3AQOA

Structure and function of a membrane component secdf that enhances protein export
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
221
structure length
221
Chain Sequence
GLRIVLEADVENPTLDDLEKARTVLENRINALGVAEPLIQIQGQKRIVVELPGLSQADQDRALKLIGQRAVLEFRIVKEGATGTTVAQINQALRENPRLNREELEKDLIKPEDLGPPLLTGADLADARAVFDQFGRPQVSLTFTPEGAKKFEEVTRQNIGKRLAIVLDGRVYTAPVIRQAITGGQAVIEGLSSVEEASEIALVLRSGSLPVPLKVAEIRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable SecDF protein-export membrane protein
publication title Structure and function of a membrane component SecDF that enhances protein export.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Membrane protein
total genus 61
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aqoA01
3.30.1360.200 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3aqoA02
3AQPA 3AQOA
chains in the Genus database with same CATH superfamily
1MN9A 3SCLE 1IJFB 1JLQA 2B8QA 2ZOGA 4CO0A 3MM7B 4DG1B 3S8SA 2WCXA 1Y7PA 5IT0A 1FFGB 2LECA 3LWMA 1E6VA 5I42B 1WELA 3THPA 1VJWA 1CJUA 3QLHB 4JI6F 1F2GA 1XXBA 1Y0HA 2W2MP 1MU2B 1U25A 3W65A 4CLUA 2LEAA 2VBXA 2RGRA 1TWCA 4MQ9A 3QT7A 4P2SA 4WJ4A 4WE1B 5AXMA 4M5LA 4RPFA 3EPIA 4JI7F 5L1LA 5B0BA 1UEKA 3PG9A 4RJVA 2ZM6J 3R6LB 3OSPA 1S6UA 2DNNA 4H4MA 2KM8B 1N0UA 4DV4F 3MAAB 2AGOA 2ZWOA 3R9LA 1OQ6A 3QO9B 1GTEA 5ETNA 3NUHA 2MQNA 2I8EA 3TFHA 1RACB 2BRKA 3B78A 4GO7X 3G6ES 2DXDA 1IUJA 1HHQA 1PAEX 2ZH4A 2IM0A 5A8WB 2ZH5A 2C42A 4R5PA 3MMAA 4ITSA 1Y3KA 2HYIB 2DGTA 4KASA 3OFGA 1VRTB 4LMZA 2FGCA 3ILLA 2DH7A 3T5KA 4M95A 3H0PA 4FVCA 4B3OB 4JV5F 4NCAA 1HR0F 3MZIA 5BR8F 2WVFA 2FJDB 1S7HA 3UPFA 2KHCA 3M9NB 1QJHA 4A8KA 1ZM4A 3D68A 1TWAC 4X6AK 1YNNA 2OEMA 3JSBA 3M7VA 4DUZF 3A8IA 3LANA 1FJCA 4QIWD 2F40A 4M5JA 5K14A 4KHRA 3GIRA 4DV0F 5HROA 3OTDA 3OL8A 1U1MA 1RT2A 3HZEA 4KMDA 4WILA 3J7A1 4PKDB 1NDPA 4I6WA 4EYHB 3HDSA 2NVXC 4O0NA 2RSQA 1HI8A 3PDNA 1H3DA 3L09A 3FEYB 1RT5B 4N77A 1LEOA 2MTLA 2WB1D 3HOYK 4X4NA 4K4SA 4L3NA 1X9WA 4IG0A 5KFNA 4ZVTB 1SKWA 1QUPA 3FMWA 4LRCA 2PEBA 4QR1A 1L3SA 3LP2B 1J6XA 2IMOA 2JEJA 1TWFC 1REGX 1PIEA 2FQTA 4NLRA 1S0NA 3DKDA 1EB0A 4BXXK 2GHWA 4CNZA 2FY1A 1J6VA 3OSNA 4A3KC 3RZOK 3S1NK 3CCSS 3CJQA 4U96A 1QTNB 4ZLPA 5D4OA 3F41A 3MMCA 2ASYA 1TL7A 3MAQA 1XMOJ 4RNMA 2R7ZC 3UW1A 2GMLA 3POTB 4FPRA 3N79A 1KWMA 3QT8A 4TY8A 4WFZA 2N7CA 2JFKA 3HVTA 2WAQL 2V2QA 2P6SA 2VC1A 3MCMA 3K5NA 2Z2LA 1CULB 5CYMB 1FKOA 3DRSB 4C45A 3M6XA 3R8YA 4F4AA 2QYGA 5J2MA 4MKYA 3BDEA 5B0GA 2VL1A 4S0MA 4EFAC 3KHHA 5C4XC 2CQGA 3CMQA 1UFLA 3LOUA 1FNMA 1BS2A 2LLZA 3N0CA 3EDRB 2J9DE 1WWHA 2R7SA 2GGPA 5LJ3Y 3T1HJ 4Q43A 2VOOA 3O8WA 1TL4A 3FVYA 1YVFA 4ZP9A 1SC3B 1YCLA 5JJBA 2CPFA 2I1RA 1EJ7L 4ZPAA 2F5GA 3UCGA 1LWCB 4ZPCA 3HXAA 3EZUA 4XDCA 3FKBA 4HDGA 2WONA 4OYBA 2MGZB 1NJZA 4G0VA 1TU0B 1R6YA 3I5BA 4G65A 3OFFA 2K8GA 3HHLC 2X3DA 2QA1A 4U95A 3R1LA 4KJIA 3NNCA 2HPUA 3KK2A 4NRTA 2YNGA 5EX0A 2F8MA 1I3QA 2EW9A 5F8IA 3BP3A 4J3NA 1XZPA 4KMUA 4Q8EA 4ILMA 3D0IE 2ZDOA 1YLXA 1FWKA 4I2PB 5E41A 5I3PA 1IBKJ 4ZP7A 2KXNB 4USKA 3PJWA 1RTZA 5J2QA 3LPXA 4ED3A 4B3SJ 1GH8A 3C6UA 2VA3A 1Q79A 2J7UA 3SFUA 4YR2A 5D78A 1UMJA 2HVEA 4DOZA 5L38A 3OXFA 2NSBA 1UETA 1S1XA 2F3JA 2MXYA 3GTMA 1T3NA 5KFWA 3NG8A 3OTBA 3CJRA 5DG7A 3I31A 3GFYA 3JTNA 1L3TA 2RDIA 4RBTA 2V8PA 4DR3F 4AL6A 3OL6A 5DQGA 1S99A 1V3SA 1AZSA 5A8KA 4JV2A 2R8HA 4A4JA 5AJ3J 2RKIA 2ZWPA 4DPOA 1P6TA 5IP9C 2W8KA 1XTZA 3G8QA 4ILRA 2FLPA 4LRFA 1SQFA 2XMKA 5C25A 1QSYA 1HL6A 4DSIA 4ANCA 3ONQA 3TVYA 2BA9A 3DOMA 2OFGX 1X5OA 2PI5A 1MWZA 4M5GA 3T5LA 1HARA 4YN3B 3DRPB 3TX8A 2BDPA 4C3HK 6AT1B 2KFNA 3M6UA 4IH6A 2DH9A 3GTLK 4O3OA 3KDNA 3G4CA 1BDFA 4KIAA 2XO7A 2WAQD 2ZVIA 3ENAA 3WQPA 4ETXA 2DNRA 4N41A 3FBFA 4BLBA 1RI7A 4Z7CA 3D5MA 1FNXH 4OQJA 4DV2F 4P7TA 3ILOA 4ECSA 3KUHA 3DLKA 1OPZA 3LAJA 4CM2A 3JB9k 3CIMA 3LPYA 4EEYA 2XMUA 1R3NA 2HHHJ 4B9NA 3D3BJ 3OR1A 3IAS9 4LR8A 2HQIA 5HO4A 1J6WA 3CWJA 1VQKS 2XYPB 3S6EA 1TWHC 3UCZP 4DDFA 3OREA 3RTVA 4TKTA 4RW7A 2FC8A 2CNKB 1NKBA 4YFUA 1X8DA 4U7CA 3GTOC 1U45A 4C2MA 3OEPA 4IYQA 1WI6A 4DSKA 1U0HB 2OD6A 1SKUB 1VQ7S 1S9EA 1YJRA 4DPYA 3UNYA 1HA1A 3GEEA 2LU2A 3EE3A 2MPUA 1S1UB 4Y7NC 4FYYB 4A3BK 1O26A 4KGZB 1BMQB 3HOUC 2YKQA 5K8MA 1K0TA 1WD6A 1CJKA 4Y34A 5K9FA 1S1VA 1HNWF 4NYPA 2Z58B 2ZH9A 1RWOB 4ELUA 2HAFA 1NHUA 1Y5IB 2ZKUA 4Y6IA 3TEHB 1ITPA 2J6SA 2B63K 1B3TA 2R92K 3GPAA 3S1MC 1KVJA 2NYHA 3AAWB 1I51B 4ZITA 2VUMK 1YJ7A 2AV5A 5I42A 1OWXA 4WFNQ 5G4DA 3S2HK 3CMES 4DFMA 1SFOA 2EBEA 1ZBSA 1UA0A 3BO4A 4LIRA 3HOXC 2V63A 3HJFA 2RF2B 1RTDA 4ED6A 1YBAA 4OX9J 1JB0C 2MJNA 1D9AA 3JSMB 2LEBA 3TFJA 2HHWA 2W7OA 1MSWD 3V4MA 2HFVA 2JA7A 3KJVA 1Y5NB 4NLGA 4QW9A 1EETB 4JI1F 1HD0A 4DUTA 2RQCA 5EX3A 2BBEA 2CPEA 3DOLB 4P5AA 3C16A 4PQUA 1RJJA 3U27A 4ZK7M 4ECWA 1UVNA 5HMWA 2MZJA 5HVHA 3U7JA 1P9QC 2E29A 1RHQB 3PO3K 5A8WA 4PWDA 1N0VC 1WEXA 3OW2R 3AA9A 3ZZUA 3MFHA 3V4IA 3KTQA 4A3CC 2D3UA 2QSFA 4Y00A 3HVRA 3NCPA 3W9IA 2E9RX 3IGNA 1UVJA 1PBAA 4DL0C 4A3IK 1SJ4P 3KJNB 2HHPA 2HVDA 3VQSA 2RRNA 2UXDF 4TNOA 1LK7A 3HKWA 3IC1A 3MTKA 5J1EB 2VFVA 1X4BA 4LFBJ 4DV5J 1XMBA 3DDIA 4Q5VA 2NVYC 2ATCB 2IYGA 3CJKA 3IR5B 2UVRA 1Q82T 1YBUA 1NPRA 1B99A 3VQTA 4KSEB 4QBUA 5JUMA 2IC3A 1WG4A 1UJ6A 4Q4ZA 3CEDA 2Q66A 4F04B 3NXZA 2BRLA 3BREA 5KFQA 2DISA 2IHR1 1HKAA 1ZOTA 3TUZC 3S1QC 4QYZJ 3ZZRA 3DDNA 2RE1A 2WB4A 2NVTK 2AYEA 2R8JA 2O01C 2QA4G 4M5MA 5KFAA 5L9NA 1DURA 3IM8A 3KUEA 1I50A 4EZ9A 1CLFA 1S1TB 3D6TB 2MYFA 3FKIC 3BQ0A 3MR7A 4NA2A 1KBRA 3D3CJ 4JP8A 2WZ1A 2HSEB 1OJ4A 1ICEB 1PCAA 3ENQA 3GTGK 3HXMA 4USMA 1K83K 2F1FA 3LWLA 3J7YI 3MUMP 1RUSA 4DLEA 3MMBB 2YKMB 4ZVFA 4LF5J 1JLBB 3MWBA 2CFAA 2BVZA 2YX7A 4FF1A 4KN4A 2V67A 2AP6A 3PRVA 1O2AA 4Y2MA 4J7CA 4N8OA 1H72C 5C7PA 2DNHA 3GZ7A 3L3CA 3CCRS 5IYCC 4EO6A 1EFWA 2L9WA 5L8RC 3LW5C 1VBZA 3H4DA 4P5BA 1N5SA 2KFZA 2PT0A 2JWNA 4WJBA 2M7SA 2VQFJ 4ECZA 1Y4ZB 4YB1P 3GIKA 1I6VA 2HS3A 3OT9A 3P6YC 2LMIA 4KC6A 2ZJPQ 3HFKA 1LWFA 5C2CA 2VBWA 4DR6J 3RR8A 4U6PA 1VMBA 4RW9B 5F3ZA 2WVDA 2ZD1B 3RRGA 2OPQB 3MM9B 2EK1A 4EBDA 1BE4A 4B02A 5AXLA 4BC7A 4XTTA 2N4CA 3S1TA 3K5OA 2H51B 3D6FB 3M6VA 2HGNA 3SV4A 4PUOA 4TU9A 3S1RK 3JAMU 4O3RA 2VC0A 3OVSA 2GVZA 4WFAQ 2HNZB 1JLEB 4LLGA 3ZNJ1 4DUYJ 3TA2A 5MAOA 2KDOA 1T9XA 2RRBA 1N5QA 2JA6C 1PO6A 4X4RA 1U6FA 1KS2A 3IA0A 2OPRA 2BQRA 2FVPA 3TR5A 4YHHF 3NGSA 2A3JA 4B3MF 1SC4B 1CS4B 4YDXA 4P7VA 4YOEA 1Y3JA 4Q2MA 3GTJK 4Y52C 4DN0A 3BEGB 1N5YB 1K9MT 2I5JB 1NK5A 2FZKB 3HOYC 3IG1B 3OHAA 2DGVA 4GTLA 2B8PA 4CO5A 4LR9A 2OHDA 3EX7B 3OXGA 4MIAA 4Q0BA 2YTCA 1OYDA 1EP4B 3THVA 3M30B 3ZO7A 2DGXA 1OQ3A 3X3UA 4EZ6A 3H8YA 3LA0A 2K3IA 4FKYA 2DGUA 3IAM9 4FZVA 5GVQA 3C14A 3PHEA 4LF9F 1INNA 3RZOC 3CDWA 3GTQC 1TQLA 4RW4B 4PZVA 3M8WA 1X60A 2M88A 1C2PA 1OY6A 2H9ZA 5M3MK 1YITS 2D74B 2NSCA 4F3MA 3IRXB 1PJ7A 4R0JA 3QAEA 1O2BA 1PYOB 3N5BA 2MQOA 2MKYA 2CIMA 3JSYA 2JA5A 1SJFA 1ZETA 2M9KA 1UFWA 2E5IA 3EWGA 4WKRA 4G1QA 2UXBF 1S5ZA 3MURP 4KMHA 5HJYA 2BJEA 4CYUA 5C4JC 1Y1VK 2L9NA 2UUAF 5KFSA 2MQQA 1FWLA 3OTOF 1PAUB 4GKJF 2XQCA 4F4WA 2DITA 1EARA 1T94A 2IMWP 4X64J 3UDLA 4KQZA 3T3FA 4XPCA 1J2VA 4FF3A 5F8HA 1IBMF 3TAMA 5DDQC 1FJEB 4BBRK 4MK9A 1X31C 3D6MB 3CCQS 4YY3J 2CW0A 4DR4J 3U1MA 2RJZA 3NLCA 4OI0A 1U02A 3ERED 4XSXA 2UXCF 3CDUA 1TP7A 1KVIA 2ZEJA 4DEZA 3LQVA 2BE2A 4JI3J 3NCQA 2F63A 3WODA 4QZVB 2HRUA 2JVRA 1TR0A 3FQKA 3GSDA 4CP5A 4L74A 1GE9A 4NCBA 2H5IB 4ZVRB 1HNIB 4TQRA 4XIUA 3T19A 4OINA 3TUPA 1F93A 3K57A 2VASA 1U8SA 3HVAA 2YH1A 1GXTA 2MEWA 1D9FA 1S72S 5ETTA 4A3DC 5F0WA 2ZC3A 5GMDA 1NK8A 1FRJA 1WKJA 4GTDA 2NVQC 2WOMA 4DX6A 1XWLA 5JMNA 1S1UA 3W61A 3T00A 2A2CA 2DRBA 4USHA 2CVEA 2XEXA 4OV1A 3MEGB 1N6QB 3BB5A 2VG7A 1JNRB 3B54A 4OHXA 1B0PA 1TK8A 2E2IK 2HVIA 1RTIA 4CZCA 2JC0A 3E51A 2YKNB 1OO0B 1WC3A 4KH0B 4QIFA 3L4JA 1SH0A 1MW7A 2RS8A 1XR5A 4NX9A 4USJC 1D9DA 1IWGA 1QE1A 2C2NA 4OL8A 1N4LA 2CUYA 5DRKA 2P5VA 3V6DB 1RT4A 3DDKA 1UTAA 2R7QA 4RLEA 2W9CA 2DR7A 1RTHA 1YKWA 4OZJA 1S9GA 3QSIA 4GVBB 2R93K 3M8PA 4X4VA 3FBBA 5F0UA 1S9FA 2XSFA 3NCRA 1O24A 5E7OB 2DPJA 1Q0NA 1YJVA 2CNLB 1KTVA 1C1BB 2OIHA 4HTJA 4F4ZA 3DOLA 2M2BA 2W9AA 1XMQJ 1XNQF 1YZ6A 1FDDA 3UDEA 2OMOA 1T3OA 4UOFA 4OZ5A 2CZ9A 3FK4A 5T7LB 3W1YC 4AYBL 4C11A 5KT4A 2RILA 4RW6B 4C48A 3V81B 3H98A 2E5HA 5E68A 4KO0B 3PKMA 3TWZA 2DHGA 4I0WA 3U02A 3KHGA 3DHXA 5IV3A 1WTFA 2HIYA 3H20A 1S49A 3GSIA 4JI0J 3PHTA 2KKHA 3S15C 2ACMA 1FT8A 1SQEA 1IKWB 2RHQB 1FO1A 4NLPA 2ZM6F 3PIOQ 4KH1B 3ISZA 4LVOP 4TYBA 2YNHA 2Z8QA 1V5VA 4CLZA 4G3IA 1RYSA 1SBRA 1RXOB 1S0OA 4LSLB 2V8GA 1DLOA 1BQMB 4D3GA 4OFZA 4KAWX 3VGVA 3PW0A 4Y2KA 3QWPA 1FJ7A 5M3FK 1FDAA 2PHCB 3Q2SC 3G8TA 5FDLA 1KDNA 1VRUB 4ZVQB 3IS9A 4K4TA 5K8NA 4J90A 2YBVA 4YUDA 5IM0A 2DNLA 2XS7A 1BHNA 2GSUA 1VQNS 1T9VA 1NJYA 1HI9A 2DR6A 3I0RA 5GAGU 2LXIA 2VG6B 2ZH7A 4JB8B 1JXVA 3KLIB 2KM8C 4X4PA 4PYAA 2AMCB 1O28A 4JI7J 1VJEA 4KM9A 5DETA 2JSXA 4NLVA 3T9ZA 4A3EC 2JC1A 3M32B 1SKSA 1TFWA 2HKEA 3CD5A 1YTYA 2HMIA 3MECB 5F8MA 2YNFB 3BSOA 3RW7A 3UD4P 1RWVB 5IS2A 2HWIA 2FJWA 4M5DB 4DLGA 5IV4A 1DQAA 3OVAA 4H4KA 3I4NK 1G6BA 2EPIA 2VBZA 4NYOA 1Q7LB 3SZZA 4DL4A 3GWCA 2YQ1A 2KI2A 1LW0B 3N4WA 5I3UB 1O29A 3MM9A 1HR0J 1U6BA 4MYTA 2OJ3A 4M1XA 5A0YB 3VWSA 1XMOF 3MF5A 2KL8A 3RZDC 3GTPC 4DV0J 2YXLA 3NOGA 3HLUA 3QZ8A 4I2QB 4ECUA 4K4YA 2L08A 3R5JB 1HNXJ 5FJ8K 1RP5A 3A3NB 3C66A 3SXLA 4DQQA 4AYBD 1RWNB 4J9LA 2H4WB 2E2JK 2UV8A 1RAOA 2LA6A 2JL9A 3GB0A 4O2DA 8ATCB 3VF0B 3UQSA 3PO2K 1ROFA 3T1HF 1VFJA 2E1CA 4USWA 5RUBA 4F0HA 1SI9A 1KN6A 4Q44A 2PSZA 3O2IA 3GTLA 1U26A 4OIOA 3IG1A 4P10A 3LP1A 2KU7A 1WIHA 5CD4H 3AOAA 1CBKA 4C3IC 1RT6B 3MI7X 3K8WA 3M30A 3SZYA 3T6JA 4ZOSA 2G4BA 3SQOP 2HS4A 3JQJA 5THWA 4IRKA 4C8LA 2CA9A 3H4BA 4MFBA 4CDIA 4UTGA 4DWIA 2NXJA 1UL3A 4QWAA 2DT9A 3CNQP 3H2LA 4TLRA 3GTGC 2KG0A 4OIPA 3GTKK 3KG1A 1NK4A 2XWYA 1AFIA 4JI5J 3R2CJ 2B56A 3S14C 2GIFA 1HIYA 3NEKA 4OZ0A 1J98A 1IBKF 5ETVA 3M3YC 4CLPA 2U1AA 1MROB 4CH7A 3H59A 2XY5A 1XBWA 3EM1A 2IPOB 3ET6B 4KN7A 4A3FK 1HBNB 4ED2A 1DY3A 3RB4A 2IAJB 4ICLB 3FDSA 4WXWA 5HANA 2DHSA 1GMVA 2G0IA 2P9CA 1TL3A 3CJ4A 1UJ4A 1VQOS 3KFWX 4O0IA 3HOZK 3M4OK 3I32A 4ELTA 4J9VA 1M5VC 3UN2A 3NWGA 4DU8A 2G1DA 4RMFA 2HWTA 2V2KA 3L4KA 2C2ZB 3M1VB 5JVGQ 1FRLA 2B9XA 2QMWA 2B63A 2R92A 4C0OC 3P49B 5AJ3F 2BABA 3CC4S 3W60A 1HQEA 1R0CB 2VUMA 1DTTB 4OHVA 1F9FA 2MHNA 3S1RC 2HBQB 4YB7A 1T9TA 2K2PA 4ZVPB 1SIWB 4HTIA 2IFXA 1FJGF 2ZHBA 3HOVK 2WW4A 5HJXA 4URGA 4YQWA 3KJFB 3PX4A 2XGPA 3N5FA 4HH0A 4LF7J 2Y0SD 3AJDA 3LO3A 3RW6A 4DJBA 3UR0A 3ZZ0A 4OJHA 5DM7Q 4USTA 1VHIA 4XAKA 3BP8C 3M8YA 1VGYA 4EK2A 2VH7A 1MNEA 1TK5A 3DLGA 3U1NA 2HHSA 5HK4A 4DSEA 5M5YK 1IR0A 4ZJOA 4MK7A 1HNZF 2XYHB 3AB2B 2CJ9A 1U2FA 1SQGA 4BHQA 3QPIA 4HL9A 1XZQA 1IBCB 1ZA1B 2MKCA 3FCWA 3M6WA 2VD3A 1RWUA 2KTQA 1DFDA 2W4PA 4RW8A 2WHOA 3W8GA 3ZNUA 2HHHF 4X84A 3KLGA 5HAOA 4LRAA 2VF3A 3HSZA 3VALA 1Q81T 3ELHA 3AHPA 1AW0A 4A3MK 4KHMA 5HI7A 4FF2A 1RISA 5B0CA 3HOWC 5CABA 3NAIA 4TYAA 2FHKA 4ECRA 1TKXA 4WIQA 3DYAA 4EO8A 2BM0A 4UUXA 3V4GA 1WDTA 2I0XA 1F5BA 4GVBA 3L7OA 2R2SA 2A6OA 2XMMA 1VK3A 4M94A 1XC9A 1FXRA 2J8AA 1TV6B 4JBCA 4FXDA 4ZPVR 2C2OB 1H2VZ 3ZZYA 1J5EF 1QVFR 1Q16B 5KFRA 2XZWA 4FF4A 4X65J 2JA8K 4KE5A 2CPZA 3OR2A 1AB8A 1FK9B 2BJ1A 3QIDA 3MFIA 3I4HX 1FX2A 1NSPA 3M05A 2CAJA 5J1PA 1MMLA 1E6YA 3GG0A 1UV7A 4A93C 4M5HA 2V6TA 2KT5A 4L6V3 4CLWA 3PR5B 4PCQA 3RAXA 1XNRJ 5IOQA 1EX8A 2BYCA 3RJMB 2DR8A 2CDQA 1KLMA 4UY85 1MLAA 5FJ4A 1K8AT 2Q1LA 2FHMA 3Q8VA 2HNDA 4AL5A 1K83A 5HMXA 2QLBB 2GHPA 1ZQ1C 1C0UA 1FA0A 3FOFA 4K8RA 4ZPBA 2OI2A 4OX9F 2W1BA 3ZTRA 4ZS6A 4L72B 2XCAA 1QTMA 4I64A 3CCUS 3C6TB 1KHWA 4NLDA 2V4RA 4X62J 3IR6B 3KLFB 4HT7A 2LYVA 4LSLA 5K20B 2J5AA 4K4ZA 3GE9A 2DR9A 3LGMA 4F26A 3MCSA 2HHXA 1UWBA 5HP1B 3LAMA 3N6MA 2LXFA 2AD9A 1TWAK 3VAIA 2J9CA 2XHWA 1ZAXA 3D1OA 3QATA 1W7WA 1ZM9A 3GONA 2ZUFA 3ZZTA 4F2SA 2B4OA 2E2IC 3UN5A 3UVJB 2C2KB 5FLXU 1S12A 3HI9A 2IM2A 2NVXK 2MKSA 2JLFA 5C24A 1Q95G 4LFBF 2UV8G 3L9ZA 3M8SA 4DV5F 3QJLA 3ETOA 5KG0A 3UD5A 3CC7S 1NEEA 2ADCA 2BJDA 2DEJA 2QFJA 5EWFA 3LGHA 1O27A 3EVMA 1S48A 3THTA 3TANA 1S59A 3D6HB 4ZLNA 1TK0A 3VAGA 2P8TA 2RDJA 4Y2IA 4NLXA 4KY3A 3KOAA 3D9BA 4N7TA 5CHCB 1FWPA 2D41A 1RHUB 1JQWA 4WKYA 1TWFK 2YNFA 4C8ZA 3K89A 3IXQA 4J9SA 2R93C 3BSCA 3EICA 1EIYB 2RH6A 4F4KA 3GTJA 1IKVA 2CQ2A 1IJEB 3E3XA 1TUVA 2M52A 1F6TA 2QO3A 2XLKA 4ES1A 2CPYA 4X4SA 2FIUA 4BBSC 1E6VB 2R7ZK 5D4PA 3T02A 1CJUB 3ZZPA 5C44C 2E1PA 4KPYA 2OMLA 3ZZZA 5I3UA 1K0VA 1YBTA 3CD6S 4PG8A 3PJ9A 5A0YA 2VQEJ 1NRKA 3NL0A 1KNZA 3BQ1A 1F7UA 1IN0A 4LF5F 4ZIWA 1O2FB 1UCNA 3KNGA 2ABYA 2A6MA 3EQLA 2IJRA 3MM5A 3CCLS 3UI3A 4H4MB 3GCXP 1RB0A 2V8DA 3H0GC 1GTHA 2DK2A 4KMAA 4Q45A 3MDFA 2W24A 1JLGA 4RL1A 1BWVA 2GO8A 3MR2A 5IC4B 3AD8C 1SIZA 4I4BA 4R5PB 1WSRA 3MMAB 4J9RA 5DDPC 5IT9U 3OUYA 2VQFF 3UNGC 3MUVP 4BBYA 4ZPTR 4NASA 1KQGB 4DR6F 2PD1A 5A8RA 3CXCR 1VQLS 2E44A 4ZVEA 1Y1VA 3WX8A 3S16C 1NKEA 3O3LA 3PYGA 1MG7A 1JLCA 5AT1B 1UZHA 1Y1WC 1GMUA 4C8KA 3GJTB 1LOUA 2C3MA 1JMTA 5K14B 2V6UA 5KFFA 1FD8A 5HROB 1RT2B 4MEXA 5IP7K 2W7PA 2CPHA 1F0XA 3R7BB 3W3SA 3CJ8A 1JOEA 2GIRA 5LT5A 3GCWP 2ZJQQ 3T01A 2CQPA 4ED4A 5M2RA 4IOCQ 1IR2A 4DUYF 2DNZA 3ETMA 3OTEA 3W62A 3VTIA 3KHRA 4Y2CA 1T03B 2YU9C 4IG0B 3D28A 2GSNA 1WHWA 2EFPA 2DTJA 1OY8A 1U1PA 4NYZA 3F56A 3IPJA 1ZXOA 4NLWA 4DV3J 3JXOA 2E9ZA 1BXNA 3OPFA 1RTJA 3Q8PB 3AXKA 4TQSA 4TU7A 3MMCB 4P52A 1H73A 1TL7B 3N01A 1WCMK 2VFRA 4HR2A 4ICLA 5D3GA 3K7RA 4DQSA 1OSDA 4FYWB 5FD1A 1DD5A 5IP9K 2MZQA 4TY8B 3KG0A 3GU0A 1CJTA 4YEAA 2DNGA 4IH5A 4OYAA 1X9MA 3VVUA 1FKOB 4DDQA 2G9OA 2R8KA 1YX2A 2CDRB 3NAHA 5CH7B 5DLGA 1JLAA 3NGKA 3Q83A 1O5JA 2YWGA 3P8BB 2PA8L 4B3MJ 1ZA2B 2LDYA 4QYZK 1RT1A 4LIWA 2V6SA 4OMFG 2HZCA 4KYZA 2X1AA 2DNKA 2AJFE 1UEVA 3DU6A 1AXQA 4MKBA 2QMUB 1NK7A 2KZMA 3EYZA 1YK9A 4J9QA 4NPOA 1DJ0A 1VI7A 4X64F 4K2XA 2XMVA 8RUCA 5K8PA 1WC1A 3OVBA 4QYRA 3KK2B 2J76E 1TWHK 2YNGB 1RAJA 1WQHA 1RHKB 1HWIA 4DR4F 3QYYA 2MDAA 3VAKA 3K5PA 3ICLA 1XZPB 2ZZTA 2Y1JA 2W8LA 3GTOK 3TJ9A 4HHUA 3D1QA 2MZ1A 3KMSA 3LAPA 1Q8KA 4OZNA 4JI3F 1VQ4S 1U2CA 1WOOA 2VU5A 5GAGI 5J2QB 3SYZA 2Y1LB 2E2HC 2G13A 2WVEA 4U8VA 2FQQB 3GYXB 2DGQA 2YKOA 1RADB 3C6UB 4Y7NK 4A8XA 1UP1A 1T0TV 3FEZA 2ZZMA 3HOUK 4CLSA 1VHFA 4DX5A 3QNWB 1LW2A 4ZP6A 2CQ4A 2GJIA 3SBMA 2V6AA 2VA2A 3OTOJ 3AY0A 1TV6A 2BX6A 1FF2A 1S1XB 1IKYA 1YZ7A 1UA1A 3N6LA 2PMHA 2XI3A 1S1WB 3UN3A 3J81U 1EH1A 4KARA 2LFVA 2R42A 3K7AC 3RRHA 2J9DA 1HD1A 1X9SA 1AZSB 1EQMA 1IBLF 2IM1A 5A8KB 2OGUA 2HFZA 2PN6A 2AHOB 2RKIB 4ECTA 2C28A 2UXCJ 1O0PA 3HOXK 2BM1A 1N8RT 3W2WB 4ZN3A 4DR2J 2GX8A 1RU2A 1F7VA 3I87A 4F4XA 4GKKF 4ED5A 2VKRA 3DOMB 3LF0A 1S4FA 3CCJS 4CH0S 1T11A 4C3MA 4FNIA 2KYZA 3HJVA 2XMJA 4NI2B 3MM8A 4OZ3A 2DJWA 2C2EA 4UOGA 1WHYA 1WI8A 1KQKA 3ZZOA 2J0WA 4P2FA 2ZBPA 4IFVA 5HMZA 1RT3A 2RQMA 3D0GE 2JZ5A 2ZUEA 1RAEB 1BUXA 1Z2LA 4P74A 2DPIA 2V8VA 3NMAA 4PPZA 4A48A 3GTYX 2D7SA 1P27B 3DLKB 2Y1IA 4AL7A 1WOPA 1D0EA 1C0TB 2R7XA 2PA8D 1XMQF 2O5DA 1T95A 2ZUGA 3KJQB 1HW9A 3RBXA 1DAXA 3QBCA 4YMEA 1NCLA 5EHHA 2ADBA 2BQ3A 3OR1B 4EUVA 3SIPB 1IWAA 1NK9A 1WNEA 2VG5B 2AGPA 2KXHA 4NCGA 4XLPA 5BYSA 2NVYK 2F9JA 2IVMA 2UU9J 2HQDA 3TI0A 3HKZL 4KHPJ 2QLFB 1K1QA 4RW7B 1HI1A 3WX4A 4UZCA 1R9TC 3VAHA 2PI4A 3CCWA 5CD4A 1R6VA 3DLLQ 4CRJA 2QZ8A 4ALZA 4A3MC 1SJ3P 4IH7A 3BUEA 2PE8A 4DMZA 3W8PA 2UUWA 3BGOP 4EI2A 4ZIVA 4OYWA 1RAAB 4K4XA 2A10A 1YIJS 1VQYA 1BGXT 4B9VA 4PG7A 1TWGA 3J80U 4OZ2A 2GNKA 1QAYA 1RHRB 2XWXA 4X4QA 2O5JA 1TUWA 1HYSA 1CJKB 4QPTA 3FKIK 1S1VB 1GEHA 1AFJA 4DPUA 1C1CA 2NQPA 4PG5A 3HM9A 4UT4A 2PFFB 1R0AB 4DCJB 4E8UA 2JA8C 2ZH1A 3RAQA 3HHLB 3DU5A 4LSNA 1RDRA 1K73T 1KLNA 1BQXA 2LQ8A 3EPGA 2MQMA 2QLWA 2CQCA 2DB1A 2WRMA 4K5RA 3CQZC 4KRWA 4YS2A 1F3FA 4O3PA 4DSLA 2RD5C 3QFWA 5D0HA 1HW8A 1RTDB 3AODA 2MQLA 2FYXA 3QFHA 5IYCK 3E8OA 4NOHA 1N48A 1RA6A 4ZHRA 5KG2A 3W63A 2WTFA 3SCIE 2Y8WA 3KJVB 2KT2A 4F3QA 3GTKA 2B7CB 5GMEA 3P5BP 4JI4J 3GEHA 2HHUA 4G7ZA 2RQ4A 5EGHA 2IA6A 2LQ5A 2Y1RI 3BGRB 3KK1A 3C16B 4P6QA 4PQUB 1RT7A 1F9HA 1R7IA 4U8YA 2XTJP 1IE0A 2NUHA 4U7UD 4ZVGA 3DMJB 4PWDB 3V4IB 4J91A 5AXNA 2XS2A 3MEDA 2F8HA 3DRYA 7FDRA 2PMZL 1SJRA 2FDNA 2XCQA 4OI6A 4A3JC 1V3ZA 4ZP8A 1O8BA 1XN9A 3H5XA 3G8SA 5EN1A 2JH3A 1IS1A 1SKRA 3VZHA 4QJVA 3V5RA 3DXJA 2OPPB 3FRZA 4PG4A 1HBOA 2V34A 3ILIA 4RKUC 3RUBL 1RGVA 3CJKB 2ALZA 1TUGB 1I94J 5C3EK 5G0RA 4C3JC 3OTCA 2JA6K 3TEGA 5DQIA 3M2RA 4WIIA 1DQ9A 3VZIA 4ZN1A 3EVOA 3H5YA 2B9YA 4KKOA 1HNXF 1PC4A 2IC3B 3TVKA 1IKXA 4RWWA 4Y52K 3I5AA 1AROP 2MZTA 1ZYRA 2QL7B 2ZUAA 4K59A 1YJNS 3D67A 2B4VA 1IXKA 1T03A 2CPXA 5E3QA 3T5JA 3VAJA 1YRUA 4GRSA 1LWXA 3EGNA 2XULA 2X1GA 5FLXY 1DCHA 1IM6A 2CZ4A 3H40A 4XLNA 1RAHB 1KSPA 2AEJA 3DNCA 1N36J 1MWYA 1T7PA 3X1LB 5FIIA 4Q5SA 2C2DA 2LKZA 2PA3A 3GTQK 1O25A 4A46A 1VRQC 4F67A 2RRAA 2E1AA 3M2UA 5E3RA 4DN9A 1R0BG 3BKFA 5HQ8A 1WC0A 2E7WA 2BJ3A 1NM2A 4TVAB 4CWBA 3M8ZA 4D3HA 2JX2A 3NGUA 4GC6A 2CFAB 1YI2S 4NXNF 3T1AA 5E2QA 1JNZB 1NSKL 1NH7A 4JI5F 2ZJRQ 3R5DA 2IBOA 3MMLB 1NHVA 3TQEA 4I6AA 4O23A 1T05A 4C7QA 5C4JK 2WSFC 1RZMA 2DXEA 2OPSB 1XEZA 1NMEB 3D1HA 4ED1A 1LWFB 3PYDA 3GR0A 2MY7A 5CCLA 3TOQA 2GFFA 3W64A 4OHYA 5CQGA 1FNOA 1VBXA 2CJQA 1FKPA 1VGXA 3FQLA 2D3ZA 3QRPA 5L1IA 2AWZA 2ZH2A 1R89A 2HZAA 3W2VA 2OD4A 3LP0A 2KHDA 3CJ0A 2RT3A 4PUOB 1P9YA 3DC2A 2IM3A 4CLTA 4IR1A 2ACYA 5KFIA 4JOUA 1SB6A 2GVZB 4DZDA 3S7RA 4J9NA 3M8RA 4PABA 5IT9Y 1YHQS 2Z30B 2PMZD 4O4RA 3EXYA 4F7VA 4DL6A 5IP7C 5BYQA 2P8IA 3F44A 2OPRB 1U1LA 5D4LA 3QGPA 5D6GA 2OP5A 4A3DK 4LF7F 2M8HA 3TA1A 2NVQK 4NZ0A 1FKAF 4USIA 4AXIA 2KH9A 1BC6A 4NEZA 2QN6B 3ZC4A 3HHDA 1UZDA 4PEOA 5DJBA 4AXJA 2UUBF 4RUAA 4Q0BB 2XI2A 1HFEL 1JLFA 1HWUA 1UVIA 1WJ9A 2OO4A 4ED7A 2ERRA 4C9DA 1NSAA 4A8FA 1R8AA 3C14B 3CJSA 4G6VB 2NYIA 3N3YA 1S1WA 3CTRA 1GMWA 2KFYA 5HQLA 1T9YA 3QGIA 1WCMC 2LVWA 3DXBA 2HEKA 3SDEB 1S79A 2Z56B 3MM6A 1TWAA 3BO3A 4LF8F 5T41A 2BV3A 3PRBA 4I68A 1HQUA 2HVZA 4CM0A 5AE2A 3W2WA 4EBCA 1FCAA 1SH3A 2DCLA 2FC9A 3K2YA 1FJGJ 1RWPB 5CZVA 1XXCA 4N76A 3AQOA 1NDKA 2NVXA 2DD8S 3GV5B 1LWEA 4HYKA 1FRMA 4G1QB 3RAMA 1ZPWX 4NI2A 4CYUB 5ETKA 2R8IA 2Y8YA 3PVXA 1VQ5S 2XS5A 4GFQA 2GAHC 1NPPA 1Q8BA 4ECXA 4NL5A 1HNZJ 1TWFA 1RAGB 1Y11A 2GMHA 1WOSA 1JQGA 5ETPA 4L3KA 4X65F 4BWMA 3R97A 5LSRA 1U24A 2NPIA 3HHLD 1WG5A 2FJAB 2HIQA 2W4DA 3TAMB 5IOLA 5KFVA 4DPWA 4LSZB 1QLNA 1C0TA 1TMJA 3V2UC 2HGLA 3NY0A 2X3GA 4DR5J 3C19A 5AE1A 1TAUA 2R7ZA 1XNRF 2B43A 2LU1A 2VG5A 4KGXB 3W5ZA 4A3LC 4C6AA 2BE2B 4YFNA 2UUCJ 1Z2ZA 5JVHQ 3S15K 2BE5A 2PO4A 3PW7A 3NOCA 4M8LA 3S01A 1CC8A 5LXYA 5LSOA 2R2UA 3R1HA 4HVZA 5KT6A 3HF5A 2RNEA 4PXEA 3FFIA 5IZHA 4HLBA 3E2EA 2EKYA 2H3EB 4USVA 4IRDA 2XZTB 1F3VA 2PEHA 4DXLA 3SI8A 3G86A 2AX1A 4ZLJA 3C46A 3HULA 4B3RJ 2FLLA 3I9V9 1EAYC 2WOMB 1J5EJ 4LRDA 3LTOA 4X62F 1SFOK 3FMBA 3FOEA 2CJBA 5E3PA 1BY9A 2GA7A 1JK9B 3BYPA 1UW9A 1AUDA 2KRBA 2PPBA 1CSJA 2E5LF 2VG7B 3RG6A 4OYXA 3G6VA 1PSDA 2MY8A 2QX0A 5LMNF 1RTIB 2DVIA 3G9CA 1R0AA 2GQCA 1HHTP 2OKQA 4KT0C 5L39A 4K4WA 2A6HA 3HHLA 5DZ6A 4OHZA 3DRRA 2CJXB 2KXFA 1QE1B 4UW2A 4FN5A 4A3EK 5HQMA 3GLJA 1FHTA 3PXGa 1RT4B 3LALA 2AYGA 1FEHA 3ZTPA 1VS3A 2W9CB 1TAQA 1RTHB 1S9GB 2UZAA 4OI3A 3J7Z5 3Q8SB 3CPWR 1NSQA 3J81Y 1G51A 4DSJA 2QYCA 3M8PB 2XLIA 1LNQA 1UFKA 3T1YJ 3VHQA 5L1KA 3BV8A 5B0FA 2KJWA 4YR3A 1ZTWA 4HDHA 4O44B 2W2OP 3BGRA 1KQFB 2IJFA 3PCOB 3ILJA 3P45B 4C98A 2FZCB 1KOOA 2OTJS 3DMJA 3U1LA 4A8OA 3R6GB 1X5PA 2ZFZA 4C11B 1JXEA 4KB4A 3HHEA 2ASLA 4MJKA 2OEJA 2MJUA 3RZDK 3GTPK 4FKXA 2BKPA 3Q23A 3I4MC 2BXJA 4AT1B 2MKKA 2M8DB 5J2PA 2OPPA 3HT0A 2VQEF 1UEUA 4PXDA 4ZDNA 3DLEA 1W2BR 3CCVS 2HFNA 2W7VA 3KYLA 2AYMA 4I6YA 4DF4A 3RZAA 2HQ3A 4Q2LA 1Y00A 2GQQA 2YNHB 1B0TA 1QAJA 2RVJA 1WF1A 3TTGA 5IC6B 1RBOB 2JDJA 1DLOB 3R5BA 3BGUA 4OYPA 1Q78A 3M9OB 3L95X 1FX4A 1WC6A 1H0HB 1V3RA 5C42A 1OSCA 1JJ2R 5EWGA 1K47A 3NS5A 1S6QA 4LR7A 2IYIA 2L48A 3GYGA 4IG3A 5FDLB 2DGOA 1M5PC 4C3IK 2V2ZA 3NS6A 1LXJA 4Y3CA 4HH1A 4WCEQ 3IS9B 1UAWA 1SJQA 2NS1B 4DF8A 5IM0B 3L4BC 1RWKB 3WC2A 3I0RB 1U2RA 3OJUA 3S2DC 4ID8A 5KFCA 4A8SA 2POKA 3HFZB 3MUTP 1B70B 1KVKA 3PTWA 1M5HA 3W7BA 2AT1B 4IFYB 1F60B 3J80Y 1ZZNA 5M5WK 3SSRA 2IRUA 4CO2A 4OX6A 3MPDA 3NGTA 2DCUB 1TWHA 5D0RA 4YG2A 3S14K 1K1SA 2CVIA 5F8JA 3G82B 2MLYA 2HMIB 4USUA 2BW2A 3O5TB 3M3YK 2B51A 1Q5YA 1OY9A 1RSCA 3G4SS 3GTOA 4OYIA 4ILDA 3TUIC 4EWTA 4PWUA 3PW5A 4WK3A 4PPDA 1WQFA 1Z4UA 4K5SA 2ZH3A 4ZCLA 2FVSA 3SCKE 1CEZA 2OPSA 2IA0A 4H4OB 4AE5A 3HVWA 2K1RB 3FUYA 5KG5A 4NLQA 4DV3F 2EVZA 3EMTA 4HACA 4RO0A 3RB0A 3CJ2A 3PIPQ 2BOAA 4FZBA 2E5JA 1CJVA 2RQKA 2BW7A 5KT7A 1D3WA 1HWJA 1VQSA 1YRXA 2V4JA 2N82B 3CJTA 4AD6A 1GX5A 3TUJC 2R7WA 1SPBP 3DN9A 1Y10A 1QVGR 1S57A 4V1Ak 4YFXA 1H6KX 2R4FA 2D9PA 2QMXA 1H98A 2YNIA 1WC4A 1VIOA 2XZDB 4WZQA 3JYTB 3MOZA 3HX9A 3JTPA 4MMOA 4V19J 5C3EC 4QIWL 1PILA 3KLVA 4NLYA 1HBMB 2CG4A 1NH8A 2CPIA 1RKIA 4EGLA 3SFGA 1VJQA 1NNDA 3PFOA 3PR4A 2QTWA 3G2XA 4QWDA 5ADZA 4ZJQA 3BN7A 3IWLA 4AQYJ 5DDRC 4TXSA 3SMZA 3LP1B 5JVOA 2XY7A 2EXUA 2WB1L 3K0JA 2M4MA 2CJAA 2ZHAA 2JEIA 3D0HE 4RUCA 3BBCA 1REVB 3BKTA 2GMJA 4QIVA 3CC2S 3Q0AA 2ZITA 1S10A 1BGWA 2G1HA 4MFBB 3WIVA 1FI4A 2XCRB 2XSJA 1NJXA 3QJJA 3GQCA 1N5VA 2RAQA 5JFEA 5L1JA 5A6WA 3IFEA 1I5OB 1NJIT 3KMQA 1MMNA 3HOWK 3K8VA 2V68A 3BR9A 3PM9A 3SDEA 1YWXA 1GK8A 4NA1A 1QSLA 2R2RA 2AZ1A 3IBFB 2CPDA 2NVYA 3GEIA 1SUQA 3PYEA 3IWXA 2CQ0A 3MEEA 3BM7A 3B6BA 4BY1K 3DLHA 2E66A 4ZKAA 3JSTA 3SCJE 1NHKL 3AXMA 2F7VA 4MK8A 4KAIA 4PRFA 3PNIA 3KLHA 3R3TA 4WJ3M 3T9NA 2EFGA 3TYTA 4I7FB 1TL3B 4LF6J 5CZXA 4MAKA 4N8NA 4JV0A 4A93K 3R7NB 2RU9A 1I3QC 3FKIA 2ZE2A 4ETZA 1KC8T 2G0JA 5H9EJ 1J5OB 1HWLA 2XNRA 2G0CA 3C15A 4RU2A 1I6HC 2C3YA 1RCOB 1HQEB 2EG1A 3EGWB 3WDOA 2C22A 5LMUJ 2GVDA 4DR2F 2L41A 2B4PA 3HSGA 1NZ8A 2P9EA 2DY9A 4X2BA 5HLFA 1L5UA 1EQ0A 2CYYA 4O4GA 2HFUA 1WKLA 2DRDA 3RB3A 3UCUP 3GTMC 3AQPA 2ZH8A 1U49A 4ZLLA 2YWFA 4M63A 3DLGB 2DYAA 3P5TL 1M1HA 4O3QA 1SXLA 3D66A 2WVCA 2RH3A 4XSZA 2CADA 3UO0A 1J27A 2YX1A 1VR6A 5B08A 2B5JA 1X4AA 1IQZA 2NLWA 3Q8UA 4CTAB 2EEYA 6FDRA 2COLA 5ETSA 4LFCJ 3I55S 1XZQB 4B9MA 2NR0A 4RW8B 3VGUA 5F8NA 4F02A 5DG9A 3MPWA 4J9PA 1IBLJ 2DNPA 3H3VL 3KLGB 2F4VF 4KPCA 1HHSA 4PG6A 4KV8A 2E9TA 3MOJB 3NBPB 3MPVA 4OLPA 2UU9F 2ZNZA 2NZ4A 3FBCA 4GKKJ 2AIRB 2FVCA 4KHPF 1DRZA 1T02A 4QU6A 2HS0A 2AJ0A 3TAPA 1KOHA 1N34J 1TKXB 2I9SA 3DYAB 1JKHA 4GTCA 3TARA 4KATA 2MLZA 4RUBA 3VA7A 3CJ5A 2JA6A 2RS2A 3MAHA 4FYVB 1H74A 5KFGA 4RX6A 2PFDA 4BY7C 3BPDA 4DX7A 1HBUA 4EBEA 3BF4A 2NXEA 5KAKA 5KT2A 3GJSB 4X66J 1S7IA 2LQBA 2ZKTA 1YNJA 4A47A 3E01A 1NZAA 2N7YA 3VAMA 1ZTTA 4K4VA 3HT3A 4LR2A 1X5SA 1WSVA 5KFXA 2JEGA 4P2MA 2XC9A 3OR2B 5CYQA 1P8GA 4BBSK 4O44A 4JI2J 1VC0A 1QAXA 4I1TA 1CG2A 1DZ5A 5L9XA 5C44K 1MN7A 4DS5A 3BZQA 3QIPA 1E6YB 4DR7J 4ERDA 4J5OA 1RLDA 2JOQA 2W25A 2KZZA 3W5XA 1FD2A 1VYAA 1SMYA 4WPAA 3FZ2A 2V4QA 4R0EA 5KFLA 2IBKA 2ZDPA 3GTQA 4CCHA 1KLMB 1UPMB 2WBRA 3A3OB 2MZSA 2Z0GA 3L7UA 4C2MC 1KP6A 2HNDB 3OFEA 2C3PA 4DQIA 3B4DA 2A0FB 1C0UB 1I1GA 4MT1A 5J2NA 4N5SA 3H0GK 1KTQA 4HHHA 4UQTA 1FTCA 3PEJA 5DM6Q 3BSAA 2X7IA 4DV6J 3K59A 1ULRA 4JI4F 5H9FJ 5HVFA 4RR5A 3QT6A 3SSSA 4K2JA 2P5MA 1QM9A 5D0EA 2BJ8A 3IGVA 5IORA 2OSQA 5GAEU 4DBQA 2WSCC 5SUHA 2HZVA 2JHEA 3VAFA 1FRXA 5EDWA 4W4MA 3CD7A 4M5KA 2H48B 4PR6A 3S16K 3R27A 4C0HA 2VOPA 1UWBB 3KXDA 1NK6A 3EGZA 1SFOC 1Y1WK 2FJVA 2YH0A 2W2QP 3DOKA 2BQUA 4Y2AA 4DHVA 2VFSA 4KM8A 1QSSA 2IVYA 2R2TA 3EUNA 2QRRA 5CA5A 1VLOA 3HCXA 3IMQJ 3KWMA 2JA7C 5C24B 1VBYA 2EKNA 3A8JA 3M8QA 1X4DA 4I69A 3SQGA 4IFYA 1I94F 1VQ6S 4XK8C 1P1LA 1YGYA 3FC9A 2A2DA 2AEMA 1NKCA 3QAUA 2YU9K 3OLBA 2MZRA 2FLOA 4P9SA 4GC7A 3H3VD 1X7VA 4LFAJ 4WZMA 3G82A 5T14A 4NLSA 2DGSA 4G7OA 4J9MA 1YQHA 2FY8A 2CWXA 3HSDA 1IKVB 3CCZA 3Q3QA 2FVRA 2DHXA 2GCFA 1BQNA 4UOCA 4OIRA 1TVRA 3ZXWA 1OPIA 3BPSP 1TL1A 2BKOA 5DZ7A 2G2ZA 4H4OA 4IQXA 1N36F 1D1UA 2K1RA 2AX0A 3DGPA 4O3SA 1C4CA 1JJ4A 4C3LA 3DRXA 2ZH6A 3ENVA 2XGQA 1VQPS 1S77D 3FHZA 2CRLA 5K8OA 1RCXB 2H1YA 1QAIA 3FNNA 3QQCD 4FBTA 2P2CB 1YJUA 5KTQA 3MM5B 3NWRA 3L7PA 2QT7A 3CT9A 1XQIA 2XYGB 2YQ0A 2FJEB 1YDLA 5BXIA 5KFZA 4OZLA 1G1XA 3BH6B 2VPWB 3TZWA 4W98A 4PAAA 3JYTA 4E98A 1I50C 3HMJG 4LK1A 3JSRA 3HZGA 2GS8A 1JLGB 5DGBA 1DTQB 3DI6A 1HBMA 3OQ2A 3I0SA 1ELOA 1F5CA 3OUYB 4WF9Q 1WEZA 2APOA 4IKAA 2LXUA 4OIQA 4OYMA 1SV5A 5IYDC 5A8RB 1YJ9S 2RMLA 2QIFA 2A68A 2W2NP 1YG0A 3S17C 4B17A 1JLCB 4B3TF 4QQBA 3CVKA 3JQKA 2HNYA 2FLNA 4Y0FA 1G3OA 1REVA 2GC8A 2HHVA 3I82A 4U9RA 2RDDA 4F8RA 3V6KA 2W9BA 3PV8A 1LQ9A 4IO9Q 5KFYA 2ROGA 1N32J 4GTBA 4UQGA 4NXNJ 1HNVA 4OX8A 4Z37A 3DHWC 1CPZA 2E2HK 2BANB 2H54B 3UDVA 5JXSA 1RYRA 5CCMA 1U0SA 5D4NA 4IOAQ 1HMVA 2IDEA 4MEYA 2WSEC 1TKZB 1EQRA 4P71A 4RNNA 5F3TA 4HI1A 3QRRA 1G4CA 3BO2A 4RBVA 4JYAJ 3KDOA 1ZBTA 2DRAA 2NREA 1BJTA 2JNJA 2RUGA 5BJRA 3MM7A 4DG1A 2HHTA 2XCOA 3R5GA 4LJZA 1RTJB 4URSA 4CLYA 4ES3A 4ED8A 4NXMJ 3K7AK 3W9JA 3QLHA 2YKAA 5D3GB 3A1YG 1MU2A 1ZM3A 4I7FA 3A12A 1FVQA 2EFVA 1VIXA 2V0NA 4WE1A 1CJTB 2CQIA 3P4UB 2QSWA 4XDDA 1UJ5A 4QIGA 4RNHA 2O67A 2J9EA 2PIIA 3LUYA 3OJSA 4URQU 1J5OA 2K06A 2B6AB 1FFWB 1KQSR 2HBZB 3CF5Q 4WXOA 1BLUA 4LK0A 2D69A 3MAAA 1JLAB 4MTPA 5E5NA 3QO9A 3HD2A 3CAGA 5KFUA 3MTJA 4K0KJ 2J0XA 1TZ0A 4CLFA 3IN5A 5GMKa 2GSOA 3R7SB 2P6TA 3BJYA 1PJ5A 4CO4A 2NXUA 1RT1B 3TJAA 1EI6A 3D7SB 1X4HA 3H7HB 3GG1A 2DGWA 3T5HA 3QZ7A 2DY1A 2VHGA 1VRTA 3JQMA 3QX3A 1H2UX 4MKAA 2GJ2A 4ZJLA 2BZ2A 2N4DA 1N54B 2HLTA 2R7RA 2RB7A 2UUBJ 1XXAA 3JAMY 2Z4PA 2XHCA 2BR0A 4B3OA 1RA7A 2GJFA 4A3GK 1FXLA 2JJ4D 2BUNA 3B8HA 2BE9B 3G71S 1NB7A 3PO4A 5KFMA 2LP4A 4Z7YA 4CTAA 4ZPDA 5KFPA 3KLEB 1WDDA 2SXLA 2R9LA 1M1GA 3I56S 2G2OA 1RHJB 3GILA 4UUWA 1EKRA 1WG1A 5IYBC 4BLAA 4LREA 4DR5F 4ANEA 1GQEA 3N6NA 4XPEA 1R9TK 2AYBA 4DL2A 4ZVSB 4LF8J 2DNQA 2JA5C 5ETOA 3GFZA 1KD1T 2E1MC 1VQ9S 4PXBA 3NP5A 5F9NA 1N5TA 1KHVA 3GTPA 4OLOA 2J8SA 2QG9B 2UUCF 1RT5A 3NBPA 5D15A 3WZ0A 3HSJA 1N52B 4DQRA 2W2PP 4LF2A 2CJYB 1WORA 4YB6A 1GX6A 2QJ3A 3H2VE 1WF2A 3LP2A 3IP0A 5ETMA 4CO1A 2E7XA 3F73A 4FS2A 4BY1C 4DSFA 2RU3A 1LW2B 5DG8A 4BLGA 4QWCA 3TO8A 5C5JA 1N33J 4C4WA 3PW2A 4B3RF 3TQ1A 1IKYB 1FDBA 2YWKA 4FNHA 4L75A 2CQ1A 2CQBA 3AD7C 5KFTA 2Y3YA 3PJXA 1TL5A 4HEA9 2ILYA 5IFMA 1R43A 3POTA 4NA3A 2EC0A 3CQZK 3ISND 1IQ0A 3Q2TC 3CCMS 3GJRB 1SC6A 1CULA 5CYMA 3DRSA 1WHXA 2XM3A 2V50A 2MKIA 1JWWA 2Z57B 2HQFA 2ROEA 3N9UC 3BGFA 5F8LA 4ZCIA 3J7ZT 3T6BA 3GTGA 2E1RA 1ZM2A 1ZZFA 2ILZA 4FYXB 2FJXA 2FPHX 2QL5B 3MM8B 3NRBA 2KO1A 4LVNP 2ASDA 1WTBA 4MIBA 1D8YA 4DX8H 1M1KT 4IFVB 1RT3B 2YX4A 3O44A 3T1YF 5IOTA 1LWCA 1RE1B 4MYUA 2O1PA 4ZA1A 3GFXA 1URRA 4TN2A 3CO9A 2F65A 1RBAA 2B9EA 4L73A 2MKJA 1UVMA 4A3JK 2MGZA 1UVKA 2Q79A 2J0SD 1IL2A 3NNHA 1U6ZA 1SL2A 1U1NA 1WQGA 2E7VA 4XCHA 1UW4A 3G96A 1TKDA 2E5LJ 3TX0A 2E5GA 3JTOA 1DQ8A 3OL7A 4DR1J 2BMBA 2EI5A 5LMNJ 3CCES 2RHSB 4X6AC 2I6WA 4WFBQ 2ZVSA 5CYJA 4NCGB 1USOA 4K4UA 2NZCA 3TJ8A 3CGIA 1BD6A 3EJMA 4C3JK 1CQMA 3EZ5A 1TFYA 1ISEA 5LSLA 1S0MA 2M5YA 1LKZA 4I2PA 4DV7J 3SEOA 3I9ZA 4QOTA 1KFDA 1IVZA 4LF4F 2HLUA 2GW8A 3PFEA 3SZ2A 5LM7E 1MWQA 1JIHA 3O1LA 1NU4A 1T8EA 4TY9A 4WBFA 4BCAA 4KTQA 2VODA 3TZYA 4ELVA 1HYSB 2ZBIA 2WBMA 3M9MB 1LXNA 4NE9C 5M2UA 1TKTB 2AEFA 2EBGA 3NGDA 2F9DA 4ZPWR 1PG5B 4BXXC 1C1CB 3Q8RB 3S1NC 1PYTA 1FRIA 3G87A 4AH6A 2HFOA 4ZVUB 4OHWA 4LSNB 1KRPA 2GHVC 1N56A 2NPFA 4M5IA 3PKYA 5IQQA 1ZAVA 4ECYA 3HFVA 1S97A 1D09B 3MXHP 3IR7B 1R8HA 3VGTA 1VQMS 3CB4A 5ETRA 1XR6A 3EDQB 2CPJA 8AT1B 3S0XA 4YP3A 4FDFA 1VLYA 1EKSA 3FSYA 4ZHRB 3DRPA 4ENOA 1WEYA 4DV1J 3R2DJ 1HPZB 3NGRA 1IQTA 4JV1A 3Q22A 1RU0A 1DARA 3KK1B 1RT7B 3QGHA 1A7GE 4FXWA 4E2FB 2EFOA 5DGAA 2KN4A 4FM9A 4NZ7A 1DTQA 1F9NA 5TJ3A 2DXFA 3MEDB 4C8YA 4F4YA 2XMAA 4QU7A 3ZTQA 2MLXA 3OLAA 3MCOA 3H2UB 2VDHA 2X1FA 4OJ3A 4Z2XA 1KFSA 2EC2A 3WIUA 2J6UA 4QJVB 2IJNA 4CNYA 4U67Q 1UWAA 2D3O1 4WTOB 2VPXB 1V6HA 1HBOB 3W5YA 2YWWA 3H25A 2J7WA 5ETQA 5G0RB 2GO9A 1G7CB 5KOWA 4B9UA 3M2RB 2VB6A 3TZXA 3GYNA 3EXCX 1URNA 2FB0A 2XB2D 4KKOB 1U0HA 4IDKB 4B9SA 3PY8A 1IKXB 4H4KC 1JJHA 1VC6A 1R8PA 4QIEA 2IRYA 1U1OA 3M2VB 2BANA 4OI1A 3GP9A 5HATA 3Q8QB 4BC9A 4JI8J 3LH2S 4F36A 3M4XA 2CZVC 5DQHA 4X4TA 5HVGA 2UP1A 1TKZA 1VC5A 1P1TA 4DCOB 4HI2A 3TW0A 1B0VA 2LA4A 4BDPA 3CSKA 2DO0A 3AJ1A 1S6OA 4A8YA 4AQYF 4RBUA 5KT3A 3KHLA 1RLCL 2GQ2A 3M2UB 5CXTA 1B7FA 4NLTA 1VH2A 1FRHA 4DS4A 3PZPA 2RF2A 3JSMA 5FLMK 2E2IA 2FZGB 1FXDA 2B6AA 3A8EA 3PRDA 5HSPA 2PC6A 2UVVA 1KEKA 4WK1A 1EETA 2U2FA 4C3HC 5IWAJ 2JLEA 4ECQA 3GTLC 3WBZA 1T05B 3UD3P 1VDHA 4G0UA 1GAOA 1ZYQA 2CQHA 3QGGA 4FVMA 1KR4A 5MLCV 2R93A 2D6FC 3BKUA 1FKPB 3MR5A 1V9OA 1OMSA 1XJWB 4OI2A 2YWHA 2D9OA 3W2VB 4A8QA 4LF6F 3LP0B 1Y9OA 3D54A 1HWKA 5GAEI 3AH5A 5J1EA 1Q1KA 2M3DA 2N3LA 2DHAA 4ZCKA 2N3OA 4A3LK 4B9LA 3KLEA 5E33A 3QJPA 2K7KA 4IRCA 4H54A 2RIJA 2HW3A 4PXCA 5GADU 3EVWA 3NMRA 1ZPVA 5LMUF 4OIXA 1NXIA 4YR0A 4UZBA 2OEKA 2ZBRA 1PYSB 4C8NA 2XO6A 3MGJA 3CULA 2A6EA 3TP2A 1WF0A 3PX0A 2WK4A 4KGKA 3TFIA 2Q6BA 2AJ2A 4Y28C 3H0GA 4A3BC 4UF4A 3DGVA 5GAHU 3G6YA 1U1RA 3K5MA 1S1TA 3MMJA 4JI6J 1JLFB 4CIOA 4DFKA 2A69A 5E3AA 2HRYA 2HFSA 1SC1B 4JUZA 1TTHB 2DH8A 4CLKA 2B63C 4OV6A 2R92C 3ZFVA 2YKPA 4QWEA 4LFCF 2VUMC 3MMBA 2YKMA 1AUSL 3BYRA 1L3VA 1K44A 1JLBA 3KUGA 2HG4A 3OBIA 3S2HC 3MM6B 1WUUA 1RWXB 1Y1WA 3VV2B 4DV4J 1HQUB 3KK3B 2HRTA 5HBMB 2XY6A 1RABB 2KYXA 4KB2A 2BOPA 3EZOA 2HQCA 1X4EA 4EU0A 5B09A 1N34F 1VCTA 1LWEB 4M5NA 5ETLA 1U4BA 3IBWA 1GXUA 1B4AA 1AYEA 4LUBA 1ZAWA 1A9NB 1O51A 4LBHA 2YU9A 2QFIA 3GR1A 5HN0A 4RW9A 4JV5J 3PO3C 2ZD1A 2OPQA 2PDAA 4X66F 2I38A 5BR8J 2M0GB 1Q86T 4CT8A 1VOMA 4G1IA 3H90A 4DUZJ 2HQGA 4DZ6A 2DHHA 1VQ8S 9RUBA 2Y0SL 2DBBA 5KFOA 4M1KA 4JI2F 3G6XA 3AB4B 3RBDA 1X4CA 4A3IC 2QEXS 1KQ4A 2ALYB 4A3GC 3I4MK 5IXUA 4DR7F 5HL7Q 2BJ7A 2FTRA 4QWBA 2YPYA 3VCDA 2F8EX 3K5LA 1L3UA 2F4VJ 2EWHA 2HNZA 3FSXA 2O5IA 1JLEA 1FTRA 4F3OA 4GO5X 1TWGK 2X1BA 2NCKL 2KRRA 2DEIA 2ZZNA 1F5AA 2QLJB 4HHJA 2Y0BB 1U1KA 4CI0B 2IVFB 1PJ6A 4RZRA 3VGSA 2AQ4A 1AA1B 1UPPA 1CS4A 1L0WA 3HHKA 3FFIB 1FVSA 2EFQA 1D8ZA 3UE2A 5D77A 1N5YA 1RAFB 1RBLA 4NOIA 2DNOA 2I5JA 2KWAA 4DV6F 3QMQA 2NVTC 2H65B 4G1PA 2VIHA 5H1SV 3GDZA 1SVDA 3GIJA 2AJ4A 1USMA 1EP4A 1M5SA 5L46A 4GZYA 4KFBB 5EWEA 4F25A 1TWCK 1R31A 5D8HB 3CJ3A 1TKTA 1S6PB 1RWWB 3DLJA 3C2PA 5F9LA 1C4AA 5H9EK 4OX7A 4CLLA 2NXNA 4RW4A 3S2DK 5SZTA 1K83C 2C3OA 3BH7B 3LGNA 4ZH4A 1B4SA 2NUUG 3J81j 3DRRB 3IRXA 2H5JB 3TNVA 2R7UA 3C3LA 1NPKA 4C8MA 4OJ1A 4F0MA 1PC5A 5IT4A 3P3DA 3B82A 4NZ6A 4Y65A 4J9UE 2HAIA 3MPUB 2BEFA 4P2XA 3ULHA 4B3SF 3BN4A 2EBBA 4YDDB 1U48A 4DQPA 2RUSA 4CT9A 1NAQA 2L9DA 2LQ9A 1NO8A 2YVSA 3H5SA 2AW0A 1UKUA 5I3QA 3D2WA 4LFAF 4WU3A 1HPZA 2E2HA 3GIIA 4JK1A 3ITHB 1S0VA 1XERA 1U7LA 4MKVA 1FFSB 2AKWB 1G2EA 2QGFB 5A6PA 4LRBA 3FEXB 1JXLA 4KB7A 3BS9A 2DIVA 5KG3A 5KFHA 1LFWA 4W92B 3ISNC 3T41A 4FXVA 2MB0B 2ZOFA 5KG6A 3NNAA 3OFHA 3BQ2A 3GIMA 1NJWA 2C1EB 5DLFA 1Q53A 5J2PB 2R8GA 4LOWA 4MIWA 2OELA 3VVTA 1YSJA 3Q86A 5A2QU 1HNIA 3DLEB 1I6JA 3MD1A 7FD1A 4ED0A 3TZZA 2Q43A 1S76D 2BJ9A 1S4EA 3MHYA 4B9TA 5KT5A 3CW2C 4YFKA 2J6TA 2FQOA 5B0AA 5IOSA 2AZ3A 3GTJC 4C8OA 4U7UK 4IDKA 2HBYB 3WHIA 4GT9A 1AT1B 2VZ9A 1NDLA 2W7AA 3BDPA 5EGYA 3M2VA 1HLWA 1SH2A 3HKZD 5C42B 3A8KA 2IIHA 4ID5B 4N47A 1GNKA 1S6QB 5CAAA 1SCJB 3MEGA 4DR3J 4IG3B 4LBPA 4WYLA 1RAIB 1N6QA 1QD1A 1LFPA 1KONA 1SJ1A 3US5A 5HMYA 4DL7A 2J0QD 2OAUA 2Z2MA 1OYEA 4DI6A 3QSYB 2ZNYA 2YKNA 3LPEA 2QL9B 5AE3A 3H42A 3Q24A 1Z1ZA 3OD2A 1ZVUA 4QR0A 4OJGA 2OUGA 4GMKA 1FE4A 4FYDA 3V6DA 3F0NA 2GV1A 4KR0B 3SV3A 1WHVA 1N32F 2HHQA 2VONA 1X4FA 3JS9A 1R9TA 2YWEA 4RUHA 3K58A 3CDBA 3ZTSA 2QLXA 1IW7A 4G7HA 5H9FK 2OSRA 2KT3A 4DV2J 2BKNA 2QA2A 4ECVA 1C1BA 1RK8A 3ADAC 1Y1VC 4QR2A 5BYRA 3G4AA 3BR8A 4RWXA 4JYAF 5KFJA 3RBZA 1R8CA 4KGMA 4Q8FA 5LJ5Y 2FUG9 5EUHA 1H2TZ 3PACA 3UFCX 2AJQA 1U1QA 2GAGC 4HACB 1I3QK 4C3KA 5T7LA 3W66A 1GMWD 4HT5A 3HK2A 3AD9C 4BBRC 4NXMF 2B4UA 4RW6A 4B3TJ 2DNYA 3IO1A 2FD2A 4PQAA 2Z2ZA 3V81A 1CJVB 3I5CA 2Y3PA 5F8GA 1U8WA 2OH2A 2FJBB 3FRYA 4IUFA 1I6HK 4KO0A 2V4JB 4R8UB 3GV7B 4DPTA 4G0WA 3FZBA 2VICA 1Q7YT 2KG1A 5C2GA 4PYDA 3BBBA 2D3OR 1B7YB 3J7AN 4GTEA 3CQZA 3QT5A 5CJ9A 1IKWA 1I3OB 2UUTA 3CDAA 3RRKA 2YNIB 1X5TA 3I6PA 4DL5A 1NB2A 2YY3A 4ATNA 1N88A 3BGLA 2CQDA 3ENWA 1Q8IA 1DHMA 3GTMK 2H5EA 4K0KF 4V19X 4NRUA 1BQMA 4FS1A 1HNWJ 2O66A 1X0PA 5K5MA 2YQ3A 1SL1A 5DDOC 3TRGA 4BKWA 1Q5VA 2KJVA 2EK6A 1VRUA 2FHJD 3DM2B 3DLBA 5M5XK 2CKWA 2VPYB 3N28A 1QDUB 1RWMB 4DFPA 7AT1B 3CIZA 3HD1A 4ZVHA 5KFDA 4WWSA 2VG6A 2XSJB 4KDDA 4N56A 3KLIA 4J9KA 5HL8A 2HURA 2GZOA 3A13A 3FJ2A 3V6JA 1F1BB 2GIQA 5D0GA 1Q8LA 4IR9A 4BS2A 2BE7D 2LQJA 3A3PB 5B7WA 1DCPA 1MMDA 1YJTA 3M32A 2B7BB 4JI1J 1SUQB 3KKFA 5F41A 1F2HA 3KK3A 2XLJA 1W26A 3MEEB 3QRQA 5HBMA 3MECA 1RQ0A 4CH1A 3UWTA 3DCAA 3CUNA 3PEHA 3CMAS 5FLMC 4PWWA 3UR3C 4BY7K 1M5KC 1IBAA 1JLQB 4A3KK 2IY5B 2CWKA 5B0EA 1FERA 4ZCMA 4M5DA 1EZZB 1TMMA 5EGEA 1FE0A 2ATLA 1VBKA 2VUGA 1GFWB 3KLHB 1V5IB 2BACA 3R5AA 5IQ6A 2R7TA 1N33F 2VDIA 1LW0A 4CQ1A 3CDEA 3P96A 1FEEA 2VJVA 2UXDJ 3RBEA 2W01A 3TAQA 2ZBQA 1A6LA 1XR7A 2ZE2B 4F2RA 1AB4A 2FHJA 2Z2YB 3CE8A 4GTAA 3FCVA 1JX4A 3C15B 2DIUA 5C4XK 1O6XA 1RHMB 4C2MK 2VV5A 4OYZA 4RU9A 4I2QA 2HGMA 3CCTA 2AF6A 4UY8T 2Y9HA 4QPXA 2GVDB 4TLQA 3AH6A 5M2PA 4KC5A 5A76A 1DBDA 5HLFB 2R7OA 1FESA 5LL6d 2DO4A 3IWNC 4O4GB 3Q8YA 3AFGA 1YJWS 3C8YA 2D1CA 4DL3A 2JLGA 3NKYA 3MPYA 2VKZG 1OIAA 1VISA 3FSIA 2ZHOA 1LK5A 2VPZB 4LBIA 4NWBA 4E0DA 2K7JA 2MQPA 2V8HA 4LF1A 1HQMA 2QA4S 2B5JB 1A0OB 4J37A 3RU0A 2LDIA 1GT8A 1DCOA 4I67A 4IOBA 1CQNA 3OXLA 1RT6A 3I4PA 2XCPA 4KFBA 2B0GA 2DKOB 2KVQE 3FGVA 4IO1A 4BWJA 2JVOA 4L76A 1S6PA 2AGQA 3OPKA 2IDLA 2V5HG 4DR1F 1X0FA 1T9WA 4ZMMA 2KVIA 1C0AA 2JA7K 5B0DA 4KV8B 1U09A 1Y5LB 4P72A 3HP6A 9ATCB 1EHWA 2B9WA 2B3TB 4WFYA 3HPOA 2ASJA 3AA8A 3AOBA 1JKHB 4DV7F 4X4UA 4A8MP 1M5OC 2CNOB 4NMLA 2DR5A 2ZC4A 1MROA 2XNQA 4DU7A 1HQ2A 3ET6A 4RNOA 2IRXA 1HBUB 4I56A 2VBYA 4EYIB 1HBNA 4J9OA 2UVWA 2VFUA 3I4NC 4OZ1A 3E01B 2IAJA 2LCWA 5ITHA 2MMYA 2XG8A 3AT1B 4W90B 2Q6CA 2NXCA 3ITHA 4C97A 5KG7A 2C2MB 3OL9A 4ER8A 5CYQB 4K7QA 1WKKA 4LQ3A 2M70A 4LQ9A 2MSSA 4K50A 3OV7A 2JEFA 3RYLA 1H7XA 4OI4A 3UDCA 3HVTB 3QIPB 2O3DA 1M0SA 2CG8A 3AOCA 1VK8A 2UVUA 2A1BA 1F9EB 1RU1A 3CD0A 3M1VA 3WC0A 1M90T 1ZS6A 5J2MB 2R3VA 4X4OA 3RGIA 5KFEA 5E0OA 1W25A 1JVIA 4GTFA 1DTTA 3MEKA 3CO0P 3HHNB 3PO5A 4YHHJ 1FDNA 1WCMA 1T9UA 1X4GA 2GGPB 5U47A 2I2YA 5J2NB 3I96A 3DXSX 4LF4J 3NS7B 1TWGC 2FHOB 2HVHA 5CHPA 3MR3A 2E2JC 1LV5A 2J7KA 1I50K 2YPZA 2JFDA 1CVJA 2CQ3A 4DV1F 4QW8A 4KBIA 1YRTA 3PO2C 4ILLA 3DFEA 4AUKA 5GADI 4LJMA 3PX6A 4FPIA 1U47A 1APSA 2WONB 3FCHA 4LQYA 5IYDK 4WYWA 3VR1A 4A8WA 3IRWP 4DCPB 3LAKA 5KG1A 1KKHA 4LF9J 2P9GA 3ZTOA 3S17K 2ZFHA 2XMWA 4ID5A 4WTYA 4YY3F 1PKUA 2WVBA 4HKQA 3B4MA 4F0KA 2C3UA 1TWCC 5GAHI 2V94A 2V9KA 3DOKB 1R27B 4NMXA 4EMDA 1TELA 1PBUA 2QE5A 2MHEA 3BBFA 3EGVA 5E3CA 1XK8A 4WP9A 4P73A 2ZBCA 3GTKC 3M8QB 2V2VA 3SQGB 4RNFA 1NK0A 6FD1A 4CO3A 4QCLA 2ZOMA 1NLKL 2ROPA 1BWEA 3FBEA 2UXBJ 4NLUA 5DS7A 1IR1A 3OHBA 3AJ2A 2EFNA 4UOHA 2HK2A 1W2IA 3PW4A 4YB5A 5LXRA 2G2YA 2JRSA 1H38A 4WP3A 1PGZA 4OYOA 2UUAJ 3N0BA 4ZVOB 3KG4A 5KFBA 2OTLS 5AXKA 4GKJJ 1OS5A 2AU0A 2F4FA 5KFKA 4JI8F 2L3MA 3IM9A 3J7YU 2QV6A 4A3FC 4WFXA 3S1MK 3GJQB 2WW8A 1QY7A 1IBMJ 4P75A 1WC5A 1BQNB 1FK9A 1Q4RA 2HK3A 1TVRB 2EG2A 4FP9A 1TL1B 1FRKA 4NLOA 4AFFA 3RR7A 3HOZC 3M4OC 4ANDA 3DGPB 4DPXA 5C25B 2X51A 1IM4A 1ZH5A 3HO1A 4C0BA 1WACA 5KOXA 3IBCB 3PYFA 2XBPA 1NUEA 2DNMA 4NEYA 2QC3A 1JJCB 2PMWA 5I4MA 2CJKA 4R8UA 3W9HA 2VFTA 1B64A 2PGCA 4O3NA 4IQMA 1B4BA 1XPPA 2FGOA 1ACMB 2A18A 3MD3A 3O6QA 3HOVC 2KB2A 2R7VA 4WU2A 4ES2A 3R5CA 1RKJA 2Q3PA 1UVLA 4WP8A 2OLWA 1L3KA 2CNNB 1NBEB 3C6TA 3H5UA 5DO2A 3TVZA 3GMGA 4A3CK 5IWAF 2OFHX 1XIQA 3DI6B 2XMTA 5LOQA 3KLFA 1HI0P 3I0SB 2AJ1A 4MH8A 1EK8A 2HBRB 5TMFA 2V69A 1CC7A 2H4YB 2MSTA 2W4CA 3BSNA 2VJUA 1SV5B 3RB6A 5A2QY 5HP1A 2CFXA 2MKHA 4TU8A 5KG4A 1GXLA 1SL0A 3A4TA 3DM2A 2HNYB 2MQ8A 4FBUA 4LT6A 3K17A 3GFHA 4Q7AA 3TA0A 5IYBK 5D4DA 3UVJA 2LEPA 2JA5K 2W9BB 3SSQA 4GVLA 3MR6A 4JI0F 3QWUA 2CXEA 3GV8B 1H7WA 5J1NA 1HNVB 3MCNA 3S1QK 1R8BA 1S9EB 2HWHA 3V6HA 2V9WA 3D4JA 5TMCA 2C2RA 4DFJA 1NDCA 2K3KA 3N0VA 2FVQA 4R25A 4XO0A 1HMVB 4F50A 4KGVB 1QUVA 4B08A 3KNAA 3Q89A 1XNQJ
chains in the Genus database with same CATH topology
3K8WA 3M30A 2B43A 2LU1A 2VG5A 3T6JA 4ZOSA 3SCLE 1IJFB 1JLQA 2G4BA 2HS4A 2ZOGA 5THWA 4IRKA 1HPZB 2BE2B 4CO0A 1Z2ZA 3MM7B 1IQTA 4C8LA 4DG1B 3S8SA 2WCXA 5JVHQ 4JV1A 3H4BA 4MFBA 2PO4A 1Y7PA 5IT0A 3PW7A 3Q22A 4DWIA 4M8LA 2LECA 3S01A 1UL3A 4QWAA 1DARA 1CC8A 5LXYA 2DT9A 3KK1B 5LSOA 3LWMA 1E6VA 1RT7B 5I42B 3QGHA 1WELA 3THPA 2R2UA 3H2LA 1A7GE 1VJWA 4FXWA 4HVZA 5KT6A 3R1HA 3HF5A 3QLHB 4TLRA 4JI6F 1F2GA 2KG0A 1XXBA 2EFOA 5DGAA 2KN4A 2RNEA 3FFIA 3KG1A 4PXEA 4FM9A 5IZHA 1NK4A 1Y0HA 4HLBA 3E2EA 2EKYA 1MU2B 4NZ7A 4IRDA 1DTQA 1U25A 1F9NA 2PEHA 3SI8A 2XWYA 3G86A 2LEAA 2VBXA 2RGRA 5TJ3A 1AFIA 2AX1A 1TWCA 3C46A 3MEDB 4P2SA 4WE1B 4C8YA 5AXMA 4F4YA 2FLLA 2B56A 4QU7A 3I9V9 3OLAA 2WOMB 3EPIA 4OZ0A 3H2UB 4JI7F 5L1LA 1IBKF 2X1FA 5B0BA 4X62F 4OJ3A 4Z2XA 1KFSA 3FMBA 2J6UA 3FOEA 2CJBA 2U1AA 1MROB 5E3PA 1BY9A 3OSPA 2IJNA 4CNYA 4CH7A 1S6UA 4U67Q 2DNNA 2GA7A 1JK9B 3H59A 4H4MA 2KM8B 1N0UA 4DV4F 2XY5A 2VPXB 1XBWA 1AUDA 1V6HA 1HBOB 2KRBA 2AGOA 1CSJA 2E5LF 2VG7B 1OQ6A 3QO9B 1GTEA 3NUHA 1HBNB 3H25A 3G6VA 1PSDA 2MY8A 5LMNF 1RTIB 4ED2A 2DVIA 2MQNA 2J7WA 2I8EA 3RB4A 2IAJB 3G9CA 5G0RB 2BRKA 2GO9A 3B78A 1G7CB 1R0AA 2GQCA 4ICLB 4GO7X 3G6ES 5KOWA 1IUJA 4B9UA 3FDSA 1HHTP 2OKQA 4WXWA 3M2RB 2DHSA 4KT0C 2P9CA 2VB6A 2ZH4A 5L39A 2IM0A 1TL3A 3CJ4A 5A8WB 1UJ4A 2C42A 3GYNA 3HHLA 2ZH5A 4R5PA 3EXCX 1VQOS 3MMAA 4ITSA 2FB0A 1URNA 2XB2D 4KKOB 1Y3KA 2HYIB 2DGTA 4KASA 3OFGA 1VRTB 4OHZA 3KFWX 4IDKB 4LMZA 3DRRA 4B9SA 4O0IA 3PY8A 1IKXB 2FGCA 4H4KC 1JJHA 3I32A 1VC6A 1R8PA 4ELTA 4QIEA 2IRYA 2KXFA 1M5VC 1QE1B 1U1OA 3NWGA 4UW2A 3M2VB 2BANA 2DH7A 4FN5A 4OI1A 3T5KA 3Q8QB 2G1DA 1FHTA 4BC9A 2HWTA 3LH2S 4M95A 2V2KA 3PXGa 1RT4B 3LALA 4FVCA 2AYGA 4B3OB 3L4KA 3M4XA 1FEHA 3M1VB 2CZVC 5JVGQ 5DQHA 1FRLA 2B9XA 4JV5F 4X4TA 2QMWA 4NCAA 1VS3A 2W9CB 2B63A 1TAQA 1RTHB 1HR0F 2UP1A 3MZIA 2R92A 4C0OC 5BR8F 1TKZA 3P49B 5AJ3F 1S9GB 2UZAA 2FJDB 1VC5A 4OI3A 3J7Z5 3Q8SB 1S7HA 2BABA 3CPWR 3UPFA 2KHCA 1P1TA 3J81Y 1HQEA 1QJHA 3M9NB 4A8KA 1ZM4A 4HI2A 3CC4S 4DSJA 3TW0A 1B0VA 2LA4A 2QYCA 3M8PB 2VUMA 2XLIA 4BDPA 3JSBA 4DUZF 1DTTB 3LANA 3CSKA 4OHVA 4QIWD 5L1KA 1FJCA 1F9FA 2MHNA 2F40A 2DO0A 5K14A 4YB7A 2K2PA 3AJ1A 1SIWB 4KHRA 4HTIA 2IFXA 4DV0F 1S6OA 1FJGF 2ZHBA 5HROA 3OTDA 3OL8A 1U1MA 4A8YA 1RT2A 4YQWA 5B0FA 4URGA 3HZEA 4AQYF 4KMDA 2KJWA 3PX4A 3J7A1 4PKDB 4RBUA 4YR3A 1ZTWA 4I6WA 4EYHB 4HDHA 4O44B 5KT3A 2XGPA 3KHLA 3BGRA 3HDSA 3N5FA 4HH0A 1KQFB 2RSQA 2IJFA 2GQ2A 2Y0SD 3LO3A 3M2UB 5CXTA 3RW6A 4DJBA 1HI8A 3UR0A 3ZZ0A 3PDNA 4OJHA 1H3DA 1B7FA 4C98A 5DM7Q 3L09A 4NLTA 1KOOA 3FEYB 4XAKA 1VGYA 2VH7A 1MNEA 1RT5B 1TK5A 3DLGA 4N77A 3U1NA 2HHSA 2WB1D 3DMJA 2OTJS 4X4NA 4K4SA 4L3NA 4DSEA 1FRHA 3U1LA 4A8OA 1X5PA 1IR0A 1X9WA 4DS4A 2ZFZA 4MK7A 3PZPA 4IG0A 4C11B 5KFNA 2RF2A 1SKWA 1HNZF 1JXEA 1QUPA 3FMWA 4KB4A 3HHEA 3AB2B 2CJ9A 1U2FA 4QR1A 4MJKA 2ASLA 4BHQA 3JSMA 1L3SA 3QPIA 2MJUA 2E2IA 3LP2B 2IMOA 1FXDA 2B6AA 4HL9A 2JEJA 3A8EA 3Q23A 3PRDA 2BXJA 2PC6A 4NLRA 2UVVA 1S0NA 1KEKA 4WK1A 2MKCA 2MKKA 1EETA 2M8DB 5J2PA 2U2FA 4C3HC 3M6WA 2VD3A 2JLEA 1RWUA 2OPPA 4ECQA 2GHWA 4CNZA 2FY1A 2KTQA 2W4PA 4RW8A 2VQEF 1DFDA 2WHOA 1UEUA 3OSNA 3CCSS 4PXDA 3WBZA 1T05B 2HHHF 4ZDNA 3UD3P 4X84A 3DLEA 4ZLPA 3KLGA 1W2BR 5D4OA 3CCVS 2HFNA 3F41A 3MMCA 3KYLA 2ASYA 2AYMA 4I6YA 4G0UA 3VALA 1Q81T 4DF4A 1GAOA 3RZAA 3MAQA 2HQ3A 1ZYQA 4Q2LA 1Y00A 4RNMA 3AHPA 3UW1A 2CQHA 2GQQA 2YNHB 1AW0A 1B0TA 1QAJA 2RVJA 4KHMA 2GMLA 3QGGA 1WF1A 1RISA 5HI7A 3POTB 5B0CA 4FF2A 4FVMA 3NAIA 1KR4A 4FPRA 4TYAA 5MLCV 2FHKA 3N79A 4WFZA 4TY8A 2N7CA 2JDJA 2R93A 4ECRA 1DLOB 3R5BA 1FKPB 2JFKA 3HVTA 1TKXA 3MR5A 3BGUA 3DYAA 1Q78A 4EO8A 2P6SA 3L95X 3M9OB 2VC1A 1V9OA 2BM0A 4OI2A 3K5NA 2YWHA 4UUXA 2Z2LA 5CYMB 1H0HB 3V4GA 1FKOA 1V3RA 3DRSB 2D9OA 3M6XA 5C42A 1OSCA 3W2VB 4A8QA 4LF6F 3LP0B 1JJ2R 5EWGA 2I0XA 5J2MA 4MKYA 1Y9OA 3NS5A 1S6QA 3D54A 2IYIA 1F5BA 1HWKA 2L48A 3BDEA 5GAEI 3L7OA 4IG3A 5FDLB 2R2SA 2DGOA 2XMMA 5B0GA 1M5PC 5J1EA 2VL1A 3AH5A 4EFAC 1Q1KA 1VK3A 2M3DA 3KHHA 4M94A 3NS6A 1XC9A 2N3LA 1FXRA 1LXJA 2CQGA 2DHAA 1TV6B 2J8AA 4Y3CA 4JBCA 1UFLA 4ZCKA 4FXDA 3LOUA 4HH1A 4WCEQ 4ZPVR 1H2VZ 3ZZYA 2N3OA 1FNMA 1UAWA 1SJQA 3IS9B 1J5EF 2NS1B 4B9LA 4DF8A 1QVFR 1Q16B 2LLZA 5KFRA 3N0CA 3KLEA 2XZWA 2J9DE 5IM0B 5E33A 1WWHA 2R7SA 4FF4A 3QJPA 2K7KA 2GGPA 5LJ3Y 4KE5A 4IRCA 4H54A 4Q43A 2VOOA 2CPZA 3WC2A 3I0RB 2RIJA 3O8WA 1U2RA 3OR2A 2HW3A 1TL4A 1FK9B 3OJUA 4PXCA 5GADU 3QIDA 3FVYA 3MFIA 1YVFA 4ZP9A 4ID8A 5KFCA 4A8SA 3NMRA 2POKA 3I4HX 3MUTP 5JJBA 1ZPVA 2CPFA 3M05A 5LMUF 1M5HA 2I1RA 4OIXA 3W7BA 5J1PA 1MMLA 1F60B 4IFYB 4ZPAA 4YR0A 3J80Y 1ZZNA 1E6YA 3GG0A 1LWCB 3UCGA 3SSRA 4C8NA 2IRUA 2KT5A 3MGJA 4L6V3 4CO2A 3PR5B 4OX6A 3CULA 4PCQA 4ZPCA 3TP2A 3RAXA 1WF0A 5IOQA 3PX0A 2WK4A 2DCUB 3EZUA 4KGKA 4XDCA 1TWHA 4HDGA 2WONA 2BYCA 2Q6BA 1K1SA 2CVIA 2MGZB 1NJZA 2DR8A 4G0VA 5F8JA 4Y28C 1R6YA 3H0GA 3I5BA 2CDQA 3OFFA 2K8GA 2HMIB 3HHLC 1KLMA 4UY85 5GAHU 2BW2A 5FJ4A 3O5TB 2QA1A 3G6YA 1K8AT 2B51A 2Q1LA 3R1LA 4KJIA 2FHMA 3K5MA 1S1TA 1U1RA 3G4SS 3NNCA 2HNDA 3GTOA 4AL5A 2HPUA 1K83A 4ILDA 3MMJA 3KK2A 5HMXA 2GHPA 3TUIC 4EWTA 4PWUA 3PW5A 4NRTA 2YNGA 5EX0A 1JLFB 4CIOA 1C0UA 4DFKA 1FA0A 4WK3A 3FOFA 4PPDA 5E3AA 2HRYA 2F8MA 1Z4UA 1WQFA 4ZPBA 1I3QA 4OX9F 2EW9A 4K5SA 5F8IA 4JUZA 2ZH3A 4J3NA 2DH8A 4ZCLA 2FVSA 3SCKE 3ZFVA 4Q8EA 4ZS6A 4ILMA 2YKPA 3D0IE 2ZDOA 4L72B 1CEZA 2OPSA 4QWEA 2IA0A 4LFCF 4H4OB 2XCAA 4AE5A 1QTMA 3MMBA 4I64A 3HVWA 2YKMA 4I2PB 3CCUS 3C6TB 5E41A 5I3PA 2K1RB 1KHWA 4NLDA 5KG5A