R7ZJ 3HEFA 2WWYA 2XF5A 1W1WE 4U88A 2Q2EB 3VFZA 4R1HA 3E3VA 3ZGKA 1A31A 2LD5A 1YI2I 1X1BA 5BS6A 2ELJA 3BZ6A 3KZIC 3TO6A 2CFXA 4NC8A 3S14J 1I6XA 1HA8A 4ILDA 1LQ1A 1Z7LA 1LEBA 5D4DA 1WJ5A 2YUSA 3GTPK 3C7JA 1F9NA 1JT0A 4KDDA 1SMYF 2DT7B 4KIGA 1YJWI 3RZOJ 4BLAA 5ICFA 1BI3A 1EH8A 1OPCA 2Y2ZA 3FKIK 2B63C 1XG1A 2JSPA 2XB0X 2P5MA 1YRNB 3HKZD 3JTHA 3DTIA 2VUMA 1BR4A 1KU2A 2F5EA 3IH3A 5TGTA 1TWAK 5CHPA 2KKOA 1XCBA 4IHYA 3OS1A 1ZH5A 3HZJA 4HA8A 1WCMC 1ODDA 2DA1A 3C18A 4BBRJ 1ZBSA 4MEXA 4LK0F 2D5VA 1AKHA 2VE8A 1T2KA 1LEAA 3G1LA 5D5WB 1EFWA 2BW3B 3GTPJ 3O2PE 2BXZA 2E1MC 4II2A 3OY9A 2M30A 1J7KA 3VPRA 1Z21A 1DQUA 1Y0NA 3SZPA 3MMLB 4P5BA 1V5FA 2JMWA 1O4XA 1FLIA 4PGGA 2GWRA 2ME0A 3I71A 4CCLA 2R92C 3HOUC 3FXKA 3FX3A 3KYDB 2WV0A 3BG5A 1IN8A 1VQ8I 2IGNA 4XLFA 1WJAA 4BHPA 3EDPA 1Y1VC 3HOXC 5GAGJ 4RGRA 3BZKA 5BQTA 4KISA 2HOAA 3ZQHA 5IYBK 1XN7A 4A6DA 1QO0D 4DOZA 3FDYA 1L3LA 3SYTA 2BVMA 2CQXA 3VA7A 2GXAA 2NVTJ 2PBIA 2Y75A 3F6OA 2AXTC 2EZKA 2JA6J 4A93J 3GTKA 4L18B 1IXRC 4CDGA 1YRNA 5M3FK 2ZSHB 4IVNA 3HSRA 1I6HC 4PGHA 1W0UA 4Y7NJ 3TMOA 1AHDP 2E1MB 2QQAA 1N25A 3DEEA 3P7NA 2FQ4A 1YITI 1Y1VK 3E1SA 1YS6A 1NK3P 2JQ7A 3UKGA 1ZRFA 5F6FA 1K6OA 2V6TA 3BP3A 3BWGA 3I4PA 3HM5A 2O3FA 4S04A 4AYBN 2QKLB 2LKPA 3ERED 5IYBJ 1LFBA 2DMNA 1R00A 1P2FA 1TNSA 3BC8A 4GDFA 2CQQA 2G7UA 2X1CA 5DD8A 2A69A 4N9HA 4QIWD 5IT9K 3LAJA 1XGSA 2L9SA 4D5CA 5HLGA 2KQRA 3JRAA 2XAFA 2I5UA 1FOXA 5F64A 2X85A 1SFKA 3E6CC 1B1BA 2LH9A 3RKQA 2ESNA 3TTGA 1TLHB 1IC8A 2O8XA 3S8PA 4IQJA 3PNTA 1NHAA 3CDHA 3JR9A 3VB2A 2QVOA 5HS9A 2DN0A 4DDQA 5M5WJ 1ETYA 2BEOA 5C4XJ 1O26A 2GZWA 1XGNA 1Z0XA 3FK6A 2ISZA 4E4HA 4A3BC 4JBAA 3CAGA 2EFOA 1XX5A 1M1EB 1MBKA 5IOSA 1QRYA 1ONVA 4KARA 1ZG3A 1D0ZA 3CJTB 3S16J 1E3HA 3KETA 5E3MA 4KICA 4YG2F 2CU7A 2A5WA 1SAXA 3AAFA 3F8BA 3HC7A 4BGDA 2PA8D 3H9QA 3V7RA 4M9SA 1TBXA 1U5TC 3ZOBA 5IPAA 2QA4I 4IKFA 3PJRA 5FD5A 3FOEA 1MDMB 1MBEA 2HXOA 4CYCA 2LRDA 1ZKGA 2PJRB 3TOAA 4A3BK 2KIUA 5JLWA 1EV7A 1H88C 2V1DA 3SFIA 2ZO4A 1O29A 5LEKA 4IPAA 2IT0A 2E2JJ 2XSJC 4RAYA 2L01A 2V9KA 3RKYA 2LLKA 4Y52C 1ZYRF 4HYEA 1XSVA 3GTJC 3MZHA 3GTPA 2XIGA 1DDNA 3CCYA 4KB2A 1R58A 1JHHA 3H0GK 2GAUA 4AD9A 2E2JC 2GIZA 3HKZA 2M7BA 1U3EM 2AQFA 1Y1WK 1RESA 2E35A 1FSEA 1G3SA 3PFYA 3LSJA 1QBJA 2AXLA 1IXCA 1HF0A 2ICWG 3AG3H 1QHHD 2I10A 1X4PA 4HV5A 1MNEA 5FKMA 1MJ9A 1GT0C 2Y31A 5DM6F 3V42A 4PAAA 3CF5F 2VODA 5FGMA 4LB5A 2YS9A 4EGYA 4BBSK 4MTDA 3HG9A 4XMYA 3CCQI 4GTAA 2P4WA 2L3DA 4GZYA 3S3MA 3LSMA 4ZH4F 1CQTA 2NVTC 3U21A 2M4KA 1MH4A 4CZCA 1MNDA 1JTYA 3T0YA 1FTTA 2K9LA 4YFKF 5EGOA 3OS2A 2W84A 1WI9A 1TQIA 5HNHA 3S15C 2WAQD 5BNGA 4A6EA 2A61A 4AIDA 3PO3K 2R92A 4W97A 3IKTA 1NTCA 3T5XA 4BY1K 5IP6A 3JRBA 4MTEA 2EIJH 1HCRA 3RSNA 4A3FC 5HDKA 4WJ4A 1ZGWA 3CQZK 2DOFA 3GDZA 3T00A 4L9JA 1O3SA 4XLAA 2XCQA 1VQMI 4WF2A 3KEQA 2JA7A 3HTUA 2K02A 5CQEA 1EI6A 1PJ6A 1H8AC 4LLLA 2VJIA 2R93K 2IW5A 2DBBA 1B59A 4LG3A 3W2AA 4IRIA 4ESFA 3HOVJ 2XSDC 4XLHA 3ZPLA 4AC0A 4KNYA 4YIRX 3SZYA 2JUGA 4JK1A 3DTKA 2XB5A 3PO3J 1AOYA 2ZB9A 1Z1DA 3I4MJ 4XL9A 2XAJA 2Y0MA 4PSWA 1Y39A 1MZBA 1H89C 2E7XA 2W7NA 3LFUA 4E6KG 3F22A 1ZRDA 1KGSA 3CC2I 1T08B 3GO5A 4P9FA 2BY1A 1X31C 1ZVUA 4XN0A 4G0VA 3FXQA 3F8CA 4A0ZA 4BUPA 1QU3A 4V2FA 2DMUA 3OYFA 4D0PA 4XR6A 3Q5FA 4IRHA 4N4NB 2YU9K 2DW4A 1IO2A 1SFOA 4J00A 1TWCC 3BP8C 2JA6K 3SFZA 1J9IA 3TFIA 2RGVA 3V8KA 4PABA 2W1OA 5IYDK 3QOEA 3A2KA 3HRMA 1V4RA 1D8JA 1FSHA 2A6HF 2NS0A 4DJAA 1XC5A 3SDGA 1E17A 1RETA 4M3GA 3DTEA 4EV0A 3GTLJ 1FOYA 2QUFA 1FBQA 4BU2A 3HBLA 5GPCA 4CA0A 1WPKA 3CZ6A 1HKSA 5TJJA 4I02A 2QSHX 3TDUC 3E5XA 3GTGC 1T33A 2ZJRF 2K9QA 2JT1A 1HKTA 3G4AA 3LMMA 2YU9J 4ENMA 1LUJB 4X6AJ 4G94A 4J3NA 1BIBA 3WTXC 1QVTA 1SD6A 4HDUA 1I3QK 3ZXSA 1JUPA 3ZCOA 1P7IA 1WJCA 3REOA 3KP7A 3OYBA 1REPC 4UY8I 2HOTA 3RKXA 3DLLF 1IQ0A 2W4SA 4P55A 4M9XA 3IP4B 2DDBA 3BQZA 3A1YA 1XD7A 5J8CA 5B1AH 4HX4A 4D7MA 2GAHC 2Q1ZB 2JA7K 3BLYA 1IAWA 2HYGD 3A8KA 5C4XK 4LD5A 5BMZA 3GTGK 3OYMA 4EJUA 2ME6A 5H20A 1B6AA 1ULYA 4L5EA 1FT9A 3WTZA 3S1QK 1W0TA 4GTDA 1X3ZB 2VQLA 4MEXF 1EH7A 2Z1DA 4ZYEA 4KITB 4KA4A 3KEYA 4LLNA 2WAQN 1G3WA 4GYIA 4WXDA 3DPLC 4DBQA 6PAXA 3HOZJ 1S5LC 2KLOA 4G7ZA 5J1YA 1USTA 3EUAA 2BGCA 3FXUA 2PHCB 1BS2A 3QRFF 3KLOA 4X6AC 1K83K 3KEOA 3LA7A 2VC1A 2XAGA 4M3EA 3SXYA 2JPCA 1QGPA 1EQRA 1LB2A 2PPBA 2OJED 2JA7C 2YX7A 4MEYF 3ZP5A 2A69F 3PNVA 4G0UA 1W5CC 1XB4A 5CPRB 1TWFK 4MFEA 1FPQA 1USMA 2DTZA 1YFHA 3DXJA 2Z99A 1LVAA 3B02A 1FMVA 1W36C 2XV4S 5DUKA 5DV5A 4PUSA 1VZ0A 2M1BA 3K70D 1O2BA 2LF7A 5LEJA 1K83C 5IP7J 4CXFA 5E79C 1K83J 1HDPA 1HSJA 2JSCA 4Q5SF 4JQFA 1UAAA 2FE3A 2MH9A 5JFRA 2KZGA 1OLTA 3OYAA 4AIKA 2LVSA 2NRAC 4GFBA 1PVEA 2GBYA 4G8XA 1S8NA 4F3QA 3VDXA 1RC9A 4KC6A 5K5RA 4QPQA 3CCVI 1VQ7I 2K9MA 1UMQA 5IT9Z 2JJ7A 4R8HA 2H09A 3S2HK 4EJWA 5BOXA 3I56I 2KFDA 1OCZH 4UVAA 3C2BA 1XZPB 1SAUA 4OOIA 9ANTA 1YNNA 3K4MA 3G71I 2HEOA 4BXXK 3Q0UA 1WQFA 2JA7J 1HQCA 4F92B 5FRMA 2W82A 4Z6YA 1ETKA 5IP7K 2AQEA 1ZG5A 3GTGA 2D45A 3OIOA 1GVJA 4HF1A 3L2UA 2A6EF 1X2NA 3SQNA 3AG2H 2LC2A 4ZDLA 5F0CA 4EM0B 5C44J 1BC7C 5GAHJ 3S1QJ 1X1CA 2LNBA 5TMCA 2M5WA 1IN5A 4ZTJA 2MLGA 3MKLA 4H4KC 5FLMC 4IZZA 4A3KJ 2OU2A 3CDIA 4UUSA 4HNUA 2MC3A 3CP2A 4M1XA 4HLXA 1IUYA 3GTMC 2JA5C 1ETVA 4NDLA 2GXGA 4LLGF 2FU4A 4QJVB 3JRIA 2XCRB 4UB8C 4AH6A 3FZVA 3WHBA 1QZEA 3T02A 3M4OK 4AVPA 2R5YA 2YSRA 2ETHA 4JK1X 1VJEA 2CW0A 2WAQL 5E20A 2XF6A 2DYSH 3C2HA 4I01A 1VTNC 3KP4A 5E1ZB 4KM9A 1RZ4A 1SD7A 4PJ0C 1IRGA 1FBUA 2RREA 2Y0SA 3PFIA 5IOYA 3GXOA 1OYWA 1YW9A 2L9RA 4LK1F 2EBBA 4KFCA 3GTQK 2A5YB 4I0BA 4LG0B 4ENNA 4LOCA 1UJ8A 2L02A 3TKYA 1XPXA 1R5ID 2PMZL 2BHYA 2HDWA 5CVVA 1R9TA 4A3KC 3K4KA 4A3GK 3HYIA 3MZ8A 2DA7A 2ZBKA 5IYDJ 3H0GA 4II3A 4JX5A 2NYXA 1P7JA 4ESJA 5KAFC 1XTAA 1VQNI 1OFCX 4BJTA 4RB1A 1TWCA 4BY7K 3VYTB 2W25A 1WHUA 4BXFA 2QQ9A 2O8KA 4ZYHA 3DBHB 2PMZD 2ZUEA 3HIFA 1BI1A 2E5ZA 2D2WA 1Z67A 4RAFA 3OV8A 1I5ZA 2F48A 1NK2P 4ZDPA 3GTJA 4HX7A 2FMYA 3WG9A 2H8WA 3S1MK 3CLQA 2ESHA 3AKZA 1Z6TA 4GTLA 3I4NC 1I39A 4ZTFA 2M0CA 3ULQB 1X1DA 1ZAOA 3FWEA 3HB9A 4YRVA 4Q4ZF 4EGZA 1JJ6C 4Y7NC 1O2AA 1ZR2A 3J80Z 2F4OB 2QGUA 4YFKA 4A3DC 3L7WA 3AQOA 1LPQA 4B3AA 2ZFUA 3GVAA 2NVUB 1SFEA 4XBFA 2VQGA 2DFIA 2IGOA 4PK4A 3TO9A 3ZQLA 1A04A 2EFNA 3EUHA 2GSOA 2PA8L 2QBYB 5L46A 3O8GA 1U5TA 2FNPA 1NG7A 3ELKA 1IF1A 1K4TA 2R7UA 1R5HA 4Y17A 2BW3A 2CV1A 1FNNA 2XHKA 3NAUA 1EK8A 2PN6A 3CDLA 2GA2A 2X6OA 1TWGC 3S1MC 4JYKA 4UUSB 2DQLA 4CUGA 4KIFA 5D6EA 2BY0A 2EIKH 1RKTA 2CS3A 2DJIA 2R3SA 2L2OA 4HZFA 1W5SA 4FISA 1Z6RA 3A0BC 1HXDA 3E6BA 3QP5A 4IHXA 1WSRA 3GTPC 2L0KA 3S17J 1KYZA 1MJAA 1TW2A 3Q9SA 4Y52J 3LQRA 1RR8C 1DGRM 4IJAA 3KPHA 3RPUA 3NRVA 4G12A 1W5TA 1WI3A 5J47A 1INNA 3S1NC 4PJNA 5DD4A 2FF4A 3HOYC 1FMWA 1OJLA 2K4BA 4A3MJ 1TWAC 1SMTA 1WOSA 1B9NA 1R9TC 3I55I 3CO6C 4M6XA 3K7AC 5ERIA 1F4KA 1MMDA 3JTGA 4E7KA 3RPQA 3HPHA 1Y0UA 5EEAA 2OPTA 5J4VA 3PNYA 3I59A 1H9TA 4Q5SA 5JVOA 1KU7A 2DA6A 1B4BA 2XAUA 2KJCA 2NNNA 4O2DA 2DK5A 2DU9A 4BH9A 2DMTA 4XQFA 2VKDA 5HS7A 3PIPF 1EJ9A 4FTHA 3FXJA 4UV8A 4I76A 1E0EA 1KQ8A 4NHJA 1IRXA 2ADUA 5HNFA 1QPMA 4C2MJ 2DA2A 4BE0A 5AONA 5HS8A 2WAQA 1FEXA 1YW8A 1X1PA 3K4BA 3VYUB 1DD5A 2VPLA 5D4RA 5E8IA 4H0EA 5L3BA 1HW1A 2CQKA 4N4OB 3N4MA 3DV8A 1R1UA 2X1EA 2VE9A 4RGSA 4EMSA 2ECBA 1SVOA 5K5OA 4LITA 2RQQA 3U1DA 5IYDC 1ENHA 2HOEA 3VWBA 1OQYA 4HSTA 5HVQC 1P4WA 3AG1H 5CLSA 4NOIA 2QBYA 2EV0A 3GEZA 4IF4A 1ON2A 5F08A 3ABTA 1JGSA 3HOWC 5H6QA 3S17C 4MQ9A 1WQ2A 4XKCA 1YYVA 1V55H 1JE8A 2VASA 1BOBA 2XRLA 4XSZF 4MO7A 5L3GA 3OIQA 3L2RA 1IUFA 3RYPA 1LVKA 1IV6A 2CJJA 4RMNA 2NOGA 2NOJB 2XPUA 3BCAA 3QX3A 3HKZL 4ZH4A 2DMQA 2BXYA 2KDOA 3RJPA 2O7OA 2CSOA 1I1SA 2PMZA 5EGHA 1IG7A 3FF5A 4MHGA 1LFPA 2HDCA 4A3CJ 2GSUA 2XGDA 3B6CA 3ZN1A 4BQAA 1PUEE 1ZXOA 1BJZA 4RLFA 5KVRA 4A3JC 1KU3A 2FMLA 3AL0C 3HJEA 2DI3A 3RKWA 2R7VA 4U0VA 2X0LA 4XRFA 1YG2A 4P9SA 4A69C 4HW0A 2QKMB 4RS8A 4D5FA 4YIIA 3N3YA 1RKWA 1OCTC 3PO2C 4YELA 5K5QA 4NQWA 5J1RA 2E2HJ 1FYLA 2F4MB 3U1KA 3H92A 2EBIA 2O0YA 4CSWA 2L7ZA 1I50K 1BC8C 1XZQA 5JFEA 1ZRCA 1LE8B 4C3JC 1ZTRA 3LL7A 3H35A 2VQHA 3K4CA 5EYRA 4A3EJ 3ISPA 1QPIA 5C3EJ 3CESA 4BL0B 1Y8QB 4L9VA 1R7JA 4PSXA 4F52A 3SDBA 2TRTA 2QM3A 3FMQA 2K7LA 4KUMA 1X2MA 2ZXWH 1U78A 1S6LA 4A93C 3GF2A 3F9KA 2XAHA 1QA6A 1IS1A 1UG2A 4KJZA 3L2VA 3G2BA 1RRJA 1N77A 4OINA 5J8FA 3TDZC 5ICCA 3PQJA 4FT8A 3D5RC 3ZQFA 4HF0A 1V3FA 4FETA 4KT6A 5E1XA 3VEPA 3BQYA 3CJQB 5DCMB 4HV6A 2QQBA 2R7SA 2ISYA 4G6DA 3H1CA 4HQMA 4MIMA 3L09A 3GBGA 1W7PA 2VUMK 4MQVA 1QHGA 3V8JA 3HOSA 4XM3A 5DUIA 1VLOA 4GCVA 3CCUI 1IBAA 2E60A 5FKKA 5J40A 1XZQB 4QSHA 5B5EC 4CYDA 2XRNA 1TWFA 2N8GA 5D5VB 2GA1A 5FLXK 4XCHA 3COAC 3BR3A 2M4GA 2MA3A 3BR6A 3GTJJ 1MNMC 4OIQA 3TP3A 4OIRA 1UB9A 5EZGA 3D5LA 4BXXJ 2LBFA 4IX7A 2PJRA 1MH3A 3FXMA 1YW7A 1G51A 4QIWN 1Z9CA 3BG7A 2F5FA 5C44K 2OF7A 3BT9A 2PG4A 1ZK8A 5LRSA 2J5PA 4Q4ZA 3GFIA 1OCPA 1QZZA 2V7FA 3H9JA 4BQQA 3QYBA 1R4NB 1UHSA 4DW6A 1TWCJ 3GX4X 1SFOK 2A6HA 2JUCA
chains in the Genus database with same CATH topology
1KQ9A 3O6BB 2LSOA 1I1GA 3T8TA 4KMUX 1C0WA 5LBQA 3KP2A 5ILVA 1GXQA 1R22A 2DAOA 3R4KA 4LB6B 5EEHA 1LNWA 1UHWA 4E70A 1OMIA 1BI2A 1MKMA 3VODA 4WCGA 1O3QA 1FYKA 2XROA 3F3XA 5JHUA 1Z91A 2BYVE 4MQ9F 2FXAA 3DEUA 4UUVA 1FZPB 3KLNA 1F1ZA 1O7FA 5LGTA 1B4AA 2D1VA 2K86A 2XKOA 2Q2EA 1SD5A 4Q48A 4U7DA 1PP8F 2QLZA 1J59A 1B9MA 4I7HA 3BDDA 1GXPA 5F1RA 2W57A 4RMFA 3HRUA 3FM5A 3WU1B 2FBIA 4EVIA 5AIQA 2EA4A 1IN6A 1IZ1A 4A2UA 2HKXA 2CGPA 4IXAA 1STZA 2OZUA 3BROA 1JHFA 2Z5UA 5D8LB 3C1DA 4P5OA 4RGUA 1BI0A 5EEGA 2D6FC 1U2WA 3JSOA 1XSXA 2PEXA 2RVCA 3QP6A 5LHIA 3ABUA 5AIPA 2EA2A 3MZYA 2STTA 3MWMA 3GW2A 1DP7P 4WJ3M 5K1YA 4L5JA 2VT2A 2YR2A 5E18F 2OQRA 2EJRA 2DK8A 2CW0F 2A07F 3HTSB 2L4MA 1IL2A 3PQKA 3R60A 1D5VA 4UVBA 4GGGA 1BBYA 3IRQA 2AS5F 4MNUA 1CF7B 4HBLA 1JXSA 1OKRA 3K1NA 4L9TA 1LDKB 1C0AA 4K2EA 1J0RA 2P5LC 2FQ3A 3QU6A 5D5UB 2ZFWA 2M8EA 5FLXZ 3M8FA 2CYYA 1FC3A 5L3DA 3CUQA 5E1WA 5E8GA 4B09A 2VOPA 4ZZDA 1BOAA 1FOKA 4WXHA 4U0YA 1O3RA 4RB3C 4LFUA 2M45A 3IWZA 3K1MA 4A5NA 4BHCA 3W6KB 2OA4A 1XCVA 3EYYA 3WTWC 5ICGA 4P96A 4ESBA 2PMUA 3T1BA 1FY7A 4XLNF 4RB2C 1T39A 2PQ8A 2XGXA 2M87A 3EQLF 3I0TA 3MCZA 1D3YA 3GFMA 3WTSC 4U0WA 1BIAA 3J81Z 3ZMVA 1HW2A 1DPUA 3JAMK 2EV5A 5HDGA 5IT3A 1OYYA 3W6JB 3K69A 4OIQF 3LAPA 2IRFG 4QLCU 3QOPA 1S7OA 2NAZA 2R7DA 4RAZA 4LJZF 1FP1D 2L54A 2XUBA 1T38A 5BPIA 5DCMA 5HOOA 4L0YB 1J75A 4BHBA 4KN7X 2P6TA 3FXRA 5L3FA 4KT5C 1BM9A 2DPUA 3IC7A 1L0OC 3IRRA 2MH2A 4NB5A 1R1TA 4BAYA 4KN4X 1FYMA 5LHHA 4I0AA 5LHGA 2WTEA 4LGWA 3WODF 4N0BA 5LGUA 3CUOA 1P4AA 5FO5A 3ZMTA 1W7PD 2RNJA 3ZMUA 2VBXA 3DXJF 3R61A 2UZKA 1S29A 4S05A 1XDUA 2Q8KA 4L9NA 4FX0A 2FBHA 4Z2YA 2DTRA 3HSEA 2BBYA 1BN5A 2H6CA 1FX7A 2FA5A 3CLOA 4HLYA 1GHCA 1L0WA 4UVCA 4AWXB 3CJNA 1TQPA 3KZZA 1UHMA 2ZXJA 3HRTA 5D5XB 1YTYA 2V9VA 3I53A 2PJPA 1UCRA 4A12A 3J7AO 4FX4A 3P9KA 3IL2A 4ZYDA 1UFMA 2ACJA 4Q47A 4KYWA 4WK8F 4HOBA 2FBKA 3R0JA 2HYFA 2G9WA 3M1EA 1Z05A 4EJTA 1T98A 3WGGA 5LGNA 4M6YA 1ZG1A 3WGIA 5D4SA 4HQEA 4G7HF 4OINF 3HHHA 2CWEA 2V1XA 3EYIA 5CJ9A 3ZMZA 3FMSA 3GLXA 2BE5F 2IA0A 4PZJA 3M9AA 1W4MA 1LDJA 2IA2A 4OMYA 1ZHFA 5JR3A 1S3JA 2WC2A 3WE3A 4O3MA 3ML6A 5BPDA 1D8KA 1ZGAA 2B0LA 2P7VB 4PDKA 4UXNA 5JI6A 2BV6A 4TV7A 4A5MA 4LMYA 4BXUA 1E2XA 3Q9VA 1IRFA 4IHTA 1ZGJA 1K79A 1R1VA 3HRSA 2RDPA 2UXNA 5LLQA 1WRJA 2O03A 2X4HA 1YIOA 3TQNA 2E7WA 4ETSA 1Q1HA 3WU0A 3RIRA 2IA1A 5KK1A 1BJAA 4M9ZA 2FEZA 1YQAA 2W24A 2EWNA 4OMZA 3K9TA 3GZ6A 3R0AA 4M72A 1RUNA 1R23A 3S2WA 3QAHA 4OIOF 3ZN0A 2QENA 1WKMA 3IHUA 3ECHA 1K78A 3U9GA 2XASA 1K78B 5CVRA 4M74A 4BNCA 2RV8A 4M71A 3L9FA 5HLHA 1LJ9A 2VBZA 1RUOA 1EH6A 2JPBA 1KYWA 5FFXA 2UWMA 1QZYA 2HWVA 3F6VA 1KQ0A 1O3TA 3DQVC 2PI0A 1ZREA 1I27A 4L0ZB 3LQQA 4I98B 1TW3A 2OAZA 2FSWA 3BPXA 1QQIA 3GFJA 5J6XA 2ZNYA 3NQOA 4UNOA 4KIBA 3LA2A 3G73A 2Y48A 1G6NA 3M8EA 2P5VA 2L4AA 3QPHA 4RB0A 3K2ZA 3I5UA 2LF8A 3QU3A 2TDXA 4G7ZF 2K27A 1H0MA 5A2QZ 4G6QA 3R6SA 3F8FA 3GYHX 4N9IA 4XSXF 1CF7A 1YO5C 1IW7F 3L00A 4ASNA 2JZYA 2PFBA 2HQNA 4A0YA 3HSFA 4DNCA 1DUXC 3GZ5A 3WGHA 1G4DA 2DQRA 3KP6A 2V6CA 2ZCWA 1PDNC 2F5DA 4Y13A 2EFWA 3IKVA 5LRRA 3LFKA 1IN4A 5CVIA 2R7FA 4CHUA 3K0LA 3P9CA 1MGTA 1O7LA 3SHFA 3JAMZ 4GO1A 2ZNZA 4WXCA 3MQ0A 1MJBA 1O57A 5FFZA 3CUQB 2G7HA 1MDMA 4M73A 2FRHA 3GUDA 4HDVA 5L3EA 1G3YA 4OIRF 2OBPA 3M7GA 4CGZA 3BJ6A 2JRTA 4LG0A 4KDPA 3H3UA 4RGXA 4R79A 1SD4A 3GWZA 1HKQA 5D6FA 4HF2A 1Z7UA 4O6JA 2DO7A 2O61A 4L5IA 1J2XA 2C6YA 1K7AA 1FWZA 3KFWX 2EK5A 1T0FA 4A0XA 4O5VA 2D1HA 3KCCA 5DYMA 3HUGA 4YIFA 1U6GA 2OQGA 2DLLA 3I59B 3SZTA 3EETA 1ON1A 1YS7A 3FM3A 2P8TA 3D0SA 3RYRA 3WTYC 2KRFA 2VC0A 4FHTA 3VOEA 4HX8A 4EJVA 3WTVC 3B73A 3I58A 2UXXA 3FMRA 3GFLA 1IN7A 3HOTA 2Q0OA 2PLYA 3DFGA 2W85A 5HDNA 3CTAA 2OD5A 2VN2A 3E6MA 3LWFA 3DF8A 1HW5A 2CO5A 2GXBA 2JTVA 1W7PB 3JSPA 2DPDA 2FOKA 3BPVA 2QYOA 2COMA 4XLPF 2VBWA 3P9IA 4EM1A 2EV6A 2PMHA 2HQRA 3E5QA 4EQQA 4YFXF 1IXSB 1XDSA 2YU3A 2H27A 4KMFA 3IWFA 2P7CB 4OU0A 1XMKA 5H6RA 2VXZA 1P92A 3F8MA 4ZZLA 3V7SA 1USSA 1F5TA 1QNTA 3V4GA 4ZYGA 4U7BA 4EM2A 1HSTA 5DDGA 3K1PA 4QWQA 2A3SA 1TTYA 4I2OA 1T6SA 4F7ZA 1XSDA 3J81K 5ILSA 2A68F 3F72A 3ROUA 2IPQX 1KU9A 2HTJA 3WE2A 3LSTA 3FHZA 5FB2A 1WWXA 4YFNF 1TNTA 1OYIA 2H94A 3RI4A 2FNAA 2VONA 4B8XA 3KZYA 2DT5A 3WTUC 2V79A 5HLIA 1P4XA 3DP7A 1G3TA 4BYYA 1XGOA 2F2EA 3J80K 1HBXG 3G3ZA 4DQ2A 3BY6A 2XAQA 3V8LA 3ECOA 3CUQC 2ELHA 1SFUA 3ZMDA 4PCQA 4G7OF 4GYGA 2IVMA 5D8KB 3KP5A 1ZARA 1S7AA 2J5OA 4CO8A 3DPTA 2V1UA 3C3WA 2XKPA 4ENJA 1P6RA 3ZMSA 1CGPA 2YPRA 3TGNA 3NEUA 3U2RA 4GXOA 1H9GA 3DKWA 3E6DA 2NNYA 1R36A 2CG4A 3BJOA 3O3KA 3L2CA 1DPRA 3H3ZA 2F5CA 1FP2A 2ZMEA 4G9YA 5ED4A 2GQQA 1XMAA 2QZ8A 2KIFA 1ZLJA 2P6SA 1SFXA 5A2QK 4EJOA 3HHGA 3TOBA 5FD6A 1KA8A 2K4JA 4P9UA 4CZZA 2VBYA 5E17F 2HTSA 5CYVA 4AIHA 4ON0A 2IJLA 1X3UA 4WX9A 2RC4A 2E1NA 3T8RA 3N97A 3ZQ7A 2EB7A 3KE2A 2O6GE 2ZKZA 2YX4A 4I09A 5CVUA 4IRGA 5CVJA 3MAJA 2GIVA 3WTTC 3BP8A 4OIPF 1RI7A 5ICEA 2RKHA 2VT3A 2HKOA 1MD0A 2Z9OA 2LDUA 2EFPA 2KJBA 4UV9A 2Z33A 2HGCA 2MBFA 2MD5A 1U8RA 2RQPA 1OR7A 1PP7U 3TO7A 1R5GA 4ENKA 5ILUA 2QWWA 5DEQA 1J5YA 2H6BA 3OOPA 3F23A 3BJAA 5L3CA 2HFHA 2ZJ2A 3RDIA 3CO7C 3KP3A 2VOOA 4HAMA 3RTRA 1TQMA 1ZLKA 3F21A 4Y15A 3I64A 4MGRA 2Z3YA 4WWCA 1AWCA 4CICA 2RN7A 3BOQA 1ZN2A 2P5KA 1ZQ1C 2HZTA 1RNLA 3LA3A 1YLFA 3E5UA 2STWA 2EFQA 2E1CA 2OZ6A 2MLKA 5JVTA 1LDDA 4AIJA 2KIMA 3I54A 2ZMEB 3JW4A 4UHTA 3F8NA 3MFKA 2HR3A 3E97A 5TRDA 3QPTA 1FBSA 3MEXA 1U5TB 2XVCA 2IP2A 4IHSA 3V7CA 1XGMA 1RIOH 5DCFA 2HS5A 1WSUA 2WWYA 4U88A 3VFZA 4R1HA 3E3VA 5BS6A 3BZ6A 3TO6A 2CFXA 1I6XA 1LQ1A 1LEBA 3C7JA 1F9NA 1SMYF 4KIGA 5ICFA 1BI3A 1EH8A 1OPCA 3JTHA 2F5EA 1KU2A 2KKOA 1XCBA 1ZH5A 4HA8A 1ODDA 3C18A 4LK0F 2VE8A 1T2KA 1LEAA 5D5WB 1EFWA 3O2PE 2M30A 1J7KA 3SZPA 1FLIA 4PGGA 2GWRA 3I71A 3FX3A 2WV0A 1IN8A 4BHPA 3EDPA 4RGRA 5BQTA 1XN7A 4A6DA 1QO0D 1L3LA 2PBIA 2Y75A 3F6OA 4L18B 1IXRC 4CDGA 4IVNA 3HSRA 4PGHA 2QQAA 3P7NA 1YS6A 1ZRFA 5F6FA 1K6OA 3BWGA 3I4PA 2O3FA 4S04A 3ERED 2LKPA 1R00A 1P2FA 1TNSA 2G7UA 5DD8A 4N9HA 5IT9K 3LAJA 1XGSA 5HLGA 2XAFA 5F64A 3E6CC 1B1BA 2ESNA 1TLHB 2O8XA 1NHAA 3CDHA 3VB2A 2QVOA 5HS9A 2BEOA 2GZWA 1XGNA 2ISZA 4JBAA 2EFOA 1ONVA 1ZG3A 3KETA 4KICA 4YG2F 1SAXA 3AAFA 3F8BA 3V7RA 4M9SA 1TBXA 1U5TC 5FD5A 1MDMB 3TOAA 2KIUA 1EV7A 2V1DA 2ZO4A 5LEKA 4IPAA 2IT0A 4RAYA 2L01A 3RKYA 1ZYRF 4HYEA 1XSVA 3MZHA 2XIGA 1DDNA 1R58A 1JHHA 2GAUA 4AD9A 1U3EM 1FSEA 1G3SA 1QBJA 2AXLA 1IXCA 4HV5A 1MJ9A 2VODA 5FGMA 4LB5A 4EGYA 4MTDA 2P4WA 2L3DA 4ZH4F 3T0YA 4YFKF 2W84A 1WI9A 1TQIA 4A6EA 2A61A 3IKTA 3T5XA 4MTEA 5HDKA 4WJ4A 4L9JA 1O3SA 4WF2A 3KEQA 3HTUA 2K02A 4LLLA 2IW5A 2DBBA 1B59A 4IRIA 4ESFA 3ZPLA 4KNYA 1AOYA 1Z1DA 2XAJA 2Y0MA 1MZBA 2E7XA 3F22A 1ZRDA 1KGSA 3GO5A 4P9FA 3FXQA 3F8CA 4A0ZA 4D0PA 3Q5FA 4IRHA 2DW4A 3SFZA 1J9IA 2RGVA 3V8KA 1D8JA 3HRMA 1V4RA 1FSHA 2A6HF 2NS0A 1E17A 4EV0A 2QUFA 1FBQA 1HKSA 5TJJA 4I02A 3TDUC 3E5XA 2JT1A 1HKTA 4ENMA 4G94A 1BIBA 3WTXC 1SD6A 4HDUA 3REOA 3KP7A 1REPC 3RKXA 4P55A 4M9XA 1XD7A 5J8CA 4HX4A 1IAWA 2HYGD 4LD5A 5BMZA 4EJUA 5H20A 1B6AA 1ULYA 1FT9A 3WTZA 4MEXF 1EH7A 4ZYEA 4KA4A 4LLNA 1G3WA 4GYIA 4WXDA 3DPLC 6PAXA 1USTA 2BGCA 3FXUA 3QRFF 3KLOA 3SXYA 3KEOA 2VC1A 2XAGA 3LA7A 2JPCA 1QGPA 1EQRA 1LB2A 2YX7A 4MEYF 3ZP5A 2A69F 1XB4A 1FPQA 1YFHA 2Z99A 1LVAA 3B02A 2XV4S 5DUKA 5DV5A 2M1BA 2LF7A 5LEJA 4CXFA 1HSJA 2JSCA 4Q5SF 4JQFA 2FE3A 2MH9A 5JFRA 2NRAC 4AIKA 4G8XA 1S8NA 5K5RA 5IT9Z 4R8HA 2H09A 4EJWA 5BOXA 4UVAA 4OOIA 2HEOA 1HQCA 1ZG5A 2D45A 1GVJA 4HF1A 2A6EF 4EM0B 3SQNA 1BC7C 2LNBA 2M5WA 1IN5A 2MLGA 2OU2A 2MC3A 4HLXA 1IUYA 2GXGA 4LLGF 2FU4A 4AH6A 3FZVA 4AVPA 2YSRA 2ETHA 4JK1X 5E20A 1VTNC 4I01A 3KP4A 5E1ZB 1RZ4A 1SD7A 1IRGA 1FBUA 3PFIA 3GXOA 1OYWA 1YW9A 4LK1F 4KFCA 2A5YB 4I0BA 4LG0B 4ENNA 3TKYA 2L02A 5CVVA 3HYIA 2ZBKA 2NYXA 4ESJA 4RB1A 2W25A 2QQ9A 4ZYHA 3HIFA 1BI1A 2D2WA 3OV8A 1I5ZA 4HX7A 2FMYA 3WG9A 2ESHA 1Z6TA 3ULQB 3FWEA 1ZAOA 4Q4ZF 4EGZA 3J80Z 3L7WA 3GVAA 1SFEA 4XBFA 2DFIA 3TO9A 1A04A 2EFNA 3EUHA 2QBYB 1U5TA 2FNPA 3ELKA 1IF1A 1R5HA 4Y17A 1FNNA 2XHKA 2PN6A 2GA2A 2DQLA 4KIFA 5D6EA 2R3SA 4HZFA 1W5SA 1Z6RA 1HXDA 3E6BA 3QP5A 1KYZA 1MJAA 1TW2A 3Q9SA 3LQRA 4IJAA 3RPUA 3NRVA 1W5TA 5DD4A 2FF4A 2K4BA 1SMTA 1B9NA 3CO6C 4M6XA 5ERIA 1F4KA 3JTGA 3RPQA 1Y0UA 3I59A 1H9TA 1KU7A 2KJCA 2NNNA 4O2DA 2DK5A 2DU9A 4BH9A 5HS7A 4UV8A 1KQ8A 4NHJA 2ADUA 1QPMA 5AONA 5HS8A 1YW8A 5D4RA 5E8IA 4H0EA 5L3BA 1HW1A 2CQKA 3N4MA 3DV8A 1R1UA 2VE9A 4RGSA 4EMSA 5K5OA 3U1DA 2HOEA 5HVQC 1P4WA 5CLSA 2QBYA 2EV0A 3GEZA 4IF4A 1ON2A 3ABTA 1JGSA 5H6QA 1WQ2A 1YYVA 1JE8A 4XSZF 5L3GA 3RYPA 3RJPA 2CSOA 1I1SA 3FF5A 4MHGA 2HDCA 3ZN1A 4BQAA 1PUEE 5KVRA 1KU3A 2FMLA 2DI3A 3RKWA 4U0VA 2X0LA 4XRFA 1YG2A 4HW0A 4RS8A 4YIIA 5K5QA 4NQWA 1FYLA 3H92A 2O0YA