3AQOA

Structure and function of a membrane component secdf that enhances protein export
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
221
structure length
221
Chain Sequence
GLRIVLEADVENPTLDDLEKARTVLENRINALGVAEPLIQIQGQKRIVVELPGLSQADQDRALKLIGQRAVLEFRIVKEGATGTTVAQINQALRENPRLNREELEKDLIKPEDLGPPLLTGADLADARAVFDQFGRPQVSLTFTPEGAKKFEEVTRQNIGKRLAIVLDGRVYTAPVIRQAITGGQAVIEGLSSVEEASEIALVLRSGSLPVPLKVAEIRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Probable SecDF protein-export membrane protein
publication title Structure and function of a membrane component SecDF that enhances protein export.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 61
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aqoA01
3.30.1360.200 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3aqoA02
3AQPA 3AQOA
chains in the Genus database with same CATH superfamily
4Y00A 5DG9A 1M90T 2RSQA 2P9EA 2QO3A 5ETPA 1SB6A 5C4JC 5DM7Q 4YDDB 1WTBA 3MMBB 1TU0B 4DSIA 2X1FA 4QIWD 3PW4A 2HVEA 5SUHA 4ED1A 1AYEA 3EICA 2Z30B 1HQUB 4WK1A 2Q43A 2JA8C 3FEXB 1NK7A 3CJ3A 1HI1A 2B9WA 4A3BC 2MKCA 3UNGC 4OHVA 5C25B 1U2FA 3K57A 1C2PA 3ULHA 4CT9A 1QD1A 1L3UA 4O0NA 2CDQA 2DVIA 4ANCA 2OSRA 2J5AA 1X9MA 4X84A 2E9ZA 3BYPA 1WI8A 4XSZA 3LPEA 4C6AA 4AH6A 3PO3K 1DBDA 1KVIA 1NMEB 1JKHB 1TUVA 1YJ9S 1UFKA 5C24B 1EAYC 3VF0B 4NYPA 4OI6A 5D3GB 2ZHBA 3OUYB 4JI1F 2J0WA 1TL3B 1WHVA 2R7SA 2QA2A 1JLQB 3FEZA 3PFEA 1KFDA 2KVQE 1VQOS 4PR6A 1S1UA 2HHSA 3AA8A 4X2BA 4WWSA 3CIZA 3I0RB 1UWBB 5A2QU 1IXKA 4A8SA 1XXCA 1NH8A 1VC5A 4CDIA 3W9HA 2HFNA 4LSNA 1SIZA 4JI7J 2J6UA 1WQHA 3I55S 5DG8A 2H4YB 1JOEA 2X3GA 1JJCB 1JQGA 3TUZC 2HHVA 4DV1F 5IC4B 3HK2A 3OFEA 2DB1A 3MPDA 3Q0AA 2CQPA 3MECA 2ZZMA 3CCJS 1NKBA 1H38A 1WD6A 5BJRA 1EQ0A 1Z2LA 2RAQA 4K2XA 3N0VA 2AEFA 3TI0A 3T5LA 2MKYA 1V5IB 3GEHA 3D1HA 3OREA 2H5JB 4FVCA 2KZMA 2MZRA 1XZQB 2WRMA 1F7UA 3FBEA 3F73A 3BSNA 3DLJA 1CVJA 2BZ2A 5L9XA 4C0BA 4YG2A 4NCBA 4DPTA 4RNMA 3W66A 4OJ1A 4DG1B 2VFSA 2OGUA 4WFBQ 1PYTA 1JLEB 2P5VA 3HXMA 3NNCA 2HGLA 1JB0C 2ACYA 1OQ6A 3DI6A 4X4VA 3ZTPA 4LFAF 1RWKB 2I6WA 1NJYA 3MPYA 3NKYA 1VQ8S 4FF2A 1EI6A 3I4PA 3FQKA 5I3PA 1DFDA 5HI7A 4KKOA 3PYFA 3VGTA 5LL6d 3GJSB 1VC0A 2XSJB 2IJNA 1HNWF 1N56A 1YTYA 5KFPA 2IIHA 1NAQA 2R8GA 3GTKC 2XNQA 1FWKA 3S7RA 5KAKA 2BJ3A 2WVDA 1M5OC 3DDKA 3NG8A 3M4OK 2E5LJ 3T02A 1KSPA 2F3JA 4TYAA 3H20A 1LXJA 1RKIA 4OIRA 2W4DA 2L9WA 4P71A 2PHCB 1OQ3A 3ENVA 2R7OA 4AL5A 3DMJB 2OH2A 3MAAA 4P10A 4MH8A 4USHA 2HQ3A 4USVA 3OV7A 1BLUA 1AUSL 1NPPA 1OSCA 1IS1A 3NGDA 1EZZB 1DQ8A 2ERRA 3EGWB 2DBBA 1HW8A 2IC3A 1LFPA 3TEHB 4C8NA 3D54A 3I0SB 3TVZA 4XTTA 3IGNA 1U6ZA 1IBMF 4Y0FA 1CJKB 4RW7B 3C2PA 4U7UK 4GTBA 2C3MA 2Q3PA 2YKMA 2CA9A 1TWAK 4URQU 4DR2F 3EXCX 1YHQS 2HFVA 4J9QA 4KDDA 2MZQA 4S0MA 1UJ6A 1VDHA 5HBMA 3H25A 2GMHA 2QZ8A 1K8AT 3MM6A 3KLGA 5ETTA 2CFAA 4TVAB 2DXEA 1IW7A 2E5GA 2MDAA 4ECQA 3WX4A 3M8QA 3I5AA 3RBZA 4B3TJ 3VV2B 2ZITA 5M5WK 1KRPA 4CNZA 3TFHA 3W2WB 3HKZD 5A8KA 5E3PA 2DRBA 1YRXA 2CQHA 4GTAA 1U0HB 1S6PA 1U1PA 1R0CB 4MIBA 2YWWA 3LPXA 4R0JA 4AT1B 4OQJA 1TWAA 5B7WA 2QFIA 2EC0A 4I6WA 3P5BP 2QRRA 4K4XA 4NA2A 1VQMS 4RW4A 1W7WA 3CTRA 4DV6F 2R7UA 2MQOA 5FLMC 1RT7B 2RKIB 1TTHB 4AE5A 3BP8C 4NEYA 4P52A 3RAQA 5KT2A 4BBYA 2OMLA 1YJNS 2GX8A 3KUGA 2VBWA 2FIUA 4YY3J 1FE4A 4ITSA 4WZMA 2IM1A 3BPSP 2XWYA 3OT9A 1YSJA 3RTVA 1C0TA 1RLDA 2DNOA 5H9EJ 5KFHA 4RPFA 2XMKA 1QE1A 1YJVA 4OYOA 1WSVA 4RNOA 4PZVA 2FHKA 1UZDA 4DU8A 3V81B 3BPDA 1GEHA 4I1TA 1J5OA 3W9JA 3ZZYA 3T5HA 3E51A 1UEUA 4QOTA 1WJ9A 2EBEA 1C1BB 2LEAA 2RE1A 3FCHA 4O2DA 2ROGA 1R9TK 3D1OA 3AOAA 1ZXOA 3CJ8A 2R9LA 1O29A 1UKUA 4J5OA 2AMCB 3HSGA 2RU9A 4QBUA 1RI7A 1P8GA 4B9UA 2OEKA 3BP3A 3DXBA 3A3PB 3NNHA 2BW2A 2W9CB 1VFJA 4C3JC 3BBFA 3TJ8A 4ECWA 3RG6A 2PI4A 4XDDA 3T9NA 3DDNA 4NLVA 1DD5A 3Q83A 3ITHB 3TQ1A 1RE1B 1LW2B 2F7VA 2JA5C 2IAJB 1NJIT 1VMBA 4DPWA 4DPUA 1HWLA 3EWGA 2DXDA 3R7SB 1R9TA 5IS2A 2JH3A 3RUBL 1T94A 5KFTA 2HHTA 5D77A 4A3IC 1ZETA 3RR8A 1FXRA 1NKCA 1M5KC 1VI7A 1D9DA 2O66A 4D3HA 4LFBJ 5C44C 1FDNA 4CO0A 1FD2A 2PMWA 2XGQA 1H2UX 3OTCA 4LF2A 1R8BA 2AWZA 4UOHA 2CJAA 1RXOB 4QWBA 4N47A 4L3NA 3G8QA 2DNPA 1LKZA 1H7XA 2FJAB 1I50C 2DGWA 4OJHA 3AA9A 3TWZA 2HKEA 2G9OA 2LQ5A 2D3O1 3LH2S 4DPXA 5B0CA 4DUZJ 1NSQA 2ZH7A 2HW3A 2RS2A 2W24A 2AYBA 2D6FC 2FHJA 1T05B 4WF9Q 1YJWS 4GO5X 2ILYA 1VRTB 3AT1B 4J9PA 1O2AA 4N77A 3KUHA 8ATCB 4WFZA 1I6HC 1QSLA 5F41A 1IKVA 1RLCL 4USMA 3H2VE 3IS9B 3IMQJ 5C3EC 2W9BA 1LK7A 3AB2B 3BSAA 1E6YB 5ETRA 1JLBB 3LWMA 2NXNA 4FNIA 1R27B 3M8PB 4DR6J 1SUQA 1JXVA 1WF2A 2ZUAA 2GVZA 1X7VA 2ASYA 4C8YA 2ZDOA 2ZNYA 4QWDA 1X4EA 5M2RA 1N4LA 4TY8A 3D0GE 2AJFE 3R9LA 2XZWA 1AA1B 1VQKS 3TX8A 4OYPA 3DXJA 3TX0A 2AJ1A 4ZVQB 5K8PA 3UVJB 4KGKA 2I5JB 1M5VC 1Y9OA 2R2RA 1U7LA 5IC6B 2AYEA 2FVCA 2W25A 3CSKA 1VGXA 3QYYA 1XMOJ 1F7VA 1TL1A 3EVOA 4KGVB 4P2SA 4Q44A 5C4JK 2YKOA 2HWIA 1XBWA 3QIPA 2QE5A 4J9OA 1EETA 5IYCC 1G7CB 2A68A 2DKOB 2AU0A 1F5AA 1V3ZA 2AV5A 4A3BK 4ZPVR 1B0PA 2MZTA 3LO3A 4F4XA 4RW8A 1X9WA 3P3DA 3M2RB 3MI7X 3HLUA 2L3MA 3AJ1A 4F0MA 3QO9A 1OJ4A 2LDYA 2QA4G 2RMLA 1Y5IB 5KG4A 5A8RA 4IKAA 5T7LB 2NVTC 1H98A 1KEKA 3CT9A 5KFGA 4H4KA 1EH1A 2C3YA 4RU9A 1NSPA 2BJ7A 1NB2A 2ZBCA 1X9SA 3CDBA 3FJ2A 3A3NB 2CKWA 3GYNA 1U26A 2XCAA 3HSJA 4LFCF 1BS2A 1XR5A 3UDVA 2AJQA 3DXSX 3ZNUA 2V0NA 1HQ2A 1RT6A 3SMZA 1VC6A 1FNXH 2B7CB 1BHNA 5T14A 1Y4ZB 2YNIB 3NBPA 3FMBA 3RRGA 2XM3A 3S1RC 2XSFA 1SIWB 3RRKA 4F4AA 5E7OB 2H4WB 4FYWB 4FDFA 5AXNA 2XCPA 3D5MA 1TMMA 2MQ8A 3SSSA 2NUUG 2VU5A 4BY1C 1SXLA 3HI9A 3Q3QA 1TWHC 3W9IA 3DU5A 1F2HA 1NDCA 3UCZP 3AFGA 5K8NA 4LSNB 1F5BA 2GAGC 1CC7A 4RU2A 2XLJA 1N36J 3DM2A 2JEFA 1BE4A 4ZN3A 3BH6B 2GQCA 1HL6A 1KVKA 2PMZD 1T9WA 4DV0J 2CPYA 3OLBA 3K5MA 4C8LA 2KG1A 3OL8A 3GV8B 1YBAA 2Y3PA 3UCUP 3TA1A 4ID8A 2HFZA 3DYAA 3R5DA 5C42A 4TNOA 3VAGA 1Y5LB 2BOPA 4XK8C 1ZM3A 1KR4A 3RW6A 1JVIA 1O8BA 2E5LF 3KLHB 1N52B 2KXFA 3GV7B 1DHMA 1GX6A 2CNNB 3L95X 2MPUA 3R1HA 3GTKK 1SJRA 1NK0A 3BYRA 1DLOB 2AT1B 1MROA 4TY9A 2MQNA 5L9NA 4JI4J 1A9NB 2BE9B 2BKPA 1GTEA 4LR9A 3EQLA 1FWLA 4P5BA 3MAQA 1BD6A 1DTQA 1U2CA 1RTDA 3GV5B 3S8SA 3BQ0A 3NXZA 2OP5A 3U1LA 2HHPA 1VQ4S 4LRDA 1NO8A 2VQFJ 1TWFK 4J91A 4AXIA 3GTKA 2L9NA 3T9ZA 2HHWA 1X5OA 5LMNJ 1IWAA 1FK9B 1WELA 4E2FB 2KRBA 4C0OC 3UDLA 5HJYA 3D66A 3CWJA 2WBMA 1KWMA 5GAHU 2HBYB 4KYZA 3VTIA 4TQRA 1YJUA 4FXDA 1B0VA 2ZUFA 4DX5A 2ILZA 1SMYA 3OSNA 1S72S 4JI6J 2R8IA 4ALZA 4X4PA 4LBIA 3KTQA 2MZJA 3DOMA 3D68A 4ZHRA 5ITHA 1T8EA 1TWFA 5AXLA 4BY7C 3E01A 3PHTA 3UR0A 4LLGA 2D7SA 1EB0A 3LAMA 3TR5A 3KJVB 4B02A 4A8XA 4HT7A 2C28A 1B99A 3MMAA 3AY0A 1NCLA 3LGNA 2HSEB 3H8YA 1ZM2A 4CLKA 3D0HE 2Y0BB 3LOUA 3M8QB 4C8MA 2IRUA 3GJQB 1IQZA 3KNGA 4DBQA 1MWQA 4OFZA 1USMA 4K4TA 2XG8A 2CJYB 1HBOA 3ILIA 3KDNA 2GO8A 9ATCB 4DV4J 3SZ2A 2WVBA 3N3YA 1RTIA 4NLUA 3W5XA 4EO6A 1SVDA 2XS7A 3R7BB 4O3RA 4CT8A 4I64A 1KTQA 2VDIA 4X65J 4TU7A 1EQRA 1I3QK 4Z7YA 4MIAA 4ZLPA 1RAGB 3AD9C 2YKNB 4A3KC 4O3PA 1LNQA 1KOOA 2KU7A 4B9SA 4OYMA 3S17C 2RDDA 5KFKA 2KM8B 3LTOA 4K7QA 3KHRA 4RUAA 3M9MB 3T1HJ 3C16B 2AP6A 2YY3A 3VA7A 3HOXK 5HAOA 3FNNA 4P73A 2K3KA 1TWGK 5EWGA 2RQCA 2G0IA 4DF4A 2WVEA 2BANB 4CTAA 4Q0BB 3J7A1 2CYYA 1U6FA 5E3RA 2FB0A 4GRSA 4QR2A 1HQEB 1I3QA 2MKKA 3NEKA 5EWEA 4Z7CA 1T02A 2DH9A 1QJHA 1WDTA 1RU0A 2HMIB 4V19X 4KQZA 2AIRB 2DHHA 9RUBA 2IHR1 4YMEA 3H5YA 3DOLB 1EHWA 1X5PA 4LQ3A 1LWFB 2JA6K 2MGZA 5J2NA 4JI0J 5GMKa 2CIMA 1CJUA 1VQ7S 3E2EA 4LK0A 1TWGA 2E1MC 3K17A 3KMSA 4BDPA 1PSDA 3NY0A 1H2VZ 3MCSA 2BKOA 3MEGA 3R1LA 3AQPA 1TUWA 4LFBF 3O5TB 3OJUA 2HHQA 1IBLJ 4H4OA 2NUHA 3F0NA 4K0KF 3AJ2A 4KJIA 4C48A 2F9JA 4JI5F 3EM1A 1HI0P 2KT5A 2DHXA 4A3IK 4GTFA 2JA6A 1HQMA 3MEEA 1G3OA 5C44K 3NS5A 2DK2A 2E5JA 1HIYA 1TL7A 4F7VA 2C3OA 3MTJA 1NPRA 2EBGA 2JWNA 4DUZF 4ZOSA 1VRUA 4KIAA 2H5EA 4FYYB 2XNRA 1I50K 1HMVA 1IKWA 5L38A 2E5IA 4KM9A 4F04B 5D0GA 4LIRA 3GIKA 2ATLA 4KB4A 1SH3A 1IUJA 2KT3A 2Y0SD 3OPKA 3SCJE 1DQ9A 1A0OB 2VUMC 3A8KA 1F93A 2MHEA 4JV1A 1TFYA 4HH0A 4DFMA 1PBUA 2Q6CA 1R7IA 1RT3B 1GMUA 4I6YA 1H2TZ 4A3JC 2MLZA 2HIYA 4CO3A 3A8IA 4DEZA 3HJVA 3D1QA 2P2CB 1I50A 2O3DA 2OFHX 4CYUB 1SFOK 2I38A 4OZ3A 2UUWA 3LP0A 1UPMB 3ILOA 4NCGB 4O4RA 4EYIB 5L46A 4F3QA 3R27A 2KO1A 1VBKA 3LAJA 5E3AA 1DZ5A 1B4AA 4F2RA 4Z37A 1EFWA 2WVCA 1IKXA 1VLOA 1DJ0A 4DQIA 2J7WA 1RZMA 1U8SA 1WHYA 4EEYA 2BRKA 1C0UA 1R43A 2GIFA 3B6BA 1XMOF 4PCQA 3DLEB 2BE7D 1Y1VK 1ZYRA 3K5NA 2IYIA 1S9FA 3MMLB 5F9NA 3NOCA 3TP2A 1SFOA 3QLHA 3V6JA 2OHDA 2FGOA 3MMCB 2BXJA 4TY8B 1ZPWX 3PHEA 4O0IA 1OPZA 2LXUA 1QUPA 5KTQA 3M2UB 4GTEA 1MG7A 1HNIB 4X6AC 1S49A 4M8LA 4MTPA 2QSWA 2J9DA 4QIVA 5IM0B 5I3UA 4DWIA 2ZD1B 4WPAA 3N6LA 4QJVB 3L3CA 2R2UA 5IYCK 3S2DC 2C2ZB 5A8WA 1Y1WC 8RUCA 4DSFA 1Y1VA 3HMJG 1IKYA 5KG0A 3AD7C 1S6UA 4TQSA 2VHGA 2W2PP 5FDLA 1YZ6A 4QIEA 3MM9B 5LSRA 3OBIA 1FTCA 2XS2A 4RL1A 1WKKA 1GT8A 1REVB 3CQZK 2B63K 4UOGA 2KYXA 4CO4A 4B3MJ 1URRA 2RRAA 3SV3A 4RW6A 2NLWA 3UI3A 3N28A 3PIOQ 2VG6B 4X4TA 2CG4A 4NXMJ 4ILRA 4KAWX 2JFKA 3C46A 1Q8KA 3TTGA 3QO9B 2YNFB 2CQGA 1HD1A 4F4WA 2VA3A 2F4VJ 2XEXA 1UVLA 4CH0S 3M05A 2YNGB 4USIA 3LQVA 3PRBA 4LIWA 3CQZA 2B63A 1E6VA 1VQSA 4ZPBA 3LALA 2LCWA 5D15A 3OVSA 3TAQA 2EK6A 1BWEA 4BXXC 4ED3A 1N36F 2DJWA 3QT6A 1ZTTA 1S6QB 2VKZG 3D2WA 3IWLA 4KRWA 1XQIA 2R7ZC 2WK4A 2V4QA 3UCGA 3MXHP 1N6QA 4DV0F 1YITS 3V4IB 4KR0B 2GV1A 2JNJA 5IZHA 2RH6A 2IM3A 4Y2KA 4PXCA 5CD4H 3G8SA 2NVQC 3QZ8A 1WOSA 5CYQA 1U1OA 4ID5B 2KI2A 3SCIE 4G1PA 1NPKA 3IRWP 2XMTA 2RS8A 1HR0J 1ZH5A 4ELUA 1DTTB 2B4UA 2PA8L 1ICEB 3GP9A 4DPYA 4YN3B 2DR9A 3FQLA 3FVYA 3FOFA 4ZVOB 2VG7A 1GXUA 1S57A 1CS4A 2C2DA 5C7PA 2FQTA 2IVMA 3LW5C 3J80Y 2G0CA 2CZ4A 4M5NA 3VR1A 3GFYA 4DUYJ 4RBUA 4X64J 3CCSS 3PJWA 3B54A 2HQIA 2PD1A 4RWWA 3KLVA 1P27B 1NDLA 3MM8B 2L41A 1TL4A 1JX4A 1SH0A 3HVAA 2XQCA 4YP3A 2VKRA 1DRZA 3C19A 4AQYF 3MUMP 5HVFA 3O44A 2VQFF 2NZ4A 4F4YA 1S9GA 5HL8A 3V6DB 3C6UB 5K9FA 3BKFA 3NGKA 2FJEB 3QIDA 2N7YA 1U47A 1NDKA 2HS3A 3MR5A 3PNIA 3CCLS 3EVWA 2X3DA 2V5HG 1F60B 2MHNA 2RHQB 4DDQA 4BWMA 1NK9A 4DR7F 3LAKA 4JV2A 4OHXA 2A10A 2RHSB 2F40A 1PIEA 4JI8J 3Q89A 5CYMB 3MZIA 1T9YA 2VD3A 2Z56B 1Q53A 4ECSA 2DEJA 3OLAA 2M88A 3VZHA 1EKSA 2POKA 1LW0B 2ATCB 3CJTA 4RMFA 2MJUA 4LSLB 5HN0A 3A8EA 3I87A 4DFKA 3DHWC 5LXRA 1UPPA 2H9ZA 1S77D 3FKBA 2OEMA 3EGNA 2XCOA 4U67Q 1VIOA 1UFWA 4ZCMA 5A0YB 2OUGA 3EX7B 1N5TA 1XTZA 3DLGB 3RB0A 3J80U 4FBUA 3FKIK 1N5YA 5GMEA 4H4MA 2V4RA 2C22A 1IR2A 2K2PA 1WOPA 3P4UB 4OV6A 3HOVC 1TK8A 3FRYA 3WDOA 2AW0A 3X1LB 3PW2A 4ZLNA 2RT3A 1KN6A 5CCLA 2Y9HA 5IFMA 4DV4F 1RCOB 4IYQA 5HROA 2OJ3A 4X65F 2UUTA 4A3LC 1P6TA 2MQPA 4IG0B 2BUNA 1CQMA 4RZRA 3EUNA 3IR6B 4P2XA 4QWCA 3EPGA 3FKIA 4ZKAA 1U1LA 3S16C 5IP9K 4ENOA 3H4BA 1X4DA 5IP7K 1J98A 1FWPA 2LQJA 4Y6IA 4ZPWR 1NSAA 5HMWA 2RRBA 5KFLA 3CULA 3NGSA 2E7WA 1CJTB 2IFXA 4DQRA 2EBBA 1VK3A 2AF6A 1AB4A 1ACMB 1FX2A 2XGPA 4B9LA 1TZ0A 3H5XA 3G82B 2PGCA 3GFXA 1JLAB 2YKPA 4U7UD 4ED8A 5KFXA 3G9CA 4P74A 3QGPA 1FTRA 3KLIA 2YNHA 5K8MA 5D4OA 2YU9K 4JI0F 1U25A 3HDSA 1BXNA 2R7WA 3KK1B 1NNDA 3DRPB 2MY8A 4EWTA 2UUBF 4NYZA 1S97A 1VJWA 3EXYA 3NOGA 1UEKA 4TXSA 2A6MA 3CJKB 5G0RB 3GTOC 1ZYQA 1IBLF 3IR5B 2QMXA 5IQQA 1KLMB 2PA8D 1QAIA 1TVRA 2AX0A 3ILJA 1FEHA 4MKYA 2UXBF 5CYJA 4DSLA 2Z58B 1S4EA 2FY8A 4QW8A 2YU9A 1SJ3P 4KM8A 1ZBTA 3C14B 1Q86T 5IORA 4KN4A 3P8BB 1FX4A 1HNVA 5J2NB 3J81U 3HPOA 5KOXA 2ZH5A 2G2OA 1XN9A 2V68A 1Q5VA 2IPOB 1C1CA 3I4NC 4UY8T 2E1CA 1NK8A 2ZH2A 3DRSA 2K06A 4OYBA 4OYIA 4WFNQ 1PC4A 3HHLA 4F3MA 4DQPA 2QIFA 1M5SA 5E2QA 2QC3A 3ZZ0A 2EKYA 4USKA 2ZFZA 3KK3B 5J2QA 2R7RA 3ZZRA 3DRYA 4TLRA 4AYBD 2GIQA 3POTB 3N79A 2XMAA 1YWXA 3M30B 1A7GE 1FJGJ 1N34J 1CC8A 2HS4A 2DYAA 1GMVA 2RUSA 4BC7A 1SC3B 3MMBA 4KFBB 5KFVA 2RDIA 3HVWA 3KK2B 4LREA 4RX6A 1P1TA 3L9ZA 4J9RA 1HQUA 1QSYA 2CVIA 1YLXA 1CLFA 1H3DA 4PXDA 3TA0A 2VG5B 3QWPA 1RTZA 3PDNA 1MLAA 1C4AA 5C25A 4FF3A 3G86A 2DIUA 3PYGA 4EUVA 1WACA 5EX3A 1TP7A 1Y11A 1I5OB 1YRTA 1U02A 3C15B 5DGBA 1D8YA 2B0GA 3UD3P 3HX9A 2RDJA 2XCQA 3OQ2A 1RTHB 1JKHA 1CPZA 1HYSA 5C24A 4LBPA 1WORA 2BJEA 3HSDA 5D3GA 3OUYA 1RWUA 1TL3A 2IJFA 3QRRA 1JLQA 4UZCA 1HA1A 1QY7A 1B64A 4OL8A 2W4PA 2KFYA 4BLAA 2QLXA 3KUEA 2R8JA 3PV8A 1ZQ1C 2G0JA 3PO3C 3I0RA 1UWBA 1RA6A 4DSEA 1FCAA 1FRKA 2RILA 3CJ4A 2BM0A 1F9HA 2J9CA 1D09B 5B09A 3DRRB 2CQDA 4AD6A 1PJ6A 3GYGA 2R8KA 1L5UA 4Y2AA 2CVEA 2FHJD 4GVBB 2VJVA 1WC6A 2LVWA 3DKDA 1X4GA 2WONB 2ZH3A 3GTQC 1GK8A 3WX8A 3FSIA 4JI1J 4F67A 5JMNA 1T11A 4DLEA 1R8AA 4G65A 4R5PB 5KFEA 1JLCB 4DQSA 2I8EA 3QSYB 4B3MF 3TNVA 1XZQA 4QW9A 2DNNA 4YFUA 4J9NA 4KPCA 2NCKL 4DG1A 2HVHA 3D6HB 3HULA 1F9FA 2QLWA 1MMLA 5HMZA 2J9DE 1JLEA 2R8HA 2WB4A 4OX8A 4NA3A 3UW1A 2F4VF 3HD2A 2EFVA 1FKPB 5EDWA 4ZVGA 2EWHA 3CGIA 3BKUA 1RUSA 1JJ2R 1J2VA 2F4FA 3M6VA 4OJ3A 3G6YA 2YH1A 3GE9A 2AEJA 4I7FB 3HOYK 3O3LA 1P1LA 3HZEA 3MD3A 3PZPA 4UQGA 4KASA 2HBRB 3T5KA 2XSJA 3D6MB 4ZMMA 1X4CA 1KQ4A 3V2UC 2H65B 5IOLA 4G1QB 3GR1A 1GE9A 2B9YA 3A3OB 5M5YK 1WCMK 4FF1A 1LQ9A 3CDWA 3KNAA 4DV7J 3HOZC 3QPIA 2IVYA 2CWXA 4BXXK 3ZZPA 3BGRB 2DNQA 2ZZNA 3IG1B 5KFJA 1BQNB 2M8HA 4Q43A 3DMJA 4W92B 3US5A 2VIHA 3MCMA 2WAQL 4I67A 1BC6A 3GTGC 3CF5Q 4WFAQ 2XY7A 5IYBC 4WFXA 2LXFA 5M3FK 3HF5A 2JLEA 2HHHJ 1HNWJ 1AB8A 5IV3A 2A6OA 3B4DA 5THWA 3I0SA 1WCMA 2NVQK 3MR3A 2R92K 1CJKA 3RZAA 1KQKA 4RW7A 1Q16B 4KC6A 3GQCA 2V9KA 5KFAA 3OTDA 5A6WA 3OR1B 5IT9Y 3L7OA 1SI9A 2CUYA 4DUYF 2ZBPA 4DR4F 1FXLA 2MYFA 4L6V3 3DLKB 4ZS6A 1GMWA 2IM0A 1VQ9S 2WW4A 3GU0A 2Z0GA 1JJ4A 3VQSA 1T7PA 2DRDA 3W62A 1Q7YT 1GFWB 4K8RA 2YWFA 3W2WA 3SEOA 2DNRA 4E98A 4DR3J 1TWAC 2VPZB 1X4HA 1U49A 1U0HA 4K50A 4YFKA 1N33J 1S1WB 2U1AA 3TUJC 2R92A 2BJ9A 4USWA 4UZBA 4CH1A 1VJEA 5B0EA 4ILLA 2NXCA 4BLGA 1IBMJ 2LKZA 2UV8G 4ZPTR 2ZHOA 2JLFA 1TUGB 1K83K 4LF9F 2Y8WA 3W2VA 2CNKB 3KG1A 3G4CA 4DL7A 4NZ6A 1YBTA 5J1EB 1WC5A 4C3IC 1ROFA 1RT7A 2RKIA 4J9SA 1FXDA 3AOCA 5HVHA 1USOA 2IA0A 4A8YA 3L7UA 3AHPA 1T9TA 4F25A 1TKZB 3H0GC 1VBXA 3MM7B 3ADAC 4RR5A 1WHWA 3VALA 3MEKA 1FFWB 2DISA 2Z2LA 2KXNB 1K83A 5JVOA 3IBFB 2BE2B 2RUGA 4DX7A 1N0UA 3N5FA 4USUA 3EPIA 4I2PB 1VHFA 5TMFA 1ZZFA 2F1FA 1IR1A 2DNLA 2RQKA 4I56A 3BGFA 3NRBA 2CW0A 3HHKA 5DQIA 3V81A 4IQXA 5F0WA 4CCHA 1L0WA 5D78A 4WIQA 4DV6J 4QIWL 3OL7A 1XJWB 5M2UA 1SQFA 3K5LA 5T41A 3ZTRA 5KFUA 3PEHA 1FA0A 3SZYA 4A48A 1RT2B 1C1BA 2B51A 4LF1A 3IWXA 3EJMA 2NXEA 4LRFA 2IDLA 2OPQB 1S0NA 2ZHAA 3I6PA 3UR3C 2RB7A 2W9CA 5HMYA 2XLIA 4A3GK 1RB0A 5ETOA 2DNKA 5FLXY 3ZFVA 1SQGA 4KO0B 2ZZTA 4C3HK 2VFUA 2UXDF 2EI5A 4IOAQ 2K3IA 2MSTA 1FJCA 3ITHA 1R9TC 1LW2A 2KN4A 2IAJA 1FVQA 4M95A 2EEYA 1K73T 3PEJA 4QPTA 4PWDB 2JZ5A 2RQ4A 2YQ3A 3S16K 2JEJA 2Z2YB 3D4JA 1IJFB 2QLJB 4PQAA 2W2NP 2VPYB 2ZH9A 3DGPB 1IBAA 2MXYA 1WKJA 4GTDA 4V19J 4U7CA 4CM0A 2EKNA 4RW9B 2C3UA 3R2CJ 3TFJA 1SC1B 4P6QA 3R5GA 4WYLA 2CQ0A 4YB5A 1OY8A 4KATA 5EX0A 2OPPB 4LQ9A 3H0PA 1HI8A 3H3VD 4NXNF 1ISEA 3LP1B 1TKTB 3NMAA 2KH9A 3MUVP 3I5BA 4IG3B 3GJRB 1FD8A 4GZYA 1MNEA 5E68A 3PR5B 4CIOA 2WAQD 2W8KA 4ED4A 1YJ7A 3F44A 4CRJA 3KFWX 4KGXB 3S1TA 1RBLA 1S1XB 1PJ5A 3KOAA 5H9EK 4Y65A 2JEIA 1NB7A 2IJRA 4AL7A 4MYTA 4ZN1A 4ZVUB 4DV5J 4JP8A 1T05A 1VRTA 1OYDA 2FUG9 2OPRB 2ROEA 3PM9A 3I9ZA 1HWKA 3PXGa 4OIPA 5F0UA 1HPZB 3DHXA 3Q8VA 2HZAA 3PX6A 2I9SA 3IS9A 4HI2A 3IXQA 2QGFB 4FN5A 1E6YA 3BSOA 1JLBA 4FS2A 4C45A 2CQ2A 3M8PA 4UOFA 3N0BA 2BV3A 3GWCA 4CI0B 3RU0A 2KVIA 4LBHA 3BKTA 2GHVC 3GIIA 1FEEA 3S1NK 2ZFHA 4CLWA 4C8OA 4LF6J 2QJ3A 4FBTA 2K1RB 2FZKB 5KT4A 2MZ1A 2J8AA 4B9VA 3UVJA 2LA4A 4MJKA 2I5JA 1N34F 4MFBA 2XC9A 1ELOA 5KFDA 3BGLA 4TN2A 4DN0A 4C97A 3B8HA 2JC0A 3A4TA 1SL0A 5CD4A 2YVSA 5ETNA 2Q1LA 1X60A 4M5KA 3F41A 3SSQA 4TYBA 2CPEA 3GTYX 3DRSB 4JI3F 3CJQA 5CHPA 3N6MA 4XAKA 1ZAXA 2QN6B 3QGGA 4ZVPB 1CBKA 3ONQA 2IBOA 1HKAA 3FUYA 3M32B 1R0AB 1RWWB 1F0XA 4O3NA 2PSZA 1KDNA 1U1QA 4QYZK 2PMHA 3K58A 4LOWA 3TRGA 4WJBA 4FP9A 2YWHA 2CPZA 4KB7A 7FD1A 5DLFA 3EDRB 1YJRA 1OY6A 3OVBA 4PXBA 2E9RX 4OJGA 1FJEB 2HBQB 3M2RA 5LT5A 5KFFA 2HFSA 3CCQS 3KJQB 3S1QK 1PCAA 2ZDPA 4H4KC 2AGQA 3KXDA 5T7LA 3S15K 5ETQA 3A1YG 2UVVA 2ASLA 1UVIA 1G1XA 3HKZL 2FGCA 5E33A 4ECYA 3FZBA 3W64A 1U0SA 3M6UA 3Q86A 3MPUB 3UD4P 4DFJA 3GG1A 4C9DA 3PW5A 2XTJP 2CZ9A 3IBWA 3GIRA 1KD1T 1HYSB 2YNIA 2LEBA 2VL1A 5I3QA 4C8KA 1SL2A 3G2XA 3HFKA 3H7HB 4O3SA 3QWUA 1XMQF 1PGZA 1UFLA 3HXAA 1FDAA 2IRYA 4PWUA 4ERDA 4ED2A 2RU3A 3BGUA 1DY3A 3GTQK 1VS3A 4Q8EA 4GTCA 4C3KA 2OLWA 4ZIVA 4KN7A 3FEYB 2Y1LB 3DCAA 2MB0B 3PIPQ 1JK9B 3RB6A 3QZ7A 1TMJA 2HGNA 4LFCJ 3HFVA 4EMDA 2EG1A 1FESA 1FNMA 4ZITA 3GFZA 3D7SB 4J90A 1F3VA 2ZVSA 1KQGB 1FFGB 2NR0A 1U2RA 3AODA 4LF8J 3FCWA 1F9EB 4CLZA 3JSBA 4BC9A 4KTQA 3QFWA 2NYIA 3GTQA 4BCAA 1JLGB 1HBUB 3U1NA 2XMUA 1AUDA 4IRKA 3SQOP 1RAAB 3H40A 1U6BA 3TO8A 3KLHA 4DV7F 3ZTOA 1M5PC 5A76A 2HQFA 4FM9A 2XYGB 1DLOA 3S14K 2CZVC 3HVTB 3MFIA 2YWKA 3HOZK 4ZVRB 3N4WA 1UA0A 2HHHF 3FFIB 1SC6A 5A6PA 4ZCKA 3HHEA 4QIGA 2JVRA 3QNWB 3M7VA 3RZOK 3GMGA 4KARA 2DTJA 3G6XA 1O27A 1TKXA 3GTGK 3K7AK 5GADI 5IYBK 4K4SA 4OI0A 2GMLA 3Q2SC 1KQFB 2BR0A 4LR2A 2ZH1A 4OMFG 3K0JA 2O5DA 3L7PA 1FK9A 1HWJA 1B4BA 1HBMB 4GC7A 1IE0A 2BDPA 1GXTA 1Y00A 5KT6A 4U6PA 2VONA 1MU2B 3ET6B 3CJ5A 2ZWOA 2UU9J 4DR3F 2VQEJ 1TWFC 4QYRA 2M3DA 5C4XC 1N33F 3P96A 2FZGB 4IDKB 4KHPF 3AH6A 3GTGA 1X4FA 5IQ6A 2V4JB 1WG1A 1FDDA 2VPXB 4Q7AA 1UCNA 4KE5A 2M70A 2ZOGA 3O2IA 3T1YF 4DPOA 3GYXB 5F8GA 3HP6A 4C3MA 5DGAA 3KJVA 3IWNC 1Q8BA 1GQEA 4ZP9A 3GIJA 4U8YA 2CNLB 1YJTA 4DCJB 3UN5A 4OI3A 4PWWA 2CPHA 3G8TA 3KLFA 2FLOA 1JWWA 2E5HA 2ZUEA 1UZHA 2GGPB 3VGVA 1S0OA 4WXOA 5M3MK 2W8LA 4FYXB 1UMJA 4ICLB 3WHIA 2RNEA 4A3DK 4IOCQ 1PAUB 4C3IK 1H0HB 3OTBA 1XK8A 3BQ1A 3MMJA 5J2MA 2NXUA 2HGMA 4LVNP 1UJ5A 2HQDA 1IQ0A 3EVMA 2EXUA 2AYMA 3H0GK 2B5JB 4FZBA 4OLOA 2CQ4A 3W2VB 2CPJA 2B56A 2DXFA 4G7ZA 2ZBQA 2J0XA 1M1HA 2HZCA 3NGRA 1U1NA 4WU3A 1TL5A 1BQMB 3V4GA 1ZS6A 1H72C 2CQBA 2DD8S 2YKNA 1Z4UA 4OV1A 4K4YA 1WEZA 1MMNA 4Y7NK 5HLFB 4HHHA 1VQLS 3D6FB 3C16A 3TA2A 2AEMA 2M5YA 4UOCA 1F9NA 2C2OB 3ETOA 4OX7A 5E0OA 3KJFB 1I3QC 2BANA 1S10A 3H0GA 5KFCA 4Q0BA 4NRUA 3TJAA 1NZ8A 4K4VA 2QL9B 2OSQA 1HQEA 1UTAA 4ELVA 2HHXA 1S6OA 3CXCR 4B08A 4KHRA 2N82B 2BW7A 3TEGA 2HMIA 1I94J 4CZCA 5CQGA 3GEIA 5ADZA 1XNQJ 3HOXC 3JQJA 5F8MA 1VQ5S 3DOLA 5I4MA 4IFYB 2DHAA 1TWGC 2DO4A 2JA7K 1NJZA 1LWFA 2ZM6J 3JYTB 4ZIWA 4WFYA 3VVTA 3S1MC 2H3EB 2ZVIA 5LMUF 2Y8YA 4M5DB 4NYOA 3MHYA 2D1CA 2HK3A 4CO5A 1FERA 5L1KA 2AJ4A 3H42A 2HURA 4Q2LA 2JA6C 4AL6A 4JUZA 1FKOB 1O0PA 2CPXA 4XLPA 4DOZA 3DN9A 4ZVTB 2W7PA 2JA7A 1ZM9A 4GKKJ 1U45A 2XMJA 5KG3A 2HLUA 1VGYA 3SZZA 1Q7LB 4A3MK 5D0RA 5K14B 4U95A 2FYXA 1RHMB 4G1IA 1EQMA 3ZTSA 4PQUB 2N3LA 1N48A 4DV3F 3CVKA 3TOQA 2Z2MA 4OX9J 2Y1RI 2B4VA 4DV5F 2WSEC 3FBBA 2XBPA 4Q2MA 3PG9A 4K0KJ 1AROP 3CB4A 2KXHA 1RBOB 2F9DA 5KFBA 4JI5J 1BGWA 2RJZA 1Q8LA 2CJBA 3PJXA 1M1GA 2HRTA 3KDOA 2FJXA 3D67A 2O01C 2HLTA 2PMZL 3PKMA 3OFHA 2HNDA 4F26A 4U96A 3RBXA 4ECUA 2DNZA 2YQ0A 1RT3A 5HANA 4TU9A 4Y34A 3BQ2A 1W2IA 2BEFA 4DCPB 3VAKA 1XNRF 3GTMC 1RBAA 1B0TA 1VQ6S 4GT9A 3I4MK 2FC8A 1K9MT 3FMWA 3KHGA 1U48A 3BZQA 2ZH6A 2L9DA 3O8WA 2WB1D 4KHMA 4CYUA 2HNZB 5K5MA 4LF6F 1SJ4P 2IA6A 3VAIA 4DS5A 1REGX 3RB4A 3G4SS 1S99A 1D8ZA 3KG4A 3QRQA 4NCGA 2MMYA 1VJQA 2OTLS 4C4WA 2J76E 3DLBA 1BY9A 3MM5B 1DARA 3BF4A 1FE0A 2MQLA 5G4DA 2DR5A 1DAXA 3QT8A 1F6TA 2A2DA 1RK8A 1SFOC 3DLEA 2NXJA 2IYGA 3L09A 4N76A 2GSNA 4DL6A 1KKHA 2BKNA 1FRJA 5KFIA 3QT7A 4ETXA 3SI8A 5DETA 4DR1F 4LMZA 3MMCA 2EC2A 2GAHC 1DCPA 4KGZB 2HVIA 2ZJPQ 1OYEA 3M2UA 1ZOTA 2R93K 1LWEB 1HNIA 1FDBA 4BBRC 5L8RC 3RW7A 4TU8A 1Y1VC 2G1HA 4MFBB 2MKSA 5IM0A 4QQBA 2FVPA 2ZD1A 4QJVA 3IRXB 3ENWA 3TZZA 2GC8A 4NA1A 1DURA 3MGJA 2ROPA 4EU0A 2CQ3A 3MM9A 5AE2A 4WIIA 4M5GA 4OIXA 2VBYA 1HNXJ 2AZ1A 4TKTA 1QTNB 2AQ4A 1REVA 3CCMS 2R93A 2NZCA 2N7CA 3T41A 3JSYA 1CJVB 2NREA 1RAOA 3HHLD 3DGVA 4PPZA 2HQCA 3CCUS 3CJ0A 4A8OA 4WYWA 4DX8H 1GXLA 3PRDA 2YX4A 3VHQA 3UN2A 4LF5F 2R7VA 2VG6A 4NLWA 1U8WA 5DZ6A 2F8MA 4YFNA 4PG7A 2X1AA 2Y1JA 3HM9A 3JB9k 2YNFA 2HWTA 3CQZC 2B63C 2ZOMA 1NXIA 1ZAWA 2YNGA 3RBDA 4ES3A 4J9KA 3D3BJ 1IBKJ 2EFNA 2M8DB 4GFQA 4H54A 5I42B 5F8NA 1FRXA 4OLPA 4KSEB 2V2KA 5C5JA 4I2QB 3IAS9 3BJYA 2KDOA 4HL9A 4NCAA 4DUTA 4OHYA 1SKUB 2M2BA 4OX6A 1Y5NB 2CRLA 1S6QA 4PPDA 1U4BA 5HP1B 3EGZA 3UWTA 3MD1A 1RYSA 2F5GA 3BN4A 4LF8F 4BHQA 3V4IA 3UE2A 1WIHA 3OTEA 3D9BA 2MLYA 1RADB 2P6TA 1WDDA 5HJXA 4K5RA 4KGMA 3WZ0A 2W9AA 3Q23A 4ZPDA 1RT1B 3V6KA 5FJ8K 4ID5A 1RWMB 3QQCD 3MOJB 3NCRA 5F3ZA 4A93C 2E1RA 1VBYA 1DTTA 2LLZA 4OI4A 3RRHA 2YX7A 3PO4A 3U7JA 4OZ1A 1R8PA 4DX6A 3Q22A 4B3OB 3GB0A 1VLYA 1T9XA 3WC2A 1G2EA 1NLKL 4A47A 5E41A 4RJVA 5LJ5Y 1IR0A 3TAMB 3SSRA 2E9TA 4NI2B 3MEDB 2HAIA 2IRXA 3HKWA 3ISZA 3MM8A 3OTOJ 2UZAA 4ZJOA 5SZTA 2Y3YA 3E8OA 4DHVA 2X1GA 1AW0A 2C2EA 3GG0A 1HNZF 3V6DA 3C6UA 1Q95G 5D0HA 4DU7A 3J7Z5 2XULA 2CJ9A 2W1BA 2KJWA 1IN0A 4F8RA 3QAEA 2YBVA 2IBKA 1LV5A 4GMKA 5HO4A 2UU9F 2VQEF 4BLBA 4O44B 5JVHQ 3S0XA 5CYMA 2ZWPA 3PTWA 1SV5B 3C6TB 3W65A 1HWUA 3BN7A 4HEA9 5AE1A 3VAFA 1TKXB 3ZC4A 3EZ5A 4YUDA 2B8QA 1LW0A 3V6HA 4AQYJ 4LSLA 1VQYA 3NNAA 3C66A 2Y0SL 5C4XK 1SJFA 7AT1B 3Q8QB 3AB4B 4ZCLA 1YZ7A 5AT1B 4JV0A 2LXIA 4B3SF 5A0YA 4PUOB 2BMBA 5GAEU 2Q66A 2NSCA 5BYRA 3DLGA 4CWBA 4IO1A 2ZNZA 1HBNB 3K89A 4DR7J 2BACA 1FVSA 3ENQA 3RYLA 4ZDNA 3GTPC 4DL5A 4CH7A 4LJZA 2U2FA 2JVOA 1PKUA 2KZZA 3FSYA 1PG5B 4DR5J 2DGUA 2QT7A 4IO9Q 2JL9A 2NQPA 1WSRA 4HLBA 5A2QY 2K8GA 3CCZA 2MSSA 1RT4B 1YK9A 3R5BA 3FKIC 4IG0A 5GMDA 2FVSA 2B43A 5KG2A 4GO7X 2CQCA 4ZLLA 1XZPB 3PY8A 4N7TA 3KLFB 1UJ4A 2EK1A 1SKRA 1M5HA 5D4LA 4PG5A 1GMWD 1OS5A 1S9EB 3CMQA 1N32F 1T03B 2EFGA 3W8PA 1CJTA 5J2MB 4OHWA 3T6BA 1GTHA 1S1VB 4UY85 2KL8A 4ZA1A 2A69A 5M5XK 3CMES 3A13A 3G82A 2HZVA 2B6AB 3PO2K 5EHHA 1VQNS 5IP9C 1JLAA 5IP7C 1FI4A 1AZSB 4RLEA 3RR7A 1I94F 5ETSA 2VJUA 3KLEB 2QTWA 4WE1B 1XNQF 1NRKA 5B0BA 1RQ0A 2WHOA 2I1RA 1IJEB 3O1LA 3DNCA 1B4SA 2ZM6F 3W8GA 4X4UA 3KK1A 1O2FB 1WF0A 3DRPA 4C11B 1K1QA 5DS7A 1NM2A 3SQGB 2V34A 3JSMA 3IR7B 2X7IA 1IQTA 4I69A 4IFVB 1KQSR 3CJKA 5G0RA 4YB6A 1SC4B 2F65A 3SDEB 1KLMA 3BV8A 3BGOP 2VUGA 2YU9C 2DR8A 3OL6A 5C2CA 1S79A 3S1MK 1JNRB 2A2CA 4NLTA 3G6VA 1LXNA 1U1RA 4WK3A 3U1MA 3W61A 2H54B 4HDGA 4GKKF 4QR0A 3C14A 2G1DA 4F4KA 1FKAF 2RGRA 3K7RA 1QAJA 2GFFA 1FFSB 2YQ1A 3MPWA 4N8NA 3QGHA 3HHLC 3FC9A 2UUBJ 1RTJB 4RNFA 1VBZA 4UTGA 5C2GA 3OR2B 3WC0A 4JV5F 3KMQA 4OX9F 3TW0A 3GILA 5J1PA 4DF8A 4LQYA 1P9QC 2VFVA 2JC1A 3TARA 3KK3A 1S1TB 3OW2R 1RGVA 1NBEB 2D74B 1CQNA 2W4CA 5FD1A 2UXBJ 3KG0A 2P8TA 5IYDK 1XPPA 4B9TA 2VH7A 3POTA 3G71S 4X62J 4QWEA 4EK2A 3M30A 4XSXA 3OXLA 2YTCA 3I82A 1QLNA 3R97A 4ZVFA 2ASJA 2HVDA 4UF4A 4KFBA 1SQEA 1YG0A 3CDAA 3KK2A 1VCTA 4OIOA 4KMDA 2VG5A 1HWIA 3W5YA 2ZC4A 1RCXB 3RAXA 1Q1KA 1NJWA 3H2LA 3GTMK 4MIWA 1RT5B 5RUBA 2QMWA 1J27A 2F8HA 1EP4B 3C15A 4KH0B 2KHCA 1EIYB 1VHIA 3LWLA 4WTYA 3HSZA 7FDRA 1JQWA 1WEXA 2P6SA 1ZPVA 2FJWA 4HACB 1RTHA 4NPOA 4EZ6A 3OFFA 1SJQA 5J2PB 2RF2B 2HNDB 4I4BA 4RO0A 3T6JA 1VQPS 1R6YA 2VC0A 1HW9A 5H9FJ 2YKQA 3HD1A 4KY3A 4B9NA 5GADU 4I0WA 3SFUA 3CJRA 4ED5A 3VCDA 3GTMA 1L3TA 4J7CA 1S5ZA 1NK5A 2BVZA 1Q5YA 3M3YC 3U02A 1HARA 1X0FA 2UXCF 4JYAJ 4EI2A 4I68A 4O4GB 1APSA 3LUYA 2PN6A 3DRRA 1B7FA 1WC0A 4DFPA 3AXKA 1KBRA 1OWXA 1RWNB 2V8HA 4BBRK 1ZZNA 2XY6A 3MDFA 4GVBA 1MWZA 2HNYA 2WONA 4G7HA 4MK9A 1BMQB 1YVFA 2AD9A 2HK2A 2KWAA 2VF3A 1HNXF 4LVOP 4Y3CA 2C3PA 2D9OA 3P6YC 4IH6A 1TWCK 2XHCA 2M7SA 4R5PA 3DLHA 4YR3A 1JLCA 1IM4A 4ANEA 2Q6BA 2B7BB 3HOUK 2AHOB 2DY1A 3WBZA 3GTLK 4C3LA 5FJ4A 3QJPA 3QRPA 1Y3KA 2WOMB 2M0GB 2LU2A 2DHSA 2LA6A 4OINA 4HR2A 1RHUB 2VOOA 4G6VB 1NUEA 3D3CJ 5ETLA 4OI2A 1I6VA 2E29A 4X66F 1FKPA 2YPZA 3TANA 2FJDB 1SBRA 2DNMA 3ZZOA 3R7NB 3DOKB 2GJIA 1TWCA 1NZAA 1IBKF 2JX2A 2BQ3A 3BO3A 1ITPA 4JI2J 4I7FA 4ETZA 2JHEA 4OIQA 4YDXA 3GTLA 5L1LA 2GJFA 2XMWA 2B9XA 4G1QA 1H6KX 2E7XA 4R25A 3TJ9A 4HYKA 3I56S 1AXQA 5DLGA 4OZ5A 3OEPA 4F3OA 3EGVA 3BO2A 3HOYC 3OVAA 2XYHB 1A6LA 3WODA 1YIJS 3BGRA 2GS8A 3IG1A 1BQNA 2VOPA 2FC9A 1Q82T 1TQLA 4R8UB 1C0AA 4PYDA 1PO6A 2NYHA 4KC5A 1XXBA 4CLFA 1RJJA 1NSKL 2DO0A 2L48A 1WCMC 1T3NA 4FYDA 3LP2B 5KFWA 4KB2A 4NL5A 3WIUA 1O26A 5F8IA 3K8VA 4E0DA 3KHHA 1M0SA 1N88A 1RHRB 2JEGA 3HOWC 4A93K 3OR1A 1J6XA 2ZE2B 3CC2S 3TZYA 1BDFA 2E44A 3DLKA 3BO4A 5DZ7A 2R42A 4O23A 2PPBA 2XYPB 3IAM9 2PEHA 1X31C 3T3FA 2NVXK 2ALZA 3OTOF 1Q8IA 5CZVA 4IRDA 3L4JA 2R92C 2E2JK 1V3SA 4EFAC 2O1PA 4A3FK 3THTA 3CCVS 2ZKUA 3BDPA 1S1WA 4A8QA 2E2HK 2N3OA 1NK6A 1W25A 2Y1IA 2V2QA 1N0VC 5JJBA 3ZO7A 4M5MA 2J7KA 1NKEA 1YNJA 4X4OA 5ETKA 4DL4A 1U1KA 2FTRA 3IFEA 2K7KA 3Q8UA 2P9GA 2JFDA 4MQ9A 2NVXA 2NVYK 5J1EA 4DR4J 5U47A 2QLFB 3OL9A 4QYZJ 4FXVA 1HHSA 1HI9A 1TAQA 5IWAF 3CC4S 5TJ3A 3QATA 4G0UA 1TKZA 4M5HA 3AXMA 1K83C 2O5JA 5HMXA 2E2HA 3MM7A 3QT5A 2BOAA 3QFHA 1V6HA 4OZ2A 2E2IK 3AD8C 1CULB 3NUHA 3M1VB 3RZDC 2BE2A 1PYSB 4AYBL 3IA0A 4A46A 4P75A 1WQFA 4J3NA 4I2PA 5IOTA 4MEYA 2HFUA 1KC8T 3FOEA 2NVYA 4LF9J 3NL0A 4A3EK 1MWYA 1EJ7L 1NHKL 3H5SA 4R0EA 1YX2A 4BBSC 4C2MC 2OFGX 3NGTA 3EZOA 2OPSB 3DDIA 5TMCA 2UVRA 4KV8B 3FDSA 2ZH4A 2HPUA 4DR5F 1NK4A 1RT2A 3ERED 2E2IA 4CQ1A 3Q2TC 1D3WA 4A4JA 2XO7A 5GAGU 3TAPA 2DGOA 2GHWA 2OPQA 4MMOA 3GTPK 1WI6A 3OJSA 3U27A 3O6QA 1FRLA 3ZXWA 4P9SA 5J1NA 2DGSA 3MTKA 4ZPCA 1N5SA 4KO0A 4MKVA 4KMUA 1WG5A 1QTMA 1OSDA 3CE8A 4YEAA 4EGLA 4PWDA 5LXYA 2UP1A 1OMSA 2D3OR 1ZTWA 2FZCB 4URSA 5CABA 4A3GC 3EDQB 3G87A 3J7ZT 4A8WA 3GTPA 3DGPA 1X5SA 4PYAA 4P2FA 4K4UA 4C3HC 4CLYA 5KFNA 4RW9A 4M94A 3FHZA 3N0CA 2LQ8A 2OPPA 2JA8K 1YCLA 3LAPA 2ZEJA 1O6XA 3LP1A 1TKTA 4DSJA 2BJ8A 4KT0C 4IG3A 1TFWA 2A6EA 3NAIA 3JQMA 2B8PA 2UXDJ 4A3CC 3TVYA 4QWAA 2SXLA 3SFGA 1BGXT 2LEPA 2VV5A 4F2SA 1S1XA 2CPDA 3BB5A 1RHQB 2MKIA 2NPFA 2GNKA 1KOHA 4ZVSB 3NCPA 1T9UA 2CNOB 3CAGA 1C4CA 1LOUA 1F5CA 1RDRA 4JI7F 2OPRA 2V67A 4YOEA 4NXNJ 2AX1A 4URGA 5CA5A 4NZ7A 1HPZA 4L72B 4F0KA 1S7HA 3I4HX 3JSMB 4IH7A 1FF2A 4P7TA 1YDLA 2E66A 3SYZA 4BS2A 4MAKA 2A18A 1Y10A 3GFHA 3VGUA 1S1UB 4XLNA 3DFEA 1UEVA 5DDQC 1H7WA 2PIIA 2P5MA 1LWCA 2XI2A 2K1RA 2MKJA 4X62F 2GQ2A 2RIJA 4MYUA 3FRZA 1BUXA 3JTOA 2FJBB 1RAJA 3JTNA 5HL7Q 4CLSA 1TR0A 3LGHA 3PR4A 3NAHA 3E3XA 3CJ2A 2WBRA 2J0SD 1RSCA 5E3QA 3S1NC 4NRTA 3J7YU 1XWLA 3MECB 1XC9A 4QU7A 1S48A 3R6GB 3X3UA 5HATA 1K44A 3QBCA 2I2YA 2OAUA 3M32A 5L1JA 2W7VA 1R0AA 4YS2A 3B82A 2J6SA 4B17A 2AJ0A 3KWMA 3MWBA 1AT1B 2XY5A 4MK8A 2FD2A 5LOQA 1FNOA 3QAUA 1QAXA 2HIQA 2B4OA 3JAMY 3DI6B 2LDIA 5EWFA 4QU6A 5IT0A 1Q81T 4M5LA 2P9CA 4ZH4A 5FIIA 1KHWA 4NLOA 2IMWP 3VAMA 2XB2D 3M8RA 4JI3J 4GKJJ 4KKOB 3IM8A 4JYAF 2LP4A 4OYZA 4RNNA 5F3TA 3GTJC 4NEZA 3NS6A 2ABYA 1QVGR 3M8SA 4C0HA 5B0DA 5DO2A 5LSOA 1X5TA 2CDRB 3S1QC 1RYRA 2OEJA 3IGVA 4L76A 3S15C 3M3YK 2HRYA 1RAEB 4EZ9A 3T5JA 2OD6A 4XPEA 1UETA 1XERA 1UAWA 2CADA 3MR6A 3JS9A 3MAAB 3RGIA 4RKUC 4Q4ZA 5LSLA 5F9LA 4B3TF 1YI2S 3CUNA 1CSJA 2VBXA 5DJBA 3BSCA 2IC3B 3EYZA 5DM6Q 2C2KB 4CLLA 2V2VA 4K59A 5BXIA 4NASA 4IOBA 4DV2J 5KG7A 3TQEA 2DCLA 4DL3A 5KG6A 3T01A 5CHCB 3H98A 1H74A 3GLJA 2W01A 4NLPA 1HD0A 4ED6A 3IP0A 2YKMB 2HNYB 4FKYA 3IPJA 3NWGA 4QR1A 3UFCX 4CLUA 4JI2F 2RD5C 3JAMU 2LFVA 4Q5SA 3V5RA 1XMQJ 2DPIA 3FCVA 2GMJA 3G4AA 2KG0A 2J7UA 5CZXA 5HBMB 3C3LA 2EFQA 1UWAA 3MM6B 2EPIA 3KLGB 2CFAB 1SKWA 3M2VA 3M8ZA 2CG8A 1XXAA 1JLGA 1HBUA 4YY3F 2XWXA 2VFRA 4PG8A 1T95A 5K20B 3NGUA 1M1KT 1IWGA 5A8KB 3B4MA 2KFZA 1JXLA 4M1XA 2DNHA 5FLMK 1S6PB 4DZDA 3TZXA 2VZ9A 1UW9A 4FXWA 4WILA 4ED7A 5EGEA 1U24A 5B08A 2L08A 4RW4B 4RUHA 1RAFB 3MAHA 3GZ7A 1O2BA 3HVTA 4PKDB 3UPFA 1GAOA 2V8DA 3ELHA 3FFIA 4EBDA 1W26A 1N5VA 5KFZA 4NMXA 2GHPA 1N8RT 3CCWA 2QEXS 4LF7J 2G2ZA 4ILMA 3I96A 1JIHA 3NCQA 3SXLA 5ETMA 4P7VA 4P72A 3PACA 3R5JB 3IM9A 3S14C 3GEEA 2F63A 2G4BA 1C0TB 4ZVHA 3H3VL 2GVDA 1VYAA 3VQTA 2LQ9A 3MFHA 2CWKA 3N9UC 3SIPB 5BYQA 1HBMA 1QE1B 2GA7A 1WQGA 5EGHA 1SCJB 3RZOC 1PYOB 1MU2A 3HOWK 1OY9A 3R6LB 3ET6A 1N54B 3K7AC 1Q0NA 1J5OB 2FLLA 4O3OA 1Q4RA 1N5QA 3ICLA 4C3JK 3GDZA 4L74A 4G3IA 2CAJA 4IDKA 4YQWA 4B3RJ 3VZIA 2V4JA 2DIVA 2KHDA 2BX6A 3PX0A 2FDNA 3D28A 2JA5K 4YHHJ 4DN9A 5AE3A 3RBEA 3K2YA 2LQBA 3BR9A 3NS7B 1DCHA 1O24A 5B0AA 3D0IE 1QVFR 4WP9A 3SCKE 4FVMA 4ECXA 3AH5A 3RB3A 1DQAA 2GGPA 5B0FA 5LJ3Y 2QG9B 1OO0B 5L1IA 3CW2C 4DQQA 3N6NA 2D3UA 1EARA 2Z4PA 4OZ0A 2WTFA 4ICLA 2PDAA 3SV4A 3BH7B 2EFPA 5M2PA 4MT1A 5DG7A 4N8OA 1D9AA 3AOBA 4EO8A 5D6GA 3VWSA 4KHPJ 2IDEA 1WG4A 3CDEA 2EVZA 4F4ZA 2JA5A 5CAAA 2UV8A 5HVGA 2A0FB 4K4WA 1RWVB 2ZUGA 1L3SA 1RA7A 1YNNA 1EKRA 2CJXB 3T1YJ 2B5JA 2QA4S 4ZK7M 4Q5VA 4LR8A 2KB2A 2AZ3A 3W1YC 2KM8C 4A3DC 1BQMA 3HT0A 2DPJA 2KYZA 3RZDK 3OD2A 4KBIA 1SH2A 3ZZZA 1BWVA 4OYWA 2N4CA 3R2DJ 4USTA 5HLFA 4KMAA 1INNA 1S59A 1PBAA 3CC7S 3MF5A 1YBUA 2MKHA 2J8SA 3ISND 4BBSK 4DR6F 4C2MK 1NHUA 3QSIA 1XIQA 1I6HK 5C3EK 4FS1A 2D41A 2AGOA 4NLXA 3W60A 4NWBA 2IMOA 1RP5A 1EK8A 4Y7NC 3V4MA 2DGTA 2BABA 5IT9U 2ZKTA 4J9MA 2GSUA 1P9YA 1T0TV 1IBCB 2MLXA 4ED0A 3FK4A 4IFYA 2B4PA 4IH5A 3JYTA 4TLQA 3PCOB 2MQMA 1IKVB 4C2MA 2W9BB 1FHTA 2FPHX 3KHLA 4GTLA 4M5DA 3SCLE 5H1SV 1SUQB 2GVZB 2KTQA 1O51A 3Q8SB 1F1BB 1WTFA 3B78A 2JA7C 3I31A 4JB8B 3D6TB 3GONA 4HI1A 2D3ZA 1FKOA 3TYTA 3P45B 3PVXA 2D9PA 4AUKA 1NU4A 2AKWB 2B3TB 1U1MA 2X51A 5AXKA 4UUWA 3VGSA 4FYVB 3ZZUA 5K14A 4Y52C 2FQQB 4PQUA 4NLQA 1TL1B 1X4BA 3HJFA 5CH7B 3TUIC 4A3CK 5LMUJ 4LR7A 2OO4A 4F36A 2XZTB 3QIPB 1PILA 3PW7A 1NEEA 2QMUB 4DSKA 1EETB 4X4QA 3PW0A 1ZM4A 2HQGA 4M1KA 1UVMA 4F50A 2QL7B 4A3MC 5EN1A 2NVTK 3NMRA 1G6BA 4J37A 4WP3A 1JLFA 4RW8B 4EBCA 3JQKA 4NE9C 4ZVEA 4AFFA 5EGYA 4ER8A 2PT0A 5D4DA 2V8PA 1HFEL 3UNYA 1V5VA 1KP6A 1ZAVA 2QX0A 2KKHA 4B9MA 5A8RB 2K7JA 3CD7A 2H5IB 1UV7A 2LYVA 5AXMA 2M52A 4DV3J 2HNZA 1L3VA 4IR9A 2KJVA 4RUBA 3S1RK 1ZA2B 2GJ2A 5HQLA 3M8YA 1O28A 4HHUA 2HRUA 4X4NA 3MM5A 4LRAA 3I4MC 5FLXU 4BY1K 3TUPA 1TWHK 1RT6B 4WBFA 5IOSA 1HLWA 3OPFA 2IVFB 3NBPB 4A8KA 4J9VA 3CD5A 5ETVA 4X4RA 4CLTA 3H2UB 1XEZA 2R7QA 5L39A 5GAEI 1XNRJ 2FHMA 2Q79A 3N01A 2DITA 2WVFA 1KONA 1DCOA 1UA1A 2VA2A 2EFOA 2V69A 2PC6A 1Y0HA 1LWCB 1LWEA 1G4CA 4OYAA 2QYGA 3VVUA 5DRKA 2QSFA 2DNGA 2XZDB 4NZ0A 1TWHA 1Z2ZA 2QFJA 3IRXA 2H51B 4WCEQ 3T19A 1TK5A 3DM2B 2VICA 1X4AA 1FT8A 3T00A 4W4MA 5AJ3J 2DEIA 5DDPC 2R93C 4GKJF 3FSXA 4JI4F 2VC1A 1ZBSA 4W98A 2VASA 2LU1A 2HVZA 4HTIA 2I0XA 1D0EA 3M6WA 4DR1J 3RJMB 3W63A 3DYAB 5C42B 1IVZA 1CJVA 4EBEA 3QX3A 4HT5A 3L4KA 3QJJA 3W3SA 4LK1A 3M9NB 3IN5A 3CMAS 4WJ4A 1WOOA 4NX9A 4J9LA 2WCXA 3GTJK 4Z2XA 1MN9A 2RRNA 1LEOA 1FRMA 4CP5A 2BRLA 5LMNF 1S4FA 1WKLA 1YRUA 1RWOB 4LRBA 4Y2CA 1VH2A 2V2ZA 4YB7A 2ALYB 5D4PA 4LJMA 3CD0A 1MROB 4USJC 1WNEA 5I42A 1GX5A 3NLCA 5DDOC 2VFTA 4I2QA 3LANA 2V6TA 1DTQB 1RTDB 1I3OB 4JI6F 3MCNA 1MW7A 4F0HA 4DV2F 2HG4A 5KOWA 3GTJA 3TZWA 5LM7E 5E5NA 2YX1A 3ZNJ1 4DI6A 1WEYA 1K0VA 4LF5J 5HP1A 4PG6A 5BR8J 2PEBA 1Z1ZA 2HAFA 1KLNA 1NHVA 3UQSA 1F3FA 1CG2A 2CQIA 5IOQA 3Q24A 3ETMA 4BY7K 2C2MB 3MCOA 4KPYA 2BBEA 3PO5A 1S0VA 1RT1A 2GZOA 2D69A 4ZCIA 3MUTP 3P5TL 1LK5A 1T3OA 4HH1A 4FPIA 1H73A 3S2HC 2RH3A 4NMLA 1JMTA 3DOMB 4ZHRB 3CCRS 2CJQA 3E01B 2PA3A 5HSPA 4B3OA 4OZNA 3NP5A 1YGYA 2A1BA 2CFXA 3ISNC 4XDCA 3MMAB 1X8DA 4N5SA 2C2RA 2BA9A 2QA1A 3TAMA 1WUUA 2MZSA 1QM9A 1WHXA 1RACB 4LF4J 1WC1A 4NI2A 3UD5A 2CQ1A 3J81Y 4WZQA 2HS0A 3MEDA 2NS1B 1CEZA 2UUCJ 3M2VB 4PEOA 2OKQA 1BQXA 2VBZA 3T1HF 4LF7F 3AQOA 1VIXA 4CO1A 4RBTA 3CO9A 2CXEA 1VRQC 4A3KK 1OPIA 8AT1B 2CPFA 1HBOB 3S17K 1RHKB 1ULRA 4G7OA 4K2JA 2ADCA 2E1PA 1RTIB 1UW4A 3R5AA 1R31A 3H5UA 1XR7A 4K4ZA 1TKDA 2OTJS 1R8CA 3GCWP 3P49B 3CIMA 3VAHA 4WP8A 1B70B 2HHUA 4O44A 3KJNB 4CM2A 2O5IA 4XIUA 4B3RF 3GPAA 4WU2A 1I1GA 1SV5A 3C6TA 4DJBA 3DLLQ 2V63A 1FO1A 2V94A 2HEKA 5D8HB 2AYGA 1XR6A 3I5CA 4LUBA 6FD1A 2BM1A 4UT4A 3EMTA 4YHHF 2GSOA 2JLGA 4DS4A 3Q8YA 1KVJA 4N56A 2MY7A 4CTAB 3W7BA 4LRCA 4QPXA 3FBFA 2DCUB 2GVDB 1HNZJ 1TV6A 5KFOA 4DCOB 1SPBP 2V8GA 4PUOA 2R7TA 5KFSA 2COLA 2V9WA 1D1UA 3J7AN 4FF4A 4NOHA 4J9UE 2PO4A 5MAOA 4ZP8A 3M8WA 1HBNA 3EZUA 2MGZB 3MR2A 4ILDA 2V6SA 2OMOA 2DY9A 2WB1L 2ASDA 4DL0C 1CJUB 2VODA 4Y2MA 1Y3JA 2RVJA 4QZVB 4ES1A 3CO0P 5F8JA 2MJNA 2PFDA 2BJ1A 3JTPA 3MEGB 1QDUB 3MURP 4PABA 1SL1A 2DH8A 1RT4A 1D9FA 2W2MP 4H4OB 1O5JA 2E1AA 1Q79A 3AJDA 4ZJLA 1J5EJ 4YR0A 2R3VA 1XZPA 3BS9A 1JJHA 4M5IA 4WTOB 2MTLA 5KT5A 4B3SJ 4D3GA 3AAWB 2DGVA 2YKAA 2GQQA 1FRHA 4FKXA 2G13A 3MEEB 2ZBIA 1B7YB 2YWGA 1S9EA 4YR2A 4WXWA 1LWXA 1RU2A 1T03A 5CJ9A 1TL7B 2M4MA 2VUMK 4NLSA 4CO2A 1HHQA 3OXFA 1S1VA 1VRUB 4KH1B 2B6AA 2DNYA 1AZSA 1HMVB 1IKWB 4HHJA 2NSBA 3A12A 3SBMA 4A3JK 5BYSA 5CCMA 3KLEA 4WE1A 5KFRA 3ZTQA 2V6UA 2A3JA 4A8FA 2ZH8A 2UUAJ 4Y2IA 1YQHA 3K5PA 4C11A 4DXLA 1O25A 3BREA 2APOA 3PO2C 2VUMA 3SQGA 2YPYA 2GIRA 4PAAA 1N32J 1V3RA 4IFVA 1QSSA 2PFFB 1SKSA 1K47A 5KT3A 3SDEA 1S0MA 1T9VA 2QYCA 4Y28C 1TK0A 5JVGQ 5KFYA 5CXTA 1WF1A 2E7VA 3LP0B 2ZOFA 3OXGA 4ECRA 1ZA1B 1F2GA 4A8MP 3OFGA 4JOUA 3BBBA 4FNHA 3M6XA 4GC6A 2YH0A 1IKXB 3FZ2A 4X6AK 1C0UB 4EYHB 4NLYA 1EX8A 1RTJA 3OHBA 1RAIB 3OR2A 2WZ1A 5JUMA 4M63A 2LMIA 3Q8RB 2V8VA 4IQMA 3S2DK 3HCXA 3K5OA 3QLHB 1Y1WK 2KT2A 4UUXA 4Y52K 5K8OA 3A8JA 2ADBA 4NLDA 3UN3A 1S7IA 2X1BA 5KT7A 1XMBA 1S1TA 2XI3A 1VR6A 3L4BC 1PJ7A 3TFIA 1KTVA 2H1YA 2FJVA 4C8ZA 3LA0A 3CNQP 4YFXA 4DDFA 3PKYA 3G96A 3CEDA 1WC3A 2Z2ZA 2R7XA 4NLRA 2QLBB 5I3UB 3FBCA 3GSDA 4NXMF 1LFWA 2W7AA 5A8WB 3CCTA 2WW8A 2XLKA 4DL2A 1IKYB 5KG1A 3WQPA 3PFOA 3ILLA 2V50A 2YXLA 3EE3A 4IRCA 1J6WA 1G51A 5FDLB 4DV1J 1TAUA 3CCES 4QCLA 1R0BG 1Y1WA 1J6VA 4JV5J 5IYDC 1UVKA 3TVKA 4MK7A 1MMDA 1K0TA 1JNZB 4MKAA 3GIMA 2EW9A 4F02A 1RAHB 1RT5A 1UVNA 1RISA 3S01A 4XPCA 1EP4A 2OIHA 2C42A 2OD4A 4RW6B 4XCHA 4JBCA 3VAJA 2B9EA 1JLFB 4HACA 5D0EA 5J2PA 2RF2A 3CPWR 3J81j 3UO0A 3HFZB 3HHDA 4ECTA 1IM6A 2BYCA 4LFAJ 4KMHA 4FPRA 1Y7PA 3IBCB 1RHJB 2QV6A 2J9EA 2FHOB 1PC5A 2AJ2A 3PYDA 3R8YA 1S12A 2HWHA 1NDPA 2R7ZK 2ZC3A 1E6VB 4E8UA 4IR1A 4UW2A 4BWJA 4MKBA 1HR0F 5MLCV 2OELA 3M4OC 2MQQA 4O4GA 1Q78A 2R2SA 2R4FA 4G0VA 3GSIA 5GAGI 5B0GA 3LPYA 3HO1A 1YKWA 2IY5B 1VISA 3JXOA 1AFJA 2DGXA 3QGIA 5AJ3F 2ACMA 5JFEA 1WC4A 3GR0A 1MSWD 1N6QB 3BM7A 4PG4A 4G0WA 3JSRA 2FLNA 1JXEA 4X64F 2R7ZA 4LT6A 1VOMA 3THVA 1R3NA 6FDRA 3KKFA 1HHTP 3HHNB 2KRRA 1KNZA 4OZLA 2R2TA 3M9OB 5CYQB 1FJ7A 1NH7A 2FVRA 2UXCJ 2WOMA 3OHAA 3BEGB 4WKYA 4PXEA 5D4NA 4LSZB 4O3QA 1TWCC 2VG7B 4RBVA 5IXUA 2GO9A 3PRVA 1CS4B 2AGPA 1IL2A 1ZVUA 3HOUC 2WSCC 3DOKA 1RWPB 4NOIA 3FGVA 1GH8A 4QIFA 3CDUA 3GTLC 2GCFA 2BQRA 4PRFA 4DR2J 2A6HA 1RABB 1KHVA 1UL3A 2YWEA 2DHGA 2N4DA 5DQGA 5IT4A 3Q8PB 4JI8F 2FVQA 2W2OP 1PAEX 3BR8A 3MOZA 2IM2A 3QJLA 4ANDA 5EUHA 2GW8A 1QUVA 2XO6A 3T1AA 2VPWB 1WWHA 4KAIA 1W2BR 2QL5B 1SJ1A 4NLGA 2PI5A 2JJ4D 4W90B 5BR8F 2BE5A 2VB6A 1UVJA 1S76D 1S9GB 4ZP6A 3ZZTA 5H9FK 2W2QP 1QAYA 2HYIB 3WIVA 4X66J 5GVQA 5F8HA 1KS2A 4R8UA 2ZJRQ 4BKWA 3ENAA 4V1Ak 2XS5A 1U09A 3QMQA 3R5CA 3LP2A 4U9RA 2M9KA 2HFOA 4ES2A 3KYLA 4JK1A 4ELTA 3UDCA 3BDEA 4P2MA 2DR6A 1VK8A 4C7QA 1B3TA 2XMMA 4ZJQA 3THPA 1RU1A 3HOVK 3S2HK 1KFSA 2ZE2A 1I6JA 4LF4F 3M4XA 4HVZA 2UUCF 5E3CA 4YB1P 3MPVA 4UQTA 1OIAA 4A3LK 1NJXA 2BQUA 1N5YB 3MR7A 2WSFC 4OHZA 2XMVA 4H4MB 4DZ6A 2UVUA 3J7YI 4RUCA 4L73A 6AT1B 4CNYA 5DDRC 1AFIA 4HDHA 3GCXP 5KFQA 3K59A 2JRSA 3JSTA 5HROB 2ZJQQ 1R6VA 2NVXC 2CPIA 3N5BA 4MEXA 2RQMA 2DRAA 3I9V9 5HQMA 5DQHA 4ZPAA 2E2JC 4HTJA 2H48B 2Z8QA 1RWXB 4A3FC 4OI1A 1TELA 2DH7A 3S6EA 2Z57B 4L75A 2E2HC 4Q45A 4DLGA 2W7OA 3PJ9A 1V9OA 3GJTB 4I6AA 3K8WA 3UDEA 1R89A 2JOQA 3F56A 5HQ8A 3R3TA 1BJTA 5F8LA 3NWRA 2FQOA 3BUEA 1I51B 1GNKA 2NVYC 2F8EX 4L3KA 4OZJA 1CULA 2UVWA 3M1VA 3BBCA 2MEWA 2DR7A 3HZGA 3G6ES 3H90A 3CJSA 2O67A 2EG2A 4X4SA 2FY1A 3OSPA 3GTOK 3LF0A 3KLIB 2YNHB 3H59A 4ECVA 3PYEA 3I32A 2OPSA 1RKJA 2JDJA 3HT3A 4M5JA 4IUFA 4K5SA 2E2IC 4KV8A 5IWAJ 2OI2A 5KFMA 2VDHA 4FZVA 4ZP7A 1UP1A 2BJDA 2V6AA 4Q8FA 3LGMA 2CJKA 4U8VA 4A3EC 1R8HA 4C98A 2J0QD 5GAHI 4DMZA 2HBZB 3W5ZA 2C1EB 1X0PA 5HK4A 1TV6B 4WJ3M 1TVRB 1J5EF 4AXJA 3I4NK 4HKQA 3GTOA 4OYXA 3DC2A 1FRIA 5JXSA 2ZBRA 2P8IA 3RAMA 2DT9A 1URNA 1FJGF 1MN7A 2C2NA 2XHWA 2KFNA 1HNVB 3HVRA 3IO1A 3PX4A 4WKRA 4XO0A 4RNHA 3H4DA 1C1CB 2DGQA 1K1SA 2JSXA 5KG5A 4ECZA 3C8YA 4CLPA 2FLPA 3CD6S 2J6TA 2PE8A 3HHLB 4P5AA 2XCRB 4ATNA 5IV4A 4ZLJA 2LECA 4RWXA 2NPIA 3DU6A 5J2QB 2UUAF 3DRXA 2G2YA 1L3KA 4GVLA 4N41A 3IC1A
chains in the Genus database with same CATH topology
4Y00A 3GFYA 1N48A 5DG9A 2VZ9A 4RBUA 4DV3F 1M90T 3CVKA 3TOQA 3CCSS 2RSQA 2Z2MA 2P9EA 3PJWA 4FXWA 2Y1RI 2QO3A 4ED7A 2HQIA 2PD1A 2B4VA 1SB6A 1P27B 4RWWA 3KLVA 4DV5F 5EGEA 3MM8B 5DM7Q 4YDDB 2L41A 2WSEC 1TL4A 1JX4A 1SH0A 2XBPA 1WTBA 3MMBB 1U24A 4Q2MA 3HVAA 4DSIA 2X1FA 4QIWD 5B08A 2L08A 1AROP 3CB4A 3PW4A 4YP3A 2VKRA 1DRZA 5SUHA 4ED1A 2KXHA 4AQYF 4RW4B 2F9DA 4RUHA 5KFBA 3MUMP 1HQUB 3MAHA 4WK1A 3GZ7A 3O44A 2VQFF 2Q43A 1BGWA 1O2BA 2NZ4A 4F4YA 2RJZA 3FEXB 1Q8LA 3HVTA 4PKDB 1NK7A 3UPFA 2CJBA 3CJ3A 3PJXA 1HI1A 1GAOA 2V8DA 1S9GA 2C2RA 1K8AT 2FJXA 2B9WA 2MKCA 2HLTA 2O01C 3FFIA 3UNGC 4EBDA 3V6DB 1N5VA 3PKMA 5KFZA 3C6UB 4OHVA 3OFHA 2HNDA 5K9FA 4F26A 5C25B 1U2FA 2GHPA 3K57A 3NGKA 1C2PA 3ULHA 2FJEB 4CT9A 2DNZA 3QIDA 1RT3A 4TU9A 4ECUA 2N7YA 4Y34A 1L3UA 1N8RT 3BQ2A 1U47A 2HS3A 1W2IA 3CCWA 3MR5A 2QEXS 3PNIA 3CCLS 4ILMA 3I96A 1XNRF 1JIHA 2CDQA 2V5HG 3NCQA 3VAKA 1B0TA 2DVIA 1VQ6S 3SXLA 4GT9A 1F60B 2MHNA 2FC8A 4P7VA 2OSRA 3FMWA 1K9MT 2J5AA 1X9MA 3KHGA 3PACA 4X84A 1U48A 4DDQA 3BZQA 4BWMA 2L9DA 2ZH6A 1NK9A 2E9ZA 4DR7F 3O8WA 2WB1D 4KHMA 1WI8A 3LAKA 4JV2A 4OHXA 2A10A 1DBDA 2HNZB 2F40A 5K5MA 1SJ4P 4LF6F 1KVIA 2IA6A 3VAIA 1JKHB 2G4BA 1TUVA 1C0TB 4ZVHA 4DS5A 5CYMB 1YJ9S 3RB4A 3G4SS 3MZIA 1S99A 3VAGA 1D8ZA 3VQTA 5C24B 3KG4A 3VF0B 2VD3A 4NCGA 2LQ9A 4NYPA 3MFHA 3N9UC 1Q53A 4ECSA 2MMYA 3OLAA 4OI6A 2M88A 5BYQA 3VZHA 1HBMA 5D3GB 2ZHBA 1QE1B 2GA7A 3OUYB 2OTLS 4JI1F 2J0WA 1TL3B 1WHVA 4C4WA 2J76E 2R7SA 2QA2A 3DLBA 1JLQB 3FEZA 1WQGA 3PFEA 1BY9A 5EGHA 2POKA 1KFDA 1LW0B 3MM5B 3AH5A 1VQOS 1DARA 3BF4A 2MJUA 1FE0A 4LSLB 5HN0A 1MU2A 3A8EA 4PR6A 1S1UA 2MQLA 5G4DA 3I87A 4DFKA 1N54B 3DHWC 2HHSA 1J5OB 2FLLA 2DR5A 1DAXA 5LXRA 3AA8A 4X2BA 2H9ZA 4O3OA 1Q4RA 1N5QA 3CIZA 3ICLA 2A2DA 3I0RB 1RK8A 1UWBB 3DLEA 4G3IA 1S77D 1IXKA 4IDKA 4YQWA 4A8SA 2IYGA 3EGNA 3L09A 3VZIA 1XXCA 2XCOA 4U67Q 1VIOA 1NH8A 1UFWA 2DIVA 2KHDA 2V4JA 4ZCMA 1VC5A 4N76A 2GSNA 2HFNA 5A0YB 4DL6A 4LSNA 1SIZA 3EX7B 1FRJA 3PX0A 1N5TA 5KFIA 2J6UA 2FDNA 1XTZA 3D28A 3DLGB 3I55S 3RB0A 1WQHA 4ETXA 5DG8A 3SI8A 5DETA 4DR1F 4LMZA 3MMCA 4FBUA 4DN9A 1N5YA 5AE3A 2HVIA 2ZJPQ 2X3GA 3RBEA 3M2UA 1ZOTA 4H4MA 3TUZC 3K2YA 2V4RA 2C22A 2HHVA 2K2PA 2LQBA 3BR9A 4DV1F 3HK2A 1LWEB 3OFEA 1HNIA 2DB1A 5B0AA 1O24A 3D0IE 1FDBA 1QVFR 1TK8A 3Q0AA 2CQPA 3MECA 3FRYA 3WDOA 2ZZMA 2AW0A 5L8RC 3CCJS 1NKBA 3X1LB 1H38A 3RW7A 1WD6A 5BJRA 4TU8A 3SCKE 1Z2LA 3PW2A 1KN6A 2RT3A 4FVMA 4MFBB 5CCLA 4ECXA 2MKSA 5IFMA 5IM0A 4K2XA 4DV4F 3RB3A 3N0VA 4QQBA 2FVPA 2ZD1A 1DQAA 2GGPA 3TI0A 5B0FA 4QJVA 3T5LA 5LJ3Y 3IRXB 4IYQA 3ENWA 5HROA 1OO0B 3D1HA 5L1IA 4DQQA 3N6NA 3OREA 2OJ3A 2D3UA 2Z4PA 2WTFA 2GC8A 4OZ0A 4ICLA 4X65F 4FVCA 2PDAA 3SV4A 2KZMA 2UUTA 1P6TA 1DURA 4NA1A 2MZRA 2WRMA 2MQPA 2EFPA 3F73A 4IG0B 3DLJA 5M2PA 3BSNA 1CVJA 3MGJA 2BZ2A 5L9XA 4C0BA 2BUNA 5DG7A 2ROPA 4EU0A 4N8OA 1D9AA 4NCBA 4EO8A 5D6GA 1CQMA 3VWSA 4RZRA 4RNMA 2CQ3A 3EUNA 3IR6B 4OJ1A 4DG1B 1WG4A 2VFSA 3CDEA 4QWCA 2EVZA 3MM9A 4F4ZA 2JA5A 5AE2A 4WFBQ 4WIIA 3EPGA 4OIXA 2VBYA 3FKIA 4ZKAA 1U1LA 2UV8A 3H4BA 1X4DA 4K4WA 1JLEB 4TKTA 2ZUGA 1L3SA 2AQ4A 2LQJA 1RA7A 4Y6IA 1REVA 2P5VA 4ZPWR 3CCMS 3HXMA 3NNCA 2HGLA 5HMWA 2R93A 1JB0C 2ACYA 1OQ6A 2RRBA 3DI6A 4X4VA 2N7CA 2B5JA 5KFLA 4LFAF 3CULA 3JSYA 2QA4S 2NREA 1NJYA 3MPYA 3HHLD 4ZK7M 3NKYA 2E7WA 4PPZA 2IFXA 3CCUS 4DQRA 1VK3A 4Q5VA 3CJ0A 2KB2A 2AF6A 4A8OA 1AB4A 1VQ8S 4WYWA 4FF2A 2KM8C 4DX8H 1GXLA 3PRDA 1BQMA 2DPJA 3I4PA 3FQKA 2YX4A 5I3PA 2KYZA 1DFDA 4KBIA 2XGPA 4B9LA 4LF5F 1SH2A 1TZ0A 3ZZZA 3H5XA 2R7VA 5HI7A 2VG6A 4NLWA 4KKOA 2F8MA 4PG7A 2N4CA 2X1AA 5LL6d 1VC0A 2PGCA 3GFXA 2XSJB 2Y1JA 3HM9A 5HLFA 1JLAB 2IJNA 3JB9k 1HNWF 4KMAA 2YKPA 3CC7S 2YNFA 1N56A 2HWTA 4ED8A 3MF5A 2MKHA 5KFXA 2ZOMA 1YTYA 3G9CA 3ISND 5KFPA 4DR6F 3QGPA 1FTRA 1NAQA 1NHUA 1ZAWA 2YNGA 3KLIA 3RBDA 2YNHA 4ES3A 4J9KA 2R8GA 2XNQA 5K8MA 3S7RA 5KAKA 2EFNA 2M8DB 5D4OA 4GFQA 4H54A 1M5OC 4JI0F 1U25A 3HDSA 5I42B 3DDKA 5F8NA 3NG8A 2R7WA 3KK1B 1NNDA 1FRXA 4OLPA 3DRPB 4KSEB 4FS1A 2D41A 1KSPA 2AGOA 2F3JA 2MY8A 2V2KA 4TYAA 5C5JA 3H20A 4I2QB 4EWTA 2UUBF 4NYZA 3IAS9 3BJYA 1S97A 1LXJA 1VJWA 4NLXA 1RKIA 2KDOA 2W4DA 2L9WA 4NWBA 4HL9A 2IMOA 1RP5A 3EXYA 4NCAA 2PHCB 1EK8A 1OQ3A 3ENVA 4OHYA 4TXSA 3V4MA 2DGTA 2BABA 2R7OA 2M2BA 4AL5A 2ZKTA 3DMJB 4J9MA 2OH2A 2GSUA 3CJKB 4MH8A 5G0RB 4USHA 2HQ3A 3OV7A 4ED0A 1BLUA 4IFYA 1ZYQA 1OSCA 2B4PA 1IBLF 1IS1A 4OX6A 3NGDA 1Y5NB 3IR5B 2CRLA 2QMXA 5IQQA 1S6QA 4PPDA 4IH5A 1KLMB 1U4BA 5HP1B 2PA8D 3EGZA 1QAIA 1TVRA 2AX0A 4TLQA 3UWTA 3JYTA 1DQ8A 1FEHA 2MQMA 3MD1A 1RYSA 1IKVB 4MKYA 2ERRA 4C2MA 3EGWB 3BN4A 2DBBA 1HW8A 4LF8F 2UXBF 4BHQA 2IC3A 2W9BB 1LFPA 1FHTA 3V4IA 5CYJA 3UE2A 4DSLA 1WIHA 2FPHX 3OTEA 4C8NA 3KHLA 4GTLA 3D54A 3I0SB 4QW8A 3TVZA 4M5DA 2YU9A 3SCLE 1SJ3P 2P6TA 4KM8A 3IGNA 1ZBTA 4K5RA 5H1SV 1U6ZA 1IBMF 1SUQB 1Q86T 4Y0FA 5IORA 4KGMA 2KTQA 1VBYA 4RW7B 3C2PA 1O51A 4U7UK 3WZ0A 2W9AA 4GTBA 1HNVA 3Q23A 2C3MA 3Q8SB 2Q3PA 4ZPDA 1RT1B 5J2NB 3V6KA 4ID5A 3HPOA 5KOXA 1WTFA 2YKMA 3B78A 2ZH5A 1XN9A 3MOJB 3I31A 4URQU 4DR2F 3NCRA 3EXCX 5F3ZA 4HI1A 1C1CA 2D3ZA 1FKOA 3TYTA 4UY8T 2E1RA 2E1CA 1YHQS 1DTTA 2LLZA 2D9PA 4AUKA 2ZH2A 4OI4A 4J9QA 3PVXA 1NU4A 3DRSA 2MZQA 4KDDA 1UJ6A 5HBMA 3RRHA 3H25A 4WFNQ 2B3TB 4V19J 1U1MA 1PC4A 2GMHA 2QZ8A 3HHLA 2YX7A 2X51A 3MM6A 5AXKA 3U7JA 3KLGA 4OZ1A 4F3MA 3PO4A 1R8PA 4UUWA 4DQPA 3Q22A 4B3OB 3GB0A 1VLYA 3KTQA 2CFAA 2E5GA 2QIFA 1M5SA 5E2QA 2MDAA 4ECQA 3ZZ0A 3WX4A 2EKYA 3M8QA 2ZFZA 3I5AA 3WC2A 3ZZUA 2ZITA 3KK3B 1G2EA