2P8TA

Hypothetical protein ph0730 from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
184
Chain Sequence
EYTVEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGHFLTLKGKEIRDKLLSMFSEPIGVSVDGYPGIAIVVKNPPEFKSIELRDEAIKFDAKGAMILTVKDNEIVFPEDFRPLKEMYPEVAKKIVDYEDGDAVIITWAETPAKALKSAIHVAYILKKEEITPEILEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0730
publication title Hypothetical protein PH0730 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 61
structure length 184
sequence length 186
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14544 DUF4443 Domain of unknown function (DUF4443)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2p8tA01
3.30.1360.30 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 GAD-like domain 2p8tA02
1R7JA 1Z1DA 2NNNA 5HDNA 1E17A 2EJRA 2DTRA 2XGXA 3Q5FA 3EUHA 2DLLA 5L3GA 2VC1A 4XSXF 1JXSA 4YFNF 1B6AA 4ENJA 1F4KA 1KQ8A 4EM1A 3L9FA 4U0YA 1XCBA 2FU4A 2M1BA 4I09A 1RIOH 2QVOA 4K2EA 2FNAA 2YSRA 2LF8A 2WC2A 1J5YA 1QZYA 1HSJA 2DAOA 1KYWA 4P96A 2PFBA 2A5YB 4ZZLA 3F72A 5E17F 5LGUA 2O0YA 2XKOA 2V1UA 5ERIA 3TGNA 1LDJA 1B9NA 5E1WA 2QM3A 3RPQA 5FLXK 4MHGA 2Z3YA 2GQQA 2CGPA 4BAYA 2Z99A 4R1HA 3SFZA 5LGNA 1WI9A 1B4AA 1IAWA 3K0LA 3GEZA 5HLHA 2EFPA 5D6EA 2VOOA 1KA8A 1U8RA 2A61A 2PQ8A 5BQTA 2PMHA 2GXGA 1ZH5A 2HYGD 1JE8A 3PQKA 3R0AA 3WGIA 2HWVA 4UVAA 3LSTA 2F2EA 3LA7A 1C0WA 3ZMUA 1ZRCA 3DFGA 1QGPA 2O61A 1IN8A 4F7ZA 5CVRA 1DP7P 4BNCA 1P4XA 5AONA 3IRQA 2ESHA 3RYRA 1HBXG 2NAZA 5KVRA 2XVCA 2E1CA 2IT0A 4L9VA 3OV8A 3TKYA 2F5EA 4A6DA 3F8NA 3SQNA 4KYWA 2ISYA 4EJWA 3I71A 5CJ9A 2QQBA 1LNWA 1HW2A 3JSOA 5J6XA 2E7WA 3AAFA 1SMYF 2XAJA 1ZGAA 2FMLA 3NRVA 5D8KB 1XD7A 2VBYA 3JAMK 4HQMA 4KFCA 5H20A 1ZN2A 3KP2A 1ZLJA 4ZYEA 2PBIA 2XUBA 2P5LC 3V4GA 1TW2A 4ZYDA 4MTDA 1TTYA 3FMQA 1MJAA 2HKXA 3GXOA 4TV7A 4ZH4F 2H27A 3ULQB 3CJNA 1I1SA 5ILVA 4WXCA 4MGRA 4PDKA 2EV6A 4WX9A 3J7AO 2NNYA 4L9NA 4OMZA 6PAXA 2D6FC 1L0OC 1FP1D 2H6BA 4RB2C 1R23A 1IRGA 5EEHA 2F5FA 1FOKA 5DCFA 1S7OA 2RC4A 5BMZA 1OYWA 4KN4X 3JTGA 1R22A 3BOQA 3BP8A 2OZ6A 2ZBKA 4LG0B 4JBAA 1YYVA 3VODA 2XIGA 1OPCA 4O2DA 3EYYA 1FZPB 4I0AA 2F5DA 1ZG1A 1ONVA 1TBXA 3TDZC 3L7WA 2EFQA 4ETSA 1IN6A 5LBQA 3P9KA 3P9CA 1Z9CA 5HLGA 1NHAA 3KLNA 2COMA 3WGGA 4CYDA 1XSDA 1DDNA 2IA1A 3EYIA 4EQQA 1XMAA 2ELHA 4HLXA 5DD8A 3FXRA 1MJBA 1HQCA 3IHUA 3IKTA 1RUOA 4HV5A 3WE3A 2XV4S 3MCZA 4GYGA 1MGTA 1T39A 2XASA 2QYOA 1I27A 2IP2A 3H3ZA 4NQWA 3ZN0A 2Z5UA 3HOTA 1P92A 3HSEA 3E5UA 4U0WA 5F6FA 1QBJA 3HOSA 3H92A 4XLPF 2FMYA 4HF2A 2JRTA 1WKMA 1GVJA 4ENMA 1PP7U 2IA2A 5E1ZB 2E1NA 3BJOA 1ZQ1C 5H6QA 1KU9A 1YS7A 3F8CA 4M73A 2FEZA 4U7BA 5FO5A 3WTYC 2GWRA 1U78A 3HYIA 4N9HA 3F6VA 4HQEA 4RGRA 4ZYGA 1P2FA 1TQMA 2HYFA 3KP7A 4NB5A 4KN7X 1ON2A 2A07F 3ZQ7A 4HDUA 3J80Z 3WTXC 4KA4A 1JHHA 1D5VA 1PDNC 1USSA 4HDVA 4UXNA 1Z6TA 2CG4A 3DPLC 1LEAA 1YS6A 4IRIA 4LG0A 3ML6A 2VBXA 2P7CB 3LQQA 4Y17A 4DNCA 4S04A 4B8XA 3VEPA 1TNSA 2HTJA 1HKQA 2DPDA 1F1ZA 4O6JA 3W6JB 2IPQX 2XKPA 4KIFA 1J9IA 5HVQC 2DU9A 1UHMA 1HW5A 1G4DA 5CVIA 2NS0A 4PGHA 1O3SA 5BPDA 4I2OA 1SMTA 2B0LA 1O3RA 4WJ3M 1IXCA 5D8LB 1FSEA 2OBPA 2EFWA 5HDKA 3K1PA 4CO8A 2VBZA 1IN5A 4RGXA 1BN5A 3MQ0A 1IXRC 1L0WA 4IRGA 1LDDA 2A3SA 2EFNA 2HR3A 2CO5A 2LKPA 3M9AA 2BE5F 1EQRA 1R5HA 4RB3C 3FMRA 2ETHA 2C6YA 5JHUA 1XGSA 3ECOA 3QOPA 3RKYA 4YFXF 4LLNA 3V7CA 1RI7A 4HV6A 2WWYA 4KDPA 2K4JA 1G3TA 3MEXA 3I58A 1ZREA 3ABTA 3KCCA 3FF5A 2GAUA 2G7HA 4R8HA 2H94A 4IJAA 3ZP5A 3KP4A 1USTA 4Y13A 4WF2A 4KNYA 2MC3A 4L5JA 2QUFA 1KU2A 2J5OA 2ISZA 5LRRA 1FWZA 2G7UA 4N9IA 4A0ZA 4KMFA 2RVCA 3CLOA 1T2KA 2A68F 5L3DA 5DV5A 1YQAA 4L0YB 4ZZDA 3ISPA 5JI6A 4L0ZB 1YO5C 3V8LA 3WTZA 4KICA 2V1DA 2VXZA 2G9WA 4BHBA 2Z33A 2L02A 3C7JA 3K69A 3GFJA 2BYVE 1U5TB 3F22A 4HX8A 2QQAA 5D6FA 5HS9A 2KRFA 2LNBA 1WWXA 4EVIA 4OIPF 1SD7A 4A2UA 4M9XA 5LHGA 3CUQC 2JSCA 2EV5A 2AXLA 1BC8C 3KP3A 2EWNA 5ICFA 4LGWA 4RB0A 3CTAA 1KGSA 3E6DA 3VB2A 3ZN1A 4P9UA 3G3ZA 2XRNA 1YTYA 2DQLA 4IF4A 3KP6A 4A5MA 1IN7A 5A2QZ 3ZPLA 4ASNA 2HQRA 3I59B 2P7VB 1MZBA 2MH9A 3I53A 3LA2A 2V79A 3QU6A 2EA2A 1I1GA 2OAZA 3BPVA 4CHUA 1OYIA 1R00A 1UCRA 1K78B 4Z2YA 5AIPA 1G3WA 2DT5A 3M7GA 3RDIA 3LQRA 1RUNA 2ZNZA 4MEYF 1BIBA 3I0TA 3E6BA 3E5QA 2YR2A 3BPXA 1OR7A 1C0AA 2Y48A 3CO7C 3IC7A 4WXDA 4L5IA 1SD4A 1B59A 4HX7A 2FNPA 1FYKA 1JHFA 2J5PA 2L54A 3REOA 3P7NA 1TQPA 2CWEA 4MTEA 3WE2A 5CYVA 3R4KA 1OMIA 4Q47A 2X4HA 3U9GA 2M45A 4ESFA 3MZHA 2VT3A 4I98B 2W57A 1WSUA 4M6YA 3HRSA 3WG9A 5E1XA 2P6TA 3F23A 2BBYA 1FPQA 2P8TA 3BWGA 4OINF 3HTSB 2D1VA 1XN7A 2ZKZA 4AVPA 1U6GA 2HQNA 1RZ4A 1U5TA 3BY6A 5ICCA 4RAZA 5DCMB 4EJOA 1BM9A 5H6RA 2X0LA 3BROA 3ZMSA 1P4WA 2K02A 5HLIA 3TO7A 4M71A 1Z05A 3CO6C 2XAGA 1T0FA 5F1RA 1Z91A 2HDCA 2H6CA 2KJCA 3VOEA 2F5CA 3DQVC 1SAXA 3JAMZ 4EJUA 5HOOA 4KMUX 4YG2F 4UNOA 4HF1A 1ZRFA 3I59A 5CLSA 4LLGF 3EQLF 4IHTA 4I7HA 3KEOA 3HHGA 3NQOA 5BOXA 3R0JA 4UHTA 3SXYA 3VFZA 1K78A 3HSRA 4AIKA 3L00A 5CVVA 2MLGA 4CICA 3MAJA 5AIQA 1RNLA 5IT9K 1EH7A 2W24A 1P6RA 1GHCA 1EFWA 2QBYB 5FGMA 1CGPA 2DK8A 3G73A 3K1MA 3RI4A 3GX4X 3T1BA 4EJTA 5E8GA 4P5OA 1S7AA 4JQFA 5FD6A 5ED4A 3GUDA 4Y15A 4U88A 1HKSA 2A6EF 2FQ3A 3HHHA 2UXXA 2FSWA 3R60A 5DD4A 4N0BA 4CDGA 2PLYA 3IRRA 3IWFA 1D8JA 4P55A 2KIFA 3F21A 4RMFA 1YW8A 4QLCU 3JW4A 3L2CA 2CFXA 2GIVA 4U0VA 3ZMZA 1O57A 2RKHA 3HRTA 2RQPA 3I4PA 2NYXA 1LVAA 5DCMA 5JFRA 3MWMA 1FBUA 3K9TA 3F8FA 3T5XA 3HRMA 2MH2A 2ZMEB 2FOKA 3W6KB 2HZTA 1BI1A 4H0EA 3C3WA 3ELKA 2QQ9A 2D2WA 4EGYA 2P5VA 4MEXF 5ICEA 4RS8A 3ZMDA 4IHSA 1U3EM 4LB5A 1YW7A 3DPTA 1E2XA 1FT9A 5FB2A 1G6NA 3C1DA 3SHFA 1G51A 1QO0D 3M8FA 4BHCA 3ECHA 1BI3A 3J80K 3SZPA 4ZYHA 1FY7A 1HKTA 3WU1B 4HZFA 4CZZA 4AIJA 4QWQA 2VC0A 3LWFA 1KU3A 1XDUA 1V4RA 4PZJA 1MJ9A 4PGGA 2UZKA 2E7XA 1SFUA 5DYMA 5L3BA 1CF7B 1O7LA 2LDUA 2QBYA 2DBBA 1G3YA 3D5LA 3T8TA 1IN4A 4I01A 4UVBA 4KUMA 4G94A 3WGHA 2O6GE 2OD5A 1IXSB 4HOBA 4UUVA 2DQRA 3K1NA 4LFUA 1LDKB 1R58A 2HS5A 1ODDA 2JZYA 1YFHA 1DPUA 2XAFA 3GWZA 1G3SA 3ZMTA 3GFLA 4ENNA 1EH8A 1UHWA 5F64A 2ZJ2A 2K4BA 4R79A 1ZAOA 3TO9A 4KIGA 3RIRA 2Q8KA 1EH6A 4LMYA 4GCVA 3OOPA 2L4AA 1B1BA 4RB1A 4YFKF 4A0YA 2YX7A 3WTVC 2L3DA 1L3LA 1AOYA 2V1XA 3ABUA 2QWWA 2HOEA 1P4AA 3QAHA 4OIOF 5JVTA 3ZMVA 1FBQA 3DV8A 2EB7A 3FZVA 3FHZA 3F8MA 5HDGA 4G8XA 2CQKA 1XGNA 2P4WA 1K6OA 3E6CC 2R7FA 3F3XA 1T98A 5D5UB 1W7PD 3O3KA 4A0XA 1ZGJA 3KEQA 5FD5A 4KT5C 3MFKA 3S2WA 1SFEA 4HW0A 1Z7UA 2H09A 2FBIA 3QPHA 2VE8A 5JR3A 2YU3A 3FM5A 3B73A 4FT8A 1V3FA 2IA0A 3KLOA 4B09A 2KKOA 3WTWC 2V6CA 4RAYA 1W5SA 3N4MA 4HLYA 1XCVA 2W84A 4P9FA 1SD5A 5K5OA 1KYZA 1CF7A 1EV7A 2JTVA 2WV0A 3GYHX 5D5XB 1HXDA 2ACJA 5DUIA 3BDDA 1XGMA 1K7AA 1DPRA 5KK1A 4ESJA 1REPC 4IRHA 2CW0F 2ZCWA 2HFHA 3J81Z 4LK0F 1YIOA 2IRFG 3FXQA 2FBKA 5DEQA 3Q9VA 1WQ2A 5ILSA 5BPIA 1HW1A 1Z6RA 1ON1A 4LB6B 5L3EA 3GFIA 3E6MA 3KE2A 5LHIA 3HRUA 2RN7A 1D3YA 1WRJA 3RPUA 2BGCA 2P6SA 4LK1F 5LHHA 4D0PA 2FRHA 1O3TA 4NHJA 4E70A 3I5UA 1F5TA 4Q5SF 3LAPA 4G7OF 2KIMA 2HTSA 5HS8A 3ROUA 4BHPA 4HX4A 4IPAA 5DDGA 3QU3A 5A2QK 5K5QA 1J0RA 1IUYA 4I0BA 5E20A 2DO7A 1IL2A 3R61A 2Y0MA 2MLKA 2LSOA 4WWCA 4L9TA 3C18A 2L01A 3COAC 2BEOA 3R6SA 3H3UA 4O3MA 3FWEA 2A69F 3TOAA 2EFOA 1W7PB 1XDSA 4BH9A 4PCQA 1T6SA 4GO1A 2MA3A 3N97A 2ZXJA 4M72A 3FMSA 1XSXA 1QPMA 2OQRA 1BC7C 1BI2A 4HBLA 2PI0A 3U1DA 1LB2A 3LFKA 1LJ9A 3CUQB 4MNUA 3M1EA 5FLXZ 1R36A 4L18B 3TOBA 3TDUC 3IWZA 4UV8A 2KIUA 1YLFA 1B9MA 3TQNA 5FFZA 2K86A 4Q48A 1R1VA 1BI0A 4XBFA 4GGGA 4IXAA 4BYYA 3FM3A 5IT3A 1I5ZA 1J7KA 1FYMA 5CVJA 1AWCA 2DPUA 2V9VA 1PUEE 3DP7A 4I02A 2VT2A 5L3CA 2W25A 2XAQA 1S29A 2LF7A 1J75A 1SD6A 1IW7F 2PMUA 2PG4A 5E18F 4MQVA 3WODF 1KQ0A 4G9YA 3FX3A 3P9IA 1UFMA 4L9JA 4EM0B 1STZA 4OU0A 1OKRA 2K7LA 4O5VA 3HUGA 1KU7A 2A6HF 1TLHB 4WXHA 4U7DA 4M74A 2XHKA 1A04A 2W85A 4XLNF 2O03A 1MDMB 4EV0A 4BQAA 2ZFWA 3WTSC 2P5KA 1ULYA 2RNJA 1U2WA 1XB4A 3E3VA 2MD5A 1PP8F 2Q2EA 2M87A 4IVNA 1FNNA 1I6XA 1J2XA 3LAJA 4WCGA 4EM2A 3RKXA 2FA5A 3RYPA 4Q4ZF 4HF0A 1BIAA 2VE9A 3KZZA 2OQGA 3JSPA 4MQ9F 4HYEA 2EA4A 1XSVA 1W7PA 5L3FA 5J8FA 3E5XA 1SFXA 3L09A 1R1TA 3EDPA 2YPRA 1XGOA 5ILUA 2R7DA 3DF8A 1S6LA 4G7HF 2D45A 1FYLA 3CUQA 3CDHA 3QRFF 1BBYA 3F8BA 4AH6A 3FXUA 2STTA 3I54A 2Y75A 3Q9SA 5D5WB 4RGUA 1KQ9A 5IT9Z 1GXPA 5DUKA 2JPCA 2K27A 5E8IA 2DW4A 3QP6A 4HAMA 3RJPA 1R5GA 2FBHA 4AD9A 3HIFA 2R3SA 4CGZA 1FLIA 4EJVA 4WJ4A 2QLZA 5ICGA 2GA2A 3WU0A 1W4MA 5D4RA 4EMSA 1FSHA 2ZNYA 1YG2A 4OOIA 4XSZF 2KJBA 2JPBA 3V8KA 2JT1A 1TQIA 1YW9A 1S8NA 5HS7A 1MKMA 2XROA 3KZYA 3B02A 1JGSA 1H9TA 1HSTA 1W5TA 3MZYA 4EGZA 2OZUA 1QQIA 1MDMA 2ADUA 1IF1A 3DKWA 3V7SA 1IRFA 4FX0A 1UB9A 1IZ1A 2O8XA 3TO6A 3T0YA 4LLLA 1ZG3A 3K2ZA 1QZZA 2PEXA 1ZHFA 3D0SA 2VONA 2M8EA 3HTUA 5D5VB 2PN6A 5J8CA 4OIRF 1FP2A 3GW2A 3GFMA 4LJZF 5LEJA 3WTTC 1DUXC 3KP5A 3O6BB 4S05A 4G6QA 1XMKA 1LQ1A 4XRFA 3RTRA 1H9GA 2DK5A 1ZLKA 2IJLA 2QENA 2UWMA 1VTNC 4UVCA 4A6EA 2XAHA 4ON0A 3LA3A 4CXFA 4LD5A 2PJPA 2EK5A 5TRDA 1ZG5A 1ZRDA 2EV0A 2HKOA 3EETA 3BJAA 1FC3A 2VN2A 4FHTA 4BXUA 4JK1X 2TDXA 5LRSA 4UV9A 1T38A 3NEUA 2CYYA 3V7RA 4G7ZF 1F9NA 2CSOA 2VBWA 3E97A 4G6DA 2OA4A 2FF4A 3GO5A 3WTUC 1ZYRF 3JTHA 3PQJA 1J59A 2BV6A 2FE3A 2NRAC 2VOPA 2OU2A 3RKWA 5D4SA 4GYIA 4YIIA 1FX7A 5K1YA 2Q0OA 4RGSA 3CUOA 1D8KA 5FFXA 1S3JA 2ZMEA 3HSFA 3SZTA 2RV8A 5TJJA 2HEOA 3IL2A 3GF2A 4HA8A 1TW3A 5EEGA 2DI3A 4FX4A 2RGVA 2GA1A 3GLXA 2VODA 2IW5A 3M8EA 3GVAA 3GZ6A 2Z9OA 1Y0UA 3IKVA 3DEUA 4DQ2A 2M30A 1LEBA 3KFWX 4M9ZA 2WTEA 2DFIA 1GXQA 2FXAA 3U2RA 2L4MA 2HGCA 3ERED 4A5NA 3KETA 3O2PE 3V8JA 2YX4A 4WK8F 4A12A 4GXOA 1U5TC 4YIFA 5LLQA 3F6OA 2RDPA 1OYYA 5K5RA 1O7FA 2UXNA 4AWXB 4OIQF 2M5WA 2O3FA 1H0MA 1FBSA 3BZ6A 4OMYA 5CVUA 3J81K 1BOAA 3QPTA 1TNTA 1Q1HA 2D1HA 1K79A 4ESBA 4M6XA 4M9SA 2ZO4A 3QP5A 1R1UA 4ENKA 3DXJF 3BJ6A 1MD0A 2GZWA 4KIBA 2QZ8A 1ZARA 5LEKA 1QNTA 5LGTA 2IVMA 2GXBA 1X3UA 1O3QA 2MBFA 3T8RA 5BS6A 1BJAA 2ESNA 4AIHA 3I64A 2AS5F 3PFIA 2STWA 3GZ5A
chains in the Genus database with same CATH superfamily
1R7JA 1Z1DA 2NNNA 5HDNA 1E17A 2EJRA 5M3MK 3HKZA 2MABA 2QKLB 2GOMA 4DYQA 2DTRA 1ETVA 2XGXA 3EUHA 3QOEA 3CCQI 3Q5FA 1IBAA 4PK4A 1RR7A 2DDAA 2DLLA 1YCLA 1TC3C 2B63J 1SFOA 4CSWA 2VC1A 5L3GA 4J3NA 4XSXF 1JXSA 4YFNF 1XTAA 3M3YJ 3U1KA 3KX2A 1B6AA 4ENJA 3A8IA 1F4KA 2NS7A 3ZQCA 1KQ8A 1X3ZB 4EM1A 3L9FA 4U0YA 3CCUI 3GEHA 1SVOA 1XCBA 1XX5A 4BL0B 4C3IC 5CQGA 4BQNA 2FU4A 2JVHA 2CW0A 2M1BA 3OYLA 4I09A 2HDDA 4ZYAA 1RIOH 1WCMA 2QVOA 4LK0A 4K2EA 2EZIA 2FNAA 2YSRA 3FDYA 3FXMA 2H8RA 2LF8A 2JH3A 5M5YJ 2WC2A 1J5YA 1QZYA 3C2GA 2R7RA 3S16K 1HSJA 2DAOA 1VQKI 1KYWA 3FIWA 4P96A 2M3AA 2PFBA 2A5YB 3A4CA 2JA6K 3GTKC 1O29A 4ZZLA 2B63A 2MGQA 3F72A 3HOWK 3BR0A 5E17F 3OR2C 3HOVJ 5LGUA 2X6OA 2YUSA 2HI3A 2V7FA 4PABA 1EA3A 4FQGA 3J7AY 4KN4A 2O0YA 4OIPA 2XKOA 2QCOA 2IGKA 3Q0UA 2V1UA 3O8HA 1I6HK 5ERIA 4NNJA 1LDJA 3TGNA 1B9NA 5E1WA 2QM3A 3RPQA 5FLXK 5J3LA 4YELA 4MHGA 4LK1A 5D4DA 4JOMA 2Z3YA 5B1AH 2GQQA 1YRNA 4A3MC 2CGPA 4AYBA 1YX3A 4BAYA 2Z99A 4R1HA 3MVPA 3SFZA 3AG1H 5LGNA 1I6VA 3TFHA 1WI9A 3WHBA 1B4AA 1IAWA 3K0LA 3GEZA 5HLHA 4B1RA 2EFPA 2WY8Q 5D6EA 2VOOA 1KA8A 1U8RA 3SDBA 1TWGC 2A61A 2PQ8A 5C3EK 5BQTA 2PMHA 2VQCA 4J19A 4A3BJ 1OCPA 3VWBA 2RREA 2GXGA 1Y6IA 1X1CA 2O5IA 1ZH5A 3CCMI 1FTTA 2HU9A 2R7QA 2YS9A 1KQ4A 3L4JA 3S14C 3BR3A 2HYGD 3A02A 1JE8A 3PQKA 3R0AA 4A93K 3WGIA 4D5FA 3OS2A 2HWVA 2Y0SN 5F0FA 4GTAA 2TCTA 4UVAA 1WOSA 1UMQA 3IH2A 3LSTA 2LYCA 3CC2I 5HNFA 2DTZA 4UUSB 2VQGA 2F2EA 3LA7A 1C0WA 3ZMUA 4DBRA 1ZRCA 2A6TA 3HM5A 1MBEA 2ZUEA 2OJED 1QGPA 2LK2A 1Y0NA 3DFGA 1W36D 1D1CA 1YITI 2O61A 1IN8A 1YI2I 3KPHA 2DA3A 2EIJH 4XRSG 4F7ZA 4KM8A 2BY2A 5CVRA 1DP7P 4BNCA 1P4XA 3K4MA 2BY1A 3S16C 5AONA 1BR2A 4A3KK 1KZHA 3IRQA 2JA6C 2ESHA 4NQWB 1TZLA 3HOWC 3RYRA 1HBXG 2NAZA 5KVRA 4A3CJ 2IBDA 4MEYA 2XVCA 2E1CA 2IT0A 5FLMJ 1XG1A 4L9VA 1IRXA 3M4OC 3OV8A 3TKYA 1W5CC 4GFBA 2F5EA 5FLVA 4A6DA 3OMYA 4GFQA 3S2HJ 1X3WB 3F8NA 2FUG2 3SQNA 3PO3K 1DCOA 4KYWA 4XM3A 3JRDA 3H3VD 1D0ZA 2ISYA 4EJWA 5E3NA 1IUFA 3BQYA 3I71A 5CJ9A 3L2UA 2Q1ZB 2QQBA 2JA8J 1MBJA 4C3HK 1LNWA 1POGA 2XF6A 2ECBA 1BW5A 2DA2A 2WB1D 2E2IK 5C4XC 1HW2A 3JSOA 5J6XA 2E1OA 3G1OA 2E7WA 3AAFA 2NXNB 1SMYF 2XAJA 1ZGAA 5M5XJ 2R7VA 2FMLA 3NRVA 5D8KB 4V2GA 1XD7A 2VBYA 3JAMK 4HQMA 5C3EC 4KFCA 4MO7A 5H20A 1ZN2A 3KP2A 4A69C 1A6QA 1MMGA 1ZLJA 3E0JB 4ZYEA 3PO2J 5EGOB 4XK4A 2PBIA 2XUBA 3GMEA 2P5LC 5IYBC 4Y4RA 1J09A 3H36A 3V4GA 4A93C 3DWLE 1TW2A 1E0EA 1BR1A 3H9QA 4PFPA 5KAFC 4KN7A 1IW7A 4ZYDA 1LFPA 5C44K 1TTYA 3FMQA 1MJAA 2HKXA 2W4SA 3GXOA 4TV7A 4MTDA 5IYCC 4OINA 4ZH4F 2H27A 3ULQB 3WODA 3CJNA 1U8BA 4IKFA 4GT9A 2WAQD 1I1SA 2EINH 5ILVA 1YX5A 2L7ZA 2R4GA 4WXCA 4A3LC 4M3BA 2DOFA 3HBLA 4MGRA 1WQHA 5C4JC 4PDKA 3ZRGA 3IAM2 2K9MA 3PJRA 4G12A 4WILA 4E7JA 1NG6A 1SANA 3DPUA 5IYDC 4C3JK 2EV6A 2CJJA 4P9SA 4WX9A 3L2VA 3J7AO 1V5VA 2NNYA 4L9NA 4A3KC 4OMZA 3GTQC 6PAXA 2D6FC 3QYEA 3OYJA 3CD6I 5IORA 1L0OC 1FP1D 2H6BA 4AM3A 4XRSA 4RB2C 1R23A 2X85A 1IRGA 5EEHA 2F5FA 1FOKA 2KZGA 3QQAA 5DCFA 1S7OA 2FX0A 2RC4A 5BMZA 1OYWA 4KN4X 1AU7A 3VYUB 2F6CA 1QHGA 1IC8A 3JTGA 1R22A 3BOQA 3BP8A 2OZ6A 3X2QH 2ZBKA 5TMFA 4LG0B 4JBAA 1YYVA 3VODA 2XIGA 2R5YB 5F27A 1OPCA 3CCYA 4RAFA 2VJIA 2R92K 3MKYB 2OC6A 2E35A 1GVDA 4O2DA 1HDPA 3EYYA 1FZPB 2KZVA 4I0AA 4B48A 4JK1A 2F5DA 3VYRB 3GTKJ 1BOBA 1ZG1A 1ONVA 1BDFA 1TBXA 3TDZC 3L7WA 4CZCA 3B6CA 2EFQA 3H1CA 4ETSA 1IN6A 5LBQA 2PHCB 3P9KA 3P9CA 1Z9CA 5HODA 5HLGA 2VL8A 1NHAA 4YG2A 3KLNA 4DGWB 2COMA 3WGGA 4XORA 4BY7K 4CYDA 1XSDA 3CAGA 1MMDA 2F48A 1WGXA 4LLGA 4Q4ZA 4F55A 2F4OB 4ABZA 1DDNA 2IA1A 3EYIA 4EQQA 1XMAA 2ELHA 4A3IK 4MQ9A 4HLXA 3QX3A 5DD8A 3FXRA 4A3MJ 4D9JA 1MJBA 4UUSA 4IHWA 1HQCA 3IHUA 3IKTA 5EG0B 1RUOA 4LIVA 4HV5A 3WE3A 2XV4S 3A8KA 3HOYK 3MCZA 4LR2A 4GTBA 4GYGA 1MGTA 1T39A 4XL9A 4A3JK 2XASA 2JQ7A 3CQZA 2QYOA 2VKVA 1I27A 3OOUA 5J40A 2IP2A 1I50J 3H3ZA 4G7HA 4NQWA 3ZN0A 2M0CA 4HNVA 2Z5UA 3HOTA 5L46A 1P92A 3FK7A 3I4NK 3HSEA 2LP0A 3E5UA 4U0WA 2X1CA 1JI8A 1G59A 5F6FA 1RU0A 2DMUA 1QBJA 2DDBA 3HOSA 3RZDK 2UUZA 1HA8A 3N05A 2HNHA 3H92A 3E1SA 2OPTA 4XLPF 2FMYA 1I3QK 4HF2A 5M5WK 2JRTA 1WKMA 1GVJA 2EBIA 2R7SA 2A6EA 4BBRK 2BVMA 3HOXC 1TWHA 3K6GA 2QA4I 4ENMA 1DCPA 4F3QA 1WIHA 1O24A 1PP7U 3FKIK 1D0XA 1S9HA 4UB6C 2W7NA 2IA2A 2K3PA 5E1ZB 2EQRA 2R92C 2NVQK 3H0GJ 1I50A 3FHNA 2E1NA 3BJOA 2JK3A 1ZQ1C 2BXZA 3S16J 2DFEA 3OIQA 5H6QA 4F91B 2PA8D 1KU9A 1YS7A 3HOWJ 1U9OA 3F8CA 3WG7H 4M73A 2VUMA 2FEZA 2XDVA 3ZCOA 1Y39A 5EGOA 4BKXA 2XPVA 1I6HJ 5F0HA 4U7BA 1E3PA 3HPGA 4BY7C 3OYIA 1YJWI 3ADAC 3G2BA 5FO5A 3GEEA 3H3VL 3HG9A 3WTYC 2GWRA 1U78A 3HYIA 4N9HA 1TWAK 2X6YA 3GTLJ 3HGGA 3F6VA 4QPQA 4HQEA 1RRJA 2WB1L 4RGRA 2K9QA 4ZYGA 1P2FA 1TQMA 2GXAA 3H0GA 1R49A 2HOTA 4KITB 2HYFA 5TISC 4CA0A 3ASNH 3F9KA 1JTXA 3KP7A 4NB5A 4KN7X 1ON2A 5JLWA 3FKJA 4BS9A 4BJ6C 1LUJB 2A07F 1ZGWA 3ZQ7A 3OREA 1Y1WK 4HDUA 4BXXK 5DM7F 1MH4A 3J80Z 3WTXC 1VH2A 4W97A 4KA4A 4BXFA 3FBIB 1JHHA 2K3FA 1D5VA 4IZZA 2HYJA 1PDNC 5C3EJ 2CRGA 2KL4A 1USSA 4HDVA 2GSOA 1RETA 4UXNA 1SC7A 1Z6TA 2CG4A 3DPLC 4CCNA 5EZHA 4B43A 1LEAA 3GTLA 2VQHA 3I4NC 4LQYA 1YS6A 3BG6A 4IRIA 4A93J 3A8JA 4LG0A 3ML6A 1VQOI 2VBXA 3M1CA 2DMQA 2WAQL 3S1MJ 3GTGK 2P7CB 3LQQA 1I3QC 4Y17A 4DNCA 4S04A 1TL8A 3AD8C 4M3DA 3LSIA 4B8XA 1B8IB 1R9TK 4BBRC 3VEPA 2EIMH 3L2QA 1TNSA 2O5JA 3JRGA 1P7JA 3TBIA 3CC4I 2M8GX 3FKIC 2HTJA 3QPLA 1HKQA 3IUOA 4ZDLA 2DPDA 1F1ZA 1V5FA 4O6JA 3W6JB 2IPQX 2XKPA 2NVQC 4KIFA 3OPFA 1J9IA 3OSFA 5HVQC 1M1EB 3DU5A 2DU9A 4RMNA 1WCMC 1UHMA 1HW5A 3LSMA 1WH7A 2NOGA 1O2AA 2BXYA 2NVYC 3AG2H 1G4DA 5CVIA 4PJ0C 2NS0A 4PGHA 1I39A 1JOEA 2ZUFA 1Q1VA 1O3SA 2ZFZA 2IGNA 5BPDA 1SMTA 2L9SA 4I2OA 3PNYA 2B0LA 1O3RA 4WJ3M 1IXCA 3HOUK 2KPMA 1UG0A 3G4SI 5D8LB 3LOCA 1FSEA 2LH9A 2OBPA 4B3AA 5EG0A 1TWCA 1IO2A 2EFWA 2KFDA 1RC9A 5HDKA 3PO3J 3CDLA 3SZZA 2L9NA 3K1PA 4CO8A 2VBZA 1IN5A 4N4OB 1YIJI 4RGXA 1BN5A 1OCTC 2WAEA 3OR1C 4C3HJ 3MQ0A 2E2IJ 2JA5K 3VYTB 1A36A 1IXRC 4CH7A 1L0WA 1Y1VC 3UR3C 3I3LA 4IRGA 4QIWD 4B47A 3JRIA 1LDDA 2A3SA 1MBGA 4RAGA 5FROA 1ITYA 2EFNA 2HR3A 2IS2A 4BE1A 2CO5A 2LKPA 3M9AA 1Y1WC 4BXXC 2BE5F 4M3FA 1YJNI 1EQRA 2VQLA 1R5HA 4FE4A 4RB3C 3FMRA 2L2OA 2ETHA 5CKTA 2PMZD 1OLTA 4Y7NJ 2C6YA 5JHUA 1XGSA 3ECOA 3QOPA 3T00A 3RKYA 1IS1A 3A01B 4YFXF 1JGGA 2WB1A 4BE0A 4LLNA 3GTMJ 3V7CA 1O25A 1RI7A 4HV6A 2E2IA 3GTGC 1XC5A 3CDIA 5C44J 4BDZA 2WWYA 2GAHC 4PFOA 3HPHA 3K70D 2R7ZK 4KDPA 2K4JA 4XKBA 1RESA 1R9TC 1G3TA 1SVLA 3MEXA 3I58A 1FIPA 1ZREA 2XRLA 3BR1A 3ABTA 2MSYA 3RCOA 4CUGA 2YU9K 4BQOA 1FMWA 4A3GC 3S1RJ 2KRCA 2KWAA 1ETKA 4HSRA 4FTHA 4C3JJ 3KCCA 3GTJJ 4YFKA 4Z6YA 3FF5A 1PJRA 2GAUA 2KMUA 2CQNA 4HSTA 4CYCA 2E2JJ 2G7HA 4R8HA 3GTMA 2WAQA 2H94A 2CW8A 1ZYRA 1RR8C 4IJAA 5F0CA 1WJFA 4XMYA 3ZP5A 3KP4A 1USTA 4Y13A 1J6XA 4WF2A 1ETWA 2JRMA 2DA5A 1PJ5A 4RLFA 2CQQA 4MIMA 2PA8L 2R92J 2NVXA 4KNYA 1MW7A 2MC3A 2H1KA 2ME0A 1VLOA 4IQJA 2JA5C 2DMNA 3CCEI 4L5JA 3GTJA 2K9LA 2QUFA 4C3IK 1KU2A 2XPWA 5K7HA 1MH3A 2J5OA 2R7TA 2I5UA 2ISZA 5LRRA 1FWZA 2G7UA 4BY7J 4N9IA 2V4JC 4A0ZA 3BTIA 1K83K 1PJ7A 4KMFA 3QODA 3GTPK 2RVCA 1O2FB 3CLOA 4KAWX 4OWRB 3I56I 1T2KA 2LY1A 2X9DA 9ANTA 3F0CA 2A68F 4PSXA 5L3DA 2NVUB 4A3IJ 5DV5A 3K2AA 1B8IA 1YQAA 3MKZA 4L0YB 4ZZDA 2E60A 2I10A 2LKSA 2MD0A 1LE8B 1WJ5A 3ISPA 3HOYJ 5JI6A 4L0ZB 1XPXA 1YO5C 2R7ZC 4Y52K 1QRYA 3V8LA 3CZ6A 2XCRB 3I4MK 3WTZA 4A3JJ 4KICA 4C2UA 1VNDA 1MNMC 2ME6A 2V1DA 2VXZA 2VXDA 2JUCA 3SDGA 2YU9C 3CCLI 3TMOA 5LFAA 2G9WA 2CFAB 4BHBA 2Z33A 3AL0B 2RAEA 3RQ4A 1UAAA 2L02A 3IP4B 4II3A 4CCJA 3C7JA 1UELB 2L9VA 3K69A 3GFJA 2I8DA 2IGMA 4XIDA 2V26A 2BYVE 1U5TB 4PJNA 5IY5H 4OAYA 3RZDJ 1VQ7I 1TWGK 3F22A 2K5CA 2KT0A 4HX8A 4BDYA 2QQAA 3PNTA 5D6FA 3SJMA 5HS9A 1I3QJ 2XC7A 1FOWA 2KRFA 2LNBA 5M5WJ 1WWXA 4EVIA 4OIPF 2R7XA 1T95A 4BBRJ 1SD7A 4A2UA 1ERDA 2LMDA 5K7ZA 4PJMA 4M9XA 5LHGA 5FRNA 3S14K 3JR9A 3CUQC 2JSCA 3FKIJ 1VQNI 2EV5A 4DJAA 2AXLA 1BC8C 4NDLA 2GAGC 3KP3A 2NS8A 3PSFA 2EWNA 3LFUA 4BJTA 1AHDP 5ICFA 3TFJA 3GTOK 3KYCB 3OYEA 3K4CA 4LGWA 4RB0A 1Z3YA 1TWFC 2HPIA 3DKXA 3G4AA 3CTAA 1IRZA 3PUFA 1KGSA 1DGRM 2ELKA 3E6DA 3VB2A 3IV5A 1S7EA 1ZVUA 3ZN1A 3VSLA 4P9UA 3G3ZA 3L2RA 2V6EA 1K83C 2HVQA 2XRNA 3GIRA 2HVSA 1TWAJ 1YTYA 2DQLA 4IF4A 3KP6A 4A5MA 1IN7A 4MFEA 5A2QZ 1E3HA 2R7WA 4QIWL 2QSFX 3ZPLA 4ASNA 4UB8C 2HQRA 3I59B 2P7VB 1MZBA 2MH9A 3I53A 3LA2A 3OYAA 5IOYA 2V79A 1XXBA 3M4OK 3QU6A 2EA2A 3AFHA 5E79C 5GAGJ 2ZJRF 1BR4A 1WVRA 1I1GA 2AO9A 2OAZA 2A05A 4HG2A 2PMZL 3BPVA 5IPAA 4CHUA 1OYIA 1R00A 4Y52C 4BXXJ 3I4MC 1UCRA 1K78B 2NVTK 2IS6A 4KC6A 4Z2YA 2RH6A 3GLLA 2MW8A 5AIPA 1G3WA 4Q5SA 1K61A 3HXLA 2DT5A 1K4TA 5C4XK 4G7OA 1YNJA 2VIXA 3M7GA 3RDIA 3H5RA 4GTEA 2XF5A 4KDDA 3I55I 3LQRA 1RUNA 5GTHC 2ZNZA 4XSXA 4YFNA 1J6WA 4MEYF 2L5QA 5TGTA 4DYCA 1BIBA 3I0TA 4QIWN 3E6BA 2ZXIA 1DD5A 3E5QA 2YR2A 3BPXA 1OR7A 1C0AA 2BHYA 1R9TJ 3NUHA 2Y48A 3CO7C 3DEEA 3CJRB 5IYBK 2HOAA 3IC7A 4WXDA 4L5IA 1ZK8A 2WV1A 2A69A 1GDTA 1R6RA 4W1UA 5F1JA 1SD4A 3D5RC 1LVKA 1B59A 5IYCK 2KRHA 4IL6C 2LTPA 4HX7A 3SEQA 3GTOC 2FNPA 2XPUA 1FYKA 4KT6A 1O2BA 1JHFA 1X1DA 2J5PA 4A3LK 2L54A 3REOA 5C4JK 4XRMA 2BY0A 3DBHB 1TQPA 2CWEA 3P7NA 4MTEA 1FEXA 1WOOA 2BW3B 4JX4A 3WE2A 1IV8A 2DXIA 5CYVA 5IYDK 3S1QJ 3HOUJ 2V6UA 3R4KA 1OMIA 3GTQK 4Q47A 3RZOC 2X4HA 2BOLA 3S32A 3U9GA 4LIUA 3GCMA 2M45A 4ESFA 4PJLA 2F5VA 3MZHA 2VT3A 1VQ6I 4I98B 2W57A 1JJ6C 1WSUA 4M6YA 4XLHA 2JA5J 3HRSA 2AQEA 3WG9A 4ZDOA 5E1XA 1T56A 2P6TA 1X1BA 3F23A 2BBYA 3CCVI 3KIOA 1FPQA 2COBA 2P8TA 2VI6A 3BWGA 4OINF 2CFAA 3HTSB 1XS9A 2R93K 2RNGA 5E3LA 2D1VA 1XN7A 3CJTB 2ZKZA 4AVPA 1FOXA 2NVTC 2F4IA 1U6GA 2HQNA 1RZ4A 1VZ0A 1S5LC 1U5TA 2H1LA 1WI3A 2XB5A 2GBYA 3OYBA 5CPRB 3BY6A 5ICCA 3OYDA 2MYSA 4RAZA 5DCMB 1BM9A 5H6RA 4EJOA 4KMHA 2X0LA 3BROA 4GDFA 3ZMSA 1P4WA 2CFOA 2E2HJ 2K02A 1INNA 5HLIA 3ZQGA 3TO7A 4M71A 4E7ZA 2DT6A 3S3OA 1Z05A 3CO6C 3DLLF 2R7ZJ 2XAGA 1T0FA 1X1AA 3JRBA 2PMZA 5F1RA 4YEJA 5IOZA 4IEJA 1Z91A 4C2MJ 2HDCA 2H6CA 4A3EK 2YU9J 1LFBA 3CLQA 2KJCA 4KISA 2VJ4A 2ELJA 1F93A 3S15K 5B66C 2R7OA 3VOEA 2F5CA 3DQVC 1SAXA 4B44A 3N3YA 3O8GA 3OEPA 4M1XA 2BHZA 4DZPA 2ID3A 3JAMZ 2E2HA 4EJUA 5HOOA 3SZGA 1R71A 1YNNA 1KONA 1VQPI 3QYBA 4KMUX 4YG2F 4UNOA 4HF1A 3DKYA 1ZRFA 3I59A 5CLSA 2A6HA 3ESWB 5F08A 3TL4X 1VGXA 4LLGF 1WJEA 3EQLF 4IHTA 4IO9F 4DBQA 4KASA 4I7HA 3DTIA 3KEOA 3CCJI 3HHGA 3NQOA 2BY3A 5JVGF 5BOXA 1LPQA 1ZQ3P 3R0JA 4UHTA 1TWCC 3SXYA 3VFZA 1JUSA 4RDUA 4XLNA 1K78A 3T02A 2ZSHB 3HSRA 4AIKA 4P5BA 3PM1A 3L00A 3HOXK 5CVVA 4C3IJ 2MLGA 3D5SC 4CICA 3MAJA 5AIQA 2R93C 4XKWA 3G4CA 1RNLA 5IT9K 4LOWA 1EH7A 2W24A 1P6RA 1GHCA 1EFWA 2QBYB 4FCYA 5FGMA 4ZTJA 2L0KA 4JX5A 4DZJA 4D5CA 1CGPA 2OCEA 2W00A 3OSGA 3S8PA 3GTPJ 3ABLH 2DK8A 3ASOH 3G73A 3K1MA 3RI4A 4N4NB 2BVLA 2WBMA 3GX4X 3T1BA 3JREA 3G6EI 4EJTA 5E8GA 4P5OA 1S7AA 2VPLA 3JSTA 2ZMEC 4JQFA 1U0JA 2KQRA 5FD6A 5ED4A 1WJAA 3GUDA 1AA7A 1Y8RB 2VKHA 3CMMA 3ZQQA 2IGOA 4PJJA 3CCSI 2LD5A 3MZ8A 4UUTA 4Y15A 1J98A 3HJEA 5IP7C 4U88A 4I99C 4QSHA 4Y52J 2CS3A 3I4MJ 1HKSA 2A6EF 2FQ3A 3HHHA 1N77A 2DA6A 2UXXA 3OYNA 2MC4A 1SVMA 1F7UA 2FSWA 4A3EC 3R60A 3OS0A 2CU7A 3CJQB 2V9PA 1BL0A 5DD4A 4A3DK 4N0BA 4CDGA 1LFUP 3HOZK 4B4CA 3S15C 2BW3A 4E7HA 3GTKA 2E5NA 1K6YA 2PLYA 2V1NA 5EEAA 3IRRA 1R4MB 3IWFA 1D8JA 2CH0A 4P55A 3NWTA 1TWGJ 2O7OA 2KIFA 2LLKA 1T8IA 1EH1A 3F21A 4RMFA 1YW8A 4AC0A 4QLCU 3I9V2 5M3MJ 1NH3A 2E34A 3ZXSA 1IGNA 3JW4A 3L2CA 2CFXA 3RPUD 2MG4A 2GIVA 3CP2A 3S14J 5J1YA 4XN0A 2X6XA 4B3XA 4U0VA 3ZMZA 1O57A 2RKHA 4YRVA 4XOTA 1BS2A 1ETQA 1SFOK 4C30A 4GRIA 1OFCX 1MBHA 2JA2A 3HRTA 3HKZD 4IOCF 2RQPA 3QPSA 5GPAA 1WH5A 1VQ5I 3AQOA 2JA7C 1WOPA 2XAUA 3I4PA 2HOSA 1QU3A 5EF6A 3J7YJ 3GZNB 2NYXA 1LVAA 3PFYA 2GSUA 1TWGA 5DCMA 2DYRH 5JFRA 3MWMA 1FBUA 2DJIA 3K9TA 3F8FA 3A1YA 3T5XA 3PIPF 1WCMK 3HRMA 1N25A 2MH2A 2ZMEB 2FOKA 3TP0A 3W6KB 2ZC2A 2HZTA 2JA6J 3EUKL 2NVYK 1BI1A 3TTGA 4C45A 5KNLA 2TRTA 3LNQA 4H0EA 1R5ID 1IJWC 3C3WA 3ELKA 1OQYA 2D2WA 2QQ9A 4EGYA 2P5VA 4MEXF 1PUFB 5ICEA 4FETA 1JQWA 4RS8A 3ZMDA 4G0UA 2QQ8A 4IHSA 3M4OJ 5B3SH 1U3EM 2HQAA 4LB5A 3M3YK 1YW7A 3DPTA 2QSHX 1E2XA 4XSZA 3VDXA 1R4NB 3LSRA 2G0EA 4RBOA 1T33A 1WQGA 2EILH 1FT9A 5FB2A 1G6NA 3HC7A 3K4BA 4DOZA 3C1DA 5IP9C 3SHFA 1G51A 3HDDA 1Y1VK 1QO0D 4A3DC 1HF0A 3M8FA 5C4XJ 4BHCA 1I3AA 3ECHA 1BI3A 3J80K 3IPJA 3HOZC 2X51A 4BY1K 2JA6A 3SZPA 1O4XA 4ZYHA 4I6ZA 1FY7A 4HNUA 2JN6A 1HKTA 3G1LA 4AVZA 3UKGA 2FQ4A 3WU1B 3HOVK 5IOQA 4HZFA 4CZZA 4AIJA 2K9SA 4QWQA 2EZKA 2VC0A 3LWFA 1KU3A 1XDUA 1V4RA 2LY2A 5IYBJ 5FJ8K 3EUHC 4PZJA 3BUEA 1D1BA 3FOEA 1MJ9A 4LOCA 4PGGA 4UY8I 1SFOC 1YJ9I 2R5YA 1NG7A 4CCOA 3SZYA 2WB1N 2UZKA 2E7XA 3H9JA 4QJVB 1SFUA 5DYMA 5L3BA 5IYCJ 3SEZA 1CF7B 1O7LA 2LDUA 4V2FA 1A35A 2QBYA 2DBBA 1G3YA 3D5LA 2DFFA 3T8TA 2L7MP 2RGRA 1VQLI 4A3LJ 1IN4A 1APLC 3DEWA 5C4JJ 4RM3A 4I01A 2M2EA 4UVBA 4A3GK 2D5VA 4KUMA 2IEKA 4XLFA 3GSIA 4G94A 3WGHA 2O6GE 1OCCH 3GBGA 2OD5A 5IYDJ 2FQOA 1IXSB 4A3KJ 3VSKA 2GM4A 3GTQJ 2LRDA 2E36A 4HOBA 4UUVA 2DQRA 3K1NA 1ZKGA 4LFUA 1LDKB 1R58A 2HS5A 1ODDA 2E1MC 2JZYA 1YFHA 2B63C 3AH5A 2HQ5A 2XAFA 3GWZA 1G3SA 1DPUA 3ZMTA 3GFLA 3VYSB 4ENNA 1EH8A 4G0WA 4OIRA 4LJZA 5HL8A 1UHWA 3M3YC 1WFXA 2WAQN 5F64A 5IOSA 4GTLA 2ZJ2A 2K4BA 4R79A 1B4BA 4FM9A 1ZAOA 2R93J 2KIQA 1JKQC 3TO9A 1X2NA 4KIGA 4NOIA 1TP4A 2LY9A 4X0GA 1HCRA 1SFKA 4KJZA 3RIRA 3KYLA 5DTDA 2Q8KA 3L4KA 4XOPA 5FKKA 1EH6A 4XLCA 3TP3A 4J01A 2Y3PA 4LMYA 4GCVA 1WPKA 1EJ9A 3OOPA 4V19K 2L4AA 1B1BA 4FE7A 3VA7A 4RB1A 2IS1A 2VKEA 5TJ3A 3GTQA 4BY1C 4YFKF 5K7FA 2XSDC 3N0CA 4IHXA 1YOVB 3HOVC 1QA6A 3PNVA 4A0YA 1GLNA 4P1WA 3S93A 5DM6F 2YX7A 3WTVC 2L3DA 1Y56A 1L3LA 4HPQA 3LSPA 5H2FC 2X1EA 1JT6A 1AOYA 2V1XA 3ABUA 3K4JA 1SAUA 2QWWA 2DA7A 1P4AA 2HOEA 4A3EJ 3QAHA 3ABMH 4OIOF 4F93B 4A3FK 5JVTA 2VB6A 3DTKA 3K7AK 3ZMVA 5IOTA 1FBQA 3C2HA 5GAHJ 3DV8A 3PIOF 2Y0SD 2EB7A 3A0HC 2XGDA 3FZVA 3FHZA 2EPFA 3K4LA 4BLBA 1IDYA 3F8MA 5HDGA 2DT7B 4ITVA 4G8XA 3OS1A 2FOWA 2CQKA 5E3MA 1JKOC 1XGNA 2P4WA 4G7ZA 2BZTA 5M5XK 2DN0A 3UNGC 2JMWA 5J47A 1PUFA 1K6OA 1F36A 3DLAA 3E6CC 2R7FA 2QF7A 3F3XA 3RKQA 2GSNA 1OISA 3WU2C 1T98A 1V5GA 5D5UB 4A3BC 2HXIA 1W7PD 4F92B 3O3KA 4A0XA 1ZGJA 3KEQA 1JTYA 3OYMA 5FD5A 1TT0A 4KARA 4KT5C 5KCMA 3MFKA 2FD5A 3S2WA 1SFEA 1UV7A 4HW0A 1DQUA 3HGYA 3HOXJ 1J6VA 1Z7UA 4KATA 2H09A 2FBIA 3QPHA 2VASA 2VE8A 5JR3A 4IHVA 2YU3A 3FM5A 3BLYA 2BE5A 2CUFA 3B73A 3G1MA 2WA0A 1WJCA 4FT8A 1FTZA 3IH4A 1V3FA 2DODA 2IA0A 3KLOA 1TWFK 2ICWG 4B09A 3NAUA 2KKOA 2Y9YA 3MMYB 3J7ZI 3WTWC 2R5ZB 1EK8A 2V6CA 4PSWA 4IX7A 4RAYA 5KHDA 4YFXA 1ACIA 2CQ7A 1W5SA 2V6SA 4D1QA 1OCRH 2ZSIB 4HLYA 3N4MA 1XCVA 3ZQHA 3SYTA 2CV1A 2W84A 4P9FA 1SD5A 5K5OA 4QJVA 4NC7A 1KYZA 5GPCA 1CF7A 5HNHA 1EV7A 5FKNA 1ISEA 4BU2A 2EH3A 2R92A 2JTVA 2WV0A 3GYHX 1T0FC 5D5XB 3S2HC 2LREA 2OCCH 1HXDA 3FOFA 2ACJA 5DUIA 4A3DJ 1ETOA 4A3FC 3K7AC 1BJZA 3HOZJ 3BDDA 1DGWY 2E19A 1XGMA 1K7AA 3ZQFA 2JA8C 3HXAA 1DPRA 5KK1A 4ESJA 2GLOA 3GTPC 2KDOA 1REPC 2FJ1A 4IRHA 1HQMA 3H0DA 2CW0F 2ZCWA 3BTJA 4QPOA 2HFHA 3NWSA 3J81Z 3CQZK 4LK0F 1X58A 1S72I 1YIOA 1HOMA 2IRFG 4NBQA 3I4NJ 3TW6A 3H5NA 1DP3A 3FXQA 3LL7A 2FBKA 3OWTA 4FISA 5DEQA 3Q9VA 2IXSA 5B1BH 4XNFA 1X31C 1WQ2A 4RM2A 3JRHA 5ILSA 3JRFA 3PSIA 5BPIA 3PO2C 4JYKA 1HW1A 2ZJPF 3HUGB 1SFOJ 1Z6RA 1ON1A 2Z16A 4BEHB 4ZJZA 4LB6B 3LSGA 5L3EA 3GFIA 3E6MA 1DU6A 3KE2A 1T08B 3CF5F 5LHIA 4OIQA 2V9KA 3HRUA 4PUSA 2RN7A 3A03A 4NUBA 3EUAA 3HEFA 3W3CA 1D3YA 4QTRA 3U21A 3BP8C 1WRJA 1TWHK 4BBSK 3RPUA 2BGCA 2P6SA 2PJRB 2NVQJ 1DCHA 4LK1F 5LHHA 2W1OA 4D0PA 2CW7A 1W0UA 2XB0X 1MSFC 2FRHA 1WCMJ 1O3TA 4NHJA 4E70A 3I5UA 2B9SA 1F5TA 1I50K 2O5RA 4Q5SF 5CHPA 3LAPA 2L7KA 2NVYJ 4E4HA 4G7OF 5EDNA 2KIMA 2XCQA 2HTSA 3FXKA 5HS8A 3ROUA 4BHPA 2A68A 2K9NA 1WJBA 4HX4A 4IPAA 2Q2EB 4KMUA 5DDGA 4X6AK 3QU3A 3DBRB 3A01A 2HXOA 2VUMK 1I3QA 1A31A 3W6VA 3DXJA 5A2QK 1X19A 3HZJA 2R7UA 5K5QA 1J0RA 3K4NA 4I0BA 1IUYA 3RZOK 5E20A 2DO7A 1XZPB 1IL2A 3R61A 2Y0MA 2MLKA 2LSOA 3FKIA 3HB9A 1QPIA 4WWCA 4L9TA 1AB4A 3C18A 1MBFA 3AKZA 3QYFA 2L01A 3COAC 2BEOA 3R6SA 3H3UA 4O3MA 3FWEA 1IV6A 1H88C 1Y1VJ 2A69F 3QWLA 2DMTA 1E3OC 3H0GK 2XSJC 3TOAA 4NC8A 2HDWA 4BY1J 2NVYA 4C9YA 2DJNA 2EFOA 1Y1WJ 1W7PB 2IAIA 1XDSA 4BH9A 4PCQA 1HDDC 1D1AA 1T6SA 2X48A 2KHMA 4GO1A 2MA3A 3N97A 2ZXJA 3OYFA 3CQZC 4M72A 2K40A 3FMSA 1X1PA 1XSXA 1TWAA 1QPMA 2OQRA 1BC7C 1BI2A 3CESA 4HBLA 2X1DA 2PI0A 4JX6A 5FJ8J 3U1DA 1LB2A 1HI9A 1UG2A 3LFKA 2Y0SL 3GTLK 1B72B 2CUEA 1LJ9A 2VLAA 4U87A 4RLQA 3CUQB 1H89C 3CC7I 3GTGJ 4GTFA 4MNUA 1Y1VA 3ONQA 3M1EA 5FLXZ 1R36A 2Y31A 4L18B 3TOBA 2H8WA 2X6WA 3TDUC 3RSNA 3IWZA 4UV8A 5KAIC 4CCMA 1Y1WA 1P9QC 1YLFA 1B9MA 2KIUA 2N8GA 3TQNA 1WQFA 5FFZA 2PMZN 4A3GJ 1TWHC 2K86A 4BBSC 4Q48A 2R5ZA 1R1VA 1BI0A 4XBFA 1Z67A 1FJLA 3CF2A 4GGGA 2CV0A 2W48A 4IXAA 1I50C 2EZLA 1GT0C 1XXAA 1RKTA 1Z3XA 3ZR8X 1W0TA 3JRCA 1WSRA 4BYYA 3FM3A 3MMLB 4X6AC 3GTGA 2VUMC 5IT3A 2LKXA 3S3MA 1I5ZA 5GP9A 1J7KA 1FYMA 1R9TA 2HVRA 3S1MK 3L2WA 1LE8A 3BT9A 5CVJA 1AWCA 2DPUA 2V9VA 4ANJA 1PUEE 4KM9A 3DP7A 3NARA 2VT2A 4I02A 1TWCK 5L3CA 3BZCA 3OYHA 3CMAI 2W25A 4XONA 2XAQA 4XICA 1S29A 3CCRI 2LF7A 1J75A 1SD6A 2DA4A 1IW7F 3C2BA 3H0GC 2PMUA 3MKWB 2PG4A 5E18F 4MQVA 3H35A 3WODF 3Q3QA 2P0WA 1KQ0A 4G9YA 3FX3A 3P9IA 1UFMA 4L9JA 3AG4H 4EM0B 4F52A 3JRAA 1STZA 3S2DK 3KEYA 4OU0A 1OKRA 2K7LA 4O5VA 3HUGA 2EIKH 4BEHA 1I6HC 1KU7A 1ZELA 2A6HF 1VI0A 3H3VK 1YX2A 2DCEA 3BQZA 3ABKH 1O28A 2P5MA 1TLHB 4M3GA 4WXHA 3GTLC 3ERMA 2B7EA 1P7IA 1VFCA 1JKPC 4U7DA 2JA5A 2KLOA 4A3FJ 3K7AJ 4M74A 2XHKA 1A04A 1PYVA 2PJRA 2Y2ZA 1IQ0A 2W85A 2VPRA 4XLNF 5IP7K 2O03A 1MDMB 2JVGA 4IHYA 4EV0A 4BQAA 2ZFWA 3WTSC 2P5KA 1ULYA 2RNJA 3BCAA 1U2WA 1XB4A 1Z21A 3E3VA 4I76A 4HEA2 2QSGX 3FBNB 2MD5A 1PP8F 2OF7A 4LG3A 1YHQI 2Q2EA 2M87A 4E7LA 4IVNA 5EYRA 4Y7NK 4BE2A 1ETXA 1FNNA 1I6XA 1J2XA 3Q0WA 1XZPA 4DYRA 4DDQA 2L9RA 3RQIA 3LAJA 2Y0SA 4DIQA 5LD2C 4WCGA 2HPMA 1VQ9I 4EM2A 3RKXA 4KB2A 3GTMK 1VQ4I 2FA5A 3RYPA 1UZCA 1QZEA 2R7ZA 4Q4ZF 3S1MC 3A0BC 4X1EA 2LOOA 2O9LA 4HF0A 1HLVA 1A6IA 1BIAA 2VE9A 1W36C 1X4OA 3KZZA 2OQGA 3JSPA 2ZXHA 2YU9A 4MQ9F 5B5EC 4HYEA 2EA4A 3LSHA 1XSVA 2KP6A 2NVXK 2JA7K 1W7PA 5L3FA 5J8FA 3W2WA 1WSVA 1TWFJ 4MFDA 3DU6A 1PJ6A 3S1RK 5M3FK 3E5XA 2O8KA 1SFXA 3L09A 3FK6A 2FQTA 1R1TA 2JUGA 3EDPA 1SMYA 2YPRA 3GTJK 1XGOA 4BGDA 5ILUA 3FXJA 4XLAA 2R7DA 5FRMA 3DF8A 1RPWA 4BQQA 2E2JK 1K83J 1S6LA 3BR5A 3SFIA 3S2DC 4G7HF 3OL3A 2W82A 4E7IA 5JLXA 2D45A 1B72A 3BR6A 5FKMA 1FYLA 3CUQA 3CDHA 3OL4A 3TFIA 3OYCA 3QRFF 1OJLA 2LC2A 1BBYA 2DFHA 2WY7Q 2Y30A 3F8BA 5IP6A 3BG5A 4AH6A 3PO3C 3FXUA 1JVIA 2STTA 3I54A 1ZXOA 1N75A 1TWFA 2Y75A 3Q9SA 4ZH4A 2GIZA 5D5WB 4C3HC 2E2IC 2OUMA 1XPPA 4RGUA 1ETYA 1KQ9A 5IT9Z 3PUBA 1GXPA 4HRIA 5DUKA 2JPCA 3H5AA 4M3EA 3S17K 2DOEA 2K27A 2Z1DA 5IP9K 5E8IA 1OCOH 2QEXI 2DW4A 5E3OA 3QP6A 3CQZJ 5BNGA 1K83A 4E7SA 4HAMA 3GTPA 1RKWA 3LMMA 3RJPA 1R5GA 2XGEA 3KZIC 1ORKA 2FBHA 4II2A 4AD9A 3HIFA 3EQLA 4PAAA 2R3SA 4Y7NC 4CGZA 4AU7A 1FLIA 4EJVA 2UV1A 1MMSA 4WJ4A 2QLZA 5J4VA 5ICGA 2GA2A 3K4KA 3A2KA 4XR6A 3WU0A 1W4MA 3S1NK 5D4RA 4EMSA 3G71I 1FSHA 3GTMC 2ZNYA 1YG2A 4OOIA 2XF7A 1VQ8I 2LG4A 2ZFUA 5C44C 1MNEA 4XSZF 2IS4A 1QVTA 2KJBA 1FIAA 1TWHJ 4BBSJ 2JPBA 3BCBA 4M6VA 3V8KA 5EZGA 1MMAA 1GV2A 2NVXC 1F43A 1DU0A 2JT1A 3GTOJ 3HL2A 1V5EA 2R0QC 3S1RC 1TQIA 3MKLA 4LITA 1YW9A 1S8NA 4Y3OA 2CUJA 5HS7A 4C3JC 3GTJC 1MKMA 1XZQB 1H8AC 5JVOA 4X6AJ 2W7VA 4KMAA 4ZDPA 1F7VA 2M0MA 3IH3A 2VUMJ 3CMEI 2E2JC 1JUMA 3PL8A 2XROA 3KZYA 2E71A 1USMA 3B02A 3RZOJ 1JGSA 2WAFA 1H9TA 1HSTA 1W5TA 3MZYA 4EGZA 2OZUA 1BA5A 2B63K 1QQIA 1MDMA 2AHQA 1ZR4A 2ADUA 1CQTA 1IF1A 3V42A 3DKWA 3P5JA 3V7SA 3GTOA 1IRFA 2VJJA 1NK3P 4FX0A 1UB9A 4EATA 3S0XA 1IZ1A 5FKLA 2O8XA 1FMVA 3TO6A 2NVTJ 1IDZA 3MD2A 1IG7A 4IOAF 2KDZA 3S17C 3B6AA 4GZYA 3T0YA 4LLLA 1ZG3A 2LBFB 1U9NA 1MMNA 2DA1A 3ZQIA 5DS9A 4D7NA 3K2ZA 1QZZA 5M5YK 3OYGA 2QGUA 2PEXA 1ZHFA 1N78A 1O26A 3AD7C 3D0SA 3CP8A 4AYBD 2QKMB 2VONA 2M8EA 2JSPA 3HTUA 2M34A 4P5AA 4A3IC 5GTIC 5D5VB 4XLPA 2PN6A 5J8CA 5J4YA 3S1NC 3N0BA 1Z77A 3BC8A 4OIRF 1FP2A 3AD9C 3GW2A 3GFMA 4LJZF 5F04A 1MIJA 3BG9A 2AQFA 1A5JA 3DCFA 3GEIA 3HOYC 3ZQLA 5LEJA 2OV7A 3WTTC 1DUXC 3H9GA 3KP5A 4A3JC 3O6BB 3Q0VA 5GAEJ 3AG3H 1VRQC 1VF9A 5JHFA 4S05A 4BKWA 4G6QA 1XMKA 2CQXA 1QVUA 2XGCA 4XRFA 1LQ1A 1V54H 4IQ4A 4L5EA 2EZHA 1H9GA 2DK5A 1ZTRA 3BG7A 3RTRA 1ZLKA 2M9HA 1G2HA 4MEXA 2IJLA 4Y33A 3TW7A 2PPBA 2QENA 2ZXWH 2UWMA 3CMYA 2JJ7A 1VTNC 3RZDC 4UVCA 3BG3A 4A6EA 2XAHA 4ON0A 3LA3A 4CXFA 4LD5A 3S3NA 2DOAA 2LVSA 4A3BK 1PVEA 5E68A 2PJPA 3OIPA 1TWCJ 2EK5A 3D1NI 5TRDA 1EKEA 1ZG5A 5FKOA 1ZRDA 2EV0A 2HKOA 2L7FP 4AUXA 3EETA 3FISA 3BJAA 3T01A 4CCLA 3FXLA 3IAS2 4S0HB 1FC3A 2VN2A 4XQFA 4FHTA 4JP0A 4BXUA 4JK1X 2TDXA 1X2MA 3BR2A 5LRSA 4UV9A 1VQMI 1W1WE 4XN3A 3LSKA 5J1RA 1T38A 1AKHB 3TEDA 3NEUA 1WJDA 4XKCA 3S2DJ 4XLEA 2CYYA 3V7RA 2EBBA 1TT5B 2Y9ZA 4G7ZF 1F9NA 1QHHD 2CSOA 3DBLB 2RQQA 3FXOA 3OYKA 2VBWA 4OAZA 1USOA 1EF4A 4YIRX 2ECCA 3S1QK 3E97A 1WHUA 4CYCB 1TWAC 4FASD 4G6DA 1GUUA 1MNDA 2M4GA 1ENHA 2OA4A 3LSJA 4DW6A 5EGHA 4A3CK 2FF4A 3GO5A 3WTUC 5FLMK 5IP7J 1ZYRF 2PX9A 3JTHA 3PQJA 1J59A 2BV6A 2R93A 1OR7C 2FE3A 2NRAC 4XCHA 1BW6A 1GE9A 2VOPA 3W2AA 2OU2A 3S2HK 3RKWA 5D4SA 2Y69H 1XXCA 1D5YA 3S15J 1ZR2A 1XZQA 4RA2A 4GYIA 4YIIA 1FX7A 2OTJI 2JA8K 5K1YA 2Q0OA 1UHSA 4RGSA 3CUOA 1D8KA 5FFXA 4J00A 1S3JA 1JJ8C 2ZMEA 3HSFA 3SZTA 4HNTA 4KMDA 2RV8A 4G0VA 5TJJA 4H4KC 2K85A 5CQEA 2ZJQF 5JFEA 2VJ5A 5HLTA 2HEOA 3K10A 4BJ5C 3IL2A 2E2HK 3GF2A 3EPZA 4HA8A 1TW3A 5EEGA 3ZOBA 2E1MB 1MBKA 2DI3A 2LFBA 2RGVA 4FX4A 3HKZL 4BUPA 2GA1A 3BTCA 1SEUA 3PO2K 3LPXA 1G8XA 3BTLA 3GLXA 2HZDA 3WHCA 2VODA 4C2MK 2IW5A 2LR8A 3M8EA 2NVXJ 2M7BA 3GVAA 3GZ6A 2Z9OA 2JA7J 1Y0UA 3IKVA 4MLOA 1K4SA 2M4KA 3DEUA 4DQ2A 2M30A 1Z7LA 5M3FJ 1LKXA 2A5WA 3KFWX 3M8JA 4XKVA 4M9ZA 1LEBA 4CCKA 1Y8QB 2WTEA 1JT0A 2LBFA 1VJEA 2DFIA 3AQPA 1GXQA 2FXAA 4D7MA 1MSEC 3U2RA 1YRNB 2DMPA 1YE9A 2L4MA 5GADJ 2HGCA 3ERED 2GOXB 5EJCA 3AL0C 4A5NA 4E6KG 4ZTFA 3KETA 1ZBSA 3O2PE 3V8JA 2YX4A 1FOYA 4WK8F 4A12A 4GXOA 1BGWA 3ZGKA 1U5TC 2WADA 4C2TA 4YIFA 3S1QC 2ID6A 1JKRC 3HOUC 3BP3A 4AIDA 1D0YA 3F6OA 5LLQA 3HKZN 4ILDA 2RDPA 1OYYA 4OIOA 2JA7A 1NTCA 4A3CC 1XMXA 5K5RA 1NK2P 1O7FA 2F4MB 2KISA 3OY9A 2VKDA 3KYDB 5J1UA 2V6TA 5FLMC 2E5ZA 2M7AA 2UXNA 4AWXB 4OIQF 1IE0A 3VPRA 2M5WA 2O3FA 4KB4A 3GDZA 2XCOA 3JCUC 1HC8A 1H0MA 3MN2A 3S17J 5IP9J 2NOJB 1WORA 2AXTC 4AYBL 1FBSA 3BZ6A 4G6TB 4ZC3A 3OIOA 1O27A 4OMYA 5CVUA 3BZKA 3J81K 1BOAA 3QPTA 3GTKK 1TNTA 4BLAA 1UJ8A 1Q1HA 2D1HA 4EEFG 3W2VA 1K79A 2MFZA 4ESBA 2OTLI 4M6XA 1JUPA 4M9SA 1WZ2A 4GTDA 2ZO4A 3QP5A 1GV5A 3S1NJ 3K70C 1R1UA 2JWTA 4ENKA 3DTEA 2E2HC 3DXJF 3BJ6A 4E7KA 1Z0XA 2CMPA 1MD0A 2GZWA 4KIBA 2QZ8A 4BACA 1ZARA 1OCZH 5LEKA 1QNTA 5LGTA 2IVMA 2GXBA 1X3UA 2ZB9A 1O3QA 4C2MC 4A3MK 2MBFA 3T8RA 5BS6A 2CV2A 1X4PA 1BJTA 2DYSH 1AKHA 3E7LA 1BJAA 4NC6A 4FZBA 2ESNA 4AYBN 3L1PA 5TMCA 4AIHA 5EGEA 3I64A 1V55H 2AS5F 3PFIA 4GTCA 2STWA 2P81A 3GZ5A 3M07A 2CUZA 3Q3SA 1EI6A 2Z2SB
chains in the Genus database with same CATH topology
1R7JA 1Z1DA 2NNNA 5HDNA 1E17A 2EJRA 2DTRA 2XGXA 3Q5FA 3EUHA 2DLLA 5L3GA 2VC1A 4XSXF 1JXSA 4YFNF 1B6AA 4ENJA 1F4KA 1KQ8A 4EM1A 3L9FA 4U0YA 1XCBA 2FU4A 2M1BA 4I09A 1RIOH 2QVOA 4K2EA 2FNAA 2YSRA 2LF8A 2WC2A 1J5YA 1QZYA 1HSJA 2DAOA 1KYWA 4P96A 2PFBA 2A5YB 4ZZLA 3F72A 5E17F 5LGUA 2O0YA 2XKOA 2V1UA 5ERIA 3TGNA 1LDJA 1B9NA 5E1WA 2QM3A 3RPQA 5FLXK 4MHGA 2Z3YA 2GQQA 2CGPA 4BAYA 2Z99A 4R1HA 3SFZA 5LGNA 1WI9A 1B4AA 1IAWA 3K0LA 3GEZA 5HLHA 2EFPA 5D6EA 2VOOA 1KA8A 1U8RA 2A61A 2PQ8A 5BQTA 2PMHA 2GXGA 1ZH5A 2HYGD 1JE8A 3PQKA 3R0AA 3WGIA 2HWVA 4UVAA 3LSTA 2F2EA 3LA7A 1C0WA 3ZMUA 1ZRCA 3DFGA 1QGPA 2O61A 1IN8A 4F7ZA 5CVRA 1DP7P 4BNCA 1P4XA 5AONA 3IRQA 2ESHA 3RYRA 1HBXG 2NAZA 5KVRA 2XVCA 2E1CA 2IT0A 4L9VA 3OV8A 3TKYA 2F5EA 4A6DA 3F8NA 3SQNA 4KYWA 2ISYA 4EJWA 3I71A 5CJ9A 2QQBA 1LNWA 1HW2A 3JSOA 5J6XA 2E7WA 3AAFA 1SMYF 2XAJA 1ZGAA 2FMLA 3NRVA 5D8KB 1XD7A 2VBYA 3JAMK 4HQMA 4KFCA 5H20A 1ZN2A 3KP2A 1ZLJA 4ZYEA 2PBIA 2XUBA 2P5LC 3V4GA 1TW2A 4ZYDA 4MTDA 1TTYA 3FMQA 1MJAA 2HKXA 3GXOA 4TV7A 4ZH4F 2H27A 3ULQB 3CJNA 1I1SA 5ILVA 4WXCA 4MGRA 4PDKA 2EV6A 4WX9A 3J7AO 2NNYA 4L9NA 4OMZA 6PAXA 2D6FC 1L0OC 1FP1D 2H6BA 4RB2C 1R23A 1IRGA 5EEHA 2F5FA 1FOKA 5DCFA 1S7OA 2RC4A 5BMZA 1OYWA 4KN4X 3JTGA 1R22A 3BOQA 3BP8A 2OZ6A 2ZBKA 4LG0B 4JBAA 1YYVA 3VODA 2XIGA 1OPCA 4O2DA 3EYYA 1FZPB 4I0AA 2F5DA 1ZG1A 1ONVA 1TBXA 3TDZC 3L7WA 2EFQA 4ETSA 1IN6A 5LBQA 3P9KA 3P9CA 1Z9CA 5HLGA 1NHAA 3KLNA 2COMA 3WGGA 4CYDA 1XSDA 1DDNA 2IA1A 3EYIA 4EQQA 1XMAA 2ELHA 4HLXA 5DD8A 3FXRA 1MJBA 1HQCA 3IHUA 3IKTA 1RUOA 4HV5A 3WE3A 2XV4S 3MCZA 4GYGA 1MGTA 1T39A 2XASA 2QYOA 1I27A 2IP2A 3H3ZA 4NQWA 3ZN0A 2Z5UA 3HOTA 1P92A 3HSEA 3E5UA 4U0WA 5F6FA 1QBJA 3HOSA 3H92A 4XLPF 2FMYA 4HF2A 2JRTA 1WKMA 1GVJA 4ENMA 1PP7U 2IA2A 5E1ZB 2E1NA 3BJOA 1ZQ1C 5H6QA 1KU9A 1YS7A 3F8CA 4M73A 2FEZA 4U7BA 5FO5A 3WTYC 2GWRA 1U78A 3HYIA 4N9HA 3F6VA 4HQEA 4RGRA 4ZYGA 1P2FA 1TQMA 2HYFA 3KP7A 4NB5A 4KN7X 1ON2A 2A07F 3ZQ7A 4HDUA 3J80Z 3WTXC 4KA4A 1JHHA 1D5VA 1PDNC 1USSA 4HDVA 4UXNA 1Z6TA 2CG4A 3DPLC 1LEAA 1YS6A 4IRIA 4LG0A 3ML6A 2VBXA 2P7CB 3LQQA 4Y17A 4DNCA 4S04A 4B8XA 3VEPA 1TNSA 2HTJA 1HKQA 2DPDA 1F1ZA 4O6JA 3W6JB 2IPQX 2XKPA 4KIFA 1J9IA 5HVQC 2DU9A 1UHMA 1HW5A 1G4DA 5CVIA 2NS0A 4PGHA 1O3SA 5BPDA 4I2OA 1SMTA 2B0LA 1O3RA 4WJ3M 1IXCA 5D8LB 1FSEA 2OBPA 2EFWA 5HDKA 3K1PA 4CO8A 2VBZA 1IN5A 4RGXA 1BN5A 3MQ0A 1IXRC 1L0WA 4IRGA 1LDDA 2A3SA 2EFNA 2HR3A 2CO5A 2LKPA 3M9AA 2BE5F 1EQRA 1R5HA 4RB3C 3FMRA 2ETHA 2C6YA 5JHUA 1XGSA 3ECOA 3QOPA 3RKYA 4YFXF 4LLNA 3V7CA 1RI7A 4HV6A 2WWYA 4KDPA 2K4JA 1G3TA 3MEXA 3I58A 1ZREA 3ABTA 3KCCA 3FF5A 2GAUA 2G7HA 4R8HA 2H94A 4IJAA 3ZP5A 3KP4A 1USTA 4Y13A 4WF2A 4KNYA 2MC3A 4L5JA 2QUFA 1KU2A 2J5OA 2ISZA 5LRRA 1FWZA 2G7UA 4N9IA 4A0ZA 4KMFA 2RVCA 3CLOA 1T2KA 2A68F 5L3DA 5DV5A 1YQAA 4L0YB 4ZZDA 3ISPA 5JI6A 4L0ZB 1YO5C 3V8LA 3WTZA 4KICA 2V1DA 2VXZA 2G9WA 4BHBA 2Z33A 2L02A 3C7JA 3K69A 3GFJA 2BYVE 1U5TB 3F22A 4HX8A 2QQAA 5D6FA 5HS9A 2KRFA 2LNBA 1WWXA 4EVIA 4OIPF 1SD7A 4A2UA 4M9XA 5LHGA 3CUQC 2JSCA 2EV5A 2AXLA 1BC8C 3KP3A 2EWNA 5ICFA 4LGWA 4RB0A 3CTAA 1KGSA 3E6DA 3VB2A 3ZN1A 4P9UA 3G3ZA 2XRNA 1YTYA 2DQLA 4IF4A 3KP6A 4A5MA 1IN7A 5A2QZ 3ZPLA 4ASNA 2HQRA 3I59B 2P7VB 1MZBA 2MH9A 3I53A 3LA2A 2V79A 3QU6A 2EA2A 1I1GA 2OAZA 3BPVA 4CHUA 1OYIA 1R00A 1UCRA 1K78B 4Z2YA 5AIPA 1G3WA 2DT5A 3M7GA 3RDIA 3LQRA 1RUNA 2ZNZA 4MEYF 1BIBA 3I0TA 3E6BA 3E5QA 2YR2A 3BPXA 1OR7A 1C0AA 2Y48A 3CO7C 3IC7A 4WXDA 4L5IA 1SD4A 1B59A 4HX7A 2FNPA 1FYKA 1JHFA 2J5PA 2L54A 3REOA 3P7NA 1TQPA 2CWEA 4MTEA 3WE2A 5CYVA 3R4KA 1OMIA 4Q47A 2X4HA 3U9GA 2M45A 4ESFA 3MZHA 2VT3A 4I98B 2W57A 1WSUA 4M6YA 3HRSA 3WG9A 5E1XA 2P6TA 3F23A 2BBYA 1FPQA 2P8TA 3BWGA 4OINF 3HTSB 2D1VA 1XN7A 2ZKZA 4AVPA 1U6GA 2HQNA 1RZ4A 1U5TA 3BY6A 5ICCA 4RAZA 5DCMB 4EJOA 1BM9A 5H6RA 2X0LA 3BROA 3ZMSA 1P4WA 2K02A 5HLIA 3TO7A 4M71A 1Z05A 3CO6C 2XAGA 1T0FA 5F1RA 1Z91A 2HDCA 2H6CA 2KJCA 3VOEA 2F5CA 3DQVC 1SAXA 3JAMZ 4EJUA 5HOOA 4KMUX 4YG2F 4UNOA 4HF1A 1ZRFA 3I59A 5CLSA 4LLGF 3EQLF 4IHTA 4I7HA 3KEOA 3HHGA 3NQOA 5BOXA 3R0JA 4UHTA 3SXYA 3VFZA 1K78A 3HSRA 4AIKA 3L00A 5CVVA 2MLGA 4CICA 3MAJA 5AIQA 1RNLA 5IT9K 1EH7A 2W24A 1P6RA 1GHCA 1EFWA 2QBYB 5FGMA 1CGPA 2DK8A 3G73A 3K1MA 3RI4A 3GX4X 3T1BA 4EJTA 5E8GA 4P5OA 1S7AA 4JQFA 5FD6A 5ED4A 3GUDA 4Y15A 4U88A 1HKSA 2A6EF 2FQ3A 3HHHA 2UXXA 2FSWA 3R60A 5DD4A 4N0BA 4CDGA 2PLYA 3IRRA 3IWFA 1D8JA 4P55A 2KIFA 3F21A 4RMFA 1YW8A 4QLCU 3JW4A 3L2CA 2CFXA 2GIVA 4U0VA 3ZMZA 1O57A 2RKHA 3HRTA 2RQPA 3I4PA 2NYXA 1LVAA 5DCMA 5JFRA 3MWMA 1FBUA 3K9TA 3F8FA 3T5XA 3HRMA 2MH2A 2ZMEB 2FOKA 3W6KB 2HZTA 1BI1A 4H0EA 3C3WA 3ELKA 2QQ9A 2D2WA 4EGYA 2P5VA 4MEXF 5ICEA 4RS8A 3ZMDA 4IHSA 1U3EM 4LB5A 1YW7A 3DPTA 1E2XA 1FT9A 5FB2A 1G6NA 3C1DA 3SHFA 1G51A 1QO0D 3M8FA 4BHCA 3ECHA 1BI3A 3J80K 3SZPA 4ZYHA 1FY7A 1HKTA 3WU1B 4HZFA 4CZZA 4AIJA 4QWQA 2VC0A 3LWFA 1KU3A 1XDUA 1V4RA 4PZJA 1MJ9A 4PGGA 2UZKA 2E7XA 1SFUA 5DYMA 5L3BA 1CF7B 1O7LA 2LDUA 2QBYA 2DBBA 1G3YA 3D5LA 3T8TA 1IN4A 4I01A 4UVBA 4KUMA 4G94A 3WGHA 2O6GE 2OD5A 1IXSB 4HOBA 4UUVA 2DQRA 3K1NA 4LFUA 1LDKB 1R58A 2HS5A 1ODDA 2JZYA 1YFHA 1DPUA 2XAFA 3GWZA 1G3SA 3ZMTA 3GFLA 4ENNA 1EH8A 1UHWA 5F64A 2ZJ2A 2K4BA 4R79A 1ZAOA 3TO9A 4KIGA 3RIRA 2Q8KA 1EH6A 4LMYA 4GCVA 3OOPA 2L4AA 1B1BA 4RB1A 4YFKF 4A0YA 2YX7A 3WTVC 2L3DA 1L3LA 1AOYA 2V1XA 3ABUA 2QWWA 2HOEA 1P4AA 3QAHA 4OIOF 5JVTA 3ZMVA 1FBQA 3DV8A 2EB7A 3FZVA 3FHZA 3F8MA 5HDGA 4G8XA 2CQKA 1XGNA 2P4WA 1K6OA 3E6CC 2R7FA 3F3XA 1T98A 5D5UB 1W7PD 3O3KA 4A0XA 1ZGJA 3KEQA 5FD5A 4KT5C 3MFKA 3S2WA 1SFEA 4HW0A 1Z7UA 2H09A 2FBIA 3QPHA 2VE8A 5JR3A 2YU3A 3FM5A 3B73A 4FT8A 1V3FA 2IA0A 3KLOA 4B09A 2KKOA 3WTWC 2V6CA 4RAYA 1W5SA 3N4MA 4HLYA 1XCVA 2W84A 4P9FA 1SD5A 5K5OA 1KYZA 1CF7A 1EV7A 2JTVA 2WV0A 3GYHX 5D5XB 1HXDA 2ACJA 5DUIA 3BDDA 1XGMA 1K7AA 1DPRA 5KK1A 4ESJA 1REPC 4IRHA 2CW0F 2ZCWA 2HFHA 3J81Z 4LK0F 1YIOA 2IRFG 3FXQA 2FBKA 5DEQA 3Q9VA 1WQ2A 5ILSA 5BPIA 1HW1A 1Z6RA 1ON1A 4LB6B 5L3EA 3GFIA 3E6MA 3KE2A 5LHIA 3HRUA 2RN7A 1D3YA 1WRJA 3RPUA 2BGCA 2P6SA 4LK1F 5LHHA 4D0PA 2FRHA 1O3TA 4NHJA 4E70A 3I5UA 1F5TA 4Q5SF 3LAPA 4G7OF 2KIMA 2HTSA 5HS8A 3ROUA 4BHPA 4HX4A 4IPAA 5DDGA 3QU3A 5A2QK 5K5QA 1J0RA 1IUYA 4I0BA 5E20A 2DO7A 1IL2A 3R61A 2Y0MA 2MLKA 2LSOA 4WWCA 4L9TA 3C18A 2L01A 3COAC 2BEOA 3R6SA 3H3UA 4O3MA 3FWEA 2A69F 3TOAA 2EFOA 1W7PB 1XDSA 4BH9A 4PCQA 1T6SA 4GO1A 2MA3A 3N97A 2ZXJA 4M72A 3FMSA 1XSXA 1QPMA 2OQRA 1BC7C 1BI2A 4HBLA 2PI0A 3U1DA 1LB2A 3LFKA 1LJ9A 3CUQB 4MNUA 3M1EA 5FLXZ 1R36A 4L18B 3TOBA 3TDUC 3IWZA 4UV8A 2KIUA 1YLFA 1B9MA 3TQNA 5FFZA 2K86A 4Q48A 1R1VA 1BI0A 4XBFA 4GGGA 4IXAA 4BYYA 3FM3A 5IT3A 1I5ZA 1J7KA 1FYMA 5CVJA 1AWCA 2DPUA 2V9VA 1PUEE 3DP7A 4I02A 2VT2A 5L3CA 2W25A 2XAQA 1S29A 2LF7A 1J75A 1SD6A 1IW7F 2PMUA 2PG4A 5E18F 4MQVA 3WODF 1KQ0A 4G9YA 3FX3A 3P9IA 1UFMA 4L9JA 4EM0B 1STZA 4OU0A 1OKRA 2K7LA 4O5VA 3HUGA 1KU7A 2A6HF 1TLHB 4WXHA 4U7DA 4M74A 2XHKA 1A04A 2W85A 4XLNF 2O03A 1MDMB 4EV0A 4BQAA 2ZFWA 3WTSC 2P5KA 1ULYA 2RNJA 1U2WA 1XB4A 3E3VA 2MD5A 1PP8F 2Q2EA 2M87A 4IVNA 1FNNA 1I6XA 1J2XA 3LAJA 4WCGA 4EM2A 3RKXA 2FA5A 3RYPA 4Q4ZF 4HF0A 1BIAA 2VE9A 3KZZA 2OQGA 3JSPA 4MQ9F 4HYEA 2EA4A 1XSVA 1W7PA 5L3FA 5J8FA 3E5XA 1SFXA 3L09A 1R1TA 3EDPA 2YPRA 1XGOA 5ILUA 2R7DA 3DF8A 1S6LA 4G7HF 2D45A 1FYLA 3CUQA 3CDHA 3QRFF 1BBYA 3F8BA 4AH6A 3FXUA 2STTA 3I54A 2Y75A 3Q9SA 5D5WB 4RGUA 1KQ9A 5IT9Z 1GXPA 5DUKA 2JPCA 2K27A 5E8IA 2DW4A 3QP6A 4HAMA 3RJPA 1R5GA 2FBHA 4AD9A 3HIFA 2R3SA 4CGZA 1FLIA 4EJVA 4WJ4A 2QLZA 5ICGA 2GA2A 3WU0A 1W4MA 5D4RA 4EMSA 1FSHA 2ZNYA 1YG2A 4OOIA 4XSZF 2KJBA 2JPBA 3V8KA 2JT1A 1TQIA 1YW9A 1S8NA 5HS7A 1MKMA 2XROA 3KZYA 3B02A 1JGSA 1H9TA 1HSTA 1W5TA 3MZYA 4EGZA 2OZUA 1QQIA 1MDMA 2ADUA 1IF1A 3DKWA 3V7SA 1IRFA 4FX0A 1UB9A 1IZ1A 2O8XA 3TO6A 3T0YA 4LLLA 1ZG3A 3K2ZA 1QZZA 2PEXA 1ZHFA 3D0SA 2VONA 2M8EA 3HTUA 5D5VB 2PN6A 5J8CA 4OIRF 1FP2A 3GW2A 3GFMA 4LJZF 5LEJA 3WTTC 1DUXC 3KP5A 3O6BB 4S05A 4G6QA 1XMKA 1LQ1A 4XRFA 3RTRA 1H9GA 2DK5A 1ZLKA 2IJLA 2QENA 2UWMA 1VTNC 4UVCA 4A6EA 2XAHA 4ON0A 3LA3A 4CXFA 4LD5A 2PJPA 2EK5A 5TRDA 1ZG5A 1ZRDA 2EV0A 2HKOA 3EETA 3BJAA 1FC3A 2VN2A 4FHTA 4BXUA 4JK1X 2TDXA 5LRSA 4UV9A 1T38A 3NEUA 2CYYA 3V7RA 4G7ZF 1F9NA 2CSOA 2VBWA 3E97A 4G6DA 2OA4A 2FF4A 3GO5A 3WTUC 1ZYRF 3JTHA 3PQJA 1J59A 2BV6A 2FE3A 2NRAC 2VOPA 2OU2A 3RKWA 5D4SA 4GYIA 4YIIA 1FX7A 5K1YA 2Q0OA 4RGSA 3CUOA 1D8KA 5FFXA 1S3JA 2ZMEA 3HSFA 3SZTA 2RV8A 5TJJA 2HEOA 3IL2A 3GF2A 4HA8A 1TW3A 5EEGA 2DI3A 4FX4A 2RGVA 2GA1A 3GLXA 2VODA 2IW5A 3M8EA 3GVAA 3GZ6A 2Z9OA 1Y0UA 3IKVA 3DEUA 4DQ2A 2M30A 1LEBA 3KFWX 4M9ZA 2WTEA 2DFIA 1GXQA 2FXAA 3U2RA 2L4MA 2HGCA 3ERED 4A5NA 3KETA 3O2PE 3V8JA 2YX4A 4WK8F 4A12A 4GXOA 1U5TC 4YIFA 5LLQA