3AQOA

Structure and function of a membrane component secdf that enhances protein export
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
221
structure length
221
Chain Sequence
GLRIVLEADVENPTLDDLEKARTVLENRINALGVAEPLIQIQGQKRIVVELPGLSQADQDRALKLIGQRAVLEFRIVKEGATGTTVAQINQALRENPRLNREELEKDLIKPEDLGPPLLTGADLADARAVFDQFGRPQVSLTFTPEGAKKFEEVTRQNIGKRLAIVLDGRVYTAPVIRQAITGGQAVIEGLSSVEEASEIALVLRSGSLPVPLKVAEIRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a membrane component SecDF that enhances protein export.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Membrane protein
molecule keywords Probable SecDF protein-export membrane protein
total genus 61
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aqoA01
3.30.1360.200 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3aqoA02
3AQPA 3AQOA
chains in the Genus database with same CATH superfamily
2EFQA 5H9FJ 4F04B 2WTFA 2HS4A 1TK0A 1TL3A 1DD5A 3MM9A 3CCRS 1S1VB 4H4KC 3WX4A 1OO0B 3ILIA 1KFDA 3NS5A 1Q8BA 4A3GC 3NBPA 1UFLA 4K2XA 1VQSA 1VQYA 3SYZA 1O29A 3NNAA 3PW7A 3TW0A 3F73A 2IBKA 2VA3A 1R8AA 4IG0B 1XMOF 2B9YA 5ETRA 4IG3A 3D0HE 4KYZA 3PKMA 2R7XA 4HACB 2B6AA 4ZVOB 2H5EA 4TU8A 2WB1L 3DRSA 4TN2A 2ZC4A 2RRNA 2XLJA 4F3MA 4ENOA 5KFSA 3KNAA 4H4MA 2PT0A 1HNIA 3GEHA 2NVYK 3MAAA 4DDFA 1DAXA 4PEOA 2IC3B 2BJEA 4PYDA 3T5JA 1CSJA 2DNKA 4IDKA 3Q8YA 1NU4A 3DOMB 5C25A 2ZJQQ 3NGKA 2C2RA 3L4KA 3KLGA 4ZVTB 4BLGA 5F8MA 1AXQA 1S6UA 3GE9A 2BOPA 2MQPA 2PE8A 1SBRA 1LKZA 3L7PA 4M5DA 1KEKA 3H3VL 3VV2B 3ZNJ1 1YJUA 4USVA 3UQSA 1U1MA 4P7VA 4PXBA 3ZTPA 1UEUA 2WCXA 1OY9A 4DV0F 1PBUA 2E2HC 2CPIA 5KG7A 3CCES 4JP8A 5JUMA 4YS2A 3I9V9 4DV2F 4NLUA 2MDAA 3QWUA 4OYIA 3W1YC 2V4RA 2NZCA 3IGNA 5E0OA 5GMKa 1Q86T 2KG1A 3I5BA 3MM6B 3GILA 1GTHA 3M7VA 3I0SB 3TWZA 1RE1B 1PJ6A 2XO7A 1LNQA 1X7VA 5KFMA 4ES3A 1QAYA 4ZHRB 2E2HA 4XO0A 4USTA 3HVWA 2W4PA 5B0AA 2LCWA 1S1TA 1JQWA 4LF4J 3ILJA 4RLEA 1VIXA 3L9ZA 1GX6A 3MCSA 2LEBA 4EWTA 5C4JK 1FXLA 4D3GA 2A6MA 4OZLA 3G4SS 2XHCA 1XBWA 3FC9A 4DU8A 4J9QA 3FKIA 2LQ8A 1OWXA 2U2FA 2CZ4A 4OLOA 1H7WA 3KHHA 2HVEA 2OEJA 3AT1B 1BHNA 1ACMB 3R3TA 3VAHA 3HHEA 3OSNA 3QGHA 2MEWA 2RHQB 1NPRA 4E8UA 2XCAA 5DM6Q 4KHPF 5A6PA 1ICEB 1CQNA 2Z57B 1YRUA 1N36J 3MEEA 2YBVA 4E0DA 4A3MK 5CD4A 2ZWOA 3LAKA 1CC7A 2AF6A 3BGLA 5KG4A 2QYCA 3CT9A 2VICA 4ZP6A 4DN0A 2HZAA 3FHZA 3OVSA 3AAWB 4Y3CA 2WHOA 2E7VA 4PZVA 5A8WA 1HWJA 4OQJA 4ED3A 1FJEB 1TR0A 1O8BA 3H0GA 2IVYA 1XK8A 2VG7A 4LSNA 2KVQE 3MUMP 3MURP 1HR0F 1GMWD 2G13A 4Q43A 1TK5A 3IBFB 3KJVB 2NZ4A 3OTCA 4ECTA 3KLGB 3Q2SC 3K5MA 5EX0A 2VFVA 1R6VA 4N5SA 1DTTB 3BUEA 4NLDA 4QYZK 3GIKA 4ZVHA 2FHKA 3DDNA 2XYPB 2GVZA 1RWXB 5IT9U 2BE5A 1N4LA 4N77A 1VJEA 5H9EJ 5L39A 1IJEB 2DY9A 2DYAA 2X3DA 1TKTB 2YNIB 4MKAA 4LF6J 1SJ3P 3ZTOA 1PJ7A 2Z56B 3CEDA 5D4LA 1X5OA 2YKMA 2HSEB 1TL1B 2EFGA 3RJMB 4NZ0A 4RBTA 3C19A 4DL0C 1KRPA 1S7IA 3M8RA 1KDNA 4N76A 3QRPA 4AL6A 3A1YG 3DM2B 4CLUA 1KSPA 1VQ5S 4G1IA 4EYHB 2ILYA 4JV5F 4IFVA 4ELVA 3HKZD 3C15B 4ECRA 5K5MA 3AY0A 4QIGA 3DRYA 4L75A 1H72C 3G82A 2RH6A 4KY3A 4PYAA 1N52B 2WBRA 3OTOF 4DQSA 4ILRA 1BGWA 5HANA 4L6V3 3N4WA 1KR4A 1YRXA 2XMJA 2LYVA 2EBGA 5F8LA 2MPUA 4WYWA 2HHXA 2ZUGA 1HMVB 4ILMA 3HSZA 4J9SA 1CJKB 7AT1B 1FDNA 4N56A 3H5UA 4ZCLA 1JJHA 2OPRB 3IRXB 4WTOB 3I4MK 1IR2A 3H90A 2ZH6A 4MAKA 5H1SV 3ZXWA 4B9TA 2P8IA 2AWZA 2LXUA 3GTKK 3SBMA 5HL7Q 2GAHC 4ELTA 2H1YA 3JQMA 2B4PA 4DG1B 2DRAA 3RZOK 2IA6A 3KK3B 2QL5B 5B0DA 4WFBQ 3MEKA 2UXCF 4H4KA 5K14A 2QA1A 1RZMA 1SJRA 2AGOA 4WZMA 2E2IC 1S99A 4O0IA 1Q82T 4GKKJ 2FVRA 4AD6A 4RZRA 2DT9A 2VBWA 4USHA 1YNNA 3DOLA 2C3MA 2EFVA 5DDPC 4ECWA 1UVNA 2BJ1A 2JJ4D 4C0HA 4J9VA 4ZLJA 3KXDA 1EK8A 3M32B 3V6DB 3DCAA 2U1AA 2ALZA 1TKZA 4DCJB 3GTGK 5M2PA 2R2RA 5KT3A 4YY3F 1UJ6A 1S1XB 4I69A 1L5UA 1JMTA 1XR6A 3VAMA 1PC5A 4NRUA 3OVAA 2M0GB 4BXXK 3S1NK 1FWLA 4KMDA 3D6TB 5ETPA 4Z7CA 1HNIB 2HPUA 4WPAA 4DR2J 4CP5A 4OZ5A 1VQNS 4OZ2A 4UOFA 1X0FA 1NB2A 1IN0A 4C0BA 2VU5A 2CRLA 2V2VA 4BWMA 1D9DA 1IXKA 1CULA 4YHHF 1KOOA 4NI2A 1SV5A 4F4ZA 3OUYB 1DJ0A 4P10A 3AB4B 2KRBA 3IS9A 3H8YA 2KRRA 5HI7A 3CJ3A 2FJXA 5D4NA 3V6DA 2XMMA 3MFHA 3OSPA 4J9UE 3WHIA 1R8CA 2XB2D 3G2XA 5IV4A 4Y34A 2XM3A 5GAEI 1AZSA 3M2VB 3VAJA 3M8SA 3PRDA 3RR8A 3MEDA 4TNOA 4CDIA 4YP3A 3JAMY 1XXAA 2JVOA 1MWQA 2QC3A 3RU0A 1FHTA 4OX9F 2YY3A 3EVMA 3K7AK 1NJYA 2XSJA 1TTHB 2MHEA 4DG1A 4ER8A 4WJ4A 3C6UB 1JLQA 2EC2A 2NVTC 2X1GA 1O25A 1QAXA 1J5EF 3C66A 5L8RC 1S9GA 3AXKA 1HHQA 3I4MC 4DSJA 3KK2B 2UUTA 4LSLB 4NCGB 4B3MJ 5KG5A 4GTBA 5KFCA 4UQTA 3P6YC 2K1RB 3RZDC 5DZ6A 5CXTA 3CF5Q 1UL3A 1J6VA 2WOMA 4GC6A 1RWMB 4FXVA 1OSDA 4FYWB 2MHNA 4KHMA 1EAYC 4OJ1A 5JFEA 2CPEA 1GQEA 4F2SA 2JC1A 2CNOB 2DNLA 4IH5A 1MU2A 5D4OA 3VAGA 4G65A 4DUZF 1KOHA 3IMQJ 3Q86A 4P2FA 4HR2A 5J2QB 3L7UA 4LF8F 1FJGF 2FC8A 3H40A 2RQMA 3JXOA 5J2MA 1VOMA 4DR5J 5F0WA 6AT1B 5FDLB 2VBXA 3QLHB 4LBHA 3DLGA 3I4PA 2E2HK 4F02A 2MSSA 1RWVB 3ILLA 1FTRA 1Q7LB 5GAEU 4Z2XA 4F0HA 3ZTQA 4PWDB 4ECSA 4IRDA 1YZ6A 1UJ5A 3NGUA 2Z4PA 3NCRA 1RBOB 4DL2A 4RW8B 1H98A 2RDIA 5E7OB 2X1FA 2OPPA 3WQPA 4YQWA 2G1DA 1WCMK 1H0HB 3SCIE 3UFCX 3CCWA 1ZYRA 3GDZA 2ZOFA 2H3EB 2YPYA 1LQ9A 4JB8B 4NYPA 1TWGA 4JK1A 2DNYA 1VBYA 1PAUB 3R5GA 2UVUA 3BF4A 3V4MA 4DR5F 4J90A 1AA1B 3MDFA 3S1MK 2EBEA 5I3UA 4JV1A 3I4HX 1XMQF 2WVDA 1Q81T 2X3GA 1M1GA 3VR1A 2VQEF 2FVCA 3IGVA 2FVSA 4EU0A 2B5JB 2POKA 5A2QY 3MMAA 2NPFA 1DBDA 2ZHOA 3HOWK 1RT6A 1GE9A 4IRCA 2NVXK 4WIQA 3CJ2A 1RA6A 1KS2A 3SZZA 2QLBB 4ZIWA 3MMLB 2L9DA 4B3MF 2QLXA 3ET6B 1IM6A 3RBZA 2Y1LB 3BGOP 4F8RA 3Q89A 2FJEB 1J6XA 1S0MA 2E2IA 4ALZA 4B9MA 3LWLA 4YR0A 1LK5A 1FJGJ 2ZEJA 2BUNA 2J0XA 2FJWA 4CLPA 1WC5A 3G4AA 1OIAA 1F5BA 2KM8C 5HROA 3KK2A 1Q79A 2VG5B 1T7PA 3SV3A 4OI6A 5KT7A 2UUWA 5CHCB 3FOFA 3KG1A 3GTOA 4Y2MA 3NXZA 1JXVA 1W2IA 4P2SA 2P5MA 4YR2A 3H0GC 2XZWA 2JFKA 3IP0A 2HK3A 1U0HB 2VJUA 3A8JA 4A3LK 4UY8T 2RS8A 3OD2A 1JB0C 4EBEA 1WF1A 4DL6A 1U6BA 5K8NA 1FI4A 3M2VA 3DFEA 1WC0A 1NKCA 4IH6A 4JI1F 4CIOA 4OHVA 3H59A 4BY7K 3FSIA 2VB6A 4DDQA 2HGMA 2LECA 2PA3A 3OT9A 4G7ZA 3GFXA 4B08A 3JSYA 1NDLA 4P2MA 2V4QA 5E41A 1T95A 3HVRA 2O67A 3ZC4A 2ROEA 3CIMA 3X1LB 1WEXA 2NPIA 3EM1A 2B56A 1S6OA 3L7OA 1JX4A 2BE2B 2EC0A 1IE0A 3GTOC 3OFEA 1F9FA 2DGQA 1M5OC 3OVBA 1KQFB 2MZTA 1FO1A 3I6PA 1TKZB 2J0QD 1UVJA 2GMJA 2Y8WA 1NDPA 3D54A 4TLQA 1R0CB 5GVQA 5HJYA 2YKMB 1I3QA 3RAQA 5KFGA 4FP9A 4OIQA 4C45A 3M9OB 3V81A 3C2PA 5E3QA 5FLXY 1R0AA 1BXNA 1EZZB 1TWAC 3IBWA 2D3OR 5D77A 1HIYA 2E29A 5F8NA 3CIZA 4MYUA 4TYBA 4DR4J 2BM1A 4DI6A 4KGVB 1RAJA 3D0GE 2J76E 1AFJA 4DOZA 3HHNB 4QU7A 4WIIA 4CYUB 1WELA 1R89A 3M4OK 2CQ2A 5IQQA 1XMBA 1LW0A 2CG4A 3H98A 3M9MB 3BSOA 3T5KA 4M1XA 3TZXA 3C3LA 2DRBA 1XNRF 3RB0A 2W9BA 1W7WA 3NMAA 4ED4A 1RT4A 1S5ZA 4ZJOA 2AEJA 3K17A 3A8EA 1S57A 4BY7C 1XTZA 5HP1A 4JI4J 2CQIA 1SH2A 3CMES 1EFWA 2BACA 1F5AA 2QA4S 2D9PA 3ISNC 3UR0A 1B7YB 1EHWA 4CO5A 4JI0J 1IS1A 2QV6A 3GTJC 2ZM6J 1I6VA 2CW0A 1UVKA 3AQPA 3C6TA 1HNZF 1SPBP 4B3SF 1WJ9A 2DNOA 4XCHA 2MQLA 5KFPA 1N5TA 2VBYA 1QSYA 2DNHA 2B9EA 2F3JA 2YWFA 3ENQA 5EX3A 1M5PC 4RL1A 3T3FA 1OY6A 4RW9B 4LRFA 1I50A 4DR4F 4Q2MA 4DPOA 4RNFA 2UV8G 4DFPA 1D1UA 4O3PA 2PMWA 4M5KA 1KLMA 1HI9A 1H73A 4M1KA 3U02A 3BPSP 2MY7A 2A10A 2DGUA 1ZH5A 2G0CA 4HYKA 5ETOA 1ZM4A 3UN3A 1IKVA 3EYZA 2FZKB 4DX6A 3CNQP 3BH6B 4P75A 2VFSA 1RXOB 3EQLA 2A6OA 5E2QA 1T9TA 4WWSA 3WZ0A 5MAOA 5LXYA 4IQMA 3GONA 3D0IE 2CQ4A 2HLTA 4DQIA 3QSIA 3O2IA 4TLRA 4KH0B 2HW3A 4A3BC 2WONB 1WDDA 1WUUA 2LXFA 3LW5C 1KNZA 2GSUA 2GVDB 3IG1A 1FA0A 3CVKA 5C25B 3D6HB 1I1GA 1HQUB 1SFOA 5BYSA 2QT7A 2FJBB 3I0RB 4CNYA 4BKWA 3IWLA 1EX8A 1LW2A 2GC8A 2MB0B 4QPTA 4HTIA 5L1JA 1RWOB 1JVIA 4G3IA 5T14A 3KNGA 1L3SA 4MKYA 4X4RA 4DV3J 2ZVSA 4NOIA 1R8BA 5CQGA 2I0XA 3B4MA 3HVTB 4KJIA 5M5YK 4ZDNA 2H51B 2HFOA 4LF4F 1I94F 4QR0A 5D3GB 3M3YC 3NCPA 3HOZK 1MMDA 2K1RA 1S76D 3ZZTA 2RS2A 2CWKA 3QFHA 2XTJP 1TWCC 1X5PA 4LF9F 2EK6A 4DV0J 4R5PA 1QM9A 4FNIA 4HT5A 1LW2B 3CAGA 3HOVK 5D4PA 4NXMF 5KG3A 3UD3P 3T9ZA 3OJSA 3HI9A 2X51A 1VC0A 1NJZA 2JSXA 1R31A 4EGLA 1VI7A 4BBRK 1NRKA 1T9WA 2GMHA 2FY8A 2ASLA 2ZH8A 5CCMA 1YJTA 2CJ9A 3BQ0A 2WAQL 3NS7B 3S1RC 2DNNA 2GJFA 2IYGA 4CTAA 2E2IK 1NK7A 4HH1A 3LOUA 4KC5A 3KG0A 2B7BB 2KJWA 1RLCL 3J7AN 2G9OA 3MMBB 2RQ4A 1L3KA 3GJSB 1GNKA 1VHFA 3N6LA 2BEFA 3H2VE 5DG8A 4WK1A 1AZSB 2I5JA 4LUBA 3FQLA 2P6TA 1NB7A 4LF8J 3S2HC 4PXDA 5EDWA 1F2HA 4XSZA 4U67Q 5KG0A 2PD1A 3OXFA 4DFJA 2O3DA 1DZ5A 3UDVA 2Y1IA 1PILA 2OPQB 2DY1A 5D0HA 3FFIA 1HQEB 1OYEA 2AYGA 3D1QA 1T9UA 4JYAF 1VHIA 5B7WA 2KZMA 4WCEQ 1DY3A 3HCXA 2W2MP 3Q83A 4OI2A 3PR4A 1FWKA 2ZJPQ 3TFJA 2R7VA 1FDDA 1NSAA 3W9IA 3GTPK 3RYLA 3T5LA 3S7RA 1H74A 3HOVC 3S1QK 1CG2A 4DPUA 3PEHA 4WE1A 4KARA 1DTQB 1RCOB 3FVYA 3GTYX 1RT7A 3TJ8A 4OZ1A 1ROFA 4F36A 4XDDA 4OIOA 2YTCA 3GWCA 2RKIB 4J37A 1S10A 3QATA 2R8GA 4WXWA 2R2SA 2RUGA 5F3TA 1WNEA 1O26A 2P9CA 1WEZA 1XERA 4IO1A 1U1LA 1JNZB 2CVIA 4PPDA 4RNOA 3GTGC 2M88A 4QOTA 5ETKA 3ZTRA 4P72A 1DARA 4FF4A 2D7SA 4BHQA 1TUWA 5CABA 2ATCB 4LRCA 3LGNA 4ECZA 1HD0A 4XK8C 2M8HA 2FJAB 2W9AA 5KFKA 2AX0A 3ONQA 2QRRA 5IT4A 2V9KA 2MGZB 3O1LA 4K4VA 3C14B 5HVHA 1WG1A 2Z2YB 4Y0FA 3P5TL 2YNFB 2AD9A 1C0UB 3GV7B 4ED0A 4KATA 1DTQA 4DUZJ 1Q16B 2UXCJ 3EDRB 1Z2LA 3G6XA 2EBBA 4Q0BB 4EUVA 2XYHB 1C1BB 2ACYA 3SDEA 1SCJB 1HKAA 1XQIA 1G1XA 1S6PB 3HOUC 4K2JA 4Q2LA 1MWYA 1XZQB 3P96A 3M2RA 1FK9A 4CLFA 3HLUA 1W25A 3MECB 4DZDA 3KUHA 1SL0A 2ZBIA 4QIVA 4L76A 4O44B 3QBCA 2BABA 3CCZA 1N32J 3IO1A 3K5NA 1VC6A 3KJVA 2XGQA 8ATCB 3UVJA 4DV6F 2WVEA 1K0TA 2E66A 4M63A 4HHUA 4DPYA 1E6VB 3PX0A 4JYAJ 3EGNA 3J7YU 3AFGA 2GGPB 2DR7A 4KFBB 5B0GA 5HMXA 4QPXA 3UCZP 4DQQA 2A6EA 4H54A 2PC6A 1HHTP 4NMLA 2G2YA 4NLQA 1RLDA 2FGCA 2XEXA 3TJ9A 1NAQA 3HJFA 2A6HA 1EKSA 2YX1A 4DX7A 1NZAA 1USMA 4Y6IA 3RZAA 2W9CA 1K0VA 2VG7B 3RB3A 2G4BA 1AB4A 4U8YA 3Q2TC 4ZKAA 1RT3A 2YWKA 1APSA 3AD9C 2ZH2A 1DQ9A 2JLFA 3ZZYA 2LQ9A 3E01B 4QYRA 1DCPA 4O4GA 3TVKA 2BKOA 2BJDA 1F5CA 5BYQA 4ZVSB 1YJ7A 1XNQF 3QZ8A 1DCHA 4K7QA 1ZM9A 2YKOA 1N5SA 2VBZA 2AJ0A 4NASA 2BRLA 3OR1A 4K5RA 1HFEL 2GAGC 2PN6A 4AE5A 3GFYA 2BJ8A 1HNZJ 3I55S 8RUCA 2QEXS 1SFOK 2FHJD 3T6BA 1HBOB 3GJTB 1VBXA 5HLFB 1SJ4P 3W9HA 3BKTA 1VFJA 5HVFA 3BN4A 2HBQB 2EFNA 4OJHA 1MMLA 2CG8A 4ES1A 4PQUA 2B8PA 1U02A 1IBAA 2E5IA 4Y7NC 5HBMB 2GA7A 2XSFA 4DUTA 1QD1A 3H5YA 3Q8PB 3CJRA 1IKWA 2DGSA 3THPA 1N5VA 3H5SA 3ZNUA 3QYYA 4LT6A 3A3PB 2V4JA 1RI7A 1Q8IA 4IFYB 1F9EB 3TTGA 1HQUA 1HPZA 3VVUA 1PC4A 3A8IA 3MM6A 2OPPB 3CQZC 2YU9C 2KI2A 2DXEA 4RW8A 2RAQA 2DNPA 3SSQA 3BR9A 3BDPA 3H20A 2VG6B 5AXMA 3MM8A 2FLPA 1N56A 3B78A 3MGJA 2W4CA 2AZ1A 1ZA2B 2JNJA 1TWFA 2Y3PA 4I0WA 4JBCA 4FKYA 4NPOA 5HMYA 1I3QK 2VG6A 3NGTA 4LBPA 3MR3A 3EJMA 1ZA1B 2RB7A 1MN9A 4IR1A 3ISND 3TA1A 1NUEA 3QJPA 1R8HA 1RAGB 4LK1A 4NWBA 1N32F 2WVBA 3X3UA 3TP2A 4R5PB 3RW7A 4WZQA 4DSIA 2W2QP 1IKVB 4A3JC 5ETNA 3QLHA 2K2PA 2M4MA 3RZOC 5FD1A 1KQKA 1JLBB 1KVKA 3TUIC 1TWFC 2HAIA 3C16B 1ZM2A 2G2OA 5J2PB 2UVRA 2MZQA 5GMDA 2ZBRA 3D1HA 2J0WA 3QIPA 2PMZD 1WKLA 2WK4A 5IWAJ 3H0PA 4Q7AA 2RIJA 2MSTA 2DEJA 2Y1RI 2J5AA 4A3KC 2XYGB 1NJXA 5GMEA 5J1EA 1YNJA 3TUZC 3VWSA 3OQ2A 3CQZA 4IOBA 3OR1B 2YH0A 4ECVA 1A6LA 1TKDA 4LF9J 2R92C 1HHSA 3UPFA 4M8LA 2XMAA 2Z30B 1K73T 2CAJA 1LWEA 2AYMA 3QT6A 1RCXB 2CVEA 1UVMA 3KLHA 1TV6A 2B3TB 3HD2A 4I64A 2I9SA 2ASYA 1S72S 3HOXK 3D3CJ 2AEMA 4AYBL 1UFKA 3B4DA 1QE1A 1WC1A 1G7CB 3N3YA 4ID5B 1YJNS 5LSOA 4LF2A 1R9TA 2CADA 2W2NP 2ZUEA 1JLAB 2VQFF 3DMJB 3W8PA 2MKHA 4X4OA 2G0IA 3WIVA 1ITPA 2FVQA 1QVGR 2W7OA 4GTDA 1RT1B 3HOWC 1CJVA 3CWJA 3UCGA 4G0UA 3Q0AA 1U1KA 1XEZA 4PWWA 2BANA 3W62A 1SB6A 4LBIA 3HOZC 2MKYA 3TQEA 3M6XA 3BN7A 4BBYA 2XULA 4KFBA 2AW0A 5DQHA 2PO4A 5K8OA 3DGPA 2UU9F 3IS9B 2CJYB 1TKXB 4X64F 4O3NA 5I4MA 2NVXA 3NL0A 3D1OA 3UN2A 1WOOA 2DR8A 3TO8A 1NK8A 4CWBA 2ZBCA 4LFAJ 1WCMC 2DCUB 2GHVC 3D2WA 4JI7F 4N7TA 2IDLA 2YNFA 3SZYA 2K06A 1FE4A 4DS4A 4JI6J 4UOGA 2H48B 3Q8QB 3S16C 1DCOA 3W9JA 2V8PA 1X9MA 2DPJA 1F9HA 4OYZA 2ADCA 1FNMA 2RGRA 3I5CA 4NEZA 3M30A 4OZ3A 5HP1B 4TU7A 1XNQJ 3DGVA 3EZUA 1KFSA 2UUBF 2BE2A 1PG5B 4DHVA 1IUJA 3CJTA 2L41A 4KMHA 2BE7D 1K1SA 2V5HG 4BC9A 4ZN3A 3GTLA 2HHTA 2NVQC 3M2UA 3QX3A 4X66F 1IVZA 5B09A 2JEIA 2PFFB 1EB0A 2G2ZA 2C3YA 3MF5A 1BWVA 3H4BA 2CPYA 1NLKL 1REVB 1U0HA 2B4VA 2FQTA 2NUHA 4C3LA 3LGHA 1YVFA 3AA9A 5DQGA 4HI2A 1R0AB 3K5OA 4Q8EA 3M2UB 2O5DA 3TQ1A 2RKIA 2QO3A 1LFPA 3MPDA 3CUNA 1O24A 2WSFC 3F41A 1SKWA 5IOLA 3DI6B 1X60A 4ANCA 3PM9A 1R8PA 3R5DA 4AQYF 2KT5A 2R8IA 3LALA 2M70A 4DL5A 1U49A 3TZZA 5C3EK 3CDBA 4CNZA 3RBXA 3FBFA 4KIAA 2NSBA 5ETTA 2RD5C 3JQJA 3SXLA 1URNA 2QJ3A 1T03B 3FZBA 5KOWA 5HQMA 1UV7A 1TKTA 3NGDA 1VQPS 4NZ7A 4JI0F 4NLXA 2AMCB 2KB2A 4USMA 2AU0A 4A93C 5B0EA 1I50K 1RWKB 4NA3A 2AX1A 1U09A 1RT2A 1RT6B 2GO9A 4FXWA 1C1CB 1YRTA 3K5PA 3TAQA 1LWFB 3PO4A 2YQ3A 2X7IA 2QSFA 1YSJA 2JHEA 2JVRA 2V8VA 2DHXA 4B9VA 3SZ2A 2A69A 1RTIA 2HBYB 5H9EK 4RW6B 1M0SA 2RQCA 2N7CA 2XMKA 2WSEC 4X2BA 4GZYA 2M9KA 2YKPA 1SC6A 4MEYA 3BREA 2RF2B 4P2XA 3G6VA 2HK2A 2GO8A 1OY8A 4KPYA 1IBMF 3R5JB 2CQCA 3GB0A 3CO0P 2J9EA 4P6QA 2P9EA 2MQNA 2F63A 4KAWX 2VKZG 3ENAA 2HFVA 4RW6A 3E8OA 2BOAA 5FIIA 1RTIB 5M5XK 1NHVA 2ACMA 4E98A 4C11B 1RAEB 2RILA 4DLEA 4LVOP 3GV5B 3KWMA 4K4ZA 3MUTP 3IM9A 4FYXB 4KTQA 1WKKA 4ED2A 3GTMC 5IC4B 2HFNA 3TAMB 5LT5A 3O6QA 3T41A 5C44K 4J91A 1FRLA 1NDKA 4FDFA 3ZZ0A 5GAGI 2MJUA 2R2UA 3H2UB 1JLCA 3SCKE 2ZC3A 3W63A 2J6SA 3CMAS 4P9SA 4A8XA 4QZVB 4QW9A 5C5JA 3D4JA 4RW4B 2UXBF 1P9YA 3GIRA 3PFOA 3TR5A 3BO4A 1P1LA 4NRTA 2HHPA 3CCSS 4CO4A 1FRXA 4MT1A 1KVIA 4DR3F 1VC5A 4Z37A 2XMUA 4F4YA 4MK9A 4BCAA 2EK1A 2IVMA 3F0NA 5CHPA 2C2NA 1HW8A 3O44A 2J9DE 3R27A 1BDFA 4H4OB 3KLIA 4C8ZA 4LR2A 1S9GB 4EZ9A 3GTQA 5D8HB 2KZZA 5TJ3A 5I42B 2Q3PA 2C28A 2I38A 3C6UA 1DFDA 2JA6C 1K8AT 1V5VA 1S9EA 4OHYA 1NZ8A 4BBRC 1JLGA 2DGTA 2K7KA 2KG0A 1O51A 2QSWA 2YPZA 2ILZA 4DL4A 2LQBA 4I2QB 2YU9K 4FYVB 3Q8SB 3DOKA 2R7ZK 1XXCA 5B0FA 4Q45A 1TWCK 4HEA9 4L73A 5THWA 2ASDA 2XGPA 1X5SA 5T41A 1LFWA 4OX9J 1NSKL 2MLZA 4RKUC 2DXFA 1HNVB 4QIWD 3W64A 4U95A 1O28A 3DRPA 3GTLC 5IOSA 1WSVA 2J7KA 2ZH4A 3MCNA 2IJRA 5J2QA 3JQKA 3MECA 2E44A 1C1CA 4CQ1A 4ECXA 3H2LA 2ZFZA 1RTDA 1X5TA 4TXSA 1NSPA 3DRSB 4EO6A 2BQRA 3J80Y 3I96A 1AUSL 4HACA 2MYFA 4C8NA 4A3DK 3M6VA 3SCLE 2IY5B 2LP4A 5AE3A 1WI6A 2JLGA 2APOA 3HMJG 2F65A 2VUMK 4O3OA 2DRDA 1S1VA 2XS7A 3KFWX 5FLMK 3T1HF 3B82A 4KAIA 4LFCJ 3DOKB 2J9DA 1IBKF 4LSLA 3VQTA 5DDRC 4LRAA 5ETVA 4OYMA 4C2MC 3LQVA 2Q43A 3RRKA 1TUGB 3M4XA 2GSNA 3PNIA 4DSEA 3MOZA 1Q7YT 2W8LA 4IOAQ 1CJVB 1UW4A 3MMJA 3CB4A 4C48A 5IM0A 2YX4A 4NMXA 1G3OA 3DMJA 4I6WA 3G86A 1HW9A 1VQ7S 2CQDA 3D5MA 3BJYA 1C0AA 4ERDA 3SQGA 1F7UA 5B08A 2ZOGA 4JI8J 2GJIA 3PEJA 3TOQA 4HDGA 2F5GA 2JDJA 4EK2A 3KKFA 3IRXA 2DISA 1ISEA 1XC9A 4K0KF 3VAIA 4DMZA 3FQKA 4M5NA 2AEFA 2IAJA 4DZ6A 3HJVA 1PKUA 4LFBF 4AT1B 3MCOA 4K4WA 1O6XA 4CZCA 4KB4A 1JLFA 3GYGA 2V63A 3L3CA 4G6VB 2GV1A 4LFAF 1T3OA 4Y65A 2RUSA 3R9LA 2V2KA 2CQ3A 5A8RA 2M3DA 1FRHA 4OJ3A 1S48A 2FYXA 1HWKA 3FEZA 3L95X 5IXUA 4KM8A 3W65A 3H0GK 4ZPDA 3QT5A 4PG7A 1JLEB 4QJVA 4CLKA 1TU0B 2OFHX 4QBUA 1J27A 1JJ2R 5HL8A 4A3IK 2PPBA 3DU6A 1R43A 4CI0B 5DGBA 1I51B 3T02A 1VQ9S 4YOEA 4MIAA 1I94J 4OIXA 4XAKA 1NXIA 2DB1A 4DCPB 1HR0J 2E7WA 2DNZA 4LIRA 3TFIA 4A3CC 5IP7K 1UMJA 3EUNA 1FFGB 1PGZA 2RF2A 3T6JA 5C7PA 2HNDA 2IHR1 2VC1A 3W2WB 5AE1A 4DV6J 2V0NA 1SXLA 1X9SA 3CQZK 3PDNA 1FEHA 1FRIA 1Y7PA 2A3JA 4TY9A 3TJAA 3KOAA 2UUAJ 1VGYA 1MN7A 1N48A 5L38A 4A8YA 4DQPA 2GZOA 1RT5A 5A8WB 1M5HA 2YWGA 3RR7A 3OTOJ 3A12A 3OBIA 1RBLA 2B9WA 3OXGA 2ZZMA 2VA2A 5AXKA 3GIMA 1S97A 1X4EA 1MWZA 4ANDA 2LLZA 1KONA 4USJC 2OJ3A 2MTLA 2CFAA 4BBSK 4PQUB 5F41A 1HLWA 4FPRA 4F50A 2DGVA 4ZVRB 4LVNP 1U1NA 2COLA 2YQ0A 3FOEA 1S0NA 3PIPQ 3TARA 3KLHB 5IYBK 3PYFA 3POTA 1RISA 4RBVA 1RBAA 3MPWA 4IKAA 4B3RF 1UKUA 3NGSA 3H3VD 1KQ4A 4F4KA 5KAKA 2ZNYA 3P3DA 4PG4A 4KSEB 3PY8A 4ZMMA 5KFXA 3PCOB 4CO3A 3P49B 3HT0A 3GTKC 2HVDA 4DV4F 4DV3F 4GT9A 3GTQC 3D67A 4XTTA 4YB5A 2I5JB 5CYQA 3MM7B 3PKYA 4XPCA 2EFPA 2IJFA 1TWFK 3G4CA 9RUBA 4NCBA 3CC4S 2IM1A 4RR5A 3K8VA 1Q4RA 5KFQA 3TA0A 4P5BA 2ZDOA 1ULRA 5T7LB 4LF6F 2BVZA 2VFRA 4M94A 3CW2C 1Q0NA 3B54A 4J5OA 4OYPA 2CJBA 1DLOB 2KHCA 3DLLQ 2CXEA 2YX7A 1U47A 2V6UA 1LWCB 1WSRA 1HNXJ 4XDCA 2CQ0A 2LMIA 2VUGA 3BYPA 1B70B 1IJFB 4LF7J 2IRXA 3DYAB 1MMNA 2JFDA 3G8SA 2RQKA 3FKIC 1OSCA 4C8MA 3S15K 3FZ2A 3GEEA 4PRFA 3S2DK 4ZVGA 3FKBA 1XZQA 5KFFA 2R7UA 3PJXA 1HWUA 5J1PA 1H2TZ 2W7AA 2HQDA 2IM2A 4PKDB 2EKYA 2W2PP 1RABB 1HL6A 1U4BA 3A3NB 4OIPA 1IKXB 1RK8A 2XWYA 1V9OA 3THVA 1EI6A 4TQSA 5HSPA 2DGXA 2IPOB 4DR2F 1UJ4A 4UOCA 4USUA 4AL5A 3AOCA 1S12A 4V19J 4UT4A 4C6AA 4MH8A 3KMQA 4ED5A 4BLBA 4CLSA 2DTJA 4FF1A 4DPTA 2BANB 2RRAA 3PZPA 4KM9A 3U1LA 4S0MA 1YCLA 3M1VB 2O5IA 1RU0A 2PDAA 2JA7K 1UWAA 2B43A 1KKHA 3L4JA 4WU2A 4IQXA 4WXOA 1S4EA 3PO2K 3TFHA 2OMOA 1U1RA 4HL9A 1T9XA 2AT1B 3SEOA 5KFTA 3TYTA 1RQ0A 4OHXA 1JXEA 4JI7J 2FLLA 4X4SA 5A8KB 4WP9A 2QTWA 2OUGA 5E33A 4DLGA 2O1PA 4C4WA 4GTAA 2V8GA 1TWHA 1PO6A 4X84A 5KFRA 1VMBA 1A0OB 3MEDB 3TRGA 3SQGB 4DPXA 3ENWA 3MR2A 3DXJA 2KWAA 2DGWA 3GR1A 3R5AA 1VQ8S 2GQ2A 2VUMA 4C3IC 3BR8A 4CRJA 5C42B 2Z2LA 1U8WA 1SI9A 4DR6F 1E6VA 3J7A1 2PIIA 1Y1VK 1PYTA 2OPSB 1FDAA 3FDSA 4USKA 5C4XC 4R0EA 3ELHA 1TVRB 2WSCC 4KBIA 4AYBD 3OLBA 2OPQA 4ZVUB 3TVYA 1D9AA 1RADB 3DN9A 1NK6A 3OLAA 2MLXA 3AJ1A 5FJ8K 1I50C 2BXJA 2VH7A 4MFBA 4OYOA 4PQAA 1UEKA 1NHUA 1RYSA 2VD3A 3NBPB 1XR5A 4FM9A 4HKQA 2NUUG 1Q8KA 2AJ4A 1YJRA 2CPDA 2UU9J 3JYTB 3TAPA 3SSRA 4O3RA 1HWIA 3SMZA 1JJ4A 4C2MK 2N7YA 2F4FA 3I87A 5GAHU 2FGOA 5MLCV 1GT8A 2LA4A 5EHHA 4R0JA 4J9PA 2DIVA 2VUMC 3DRXA 2MGZA 2C42A 1SQEA 5KFVA 1N88A 3S0XA 3T1HJ 1YIJS 4A3DC 1NSQA 3KHRA 4LR9A 3W5ZA 1WHYA 1RKIA 4QIFA 3M4OC 1TWAA 1BUXA 2E9ZA 4IO9Q 1FF2A 4K50A 1CJKA 2F9DA 3LTOA 1UAWA 1X0PA 4OV6A 4DFKA 1WQHA 5CA5A 4DV4J 3BSNA 3DRRA 3N5FA 3DXSX 1K1QA 3LPXA 4I2PA 2DHGA 5G0RA 4ETXA 5JVOA 5CAAA 1F7VA 4Y2IA 5C4XK 2BZ2A 2VG5A 5LL6d 4FF3A 1F3VA 4BWJA 2N3OA 2V6TA 3CJ4A 4WP8A 5DLGA 3UDEA 1ZZNA 3I9ZA 1GXTA 3M3YK 4W98A 4RUCA 4OZNA 1OPIA 1NM2A 4IR9A 1FT8A 2HIYA 1WQGA 1N33J 2M7SA 4LRDA 4YY3J 4ZIVA 4U8VA 1ZETA 4GMKA 4QWBA 4QU6A 2YNIA 4OX6A 2HVHA 5KFJA 3CDEA 2R7ZA 2P8TA 2UXBJ 1T02A 1U25A 1YZ7A 2CDRB 3KLEA 2AV5A 1VK3A 4LR7A 1JLBA 1YJWS 2DCLA 4KV8B 4CM0A 5KFDA 2H5JB 4LLGA 3ITHA 4RNMA 2LKZA 1BLUA 1X4BA 3EGVA 4WFYA 4A3BK 4DSKA 1VR6A 4NXNJ 3UO0A 1B64A 2MKKA 2IVFB 3VHQA 4B02A 1YDLA 1VGXA 1REVA 2CNLB 5BYRA 1UCNA 3Q22A 1IKYB 3LH2S 3P8BB 2GQQA 2DNGA 2C2OB 5IS2A 1FWPA 2R93C 3BSAA 2W4DA 1FDBA 2LQ5A 4Q5VA 2FD2A 1N6QA 3EWGA 3FCWA 1WF2A 4G1QB 5SZTA 3GFZA 2HVIA 1BD6A 4QWAA 3H5XA 5BJRA 3CC7S 2HHHF 2WW8A 3EMTA 2VIHA 4KMAA 2OSQA 1FKAF 4B3TF 1W2BR 1I6JA 1RU1A 5DGAA 2R93A 1FRJA 3MPUB 1C0TA 2K7JA 2UUCF 2DH7A 1YJ9S 2L9WA 1X4DA 3GYNA 4I7FB 2HIQA 1QAIA 2AKWB 3DLJA 1WDTA 2ZH7A 1RACB 4B3RJ 1S4FA 2BV3A 5IFMA 4YB1P 3MR6A 4KB2A 1RT4B 1O0PA 1TUVA 4TY8A 4EEYA 2H4YB 2LFVA 2QLFB 3MR7A 3HVTA 5IV3A 3W2VA 5CH7B 2JA5C 1UEVA 1N0UA 1VS3A 3Q24A 2D1CA 3CJKA 4DUYF 2V8DA 2NVYC 2W9CB 3CDUA 1JLQB 2W1BA 1SUQB 3R8YA 1Q1KA 1IQ0A 4GKKF 4AH6A 4DS5A 3S8SA 4C3MA 3N79A 4DX5A 3N0VA 1CJTB 3LAJA 2C1EB 2H4WB 4F0KA 4W92B 2EW9A 3HDSA 4ICLA 5D0EA 2JLEA 3WBZA 3K0JA 2Z58B 2AJFE 1TWCA 4ZLLA 3BP3A 3BV8A 2CQPA 4A3GK 1TV6B 2FDNA 4HI1A 3G9CA 2XNRA 1D8ZA 4KE5A 2AJQA 3V5RA 1NO8A 1SV5B 2FHJA 2N4CA 2UUBJ 1TELA 2ZM6F 4DF4A 4QIWL 4NLSA 4QWEA 3NNHA 2V69A 2XMWA 3M8QA 1S6PA 2VDHA 3PX4A 2CNNB 4DL7A 2JA6K 5CYMA 3QJJA 1DQ8A 8AT1B 4FBTA 4LK0A 2BQUA 4RW9A 2B0GA 3M30B 4WU3A 3LANA 2DBBA 3RTVA 1HQEA 3UNGC 3IFEA 3PJ9A 3QAUA 3CGIA 4CLTA 4A3FC 2QMUB 1VQLS 1R0BG 1ZVUA 1RTZA 4FYDA 2XC9A 4KPCA 4DL3A 2OELA 1U6ZA 4OMFG 3BGRA 1U6FA 1EQRA 1JKHA 4LR8A 2JEFA 5K8PA 3PFEA 1UWBB 3FBEA 2VPZB 2JRSA 2HFUA 4X64J 3LUYA 3K57A 1D3WA 2BMBA 3FBBA 5IC6B 3JSMB 4YFKA 1D8YA 2CPZA 5L9XA 4KKOB 1ZTTA 2E9TA 4K4XA 4AUKA 2ZNZA 3RAXA 5AXLA 3S14C 4LJMA 3HXAA 4YUDA 2LQJA 4OX8A 2HQ3A 4NE9C 1BMQB 4G7OA 2YNGA 3CJKB 2R8KA 2DIUA 1U26A 2DHAA 2DD8S 3NG8A 1RWUA 1RT7B 2V4JB 3OTDA 1URRA 2RT3A 4DV7F 3ICLA 3GJRB 3OUYA 1P6TA 4DSLA 4NOHA 4ZP7A 2HMIA 3QGIA 4ZPWR 1IKWB 1NK0A 2HNYB 4MMOA 2RDDA 1E6YB 2DR9A 4MKVA 1FESA 1UVIA 4RNNA 3V81B 3T5HA 5E3AA 3HFVA 1XMOJ 2V8HA 2R9LA 3A3OB 1XZPA 4W4MA 1WG5A 1AYEA 1KP6A 2ROGA 3LAPA 2GIQA 2AHOB 1U1PA 3S1QC 1TVRA 3RB6A 5LSLA 1SKRA 1W26A 2DNRA 3GU0A 3FUYA 2QA4G 4GO5X 2J0SD 3KJQB 3UDCA 3QQCD 2XG8A 3EVOA 2W2OP 3NAHA 1RYRA 3IAS9 4P5AA 2VASA 1F60B 4YMEA 2VHGA 2IBOA 4KDDA 4KGKA 2HWIA 4A8OA 4K4UA 4WFZA 3GCXP 3H7HB 2BW2A 1FEEA 4ZPVR 3TANA 1NKBA 1JWWA 3G6YA 5IOTA 6FD1A 3BKUA 4KT0C 3U1NA 5IYBC 1LWCA 1U48A 2QL7B 2W7PA 2BRKA 1YBUA 3P5BP 1AT1B 4WJBA 1UVLA 2GGPA 2X1AA 3LP1A 2E1MC 4ZN1A 2WVCA 2CJAA 1RWWB 2HGLA 3GTKA 2L48A 3VGSA 4A46A 4L3KA 1HMVA 4F4WA 2W25A 3IBCB 5LMUJ 5ETLA 3UD5A 2R8HA 2F8MA 3BBFA 4DR7J 3R6GB 4C8YA 1BC6A 5GADI 3TI0A 1G4CA 5JXSA 4RUAA 3KTQA 4GC7A 4P74A 1I6HC 2QA2A 1DQAA 3HFKA 2CQGA 2HBRB 4UF4A 5HN0A 1OYDA 1S0OA 2MQ8A 1FKOB 4MKBA 4ECYA 2BYCA 3OTEA 1YHQS 2R7ZC 2C22A 3UWTA 2V9WA 1YLXA 2V6AA 2VF3A 3UCUP 2E9RX 1R3NA 1C0TB 1N33F 5D3GA 5LMNF 4X4NA 1C0UA 1S6QB 3ET6A 4A3CK 2W9BB 3K58A 3QT8A 3THTA 2ROPA 3WODA 2QG9B 4X65F 3PO3C 2CQBA 4DJBA 3B6BA 3MMAB 1I6HK 1TP7A 2ZDPA 4ECUA 1IR0A 2OAUA 3S14K 3DLKA 1D0EA 2NVYA 2A2CA 4FS2A 3O3LA 1Q95G 1NJWA 2XCPA 4CH7A 2RU9A 2HQIA 1HQMA 3GZ7A 3VCDA 4MQ9A 1EQMA 3D68A 1HA1A 1XXBA 1QAJA 3DC2A 3LP2B 3HFZB 4NLYA 5KFNA 3QPIA 3W5XA 3RUBL 2PI5A 1VJQA 4RMFA 1T0TV 3MM5B 3FEYB 1B0PA 2NLWA 1B4AA 2E5LF 3UD4P 1UA0A 3QO9B 1X4HA 3ZZPA 4JI6F 2L9NA 1SH3A 1XNRJ 3OXLA 5EGEA 1ZBSA 2RNEA 2HYIB 2Y0BB 2B4UA 3VGVA 4E2FB 3SFGA 4C8OA 3ITHB 2R8JA 2ZUFA 4X62J 4CO0A 5IT9Y 1JQGA 2C3PA 1K83K 2V67A 2W01A 5E5NA 2KFYA 1R9TC 4MIBA 4NLTA 4EBCA 4ED6A 1FFSB 1IW7A 4J7CA 3V6KA 3UW1A 3FKIK 2F40A 3VVTA 5C24B 1S1TB 1PIEA 1VCTA 2Q6BA 3C14A 3T01A 4XLNA 4HHJA 2K3IA 3SDEB 2KHDA 1C1BA 3GG0A 5E3PA 5IZHA 1EJ7L 2HWHA 1MU2B 2HLUA 4LMZA 1ZS6A 1T11A 4MK7A 4LREA 2XS2A 3M05A 2HNYA 4Q5SA 2E2JC 3W8GA 4GTCA 2ZHBA 4CLYA 3M8ZA 4TKTA 5FLMC 1LWXA 2DO4A 4DX8H 4AQYJ 4JI1J 1WTBA 2Y8YA 4WFXA 1RAOA 3PW4A 3CMQA 5A0YA 4RBUA 4Y00A 4OI1A 1FKPB 1F93A 3ZZUA 4EBDA 2OEMA 1RHQB 2C3OA 4F2RA 5A8KA 4F67A 5ETQA 5KG1A 3FSXA 1IBCB 4PPZA 4K8RA 3HZGA 2RH3A 2HNDB 2JEJA 2XS5A 5A0YB 3NOGA 9ATCB 4ZPTR 4B9LA 4UW2A 1S79A 1RWNB 1QSLA 1FRMA 2GFFA 2OTLS 5KFAA 1B4BA 4AFFA 3R5BA 5IP9K 1KD1T 2KYZA 2Y3YA 4M5HA 4A48A 1I3QC 3VALA 3TX0A 2HHQA 1GFWB 3PO3K 3MAAB 3SFUA 3K8WA 1JKHB 2WB1D 4C98A 3C15A 3BO3A 1YG0A 3BGRB 3BGUA 1IL2A 3Q8UA 5DRKA 2AYEA 1QTNB 4GTEA 3R97A 1RAAB 1V5IB 3FFIB 2QYGA 3CULA 4UUXA 2NSCA 1MG7A 1USOA 3FCHA 2E2JK 2EG1A 1V6HA 1TWAK 3HVAA 3VAKA 3KHGA 2OHDA 5DZ7A 1FKOA 5J1EB 1TMMA 3MD3A 3PHEA 5KFZA 4M95A 4DV2J 3LO3A 4FVCA 2OKQA 2KFZA 4O4RA 1UA1A 5F8IA 2ZWPA 4X4QA 2PMHA 1X4FA 1IBLF 3I0RA 1HWLA 4C2MA 4FZVA 1TL5A 4ZS6A 2ZKUA 2V50A 2HFZA 3FSYA 3M8PB 3IN5A 4K4SA 5RUBA 3HP6A 4RW7A 4PWUA 5DJBA 4YFNA 4FNHA 1HBNA 3KHLA 4EI2A 3T19A 4OI0A 4UZBA 4DR1J 2B51A 2GX8A 3KJFB 2FIUA 2Z8QA 3IAM9 2GQCA 3KYLA 1O27A 5B0BA 2QMWA 2XWXA 5T7LA 3S16K 4KHPJ 3DKDA 2R7QA 1JLGB 3CDAA 3MEEB 4A3IC 3S6EA 1UW9A 2VQEJ 2OSRA 5L1LA 5FDLA 1WWHA 3NOCA 1LXNA 4USIA 3DLKB 2ZUAA 3KMSA 4GKJJ 2L3MA 1KHWA 2I6WA 2E1CA 1SJ1A 1WTFA 1KLMB 2Y9HA 1TWGC 3OFHA 3EGZA 4CO1A 3GSIA 4A8MP 4IUFA 4RU2A 1BWEA 4H4OA 4XIUA 1MROA 2OPRA 3WC0A 1NEEA 1D9FA 3QMQA 5IYDC 1RAIB 4Q4ZA 3V4IB 1S6QA 2NYHA 4U7CA 1JLCB 3VTIA 1VISA 1WACA 4LOWA 3OL8A 2VFTA 3J7Z5 1NCLA 1HI0P 4U7UK 2UVWA 4X6AC 4A8FA 1TFYA 4NLOA 2HNZB 4M5JA 4NEYA 2KO1A 4RX6A 1CLFA 5DG9A 4OZ0A 3V4IA 4RNHA 4RJVA 2HG4A 1ZZFA 1YJVA 3PYGA 3DDKA 4PXCA 2VZ9A 2E5LJ 1TWHK 1F0XA 1REGX 4JI5F 3KJNB 2K8GA 1NKEA 3CCJS 2HNZA 2FQOA 2HS3A 3NEKA 2E1PA 4JV5J 2KYXA 4BY1K 2DHSA 3SIPB 3R1HA 3HSGA 2QX0A 2B63K 4PABA 1HYSA 2XSJB 5IP7C 4WYLA 5FJ4A 2AP6A 4ZPBA 1RHMB 3TZYA 4W90B 2DEIA 2MKCA 2HEKA 2FHMA 2HBZB 2LU2A 3I4NK 3BQ2A 3FRZA 3P45B 4XLPA 2D74B 5JVGQ 4DBQA 3E01A 4F3OA 2DO0A 1T9YA 3PYDA 4F4XA 3D6MB 3H4DA 2R92K 1ZAWA 3JSMA 1S0VA 3NWRA 2PSZA 2D41A 3GIJA 4O23A 5GADU 2CYYA 1RT2B 1K9MT 4IFYA 2G0JA 4Q44A 1U24A 3Q3QA 3FNNA 1UWBA 2WAQD 1LEOA 5F8JA 1O2AA 2NXJA 3R7BB 3S17C 1T3NA 2EXUA 4K4TA 5F9NA 3AQOA 2CPFA 2KH9A 2Q1LA 1WOPA 4NXNF 2JL9A 1JXLA 2XI2A 3GFHA 3N9UC 4ELUA 5HVGA 2Z2MA 3MM7A 3FK4A 3H25A 2VDIA 3AOBA 3PG9A 3EX7B 1HBOA 5D15A 1QVFR 1Y1VC 1JIHA 5ETMA 5M2RA 4WTYA 4B9SA 1N0VC 2D3UA 2LU1A 1WC4A 1J5OB 2HVZA 1U2RA 3J81j 3O5TB 3MMCA 1FX2A 4JI3J 4BDPA 2HMIB 3GLJA 2D9OA 1HNWJ 4Y2CA 3DHWC 1RHKB 2NVQK 4B9UA 1LOUA 5IOQA 3A8KA 1T05A 3HK2A 4M5LA 2B8QA 1CJUA 4LSZB 2HHUA 1IQZA 2GIFA 4DR6J 4ZOSA 3I0SA 4OZJA 2R2TA 4I68A 4C11A 2HZCA 2JH3A 4OJGA 2P2CB 5DS7A 4JI5J 3J81Y 4BC7A 4DPWA 4KKOA 4JI8F 2BKNA 4U96A 1IWGA 3EVWA 2RJZA 4O2DA 4IYQA 3US5A 2LDYA 2LXIA 4EO8A 1X4GA 2ZD1B 1SJQA 3HHDA 1BQNB 4JV2A 1RHUB 1WC3A 1EP4A 1HBMB 2ZH3A 3W2WA 2OI2A 3KK1A 1RJJA 4ED7A 1WCMA 1FRKA 2N82B 3EGWB 3BS9A 3IA0A 5LJ3Y 3CE8A 4IOCQ 1RDRA 2CJXB 3GTLK 3TUJC 4NLPA 4P73A 2XMTA 1RTHB 3NAIA 4DQRA 2MXYA 1T94A 1A7GE 3AH6A 5C44C 3HHLA 2UXDJ 4K5SA 1FVSA 2JX2A 3JYTA 2BJ9A 4WF9Q 4YFXA 2NS1B 4LIWA 1HNWF 2UZAA 1VQMS 3CDWA 3AJ2A 4J3NA 4I6AA 4JI3F 4I1TA 3D6FB 3GEIA 3CO9A 3S2DC 3PV8A 4C9DA 1K47A 2A2DA 1ZYQA 2DGOA 3VA7A 1XIQA 2HS0A 4I4BA 1EP4B 4TU9A 3MHYA 1TAQA 5C2CA 2OO4A 2A0FB 5KFHA 1FNOA 1M5SA 4F25A 3H42A 1GH8A 3OREA 1MNEA 3QAEA 2EFOA 1RT1A 1S1WB 2JA8C 2LA6A 4CT9A 3CJ0A 2NXCA 1WD6A 2XQCA 4A8SA 2VQFJ 1U1QA 4I2QA 2FY1A 1VDHA 4OLPA 3HO1A 2Q66A 3RGIA 1V3ZA 2NXEA 2MKSA 3GTJA 3G8TA 3V6JA 3BBCA 1IKYA 4X6AK 4PAAA 1VQOS 1NBEB 5DETA 4I6YA 3S1MC 1GXLA 3GTOK 2W24A 2R7SA 1Q78A 2HHVA 3EZ5A 1X4CA 4FKXA 2WB4A 1YBTA 1VLYA 2ATLA 4ZVEA 1JLAA 2N4DA 3LP0A 4AL7A 1EIYB 3Q8RB 2DVIA 1UETA 3HHKA 1N5YB 3HKWA 3JTNA 1TK8A 3ZO7A 4PWDA 2XCQA 3N0CA 1CJUB 1CQMA 2R7OA 1AUDA 1H2VZ 2BJ3A 3FMWA 4F3QA 2JA7C 2WVFA 5J2MB 2DJWA 3P4UB 3KLEB 4DXLA 1C4CA 1L3VA 3HXMA 2Y1JA 2F8EX 3M1VA 1GMUA 1V3SA 3LGMA 4QYZJ 4RW4A 1VBKA 1HBUB 4IFVB 4F4AA 4WKYA 1BQXA 2IRUA 3MUVP 5LXRA 4ETZA 5LJ5Y 4L72B 1S49A 2XHWA 4QWDA 1L3TA 2GHWA 1GMVA 3JSRA 3JTPA 3BKFA 3K7RA 3QIPB 2OTJS 2HRYA 4O0NA 2O66A 3UR3C 5D6GA 5KG6A 3CCVS 2N3LA 3J7YI 3BZQA 1INNA 3DXBA 2GJ2A 1S59A 1AW0A 1K44A 1U0SA 3RRHA 4X65J 1DTTA 2OD4A 3ZZOA 3EDQB 3QT7A 5IT0A 4HTJA 3PTWA 5J2NB 2BQ3A 4A8KA 2XCOA 4DUYJ 1HD1A 2QFIA 1X9WA 1G6BA 2C2KB 5EWGA 1HI8A 1IBLJ 4KRWA 1CS4B 3QSYB 5AT1B 3D7SB 2EKNA 2F4VJ 2ZJRQ 1BY9A 4C3JC 5A6WA 2FJDB 3I56S 3PJWA 2VPWB 2LVWA 3SV4A 3ULHA 1SL1A 4PG8A 2IRYA 4BS2A 1SQFA 3CD6S 1DLOA 5DQIA 2MJNA 5IYCK 2FC9A 2R93K 1HBNB 1VQKS 4ZH4A 3AHPA 2H54B 1K83A 4FF2A 2BKPA 2HZVA 3R6LB 1TFWA 3V2UC 5HQ8A 4DSFA 4WFNQ 1GX5A 4KHRA 1ZAXA 3S2HK 2D69A 5K8MA 3MZIA 4IDKB 3HT3A 5J2NA 2ZBPA 1ZOTA 2ERRA 1JNRB 1F2GA 2B6AB 3R7SB 3NY0A 3BSCA 4N8NA 1VRUB 2QE5A 2YU9A 4MFBB 3MTKA 2IM0A 5M3MK 1X8DA 4URQU 1T03A 2UVVA 1PYOB 4FN5A 1JLFB 3FGVA 5BXIA 5JMNA 1KTQA 4TQRA 1YGYA 3W61A 4G0WA 2WOMB 1PBAA 3CCUS 5HLFA 4KGMA 2EVZA 5L46A 2ZH9A 3OHBA 3C16A 1ZTWA 2CPHA 3IRWP 1WQFA 2QL9B 1I5OB 3LPEA 1HBUA 1NDCA 5CD4H 1ELOA 3K5LA 4BBSC 3SQOP 2GW8A 4OYBA 2HQFA 2E1AA 5DDQC 1Y5LB 1Y10A 4U6PA 1R9TK 4ANEA 3KUEA 2LEPA 2HQCA 5CYJA 1WHXA 4ID8A 1MW7A 1RT3B 3LAMA 3BBBA 1KTVA 3HOXC 2QGFB 3CCMS 3N6NA 5U47A 4KR0B 1L0WA 1GTEA 3E51A 3VGUA 3CC2S 2J9CA 1R6YA 4Z7YA 1RB0A 1O2BA 4WP3A 2JA5A 3GR0A 2OH2A 1Z1ZA 3RBEA 4WILA 3MEGA 4NL5A 3TA2A 5I3PA 5BR8J 1CULB 4NLVA 2XI3A 3UVJB 1YX2A 4K4YA 2A68A 5HMWA 2V34A 1WHVA 3AOAA 4TVAB 5K9FA 2VOPA 3T9NA 3HSJA 1JOEA 1FTCA 4G1PA 4U9RA 2QFJA 1KWMA 4KN4A 2RRBA 3HD1A 4QJVB 2AQ4A 1RKJA 3DLHA 3EPGA 2KXHA 4NYZA 3BO2A 2I2YA 3HKZL 3MPVA 2DH9A 4Y52C 2E7XA 4G7HA 2XZDB 1LK7A 2R3VA 5JJBA 4LQ3A 1KHVA 3QWPA 5A8RB 2KDOA 1TAUA 2WZ1A 2ZKTA 3I4NC 2XY7A 1S1UA 1I3OB 2BJ7A 3GYXB 4B3OB 1RTHA 5ITHA 4UZCA 4B17A 3ADAC 3R7NB 3BB5A 3BYRA 3DGPB 4LF5F 2F1FA 5C4JC 2OEKA 4V1Ak 2FZCB 3FBCA 3FRYA 3R2DJ 3KK1B 3FMBA 2VV5A 3HHLB 3GTPA 2R7TA 1OQ3A 4ZP8A 1UP1A 4Y2AA 5M5WK 3BH7B 3V4GA 2F8HA 2JEGA 4MK8A 1ZM3A 1QTMA 1BJTA 2XZTB 3PACA 7FDRA 2I8EA 1M5KC 1N34J 2NVXC 3K59A 4LSNB 2H9ZA 3QZ7A 5CCLA 1HBMA 4ZITA 2PI4A 3OW2R 1EH1A 3LP2A 3NLCA 2FLNA 4MEXA 2VC0A 4LQ9A 5IORA 2HAFA 3N28A 1FKPA 1SQGA 2C2ZB 3CTRA 3NKYA 2CPXA 2VKRA 3KK3A 4X4TA 3MTJA 2OMLA 1OJ4A 4MIWA 1HQ2A 4RPFA 4Y7NK 3GIIA 3TEGA 4KC6A 2ZHAA 1WC6A 1S1UB 3ZFVA 3PW0A 1RU2A 1GMWA 3GTQK 1LV5A 3U1MA 4WE1B 3GSDA 2KVIA 3GV8B 2J8AA 3HSDA 1SC3B 2B7CB 3CPWR 4RUHA 2CNKB 1U7LA 4OYWA 7FD1A 3CD7A 2D3ZA 1B0TA 3D3BJ 3G87A 1N5QA 2O5JA 2VFUA 1XMQJ 2BA9A 1RHJB 4Q0BA 4O3QA 2BX6A 4KASA 2M52A 1CC8A 5J2PA 1VLOA 5HK4A 3GJQB 3ZTSA 1YKWA 2MZSA 4K59A 5CZVA 2XNQA 2RDJA 4FS1A 4OIRA 3GCWP 3PVXA 1FXDA 5KFBA 4L74A 5GAHI 3N5BA 3IR5B 4DV5F 1KVJA 4OX7A 2AGQA 1SJFA 5KG2A 4DF8A 4ZPAA 3KLVA 1GK8A 4J9NA 1M1KT 1FX4A 1WIHA 2QMXA 2E5GA 3MM5A 1NMEB 3IWXA 1SC4B 3K2YA 4QIEA 4G1QA 4RO0A 3MPYA 2JA8K 1LXJA 3SSSA 2KU7A 1H38A 2CWXA 2PEHA 1QUVA 1NK9A 4OI3A 3CJSA 4JI2F 3MAQA 1C2PA 4OHWA 2W7VA 1H7XA 4PG6A 5LMNJ 1LWFA 4EFAC 4WBFA 1PAEX 1UPPA 2YNHA 2J7WA 1MLAA 3KLFB 2B63A 4PCQA 4A93K 2HHSA 2E5JA 3GTMA 1VYAA 1VJWA 4O3SA 1U2CA 4YFUA 1VK8A 4LF7F 4NLRA 2BDPA 5AJ3F 4X4PA 2VPYB 3KLIB 5A76A 4UUWA 1KQGB 2GIRA 2XLKA 2C2MB 4NLWA 4DV1J 3PRBA 4GTLA 3HZEA 2ZFHA 3LA0A 1NH7A 3VZIA 4D3HA 4CO2A 1P8GA 3TX8A 4C3JK 1LWEB 2PMZL 4V19X 4ZP9A 2F9JA 4LRBA 3OJUA 3UN5A 1EETB 2AGPA 4J9MA 2D3O1 2WW4A 4GKJF 5DLFA 1OQ6A 4ZK7M 2SXLA 5F0UA 1XN9A 4KB7A 1J5EJ 1FE0A 4IRKA 1FXRA 4X62F 3I31A 3LP1B 3W66A 2R92A 4UTGA 1BGXT 3SI8A 3UE2A 3J80U 2NREA 1FERA 4DV5J 5L9NA 4DWIA 4P52A 1VQ6S 4DEZA 1N8RT 2R7RA 3QJLA 1SL2A 5SUHA 2FLOA 2OIHA 2V6SA 1U45A 1YITS 3ILOA 1D09B 4YG2A 3NGRA 3NP5A 4GO7X 3B8HA 1M90T 2EI5A 4NX9A 3W7BA 3AB2B 1Y0HA 4KH1B 4ECQA 2ZVIA 4KO0B 2VOOA 5IM0B 1Y1WA 4LFBJ 3DOMA 1Y1WC 1HPZB 3E2EA 4NA1A 1FD8A 1YK9A 3AXMA 1F3FA 1IBMJ 4CH0S 1FD2A 2IC3A 5E3CA 4JI2J 3DHXA 3BQ1A 3NMRA 1B99A 4O44A 3PO2C 3M8PA 4H4MB 2YWWA 5L1IA 4LQYA 2QIFA 3HF5A 5KOXA 5KFWA 4PUOB 1SVDA 2BBEA 4FBUA 4ZLNA 5ETSA 4QQBA 4B3SJ 4OINA 4HT7A 3NS6A 5K20B 2RVJA 1RTDB 2RSQA 2JA5K 4CLZA 1TKXA 5C42A 2Q6CA 2NXUA 3CD0A 2CQHA 1EARA 1QUPA 3SCJE 2MMYA 3DRPB 3N01A 4A47A 5KFLA 2MKIA 2IAJB 2DPIA 4G0VA 3IXQA 4IG3B 3JTOA 4IG0A 4YEAA 2JA6A 4PXEA 2B9XA 1KN6A 2KT2A 2K3KA 2IDEA 2JWNA 2VJVA 2MQQA 3VF0B 4DR7F 3L4BC 4BY1C 5G4DA 1JK9B 4O4GB 4FZBA 3LF0A 1F1BB 3JS9A 4CM2A 3ETMA 5DO2A 2Z0GA 4HLBA 3VGTA 4OHZA 3ZZZA 4U7UD 4C3KA 4YB6A 3C46A 5M3FK 1RTJB 3DLEA 2MLYA 1PCAA 3Q8VA 3MD1A 4GTFA 5AXNA 2CA9A 5TMFA 4PG5A 1Y00A 3FEXB 4ZVQB 3I82A 2M2BA 2RE1A 3GTJK 2OLWA 3O8WA 1S1WA 2IM3A 1U1OA 1UFWA 3R5CA 3AA8A 3S1TA 1PSDA 3OFGA 4FYYB 4Y28C 1WOSA 3BEGB 3OTBA 2E5HA 4RWWA 5D78A 3VQSA 1RA7A 5LOQA 3OR2A 3J7ZT 1VRTA 1GXUA 2BM0A 1Q8LA 2YKNA 5KT5A 4DFMA 1Y5NB 1AFIA 3IPJA 4LJZA 2I1RA 4A3JK 4PR6A 1IBKJ 3M8QB 4A3MC 3ISZA 1FFWB 4CLLA 5LMUF 1IKXA 2PHCB 2OP5A 1HNVA 1SMYA 2R7WA 3CJQA 3TAMA 3OPKA 1OS5A 3OR2B 3DOLB 4UQGA 3K89A 1TL1A 2R42A 4EZ6A 1S77D 3PYEA 1M5VC 2UV8A 5IQ6A 2PEBA 1BQNA 1XR7A 3L09A 2ADBA 1IWAA 5D4DA 3HOYC 1SUQA 4A8WA 5F8HA 2LEAA 2VL1A 3MM8B 3TEHB 1OMSA 3MCMA 2GCFA 4QW8A 4ED1A 4GRSA 2M8DB 2QLJB 3T1YJ 3OL9A 2FJVA 2MZRA 4LF1A 2V2ZA 3F56A 3QIDA 4CLWA 5D0GA 4A8QA 5KT6A 1NJIT 3DYAA 2CFXA 1HI1A 5KT4A 2UUAF 2CDQA 3S1NC 2GSOA 4XSXA 2NQPA 1WF0A 3OL6A 2AJ2A 1RUSA 2DNMA 3PRVA 4KMUA 5HROB 4NA2A 3D66A 3ZZRA 4RUBA 4MTPA 5DG7A 1SC1B 3JB9k 1CVJA 2PGCA 1WEYA 2DHHA 2DR5A 2L08A 4C0OC 2XO6A 2KFNA 4AXIA 4XPEA 3QRRA 4L3NA 2HQGA 3CCQS 3CJ5A 4J9KA 3Q23A 4WFAQ 2PA8L 4B3TJ 1QLNA 3G82B 4I7FA 2G1HA 1C4AA 2KM8B 5HQLA 3T00A 1KC8T 3POTB 4URGA 2ALYB 5C24A 4KQZA 2WRMA 1Y3JA 3DM2A 2Q79A 1S9FA 2EG2A 1RWPB 2NVTK 3G6ES 5IP9C 5KFOA 1O2FB 4BLAA 5HMZA 1FCAA 1R27B 3G96A 4A3EC 1V3RA 4C97A 4GFQA 2YH1A 5KT2A 4YR3A 1X31C 5B0CA 2B5JA 1RT5B 5HAOA 3DI6A 1NK5A 1SKUB 2MY8A 1Y11A 3QO9A 2ZOMA 3HULA 3FCVA 2R4FA 4PUOA 3RB4A 3MMBA 3M8WA 4JUZA 2CFAB 4A3FK 1P1TA 1B7FA 2BW7A 3IG1B 1J6WA 2CUYA 1M1HA 1ZAVA 4ZCKA 3U27A 1H3DA 5EGYA 1L3UA 2DITA 4X4UA 4CTAB 2WONA 3DRRB 4ZLPA 4M5GA 3IC1A 3OPFA 2GMLA 5C2GA 2FZGB 1CBKA 4C3IK 3W3SA 4GVLA 5EGHA 3OHAA 5KFYA 4WJ3M 2XMVA 1YWXA 5D0RA 4Y2KA 1HYSB 1Y1VA 3WX8A 2GS8A 1SKSA 3EXCX 3HX9A 3I5AA 1G2EA 3DDIA 5KTQA 4TYAA 2OGUA 1K83C 2IFXA 1NPPA 3U7JA 2OFGX 4URSA 4RU9A 2HGNA 4ZCMA 3M6WA 5E68A 3GP9A 1DURA 2YWHA 4C8LA 1U8SA 3N6MA 1UZHA 4USWA 3QFWA 1NK4A 3A4TA 4P71A 3HPOA 3ETOA 2IJNA 3BM7A 1BQMB 2HRUA 1AROP 2ASJA 5HBMA 4GVBB 4HVZA 5BR8F 5AJ3J 1VRTB 2C3UA 2IA0A 1VRUA 4OV1A 2KT3A 2YXLA 1KBRA 2F4VF 5G0RB 1UZDA 2V68A 3PW5A 1TL7A 5KFIA 2A18A 2RMLA 2HFSA 2BE9B 5F8GA 3OFFA 4IH7A 3NUHA 2UXDF 4ZVFA 2YKAA 2ZE2A 1N54B 2XLIA 2Y0SL 2FPHX 2MQOA 1HNXF 5DDOC 2CQ1A 3BPDA 4M5DB 1IM4A 2NXNA 2NCKL 4BXXC 4ZVPB 5HATA 4HH0A 4CYUA 1H6KX 1VQ4S 3KUGA 1CS4A 3NWGA 4NLGA 3C8YA 2YNHB 2GVDA 2HKEA 4X66J 3T1YF 3S15C 4M5MA 1PJ5A 5GAGU 3CCLS 3GPAA 1VBZA 4LF5J 2CIMA 5I3QA 3RW6A 2YVSA 1CEZA 3AD7C 4QR2A 3GTPC 1QE1B 3HM9A 3TNVA 2RU3A 4KGZB 3OL7A 3QGGA 4FXDA 2EPIA 4B3OA 2DK2A 1Y4ZB 2AIRB 4RWXA 5F3ZA 3BDEA 1TWHC 2F7VA 2IMWP 1NHKL 4YHHJ 2VONA 1FVQA 1T8EA 1DHMA 1Q5YA 4JOUA 2FTRA 1Y9OA 4NCAA 2J6TA 2B4OA 3ENVA 4OI4A 4I56A 2FB0A 1XZPB 1Q53A 3V6HA 3RZDK 1RHRB 2IYIA 2CJKA 3PO5A 2ZITA 3UDLA 1QDUB 2CJQA 2OD6A 3M32A 4NZ6A 3VAFA 1YI2S 5FLXU 5KFEA 4DR1F 2Z2ZA 2P9GA 1NH8A 1KQSR 2A1BA 3BP8C 1B3TA 4ZJLA 4HHHA 3MFIA 1ZBTA 1S1XA 3T1AA 1G51A 2XY5A 4QCLA 1Z2ZA 3CD5A 1A9NB 5HJXA 4ZJQA 2RHSB 3PX6A 2MKJA 2WBMA 3HHLC 3EE3A 4ITSA 4LFCF 3CJ8A 1N5YA 3M6UA 1LW0B 2FUG9 4ATNA 2MZJA 3JSTA 1HARA 4P7TA 2KKHA 2MZ1A 1WHWA 1MSWD 3GTGA 1RP5A 5I42A 4DN9A 2XY6A 5J1NA 3N0BA 1B0VA 1FJ7A 1WORA 3MR5A 3MOJB 2V94A 2KXNB 2ZE2B 1RAFB 1X4AA 1S9EB 2YKQA 1WKJA 5LSRA 3W2VB 4B9NA 4ZA1A 5CZXA 1TL7B 2DH8A 5E3RA 3AODA 3WIUA 2HRTA 2VPXB 2JOQA 4F7VA 2GNKA 3E3XA 3GMGA 1P9QC 3GQCA 4F26A 1YBAA 2KTQA 2XBPA 1BQMA 2DNQA 3HOYK 3IR6B 3MMCB 3CCTA 4ED8A 1EETA 5L1KA 5CYMB 2IIHA 1GAOA 4TY8B 2KJVA 1ZPVA 3S17K 1QY7A 3AD8C 2P6SA 4DCOB 1UPMB 4DV1F 4ZCIA 2ZBQA 4CT8A 2GVZB 3TZWA 3VZHA 2JA7A 1Y5IB 2HHWA 1SFOC 4GVBA 3EICA 4C3HC 5CJ9A 3KLFA 4A3EK 3WDOA 2J7UA 2KXFA 3CSKA 2CKWA 1F9NA 4A3KK 1F6TA 1P27B 5IYCC 4C3HK 5KFUA 4MJKA 2PA8D 5C3EC 4ICLB 3UI3A 4R8UA 1N6QB 2VODA 4OL8A 4OYAA 2YWEA 3RAMA 4QR1A 3IR7B 2XCRB 1CJTA 2YQ1A 1TZ0A 2X1BA 4N8OA 1BE4A 5A2QU 2ZD1A 4DU7A 1FNXH 2ZH5A 4NYOA 3FJ2A 3JSBA 4YDDB 2QZ8A 1UTAA 1N36F 2EWHA 3F44A 3ERED 5EN1A 2LDIA 5CYQB 5EWFA 2NYIA 1S7HA 3S1RK 1QSSA 4X4VA 3G71S 3QRQA 4YB7A 3A13A 1SIWB 4DV7J 2JC0A 1T05B 2JZ5A 3BGFA 3M9NB 4KV8A 4ES2A 2Y0SD 4F0MA 3KG4A 2M5YA 2BR0A 4C7QA 4AXJA 3RRGA 3C6TB 4YN3B 3IWNC 2EEYA 1FK9B 3QNWB 1GEHA 5EUHA 5LM7E 3HOUK 3EZOA 5TMCA 1TQLA 1J5OA 1TL4A 4WKRA 1BS2A 2J6UA 4MYTA 3OEPA 3NCQA 1TWGK 3LWMA 4QWCA 1AB8A 4UOHA 3DLBA 4WK3A 2DKOB 3MWBA 2FVPA 1OPZA 1WI8A 5DM7Q 3CXCR 3G8QA 2HURA 2HWTA 3K7AC 1VH2A 1XPPA 4KN7A 2V2QA 2AZ3A 1WG4A 3KDNA 3HHLD 2CPJA 5F9LA 4NCGA 3J81U 2QLWA 1XWLA 1XJWB 2FQQB 2H65B 1U2FA 5JVHQ 4FVMA 2P5VA 4I67A 3PHTA 2AJ1A 2AYBA 2ZZTA 3EPIA 3KDOA 2UUCJ 4HDHA 3MAHA 1CPZA 3DU5A 2GHPA 3IM8A 3NNCA 2IMOA 1EQ0A 1ZXOA 5I3UB 3GG1A 4J9OA 1ZPWX 4N47A 2HHHJ 4OFZA 5AE2A 3AJDA 2MQMA 1Q5VA 1N34F 1R7IA 3I32A 1RSCA 5HO4A 4M5IA 3QGPA 2PFDA 3M8YA 2E1RA 2FHOB 4R8UB 3UNYA 5EWEA 3PW2A 1B4SA 5M2UA 1Y1WK 1RAHB 4RW7B 4UY85 2H5IB 1VIOA 1JLEA 1DRZA 2ZZNA 3OV7A 3DLGB 2CZ9A 2J8SA 2B63C 3R2CJ 2DR6A 3LPYA 3RG6A 4N41A 2ZH1A 2D6FC 2KN4A 4NI2B 1NPKA 3TUPA 2KL8A 1J2VA 2ABYA 4R25A 1Y3KA 3M2RB 2NR0A 3DNCA 4A4JA 1JJCB 3JAMU 1YQHA 1TMJA 1FJCA 4EYIB 2C2DA 4NXMJ 4ILDA 4JV0A 2UP1A 3S01A 1YTYA 1E6YA 3MI7X 1RGVA 5H9FK 3W60A 1O5JA 1IQTA 1Z4UA 2QN6B 4Y52K 3TVZA 3MEGB 2CZVC 4K0KJ 1IR1A 4CCHA 2W8KA 1PYSB 4KGXB 3W5YA 2OPSA 4OYXA 1SIZA 4ZHRA 4YDXA 5IYDK 2YKNB 3MXHP 3D9BA 1J98A 4EMDA 4J9LA 3WC2A 1MROB 2DXDA 5ADZA 3DLEB 1NNDA 4I2PB 3PR5B 3RBDA 4JI4F 4ZPCA 1QJHA 2C2EA 4A3LC 1SH0A 4J9RA 3NRBA 1ZQ1C 4KO0A 5K14B 1T9VA 3AH5A 1KLNA 3MM9B 1TL3B 3PXGa 2O01C 1EKRA 6FDRA 3PIOQ 3EXYA 4ID5A 3D28A 1RTJA 4DR3J 1VRQC 4CH1A 2YNGB 4C8KA 5IWAF 3LP0B 3GTMK 3R1LA 1H2UX 4Q8FA 4ILLA 4FPIA
chains in the Genus database with same CATH topology
3RZAA 2W9CA 5JFEA 2GQQA 2EFQA 5H9FJ 2DNGA 2WTFA 1K0VA 2VG7B 3RB3A 5IS2A 2G4BA 1AB4A 2JA5A 2HS4A 3BSAA 2W4DA 1FDBA 1TL3A 4ZKAA 1RT3A 3MM9A 3CCRS 2LQ5A 3GR0A 2YWKA 4Q5VA 2OH2A 1APSA 2ZH2A 2FD2A 1DQ9A 2JLFA 3ZZYA 1S1VB 2LQ9A 1N6QA 4H4KC 3WX4A 3E01B 1Z1ZA 4QYRA 4O4GA 3RBEA 1OO0B 1KFDA 3TVKA 1WF2A 2BJDA 1F5CA 4G1QB 3MEGA 3GFZA 4NL5A 5BYQA 3NS5A 3TA2A 5SZTA 2HVIA 5I3PA 1BD6A 4NLVA 2XI3A 1XNQF 3QZ8A 1ZM9A 4K4YA 2YKOA 1N5SA 2VBZA 1Q8BA 2AJ0A 5BJRA 5HMWA 4QWAA 3CC7S 3H5XA 2BRLA 3OR1A 2HHHF 1WHVA 4K5RA 2WW8A 3NBPA 4KMAA 1UFLA 2OSQA 4K2XA 1VQSA 1VQYA 1FKAF 3SYZA 4B3TF 1HFEL 4AE5A 2PN6A 1W2BR 1O29A 3GFYA 3NNAA 3PW7A 1I6JA 5K9FA 3TW0A 5DGAA 2VOPA 3F73A 2IBKA 3T9NA 2VA3A 1R8AA 3I55S 2QEXS 1DD5A 4IG0B 1FRJA 2R93A 1C0TA 2K7JA 2FHJD 1XMOF 2B9YA 2UUCF 1FTCA 4IG3A 4G1PA 4U9RA 3T6BA 3D0HE 2QFJA 1HBOB 2DH7A 3PKMA 1YJ9S 2R7XA 2L9WA 2B6AA 1VBXA 1X4DA 2RRBA 2H5EA 5HLFB 4TU8A 2AQ4A 1RKJA 1SJ4P 3DRSA 3GYNA 4I7FB 3DLHA 1VFJA 2HIQA 3EPGA 2KXHA 3BN4A 4TN2A 2EFNA 4NYZA 4OJHA 3BO2A 2I2YA 3MPVA 1MMLA 2DH9A 4ES1A 4PQUA 2ZC4A 1QAIA 2RRNA 2E7XA 2XLJA 2E5IA 1LK7A 5HBMB 3DLJA 4F3MA 5JJBA 4LQ3A 1KHVA 3QWPA 2GA7A 2XSFA 5A8RB 5KFSA 3H5YA 2KDOA 2ZH7A 4H4MA 2PT0A 3Q8PB 3KNAA 1TAUA 1HNIA 2ZKTA 1IKWA 1S4FA 2XY7A 2BV3A 1S1UA 2DGSA 5IFMA 4YB1P 3MR6A 4KB2A 1RT4B 3GYXB 1O0PA 3THPA 4B3OB 1N5VA 1RTHA 4DDFA 1TUVA 4TY8A 4EEYA 1DAXA 3H5SA 5ITHA 4B17A 2IC3B 2BJEA 3QYYA 3BB5A 4LF5F 2F1FA 4LT6A 3T5JA 1CSJA 2V4JA 2DNKA 4IDKA 3FRYA 1RI7A 1Q8IA 3HVTA 4IFYB 3W2VA 3FMBA 3KK1B 2VV5A 3HHLB 1HQUA 1HPZA 5CH7B 1NU4A 3GTPA 2R7TA 1UEVA 1OQ3A 5C25A 4ZP8A 1N0UA 1UP1A 2ZJQQ 1PC4A 4Y2AA 3NGKA 2C2RA 1VS3A 3MM6A 3Q24A 3V4GA 2F8HA 3L4KA 2JEGA 2D1CA 4MK8A 1ZM3A 3CJKA 3KLGA 1QTMA 1BJTA 4DUYF 2V8DA 2OPPB 2KI2A 4RW8A 3PACA 5F8MA 1AXQA 7FDRA 1S6UA 2I8EA 3GE9A 2DNPA 3SSQA 2W9CB 1M5KC 2BOPA 3BR9A 3CDUA 2MQPA 3BDPA 2PE8A 1JLQB 1SBRA 1LKZA 3L7PA 3H20A 3K59A 4LSNB 2H9ZA 3QZ7A 5CCLA 2VG6B 4M5DA 5AXMA 1KEKA 3MM8A 1HBMA 2FLPA 2PI4A 3OW2R 1YJUA 3UQSA 1N56A 1EH1A 1SUQB 1Q1KA 3B78A 1U1MA 3LP2A 3NLCA 4GKKF 2FLNA 4P7VA 4PXBA 4DS5A 2VC0A 3S8SA 3MGJA 2W4CA 4C3MA 1UEUA 2WCXA 3N79A 4LQ9A 3N0VA 5IORA 3LAJA 1TWFA 4DV0F 3N28A 2Y3PA 4I0WA 1FKPA 4JBCA 2CPIA 3CTRA 3NKYA 2CPXA 4NPOA 2VKRA 5KG7A 5HMYA 4W92B 3KK3A 3CCES 2EW9A 3HDSA 4ICLA 4X4TA 2VG6A 3MTJA 2OMLA 2JLEA 3WBZA 5JUMA 4MIWA 3K0JA 2AJFE 3MR3A 1TWCA 3I9V9 2RB7A 4DV2F 4NLUA 2MDAA 4IR1A 3ISND 3GIIA 3GTKA 4KC6A 3QWUA 2ZHAA 3TA1A 1S1UB 2CQPA 3QJPA 1R8HA 4NWBA 2V4RA 3X3UA 3ZFVA 1N32F 3PW0A 3IGNA 5E0OA 3TP2A 4R5PB 5GMKa 3RW7A 1Q86T 2KG1A 1TV6B 3I5BA 4WZQA 4DSIA 1LV5A 3MM6B 3U1MA 1IKVB 2FDNA 4HI1A 3GILA 3QLHA 4WE1B 1GTHA 3GSDA 3G9CA 2K2PA 1D8ZA 3I0SB 2KVIA 2M4MA 2XNRA 4KE5A 3GV8B 2XO7A 5FD1A 2AJQA 1KQKA 1JLBB 3TUIC 3V5RA 1X7VA 1NO8A 1SV5B 2HAIA 2J8AA 1QAYA 2FHJA 4ES3A 4ZHRB 5KFMA 2E2HA 1ZM2A 2N4CA 4XO0A 5J2PB 2UVRA 2MZQA 3HVWA 3D1HA 2ZM6F 4DF4A 2B7CB 4NLSA 2W4PA 3CPWR 4RUHA 4QWEA 2J0WA 2LCWA 1S1TA 3QIPA 5B0AA 3NNHA 2PMZD 1U7LA 2WK4A 2XMWA 1S6PA 3CD7A 3M8QA 7FD1A 3PX4A 2D3ZA 4RLEA 4DL7A 5CYMA 3QJJA 1VIXA 1DQ8A 1GX6A 3MCSA 1B0TA 4Q7AA 2RIJA 2LEBA 4EWTA 1N5QA 2MSTA 4FBTA 1FXLA 4D3GA 2Y1RI 4OZLA 2J5AA 2VFUA 2BQUA 4RW9A 2BA9A 3G4SS 1NJXA 5J1EA 1XBWA 4Q0BA 3TUZC 3VWSA 2B0GA 3M30B 4WU3A 4O3QA 3OQ2A 4KASA 3CQZA 4IOBA 3OR1B 3LANA 4J9QA 2YH0A 2DBBA 3RTVA 1HQEA 2M52A 1CC8A 1A6LA 4ECVA 1TKDA 3FKIA 5J2PA 1HHSA 3UPFA 3UNGC 1OWXA 4M8LA 3IFEA 1K73T 2MZSA 3QAUA 2U2FA 2CZ4A 4K59A 4OLOA 5CZVA 1H7WA 2XNQA 3CGIA 3KHHA 1LWEA 2RDJA 2AYMA 3V4IA 1VQLS 2CVEA 4FS1A 1UVMA 3KLHA 3R3TA 1ZVUA 1TV6A 2B3TB 3PVXA 4FYDA 1FXDA 5KFBA 2XC9A 3VAHA 3HHEA 4I64A 3OSNA 4DL3A 5GAHI 3N5BA 3QGHA 1U6ZA 4OMFG 3IR5B 3BGRA 4E8UA 4DV5F 1KVJA 1U6FA 2I9SA 2XCAA 1JKHA 4OX7A 2AGQA 1SJFA 5DM6Q 5KG2A 4KHPF 4DF8A 4ZPAA 5A6PA 1CQNA 2ASYA 1S72S 3KLVA 2JEFA 4J9NA 1M1KT 1YRUA 5K8PA 3MEEA 1WIHA 2QMXA 3PFEA 4E0DA 3B4DA 2E5GA 1QE1A 1UWBB 3MM5A 3IWXA 2VPZB 1G7CB 2JRSA 3N3YA 3K2YA 4QIEA 3LAKA 3BGLA 1CC7A 2AF6A 4G1QA 2QYCA 4ID5B 5KG4A 1YJNS 5LSOA 3CT9A 4ZP6A 3MPYA 4DN0A 3LUYA 1LXJA 3K57A 1D3WA 3OVSA 3FHZA 3AAWB 3SSSA 1R9TA 2KU7A 4Y3CA 1JLAB 2VQFF 3DMJB 2WHOA 1H38A 2PEHA 1QUVA 1NK9A 5A8WA 1HWJA 4OQJA 3JSMB 4OI3A 4ED3A 2MKHA 4JI2F 1FJEB 4X4OA 1D8YA 2CPZA 5L9XA 4KKOB 1TR0A 3MAQA 1O8BA 1C2PA 2IVYA 2FVQA 3H0GA 1XK8A 1QVGR 1ZTTA 2E9TA 2VG7A 4OHWA 2W7OA 4K4XA 4LSNA 3MUMP 4GTDA 1RT1B 4AUKA 3MURP 2ZNZA 1H7XA 3RAXA 1HR0F 4PG6A 5AXLA 2G13A 3CWJA 3UCGA 4LJMA 1LWFA 4G0UA 4EFAC 4Q43A 3Q0AA 4YUDA 1U1KA 2LQJA 1TK5A 4OX8A 2HQ3A 3KJVB 2NZ4A 1XEZA 3OTCA 2YNGA 4ECTA 3CJKB 3Q2SC 3KLGB 3K5MA 2R8KA 2BANA 5EX0A 2YNHA 2J7WA 2VFVA 1SB6A 2DIUA 3KLFB 1U26A 2B63A 4PCQA 2DHAA 2DD8S 2HHSA 4N5SA 2E5JA 3NG8A 3GTMA 1DTTB 1RWUA 1RT7B 3M6XA 3BUEA 4NLDA 1VJWA 3BN7A 4BBYA 3GIKA 4ZVHA 4O3SA 2V4JB 2XULA 2FHKA 3DDNA 3OTDA 4KFBA 2AW0A 1N4LA 5DQHA 2PO4A 4N77A 1URRA 2RT3A 4YFUA 5K8OA 5L39A 3DGPA 1IJEB 1VK8A 3IS9B 4NLRA 4DV7F 5H9EJ 1TKXB 3ICLA 2BDPA 2UU9F 4LF7F 4X64F 3OUYA 5AJ3F 1TKTB 2VPYB 4X4PA 4O3NA 3KLIB 1P6TA 4DSLA 2YNIB 4MKAA 5I4MA 4NOHA 4ZP7A 2HMIA 2NVXA 4UUWA 3QGIA 1SJ3P 3NL0A 3D1OA 4ZPWR 1KQGB 1IKWB 3CEDA 5D4LA 2GIRA 1NK0A 1X5OA 2YKMA 2HNYB 2XLKA 2DR8A 4NLWA 4MMOA 1TL1B 2EFGA 1E6YB 4NZ0A 4RBTA 3TO8A 2DR9A 1NK8A 4DL0C 3PRBA 1KRPA 1FESA 4GTLA 1UVIA 3HZEA 2ZFHA 3M8RA 4RNNA 1NH7A 2ZBCA 3V81B 3T5HA 4N76A 5E3AA 2DCUB 2GHVC 3A1YG 3DM2B 3VZIA 3D2WA 4AL6A 4D3HA 4JI7F 4CO2A 1P8GA 1KSPA 1VQ5S 3TX8A 2YNFA 1LWEB 4G1IA