3AQOA

Structure and function of a membrane component secdf that enhances protein export
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
221
structure length
221
Chain Sequence
GLRIVLEADVENPTLDDLEKARTVLENRINALGVAEPLIQIQGQKRIVVELPGLSQADQDRALKLIGQRAVLEFRIVKEGATGTTVAQINQALRENPRLNREELEKDLIKPEDLGPPLLTGADLADARAVFDQFGRPQVSLTFTPEGAKKFEEVTRQNIGKRLAIVLDGRVYTAPVIRQAITGGQAVIEGLSSVEEASEIALVLRSGSLPVPLKVAEIRAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a membrane component SecDF that enhances protein export.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Membrane protein
molecule keywords Probable SecDF protein-export membrane protein
total genus 61
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3400 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aqoA01
3.30.1360.200 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3aqoA02
3AQOA 3AQPA
chains in the Genus database with same CATH superfamily
1WKJA 3SEOA 5A76A 4DG1B 5J1EB 3T1HJ 4DR4J 4JUZA 1J27A 2XQCA 2PFDA 4OJ1A 4IFVB 4KAWX 5IP7C 3IN5A 4OI4A 4OL8A 3MEEB 5IWAF 1WQHA 5CXTA 1T94A 2H5IB 4DX8H 1LW2B 2XNRA 4C48A 3KLEB 4DU8A 2M7SA 4ED5A 3WX8A 2VJVA 3LALA 2R92A 4DQSA 1VQ5S 1S1XB 1VBZA 2UVRA 3OUYB 4IFVA 5K20B 1WCMK 4FM9A 4YY3F 5LSLA 1KS2A 2FVQA 1BJTA 4GC7A 2DT9A 2QL9B 4X4QA 1XNQJ 3BR9A 1OYDA 3HSZA 4C8OA 1TWHC 4ZITA 4P2MA 2YWWA 1XC9A 2LXFA 1VMBA 3LPXA 1QUPA 2HBYB 1FNXH 4GKKJ 3S1QC 3GJSB 1IKWA 4RU9A 3FHZA 2HQGA 1X4EA 3HT3A 4CDIA 3QFHA 3DFEA 2WOMB 2W25A 2A3JA 1HQUB 4FKXA 2Q43A 1X8DA 5HQ8A 4CH1A 1BS2A 3RAMA 4UZBA 3RB4A 2V68A 4IH7A 3PW0A 2R7XA 1M90T 2HURA 1V5IB 2CZVC 2Z30B 1VQYA 5GAEI 1JLBA 1WKLA 1XTZA 1P8GA 4LRBA 4CLYA 4URSA 2UXBF 1BQNA 1S12A 5E33A 2F4FA 1G1XA 1CJKB 2BW7A 2NVXA 3R5BA 2YNFA 1CJTA 1KLMA 2R7SA 1KLNA 5DG9A 4D3HA 3US5A 4BXXC 2VJUA 2LU1A 3IR6B 3KLHB 1I3QK 4E8UA 1RWMB 3RR7A 4QWBA 2MZJA 4F4YA 3HCXA 4P6QA 5GAHI 3OTDA 4CLLA 3I55S 1MNEA 1CC8A 3GIIA 2AGOA 2B51A 4C6AA 1TMMA 4J9KA 5CAAA 4H4KA 3QSYB 4IFYA 3FZBA 1H72C 2QMUB 4OX9F 3M2VB 3W9JA 3NCPA 2DBBA 1WJ9A 2QA1A 2DR9A 1SJRA 3T1YF 1NO8A 1M1HA 1DBDA 1L3UA 5FJ8K 4A3MC 3PG9A 2W01A 1GH8A 1VI7A 2IAJA 2NVTC 1S1TA 2V9WA 1IR1A 2AJ0A 5KFCA 3H98A 1WCMC 3BKTA 5H9EJ 3HZGA 3DU6A 2Z4PA 5IS2A 1JLFA 3HD1A 3A1YG 1TL1B 4JI7F 4KGVB 2FJXA 3L4KA 3BGUA 1RT1B 5E7OB 3I9V9 4BCAA 3TA1A 4ECTA 3Q89A 2CPEA 2DO4A 1HBMA 2CJBA 2QYCA 4DL7A 4DDFA 3MOJB 1GMVA 2HWHA 4I68A 4ANDA 3TUJC 4GTAA 2COLA 1FDBA 5LL6d 3AA9A 5B0DA 4G0VA 2VQEJ 1YZ7A 1QVGR 2B5JA 3V4MA 3R3TA 2J8SA 2CRLA 2XS5A 3C14B 3CJ4A 5F8IA 3DMJA 1N5TA 4WFXA 4F26A 1JLAA 4DDQA 5J2QB 3M8QB 1HWUA 2UUTA 2GAGC 4HH1A 3GTQK 4JP8A 1OJ4A 4ZVPB 5IP9K 3RG6A 2R42A 5B7WA 4MJKA 1R89A 3NGSA 1UFWA 4PG5A 4JI7J 4QYRA 3UCGA 5ETQA 1WHWA 4P2SA 2EFVA 1JLEA 2MPUA 3R7NB 4QIEA 2L9NA 3PW2A 3N3YA 3MPWA 1C1CA 2I9SA 3VF0B 5DQGA 5IOTA 3AJ2A 4WF9Q 2XSFA 4L73A 5MAOA 1FRKA 1KWMA 3J7Z5 2HNDB 2HBQB 4DBQA 4PXBA 3TW0A 1AYEA 4Q4ZA 4L6V3 3CNQP 1JXEA 3W61A 2WB1L 2PFFB 1IR2A 2JX2A 5T7LB 4HVZA 4FDFA 3WC2A 1D9FA 2QIFA 4PQAA 1FRHA 5J2MB 5KFYA 1XPPA 2Z0GA 1ZZFA 4DL5A 5AT1B 4I2PB 3C6UA 3G6XA 3GQCA 4KT0C 4YR0A 2GA7A 2B63A 4Z2XA 3CO0P 4R8UA 5DQHA 2F4VJ 1VDHA 5ETTA 2VFUA 4CH7A 2C2EA 4F0MA 2F7VA 2MSTA 3HK2A 3N28A 3BP3A 3MHYA 5IP9C 3SZZA 1XK8A 4KE5A 4RLEA 5HL8A 3M1VA 1IQZA 1NJZA 1TWAC 1B0TA 1FESA 3FRYA 2VBYA 1UKUA 3D1QA 1CJVB 2M8HA 1NNDA 4A48A 5HP1B 4QPXA 3KOAA 1S5ZA 1RT6A 1SVDA 3HFKA 1TU0B 3BN7A 2VOPA 4Y2KA 2GQQA 2E5IA 3CIZA 4Q43A 1DZ5A 2JC1A 4RUCA 3LP0B 5FIIA 2OIHA 2QSWA 1EB0A 3OHAA 4P5BA 3HP6A 3D6TB 4WK1A 1K73T 4H54A 3U1LA 3IR7B 2GCFA 4PWWA 4RUAA 4DV7J 5C2GA 5LXRA 4FS1A 2YQ3A 3GR1A 1O0PA 1H7XA 5E2QA 4HT5A 2HG4A 5A2QY 3EJMA 2DNGA 2IBOA 4ZVFA 1TV6B 5JFEA 3R5JB 4IG3A 1LOUA 2CPYA 2V8VA 1S1WA 4ZP9A 4OIOA 1W26A 3W66A 4USJC 1DY3A 4FYWB 1ROFA 3THPA 1HIYA 4N76A 2E66A 3CD0A 4PXDA 3FZ2A 2MKIA 2C2ZB 3DC2A 5IQQA 3VQSA 2KM8B 4CLSA 3R7SB 3N6LA 2JA6C 3TP2A 1VC0A 5IYCC 1ZETA 2PMWA 4WP9A 3AD7C 1TL7B 2CIMA 4OX9J 4USHA 2DGTA 4HEA9 2NUUG 3Q0AA 3A4TA 2ZFZA 4CRJA 3Q24A 1FWPA 3NNAA 3DDIA 1VJQA 3DLGA 4EU0A 4JBCA 4LRFA 2M0GB 2XWXA 4DR4F 1IQTA 3JQJA 1T9WA 1JJHA 3KWMA 1JXVA 4JV5F 1FKOB 4A3KK 2KKHA 3CMQA 4K0KJ 3BBBA 4F50A 4J3NA 3JYTA 3UD3P 2ZH5A 4RW9B 4KIAA 5LJ3Y 1N5YA 3IBCB 3THTA 2IMWP 1TTHB 2W4DA 5HBMA 4ZCMA 2GVZB 2HVIA 1B0PA 2GJIA 1FEEA 1RT3B 3G82A 5L38A 4ZS6A 2DNKA 3PO3C 4N8OA 2PDAA 2ACMA 2EBBA 5JMNA 4U95A 3RBEA 4LRCA 1TWHA 3HO1A 2BQRA 4AUKA 3LP1A 2MQNA 4ZPDA 3I4NC 1RJJA 2EG1A 5HAOA 5D4LA 2EPIA 4NLTA 5A0YA 2NXJA 5E41A 3VALA 3QIPB 4BLAA 3DOKA 2C1EB 2K06A 1HNZF 3UCUP 2FZKB 1B7FA 3GTJA 2ZUGA 1EQ0A 4KN4A 4LR8A 5M5XK 3NGRA 4DV1F 3HKZD 4ED2A 3P96A 4HHHA 3FOFA 1LW0A 3H5XA 4ZVQB 1BHNA 2U1AA 4F4ZA 2RB7A 1BDFA 2MY8A 3PJXA 1O8BA 4DUZF 2VFRA 3GTPK 1C2PA 3HSGA 2R2UA 4G1QA 3NWRA 1O24A 1HWIA 4QU7A 3MM6B 3CJ3A 2OPRB 4EI2A 5J2NB 1X9SA 2VPZB 4USIA 1BUXA 5BYQA 2CJYB 2CQ4A 5A8KA 1SKSA 4OYPA 5D4OA 1SV5B 1LWXA 1C4AA 3IP0A 2VICA 2FJBB 5FLMK 1TELA 4A3JC 3JAMY 3PKYA 4MKVA 4OX6A 1UJ5A 2HFUA 1C1BB 4RNHA 2YKNA 3QT8A 2DNLA 2H4YB 2GMLA 3NAIA 2PO4A 4DV0F 2B6AB 3W65A 3IXQA 2KXHA 2AX0A 4WFNQ 3PDNA 1FDNA 4NZ6A 1X0FA 3QO9A 1IWAA 1U0HB 1QUVA 3GIKA 1S6PB 2B8QA 3QZ8A 3MCNA 4BBRK 4G7HA 3DRRB 4TYAA 1X5OA 4L3KA 2P9EA 4ER8A 2LEPA 1IKXB 1F9NA 2AZ3A 1WEYA 4X6AK 4JI0F 2RF2A 2IRXA 1WKKA 2J9EA 4WP8A 2W8KA 1XR7A 4C8MA 2EW9A 2N3LA 1ZPWX 4LF6F 2NPFA 3QGIA 1U45A 1K1SA 3TX8A 1FWLA 4ZIWA 1SL2A 2JL9A 2VKRA 3FK4A 2KRRA 2OKQA 1WTBA 4QYZJ 1RE1B 1IE0A 2VH7A 2M5YA 2DHGA 1QD1A 1SIWB 3ILOA 1VRQC 1DTTB 5ETNA 2SXLA 3S8SA 1UVJA 2F5GA 2JWNA 1NPKA 3JSTA 3DOMB 4EK2A 3ZTPA 1ZAXA 2B4VA 1ZOTA 1U7LA 2DNYA 3I5CA 2GO8A 2FGOA 3GTPA 1RAEB 1RBOB 4L3NA 3KYLA 5H9FJ 4CLTA 4WKRA 2XSJB 5KT4A 2IM0A 4IOAQ 4PR6A 4QWDA 2UP1A 4AT1B 5C44K 4LF1A 5J1NA 2O67A 3EX7B 2YPZA 3PYEA 3SCIE 4J9RA 5IV3A 4A8WA 1KNZA 2RUSA 2XHWA 3S16K 4OI0A 2PA8L 3ISZA 1XBWA 1VR6A 5CYJA 4P2FA 3R9LA 4TQSA 1S1UB 4BBSK 4DL2A 4A4JA 2BX6A 2EFGA 4QWEA 1ELOA 4ED0A 2QMWA 3AHPA 3E01A 1O27A 2H54B 4OJGA 1Q1KA 4NLRA 4KGKA 5L46A 2MGZB 3R1HA 3WBZA 5CJ9A 3LP2A 3DRPB 1YBAA 4DV1J 1S7IA 1PAUB 1WC0A 2CZ9A 1NK7A 2FVRA 5HQLA 4YG2A 1MROB 2Z56B 2QN6B 2BKOA 3EGWB 4OYOA 3BV8A 3CDBA 2XGPA 2HHPA 1OSCA 4I2QA 1OIAA 5ETRA 1RTHA 3S6EA 3O2IA 2UUAF 1RISA 3H3VL 2B8PA 1VS3A 3GYXB 3KG0A 3MFHA 4KM8A 4KQZA 1NHUA 3C19A 3DLBA 4KGMA 3W7BA 2BJ8A 3GTYX 4NCGA 3CD7A 1I50A 1NXIA 2ZJQQ 2YH1A 3DOLB 4ETXA 3H5SA 4MH8A 1N5QA 5C24A 1KC8T 4WJ4A 3CT9A 1RK8A 3UQSA 4A3LC 4NLSA 2CYYA 3T9NA 3Q8QB 1N33F 2C2DA 1DHMA 3WC0A 3GG0A 4UQTA 3I9ZA 4I4BA 4CO2A 4K0KF 1U26A 3PNIA 4OYBA 2ZHAA 4BDPA 3MXHP 4ZIVA 1BMQB 4OFZA 1PAEX 2ADBA 4MK7A 1HBUB 3P8BB 2RHSB 2DGXA 4RUBA 5I3PA 1NZAA 4K59A 4W98A 3VAMA 1D8YA 4C3HK 2JSXA 1IJEB 3PACA 3VAKA 1K83C 4DR2J 2DGQA 3KLIA 3FKIA 3Q2TC 4RKUC 4USVA 3QQCD 5BXIA 4DUYF 4JI6J 1UJ6A 2ZUEA 5DG8A 3KKFA 1PJ6A 3QSIA 3Q23A 5EGYA 5DG7A 3HOUK 2BDPA 1WG5A 3IG1A 2LP4A 3JTNA 5BR8F 3MMAB 2JH3A 2OELA 4DPWA 1DCPA 3BGRA 1IVZA 3W2VB 2OD4A 2PEHA 4OQJA 1H2UX 4H4KC 4PABA 3AB4B 1RQ0A 4BKWA 2O5JA 4C8KA 2R93C 1XEZA 4KASA 2XI2A 4KMUA 3HHLA 2K8GA 4DV7F 2HYIB 3EM1A 1Y11A 1O29A 3HHLC 1DQ8A 3MTJA 2MZSA 5EDWA 3U02A 1BQXA 4JI4F 2X3GA 2HVHA 3FSXA 2FHKA 2LQJA 3VTIA 3DGPB 4PWDB 1O26A 3IS9B 1I50K 1GK8A 2WVBA 1LK7A 3SFUA 3TZXA 2RQCA 1LV5A 3BSCA 3HD2A 1OY9A 4B3MF 2O5DA 1P9QC 4A3BC 2XZWA 1HBOB 4A3EC 1UFLA 2JZ5A 6FDRA 3RB3A 1S0NA 3HPOA 4ZPVR 4A3CC 4NWBA 1WORA 1HR0F 2OPSA 3EMTA 3AY0A 3R6LB 2Y1IA 1HNXF 3KG4A 2WHOA 3Q8YA 4IH5A 3POTB 2CQBA 4D3GA 2LEBA 3T9ZA 2RILA 1RTJB 3Q83A 4RBUA 3MMLB 4TVAB 4Y65A 4LF7J 4P72A 3HOZC 2KRBA 4NLYA 2WVEA 2DNNA 2NSCA 1RTDB 3KLGB 1SKWA 2H48B 4TQRA 2X7IA 5KFUA 2J9CA 1RCOB 3P3DA 3UNYA 1OQ3A 4M5JA 1VIOA 1H2TZ 3NEKA 2VUMK 3EZOA 2F40A 4ZPTR 3JAMU 2OTLS 4MFBA 5L9NA 3C6TA 3R5GA 3J81U 3AD8C 4GTEA 4GMKA 5KFAA 1NH8A 2R7QA 5A2QU 4AYBD 4DN9A 4A3DK 4DCPB 4MIAA 3ZTRA 4Q0BA 4F2RA 4XCHA 5HK4A 2OPQB 1NBEB 3KJVA 1HBNA 1WI8A 3AD9C 5AJ3F 1YX2A 1T9YA 4LF6J 2MQ8A 3GTKA 4HI2A 1NKEA 2ASYA 4LF5F 3VAFA 1VRUB 1S7HA 3KJVB 2OPQA 1VQ6S 5HLFB 1FKPB 3GE9A 2VBXA 2ZVSA 5HVFA 3WIVA 2QE5A 4KMAA 3M30B 1UA1A 3CJ2A 2V4QA 1Q82T 2J6UA 1FFGB 1RKIA 1FRMA 3S1NK 2VONA 1Q7YT 4RW7A 2LDYA 3D0HE 2HGLA 3IBWA 1S59A 2UVUA 3SQOP 3KK1B 1CS4A 3SSQA 4O3SA 2KWAA 3ZZZA 1UMJA 3ENWA 4TU9A 2VA2A 4J5OA 4KB7A 4A47A 4I6YA 2BQUA 3I56S 5D8HB 3FJ2A 1Y5IB 4X65J 1T95A 4FF4A 3FQKA 3DGVA 1FRLA 1XZPA 4LR2A 2ZWPA 1X4DA 1KVKA 1U25A 5AXLA 2UU9J 1YBUA 4ECSA 3BS9A 1UVKA 4F25A 4LK1A 1QAXA 2YXLA 3PW7A 4M5MA 4KARA 2E5JA 4DL6A 2CPHA 2DTJA 1YZ6A 2PMZD 3CJ8A 4CO0A 4A8KA 3M4XA 3MM9B 4NLUA 5G0RB 2A2CA 1QLNA 3HOZK 3IS9A 2BW2A 1BQMA 1KHVA 3DGPA 2DNHA 4URGA 1TAQA 1U2RA 3GYNA 2AQ4A 4XLPA 2HWTA 2MKCA 2BKPA 5DETA 5JUMA 2V69A 3FGVA 1E6YB 3FFIB 2OSQA 3NGDA 4C3KA 4FVMA 3NNCA 3S2DC 2FJWA 1DLOA 1ZM9A 1GAOA 4NLQA 3KTQA 1YJ7A 1B4AA 3MAQA 1RAAB 4OZ0A 3TEGA 3RUBL 3M4OC 3PTWA 3BSOA 2R2TA 1XWLA 4PG4A 5HMYA 2C28A 2FIUA 1PBUA 2XBPA 2V0NA 3GV8B 3TVYA 1IXKA 2JLGA 3FBBA 2ZH7A 2PT0A 5HO4A 1CS4B 2JA5A 3KK1A 2E2IA 1JLGA 2D6FC 3BQ1A 2HQIA 1FO1A 1H74A 1T11A 4LFAJ 1HL6A 4FF3A 4ZKAA 3D1HA 2ZUAA 2RU3A 2AW0A 2W9CB 3GTLK 2R3VA 1YSJA 3M30A 4LQ9A 3J80U 4OZNA 1TKXA 1WF1A 4IKAA 5LJ5Y 4F4XA 4UT4A 1VQ7S 2IM2A 4DOZA 3A3PB 3UCZP 3MGJA 1FKPA 4F36A 5HLFA 3CQZA 3BSNA 5KFLA 2ASJA 3L09A 2VBZA 4KMHA 5GADI 1W7WA 2YKOA 3CCWA 1ISEA 2G4BA 4M5KA 2CQCA 2QT7A 2GVDB 2E2JC 1R43A 5D0GA 2X1AA 3PIOQ 2JA5C 2XMMA 1AA1B 3OVAA 2V6UA 1I3OB 4DQIA 4TXSA 4RNFA 3DHXA 2ZH2A 3EGNA 4Y00A 1ICEB 2BBEA 4ECVA 5FLMC 4DV2F 3D6HB 5FLXY 4B08A 2B0GA 3S15K 5I3QA 3GJRB 3QRPA 4A3IK 1HR0J 1UFKA 4PG8A 2MYFA 3VAIA 2W7AA 4C3JK 3HXAA 4ED4A 3C6TB 2KZZA 4MFBB 2J7UA 1YTYA 2DR7A 3DOLA 3G86A 5M5WK 3MEGB 1V9OA 2UUCF 1VRTA 4ZN1A 3M8ZA 1PGZA 3ZTQA 1HMVA 1RTDA 2FQOA 1R9TC 2Q1LA 4TY9A 1RTHB 1I50C 1FTCA 2JHEA 2PE8A 2V8PA 2W2OP 4GTCA 1S99A 2OEKA 2MKHA 3KUEA 3Q8UA 5CD4A 1N34J 4CZCA 3POTA 4ZA1A 2IRUA 2K3KA 4N77A 5GAEU 3BBFA 1R6VA 3T41A 4J90A 3EYZA 1RYSA 4A3GK 2XY5A 4PKDB 3HHNB 3FRZA 3A8EA 2C2RA 1FXRA 4KH1B 4ZHRB 3D4JA 3FBFA 5K8NA 3BQ2A 1CQMA 4WU3A 2O1PA 1Z1ZA 1VYAA 2CAJA 1YGYA 1QY7A 4ILRA 3V6KA 3HOUC 3L7UA 2E7XA 2HAFA 2WSCC 3F44A 5KFTA 4DUYJ 3S2DK 2GSOA 1V5VA 3HFVA 4RMFA 3EGVA 2KM8C 1IR0A 2CJKA 1IBKF 4DPXA 1RWPB 2AGPA 3PVXA 4NYOA 2CPJA 3H0GA 2XSJA 1NDKA 2RH6A 2ZOGA 4MYTA 2VF3A 1GMUA 1NK5A 2DIVA 4P10A 1UWAA 1NPPA 5HATA 1R7IA 2VQFJ 4OHVA 1IKYB 5DZ7A 1Q8BA 3D0IE 5IT9U 4FN5A 2RJZA 3M6WA 1G7CB 1Q4RA 3X1LB 3CCES 1S97A 1XNRF 3DYAA 1SC6A 4DSJA 1HI0P 3OR2A 7FDRA 1BWEA 2ZZMA 1M5PC 3NKYA 5C25B 3S16C 1RHMB 1J6WA 1S9EA 2NYIA 2KU7A 4Y28C 3IFEA 4B3TF 1VBKA 4IO1A 1V3ZA 3EVWA 4Y7NC 1U2CA 5KG4A 1S76D 3CC2S 5LXYA 2G2YA 1QAJA 1VC6A 1BD6A 4DZDA 4HT7A 4OI1A 3QGGA 1M0SA 3W60A 2HSEB 4MK9A 1UVIA 4RBVA 1EP4B 3BGOP 5B08A 1X60A 2B7CB 1FKAF 4R5PA 2DITA 4P73A 2V6SA 3M05A 2MB0B 5KG2A 2Z57B 4ED6A 2AZ1A 2D9PA 1IBLF 2IPOB 3HVRA 1K47A 1IN0A 1YLXA 2I1RA 5D0RA 1KFDA 1R8PA 2I8EA 4RJVA 3VZHA 3GTKC 5E3QA 5E3RA 4NCGB 5A8RA 2LVWA 3IPJA 2FHJD 2D74B 1TK8A 4X84A 1C1BA 2YQ0A 1DTQA 1IKVB 2O01C 3R5DA 1YG0A 2VQEF 1WSVA 2WBMA 1P9YA 1YRTA 3K8WA 4YHHJ 3OFGA 4A3DC 4I2QB 4IQXA 2R7VA 4OIQA 2V9KA 2B4PA 1WC5A 1NSAA 4NLXA 2GQCA 2QRRA 4G0WA 5KFBA 5J2NA 4C3IC 3H2LA 1T7PA 3V6JA 2V50A 1KHWA 3DRPA 5IZHA 5GADU 1GTEA 3LP2B 1IM6A 5ETLA 1T3NA 2E2HC 4M1XA 2HHQA 5D3GA 3ELHA 2FLLA 1WELA 5F8JA 4I64A 1NHVA 4A3JK 1SH2A 5H9FK 2E7WA 3E01B 5TJ3A 2B9XA 1URNA 1S1UA 2WCXA 2UVVA 1SKRA 4USWA 1D9DA 2FVSA 1USOA 4FYXB 3QIPA 4NZ7A 2R8IA 2W2QP 2YNGB 5TMFA 2RS8A 3P45B 1KR4A 3GTGK 2UXDF 1I94J 3S14K 3QBCA 2QYGA 3WODA 3ULHA 4J9QA 2Q6CA 1G2EA 3G82B 4AQYJ 4ZVSB 2RIJA 2ZOFA 3DOMA 5F0UA 4ECUA 2GVZA 3QPIA 3W5XA 4EFAC 1DTTA 5HBMB 1TFWA 2XYPB 4QPTA 3JTPA 3FMBA 4MK8A 2MQLA 3KK2B 1JJCB 4GT9A 2BE2B 3U1MA 1OO0B 3RBXA 2VUMA 4ID8A 1J5EJ 1MMDA 3N0BA 1FKOA 2X51A 1TWFK 4GKJF 2XNQA 2KFYA 1XXAA 1X4FA 3KUGA 2AEFA 4DR5F 2IHR1 3WQPA 3NL0A 3VVUA 3IRWP 2Q6BA 3NAHA 2KG0A 4FZVA 4ED1A 2RF2B 1I3QA 4M94A 1YJUA 3O5TB 2IYIA 2J76E 1IKXA 2WB4A 4M5GA 5ETVA 3DRRA 2KJWA 1N48A 4RWWA 1T0TV 5KG6A 2ZBCA 2YX1A 5IC4B 1S9FA 1YJVA 3OR1B 4A3KC 3QO9B 1RADB 4IQMA 2NVXC 3MOZA 3W62A 4N5SA 3CJ5A 4FXDA 3D5MA 2B6AA 1XNRJ 3T5JA 2CFXA 1Q8KA 4C0HA 4EYHB 2KDOA 4NYZA 4QYZK 1HWKA 2KVIA 1ZPVA 4KPCA 1VFJA 2JLFA 2YNHA 4IG3B 1TV6A 4GTBA 3DRYA 2JFKA 5GMEA 4NXMF 2D3OR 1FXLA 1RBAA 2I38A 3O44A 1IBKJ 1SMYA 3CMAS 1ZM2A 1UPMB 3GSIA 1XMQF 3O6QA 4HHJA 4G6VB 5A8KB 2VPYB 2YKMA 3K5PA 4KO0B 1EKSA 1RU2A 3DM2B 2ATLA 3T5LA 2I0XA 3FKIK 2OPRA 2BXJA 4X62F 1FDDA 2A2DA 1F1BB 3LP0A 4KGXB 4DFMA 4ICLB 5CCLA 4CNYA 3HULA 4A8QA 2WAQL 3GTOC 3T02A 5CYQA 5F3TA 2MEWA 3CW2C 3CCQS 5HP1A 3LPEA 2JA7K 5IXUA 5DDOC 2XMUA 2UUWA 1QE1B 5HANA 3J80Y 5B09A 2VPXB 2MSSA 3M1VB 3ZC4A 2LQ8A 4YB6A 4YFXA 4RU2A 5C4XC 3HLUA 4AL5A 2AV5A 4NXMJ 4R8UB 3CCUS 2E44A 4X64F 3D0GE 3VCDA 2W2NP 3BP8C 2O5IA 3C8YA 1X4GA 4QW8A 3M9NB 1IBAA 2MKYA 3VAGA 1AFJA 3PRBA 5LT5A 1SJFA 2ZH3A 1N5YB 3RBDA 3RZOC 2DYAA 4PWUA 4NLVA 3RGIA 4IR1A 3ISNC 2WK4A 4KAIA 5KG1A 2MZTA 3HFZB 2RUGA 3TVZA 4N41A 2QTWA 2E5LJ 3EQLA 1C1CB 1M5SA 3B8HA 3UDLA 5LSOA 3M2RA 3UD4P 1SB6A 1Q5YA 4Z37A 3MEKA 1FRIA 3P49B 2PMZL 1SPBP 1WC3A 3MM8B 3DLGB 4Q7AA 2HS0A 4ZVEA 2HHSA 3OFHA 4L74A 1AB8A 1RUSA 2KHDA 3GFYA 4LIRA 3GMGA 3S1MK 1TL7A 1APSA 5GAHU 4X4TA 1UWBB 2XG8A 1PC4A 1U1OA 1O2AA 2M4MA 3DMJB 1HW8A 4LF9F 5A6PA 3W1YC 2XMVA 2B43A 3I0SB 1TL4A 3LAMA 1HKAA 1T03A 4DI6A 5KOWA 2B5JB 4DX6A 4A8YA 4YB1P 4EYIB 3IGNA 2NREA 1FF2A 1ZM3A 3O8WA 2K1RA 3WHIA 3K7AC 4UUWA 3GTJC 2RRAA 3G8QA 3A8JA 1JLFB 3CJSA 2JA5K 2R7OA 3CAGA 2F8MA 1TR0A 1RHKB 3CJRA 4M5NA 3OBIA 3MMBA 1OSDA 4K7QA 1S1TB 5EGHA 3I32A 4FPRA 2HBZB 2ZKTA 2FTRA 4J9PA 1Y7PA 4H4MB 3DDNA 5THWA 4OHXA 4JI8J 1CJVA 2XULA 2KT5A 2KL8A 2BJ1A 3OXFA 1QTNB 2KN4A 3FBEA 1YRXA 3SIPB 3TZZA 2IJFA 4KPYA 4KYZA 4C0BA 1F93A 4IFYB 3S1MC 2L08A 4P5AA 4LFBF 1KD1T 4GTFA 3BPDA 3TAPA 5M5YK 2ZJRQ 1NB7A 1DARA 4BBYA 1S6UA 3AQOA 5CZVA 2BQ3A 4LUBA 1NDLA 4LBIA 2KB2A 1U8WA 5EN1A 4NEZA 4ZPBA 3K17A 2RE1A 1WHVA 1NLKL 3G6VA 5IOSA 3OVSA 4WFZA 1HLWA 4GTDA 3O1LA 1SQFA 3D67A 1TWCA 5EX3A 1EX8A 5T7LA 1U6ZA 4ZPAA 2ZVIA 2JJ4D 4I0WA 4LFCJ 1FK9A 4MEXA 1LEOA 4XSXA 4NA1A 3O3LA 5DRKA 1ZBSA 3UFCX 2QO3A 5HMXA 3RZDC 2OI2A 2V63A 2HMIB 3H8YA 2OJ3A 1IWGA 4CIOA 1JB0C 3DU5A 3KDOA 3N79A 1U6BA 5DDRC 4DHVA 4J9VA 5EWGA 2R92C 1LFWA 3BJYA 2R2RA 2B4OA 4M95A 2V6TA 3CD5A 5IFMA 2K3IA 2OEJA 3NCRA 1IBMF 2BZ2A 1XR5A 2XMWA 4BXXK 5L9XA 3OV7A 3MAAA 3LGMA 1WIHA 3MTKA 1N32F 1QVFR 2EKNA 4DX7A 3C46A 1IKWB 2MLZA 4B3RF 1LWEB 5RUBA 2Y3YA 1JLAB 4K4VA 2DRDA 2W7PA 3V4IB 1A6LA 2F65A 2ABYA 1VQPS 1K0VA 3DXSX 1HI9A 2HWIA 1YQHA 4S0MA 1MMNA 4DS5A 2XMAA 3N5FA 4DPYA 2NVYK 2XCQA 4IRDA 1B7YB 4DL3A 4LF9J 3OUYA 2EI5A 5EHHA 2VDIA 2LYVA 2P9CA 3FKIC 1WUUA 2BJEA 2ADCA 3KLEA 4JI5J 4F3MA 2JA6A 1MMLA 2R7ZA 5IYCK 3UVJB 3VVTA 5K8OA 4OIPA 1Z4UA 3GP9A 4CM0A 3TZWA 2EEYA 4B02A 2LXIA 1RDRA 1L3SA 4RR5A 1KFSA 2AMCB 3EXYA 3SSSA 3AOAA 1F7VA 4ES1A 5A8WA 2NVYC 2DISA 1YDLA 4DV4J 3I82A 3FCVA 3HHDA 4JV2A 4J7CA 3D3BJ 4JOUA 3QT6A 3MECA 3FBCA 4F3OA 2Q66A 2GMJA 3R2DJ 5KFXA 2CZ4A 4I6AA 4KSEB 2XCOA 1HARA 4QIWD 3BBCA 2M52A 2M2BA 2O3DA 2CFAA 2VUMC 3GV5B 4UOHA 3M2VA 3NGUA 4P7VA 3GILA 1MWQA 1HNWF 4MIBA 4MT1A 3EDRB 1KP6A 4HHUA 2NZ4A 1EQRA 2K7JA 2ZEJA 3GEIA 3MD1A 1EETA 2BE9B 1KQKA 4ED8A 3SDEA 2XMJA 3U7JA 3MFIA 3R7BB 4EGLA 3SQGA 3TUZC 3TYTA 3KUHA 4USTA 4K2JA 3RBZA 4JV1A 1UZHA 6FD1A 3V5RA 3KLHA 2ZKUA 3JSMA 5IM0B 3OD2A 1X5TA 1HI8A 4CI0B 2HFZA 3M9MB 1KLMB 1M5HA 1N56A 2CQGA 1UVMA 3GJQB 4U6PA 4M1KA 4OX8A 2DGUA 4HL9A 1RT4B 2JA7A 2OTJS 4KN7A 1YVFA 1R0BG 4GTLA 1R8CA 5HMZA 4RO0A 1VBXA 3TARA 4FYYB 2F4VF 3G4CA 4KATA 4X4OA 2VODA 2WSFC 2A0FB 4FBTA 1CJUA 5KFWA 2GS8A 3S01A 3QJJA 3TANA 2L41A 2ZFHA 1HQ2A 3TFIA 3DRSB 1ZVUA 4H4OA 1HQUA 1Y00A 4J37A 3Q2SC 2AYBA 3ZNUA 2CFAB 3G71S 1N33J 3CEDA 2R8JA 2DR5A 2V4JB 5KG0A 1TVRA 4ELUA 4HYKA 3V81A 2OSRA 2ZNZA 3NMAA 4NOIA 2BOAA 2MHEA 1GX5A 5IYDC 3EVMA 2ZDOA 1VJWA 4L76A 3LA0A 4QIFA 3MCMA 2FY8A 5A8WB 4CO1A 1PKUA 1X4CA 1TWFA 1GT8A 1TL3B 2C3YA 2UUAJ 3TX0A 2FGCA 3H5UA 2H4WB 4CWBA 4U67Q 3D2WA 3K58A 1LW2A 2CVEA 3GTQC 2W8LA 4WIQA 4DR6F 2WVCA 3UVJA 3T5KA 1F5AA 3M3YK 3OTOF 2HNYA 3SXLA 4PYAA 3ZTOA 4YHHF 1NCLA 1XR6A 1IBMJ 2XZTB 4P52A 3J7YU 4PG7A 4OYAA 4IOCQ 2OMOA 1N54B 5L39A 2CQIA 2A6HA 1GXTA 5J1EA 4CO3A 3GTKK 4UOCA 2VL1A 2VOOA 3TUPA 4U96A 3V4IA 1ZA1B 5D0HA 2C3MA 3JS9A 1U02A 1VQMS 4OYZA 2ZE2B 2C2KB 4G7ZA 4K50A 3BKUA 4LF4J 3KJNB 2GJ2A 2QA4G 2EBEA 5D15A 3N5BA 1UEVA 1FERA 1KBRA 3PEJA 2V2VA 3DI6A 2W2MP 5KFEA 2KXNB 3BYPA 4LSLA 2WONB 4AD6A 2YWGA 3BGLA 1N6QA 2EC0A 1Y9OA 5K14A 3M4OK 1SC4B 3SCLE 4Y7NK 1CBKA 2P6TA 4L72B 2HZAA 4CLWA 5HJYA 4QJVB 2HMIA 3S1RK 2RDJA 2YY3A 2G1HA 4QQBA 5H9EK 2Y0BB 4V1Ak 2XB2D 4YFKA 1F5BA 3VV2B 3ZZOA 1UA0A 1V3SA 4F4KA 1YNJA 1C4CA 1FK9B 3KDNA 2CNLB 2ZH1A 2KZMA 2C22A 3H40A 3T19A 1FD8A 2KH9A 4ES2A 1L5UA 4ZVHA 1N88A 4ZJQA 2DO0A 3I31A 4PEOA 5C4XK 3ILJA 3IAM9 1U24A 3MCOA 2HPUA 2M70A 4NYPA 2CKWA 2Z2MA 1JJ4A 2YNIA 1DD5A 1B3TA 2JA7C 3GPAA 1S4EA 2W2PP 3MR6A 2E5GA 3LWMA 2ZD1A 4YOEA 3QWPA 4C45A 4H4MA 3WIUA 1UW4A 4CT8A 2CQPA 1WC1A 3HX9A 3GTOK 3PKMA 3VZIA 2XI3A 4X2BA 1DQAA 1F9FA 2XYGB 3MMBB 3HXMA 2VFVA 1WHXA 1F0XA 3MUMP 2HHUA 4ZPWR 3BO3A 5HROA 5M2RA 2WVDA 1H3DA 4RW8B 1HYSB 5DLGA 2NSBA 3AH6A 2GC8A 4I7FA 2RGRA 3NMRA 3S1QK 4NA3A 3IM8A 5BYRA 1P6TA 3FDSA 1SKUB 2K1RB 2XZDB 5C3EC 1PO6A 4CM2A 2XLIA 1JKHA 1RWWB 5HMWA 2XY6A 1RBLA 1W25A 1KOHA 4AL6A 3KMSA 1TUWA 3T6JA 3DLEA 4PZVA 3HVTA 4CO4A 1TWGA 3I0SA 2VG7A 3PFOA 4PAAA 1PSDA 2I6WA 3CTRA 4X62J 1N5VA 2OFHX 3CD6S 3JSBA 4QW9A 1F9EB 3PW5A 4C3JC 3EZUA 4MQ9A 3M6VA 1YBTA 1S79A 1FXDA 4O0NA 2DEIA 3HOYK 5KFIA 4WU2A 4K4YA 3SFGA 4DV2J 1S10A 1TUVA 3SZ2A 1HNIA 3S7RA 3MM8A 2G0IA 1F7UA 1FX4A 4JI5F 2XMTA 2MMYA 3VWSA 3IC1A 5LMUJ 4JI1J 2CPIA 1HI1A 2E2IC 2JC0A 1RA7A 5IORA 1I6JA 4NX9A 2WB1D 4DFJA 3S0XA 2XLKA 5AE3A 1K44A 3D68A 2R92K 2GSUA 1RABB 2RKIA 3UR3C 4IUFA 5AE2A 2UVWA 1QAIA 1Q81T 2YH0A 4DU7A 2R93A 5JXSA 2ZOMA 2DR6A 1RT5A 2ZHOA 1G51A 2RQ4A 2LXUA 1M5OC 4RNOA 5A6WA 1KEKA 1D9AA 1RTIB 2BUNA 3WDOA 1PYSB 3MURP 1E6VA 3JXOA 5ETSA 5LMUF 1URRA 1TUGB 1FTRA 3PX0A 1TK5A 5D4NA 3UDVA 2YU9C 1Y1WK 3S2HK 4YFNA 5CYMA 2QFJA 2CJ9A 5SZTA 1UZDA 3GJTB 1R31A 1QE1A 2HVDA 1AZSA 1S0OA 2A6OA 3F0NA 2BJ7A 3KLFB 3ET6A 3NS7B 1NSQA 5KFHA 4F02A 4TNOA 4MKBA 1D8ZA 4TKTA 4ICLA 4K4XA 1TWCC 2IA6A 2IM3A 1T9TA 3DM2A 4KFBB 4TU7A 4KO0A 2YKMB 2DXFA 5IYBC 4YEAA 3CCJS 2UV8G 3LWLA 3OQ2A 2FJAB 2DCLA 3VGUA 5KT2A 2H5JB 3D54A 4B9MA 2CW0A 2POKA 3TO8A 1RWXB 1SH0A 3K7AK 2YNHB 1REVA 2EKYA 4O3PA 3PCOB 3M6XA 3HI9A 3N6MA 3LAKA 4GO5X 4Q45A 4WCEQ 1N5SA 2EBGA 5C3EK 2GNKA 2Z2YB 4DSLA 2UXCF 2Y1LB 1S0MA 1BC6A 3GTLA 1VOMA 4OIXA 4QOTA 2MKJA 1ZYRA 2ZBRA 2LCWA 2E9ZA 5GMKa 1NRKA 1WD6A 1LXJA 3HHEA 2FZGB 1CULA 4FS2A 4KHPF 4KFBA 2H3EB 3KNAA 3CULA 5D78A 4G3IA 2NVQK 3PEHA 2ZBPA 4NLGA 2V6AA 3Q8RB 1EJ7L 2ASLA 1JJ2R 2DH9A 1X5SA 1YWXA 3T3FA 3QT5A 4JYAJ 3EPIA 4FPIA 3KK3B 2BE2A 2YX4A 3N01A 4NI2A 4ECYA 5CYMB 1FA0A 2CVIA 1WSRA 3R5AA 1S1VA 3UR0A 4OV1A 5D6GA 3GTMA 1RWKB 4IRCA 2VG5B 3PZPA 3OVBA 2F3JA 5F8GA 2CWKA 3NP5A 3T1AA 2UUBF 3CDAA 2HGNA 3LTOA 4OZ5A 2ZH4A 4KJIA 1MWYA 2WTFA 1RTIA 3BEGB 2YNGA 1ZAVA 2PGCA 3IR5B 4KM9A 1LXNA 1FFWB 2MZQA 1FJEB 2AX1A 1RT5B 3CC7S 3S1RC 3M8PB 4LT6A 1CSJA 3FSIA 5JJBA 4ECXA 5M2UA 4XLNA 1IBLJ 3K8VA 3IMQJ 2HK2A 2JDJA 4WXOA 2RQKA 2V8DA 1ZM4A 4A46A 2V8GA 1B0VA 5F8HA 4J9OA 4OINA 5BJRA 7AT1B 4EUVA 2NQPA 4BHQA 3F41A 2HNZA 1NK4A 5IOQA 1LWCA 5M3FK 5D3GB 1FDAA 4KC6A 4IG0B 4WILA 1GQEA 3V6HA 1A7GE 2XCAA 2GX8A 4B9UA 4A3GC 3UD5A 4WZMA 5DGBA 1VJEA 1OWXA 1HNIB 3LGNA 3HOXK 1JNZB 2DPJA 2FHMA 3MDFA 2GHWA 5C42A 4O2DA 1SXLA 4KY3A 4DQPA 1RKJA 5D4DA 3W2WA 2XYHB 4N8NA 4EBEA 2RSQA 2HHHF 2E5HA 1RAIB 5IC6B 1T9XA 3GCXP 5ETOA 1Q8LA 2AIRB 3VGVA 5CQGA 5M3MK 1U1PA 1JX4A 3MEDB 2YX7A 2ZH6A 2A1BA 3MR3A 2Z58B 3MR5A 4OLPA 2OAUA 2A68A 1IKVA 1DTQB 1IW7A 4DWIA 5HVHA 4Z7CA 1J5OA 3L9ZA 3HVTB 2F8HA 2HKEA 4DLGA 3G6YA 3LQVA 1LK5A 2E1CA 3TNVA 3HSDA 5KOXA 2ZH9A 1ZZNA 5ADZA 1RSCA 3V6DA 3GLJA 4RBTA 2KFNA 1JQWA 3MI7X 3S15C 2HBRB 4DFPA 2ZZTA 2DRAA 2RH3A 5I3UB 4DF4A 3J7ZT 2CQDA 2DHXA 1EP4A 1L0WA 1KTQA 2KG1A 4BS2A 2AJ4A 2D69A 3GV7B 5F8LA 3D3CJ 4V19J 3GIJA 2FJVA 3QFWA 1HNXJ 3OPKA 2YKPA 2YNIB 3H4DA 1TWFC 4LVNP 4I1TA 4MIWA 3GTLC 2K2PA 1WNEA 1YJTA 3OR2B 2E9TA 3LF0A 1W2BR 2LECA 3MPVA 3CVKA 3ILLA 1N32J 2F8EX 1FRXA 4WK3A 2XTJP 3CCVS 3LPYA 2IYGA 5L8RC 4PG6A 3I4PA 4OJ3A 1A9NB 2J0WA 3LANA 5DO2A 4GC6A 1HNWJ 3RZOK 3C16A 2H51B 1TKZA 2V2QA 2OH2A 2A6MA 2XM3A 3OSNA 2P8IA 1FD2A 4ZN3A 1VQ9S 2AYMA 2LLZA 3OTBA 2IA0A 4O0IA 2FHJA 1D3WA 2X1FA 4ZHRA 2CUYA 3M32B 1TKDA 4JV0A 4M5LA 4C8ZA 2WONA 2PI5A 4NXNJ 2DNPA 3CDWA 1I94F 2R7ZC 3DI6B 4LF8J 1NK6A 5F3ZA 1NPRA 2ZBIA 4DSFA 2YPYA 3J81j 1TQLA 2IC3A 5F9NA 1VGYA 1KRPA 4CLFA 2ZE2A 3GTMK 4IRKA 1WQGA 3OL7A 4DCOB 2E1PA 1TKTB 3HF5A 2NXCA 4J9SA 3W3SA 3HVWA 4QR1A 2RMLA 4HKQA 3PO5A 3SZYA 4QZVB 1HMVB 4UZCA 4JYAF 3AQPA 1FVSA 3PHTA 5C2CA 3LGHA 1O25A 3MEGA 2GGPA 2AEJA 2QGFB 1R0CB 5E3PA 4TU8A 1NAQA 3HOWK 2GIQA 1RAGB 1PC5A 3RAXA 2CWXA 3RAQA 2EFNA 1NMEB 3NUHA 1FVQA 1G4CA 2HNYB 2B9EA 2MHNA 5B0GA 4RPFA 2DCUB 1MU2B 1FE4A 2NR0A 4X4NA 3H4BA 1EI6A 1YNNA 2MDAA 1GXLA 2L3MA 2HIYA 4KHMA 4LK0A 3R97A 5LMNJ 1N0VC 1LWFA 3HOWC 4LLGA 2ZNYA 2DHAA 4LJZA 2ALZA 1C0UB 2WW4A 1Y3JA 4IDKA 4KHPJ 1L3KA 1GTHA 2N7CA 2PHCB 1J5EF 4F4WA 1S6OA 2JNJA 3V81B 4OYIA 4LF4F 1RT2A 2N3OA 1TVRB 4EBCA 2V4JA 2WZ1A 1C0TB 3R1LA 2QL7B 2VPWB 1YJRA 2M88A 4IYQA 2R7WA 1AW0A 1HNVA 3KJQB 2W9CA 5KFVA 2IDEA 3FC9A 4USKA 2ILYA 1R9TA 1IBCB 3GTMC 1NJWA 2NCKL 1R8BA 3ZO7A 4HACA 3TI0A 4ID5B 1JLGB 2EK6A 1D1UA 3SV4A 3HMJG 4N47A 3AODA 3KHLA 4B3OA 5KT3A 1D0EA 3EVOA 1UVNA 2HQ3A 2M9KA 3IWXA 3CO9A 4ELVA 1DJ0A 1CJUB 1TWAK 2A10A 1M1KT 3RZDK 1S6QB 4LBPA 3OLBA 3UN3A 1EKRA 2GAHC 4WE1A 4LFBJ 2AJ2A 3BSAA 3NRBA 4M5IA 1TAUA 5GAGU 1SI9A 2RS2A 1RT4A 1VK8A 2PD1A 3Q8PB 3SSRA 1JLQA 2HW3A 3K5NA 1E6YA 1HA1A 1Y1VC 2I5JB 1HHQA 4JI8F 2E7VA 3M7VA 3HSJA 4AE5A 4I6WA 3OTEA 3ZZYA 5E68A 3S14C 5IM0A 3JSMB 1S77D 4Q8FA 4F04B 4PQUB 4G65A 1I6HC 1YJNS 3MM9A 3D6FB 3PX6A 4HH0A 3BKFA 1NDCA 5I4MA 4GFQA 1Q95G 2DNOA 3SDEB 2Y8WA 1Y10A 4ECRA 1IM4A 3BZQA 1OYEA 4QIGA 4I69A 4OIRA 3DCAA 2HHXA 1G6BA 3ITHA 1HQEA 2HVZA 3B4DA 4ILLA 4UY8T 2R93K 3HT0A 5M2PA 4GVBB 2E1AA 2YKAA 4LREA 3E2EA 4ZVOB 1R27B 2MLXA 4CQ1A 1RHJB 2V8HA 2BJ3A 4KMDA 2HFOA 2VB6A 1RAJA 3HM9A 4O23A 5F8MA 3RYLA 4E0DA 3MUVP 4JI1F 1FI4A 5HSPA 2VFSA 4RW7B 2G2ZA 1N36F 1XIQA 1WC6A 2CJXB 1JIHA 3T00A 1J6VA 1N0UA 1WF0A 2VFTA 5HQMA 2ATCB 1VIXA 3OJSA 1VGXA 1Y1VA 1WWHA 3G9CA 5EX0A 5KFSA 5I42B 3IGVA 4FF1A 4A3FC 3U27A 4LJMA 1VRUA 1RHRB 1VBYA 1MSWD 3LO3A 3VGSA 1RACB 2KVQE 2ZWOA 3RB6A 2CADA 3H0GK 3B78A 4DUZJ 3I0RA 3QATA 1UEUA 4RW6A 2ZDPA 1SC1B 3CCRS 2E2JK 1WACA 4Q0BB 2CG4A 5CZXA 3M8WA 1HQMA 5KFMA 1U1MA 2MZRA 1LWEA 6AT1B 2PIIA 4NMXA 2W9BA 2BJDA 4X4UA 1Q86T 2HAIA 4JB8B 3FSYA 4OHZA 4A3LK 1MN9A 3ZZTA 3ISND 3AFGA 4F0HA 1WDDA 3MAAB 4DQRA 2BYCA 1KVIA 3MPUB 3S1TA 5FDLA 1P27B 2HEKA 4F67A 2YWHA 3OEPA 3EICA 3CDUA 4KR0B 1O6XA 4Q44A 3TRGA 2XCPA 2BM1A 2CNNB 1RTJA 3IAS9 1JK9B 4G1PA 5HL7Q 3ZZPA 2JEIA 4HR2A 2XY7A 4CT9A 4TY8A 3JTOA 3PXGa 2JOQA 4KB2A 5SUHA 1SL0A 1KQ4A 3D66A 3PO4A 4MMOA 3QRRA 3RRGA 1KVJA 3BQ0A 1OPZA 3M8RA 1HBOA 1JNRB 1WEXA 2ZH8A 2Y1JA 2NYHA 2OD6A 2L9WA 3TA0A 4ZJLA 3QLHB 1NJYA 1T9UA 2BE7D 1YCLA 4PWDA 5F9LA 3BDPA 1RWOB 2EFQA 4XO0A 4Q2LA 4JI3F 3ICLA 2BM0A 5IOLA 1M5VC 4MAKA 1XXCA 2DXEA 2E2HK 2QC3A 4B9SA 1KDNA 3FEZA 2OPPB 3ZNJ1 4ZCIA 3HOYC 1SCJB 2M8DB 3TEHB 3EDQB 3HJFA 2LA4A 4QCLA 3LAJA 3TQEA 3W2VA 4Y0FA 4MKAA 4PXEA 3BGRB 4LSNB 4CH0S 3L3CA 2DY9A 3L4BC 3CXCR 3L7PA 3KG1A 1LKZA 4CP5A 2LKZA 3MMAA 4CLZA 2PSZA 2R8HA 1L3TA 2M3DA 3IG1B 3QWUA 1NJIT 3EPGA 3K59A 5D4PA 4NE9C 3TWZA 1I6VA 4RUHA 3K7RA 1Q7LB 5IT4A 2CPZA 1OPIA 3LUYA 3H90A 2J5AA 1PILA 3P6YC 2E1RA 4DFKA 3TAMA 4KDDA 2XCRB 4O4GB 2B4UA 4K5SA 1PJ7A 1X9MA 5KFRA 5J1PA 2PA8D 3SV3A 2R8GA 3AOCA 4EWTA 4N56A 2XS2A 2Q3PA 3X3UA 4IOBA 3MM7B 2H9ZA 3GIMA 2IVFB 3RRHA 3TFJA 2Y0SD 4OZ2A 4DR3F 3I4MK 2MXYA 1T03B 1HBUA 3F73A 1U48A 2MJNA 4X6AC 3OFEA 3QIDA 3BO4A 5G4DA 3IWLA 3RU0A 2ZJPQ 1GE9A 3QAEA 1S72S 2J0QD 2X3DA 1UWBA 4ZLNA 3EZ5A 1SFOC 4XPCA 2DGWA 5KFDA 2EXUA 2KT2A 5KG3A 2B63K 4CTAA 1VQ4S 2HS4A 4BLGA 2NLWA 2ZM6J 2HHWA 3W5ZA 3S17C 5JVOA 2MJUA 2KYXA 1CVJA 4DLEA 3MWBA 5JVHQ 2UXDJ 5KT6A 4F7VA 4X66F 1F2GA 3H0PA 3W9IA 4U9RA 3ETMA 3M2RB 2G0JA 4OI2A 4U8YA 3CJKB 5J2PB 2LMIA 4DEZA 1JLCB 3C2PA 3KFWX 5K8MA 3AOBA 1TK0A 4R25A 3E3XA 3OTOJ 4B9VA 2EFOA 4DR6J 1NB2A 2ZHBA 1K83A 3GZ7A 3AA8A 5K5MA 2BKNA 2IJRA 1U49A 4XK8C 1KTVA 3JB9k 1FE0A 1BE4A 2XC9A 4C2MA 5EWEA 2AT1B 2ZITA 1M1GA 1SJ3P 4KV8B 3BF4A 3ENAA 2MGZA 4MEYA 3UN2A 1FNOA 2W4CA 2FPHX 4LF7F 4NCAA 4DV6F 5H1SV 3KMQA 1F3FA 3N6NA 4ZH4A 2MLYA 3VHQA 4M63A 3JQMA 1ZAWA 1RWNB 3N9UC 1WDTA 4LF8F 2BANB 4NXNF 4ZLLA 2QFIA 4EMDA 3HHKA 3NGKA 2G0CA 4EBDA 5E3AA 4DPOA 5E0OA 1F9HA 1EIYB 3H3VD 1RZMA 2JA8C 2EWHA 3PY8A 1HHSA 5CYQB 4YR3A 3PO3K 2D7SA 3SCJE 1I3QC 2EFPA 4C3IK 2J9DA 2F9DA 1CPZA 2N7YA 5DGAA 3QNWB 3Q3QA 5HI7A 1UEKA 2XLJA 1FFSB 1RYRA 4ZVRB 3D28A 5DZ6A 4ELTA 4YDXA 1BGXT 2GFFA 2DJWA 1R3NA 5CHCB 2ALYB 2ZBQA 4O44B 3IM9A 4OZ3A 1SUQB 2C42A 2XO7A 3E8OA 3MMCB 2P2CB 3DXBA 4ZMMA 2DIUA 4HDHA 4Y3CA 1U8SA 2CQ3A 1RT7A 5BR8J 4A8SA 2DB1A 2AGQA 2IFXA 2QMXA 4DJBA 2D3ZA 3HKWA 3OR1A 4M5DA 2NUHA 3IBFB 1S6PA 2FLPA 4M5DB 4NLDA 2W9AA 4X4PA 2E2HA 1U0HA 3QGPA 3CPWR 5KTQA 3OXGA 1NK8A 2JVRA 4GZYA 2CPXA 3H59A 2DGOA 3Q22A 1RT7B 3MM5A 4JK1A 2DNZA 3K89A 2YBVA 3TOQA 1YJWS 1JWWA 3FVYA 3K5MA 2WAQD 3MMCA 3UE2A 4ZVUB 2R7UA 2Y9HA 2VG6B 3AXMA 4BY1C 2AF6A 3CUNA 3K5OA 1SV5A 1INNA 3KK2A 1Q5VA 3CCMS 1RLDA 4Y2MA 3MM6A 3PW4A 4QR0A 1VISA 1WC4A 2XEXA 2G2OA 1XZQB 1Q8IA 1V6HA 1Q53A 3OJUA 4JV5J 4ZPCA 3T1HF 3M2UA 4IH6A 1DQ9A 4LMZA 2D9OA 3T6BA 3PIPQ 2J6SA 1LW0B 4J9LA 2BMBA 2RVJA 4A8FA 2VC1A 5CA5A 4G7OA 2HK3A 4A93C 2IJNA 4ZVTB 4KH0B 1DCOA 2MQPA 3F56A 2PI4A 1NM2A 2ROEA 4O3QA 1IS1A 1HPZA 3DN9A 2R7TA 1PG5B 3UI3A 2HHHJ 5C7PA 1NEEA 1SBRA 4GO7X 5GVQA 2CNOB 4Q2MA 4OI3A 1U1RA 4IR9A 4ED3A 5A0YB 1SC3B 1HPZB 3KLVA 3SBMA 5KFFA 4BLBA 2WRMA 3MPDA 4YN3B 4GKKF 2B7BB 2QLJB 2LQ5A 2MQMA 3KJFB 1AUDA 1TWGC 2OP5A 1K0TA 3GEEA 1VHIA 3G8SA 4PPZA 2G1DA 2UUCJ 2J0XA 1O2BA 3M2UB 4NL5A 1A0OB 2QLFB 1WG1A 2NPIA 1XZQA 3SI8A 2FJEB 2NVQC 5KFNA 2O66A 3BGFA 3PO2K 2H65B 4RW9A 3NOGA 2KYZA 2LFVA 4G1IA 4AH6A 2AWZA 2C2NA 1S4FA 3HZEA 5D0EA 1N4LA 3G4AA 2EK1A 3GDZA 1WG4A 3GONA 1VQSA 4MKYA 3EGZA 3HDSA 4K5RA 1SQGA 4ZCKA 1JLCA 1DCHA 5CCMA 3BM7A 4PPDA 2VG6A 3A12A 4UUXA 4O4RA 1CLFA 3ZFVA 1EH1A 3BH6B 4P9SA 2X1GA 2MZ1A 3FQLA 1KONA 4W90B 2IY5B 1Z2ZA 1AUSL 5A8RB 2GMHA 3MM5B 4RNMA 1WF2A 1XMOF 4WYWA 5ETPA 3W8GA 1X7VA 1GFWB 4DSEA 2P8TA 5IWAJ 1EK8A 4OYMA 3AH5A 3NS5A 1ZXOA 3B4MA 1S57A 3OREA 1GXUA 4LFAF 4C3HC 3W5YA 1OY6A 1T02A 4RZRA 3AJDA 1NJXA 4R5PB 4UQGA 1ZTWA 1JXLA 2CNKB 4WKYA 2C2MB 5B0FA 2RAQA 4WPAA 3CGIA 3GTOA 4KC5A 4UY85 1HFEL 1S1WB 3R6GB 4ZLJA 1U1KA 1SUQA 2ZM6F 1X4BA 3QMQA 4OX7A 4O44A 2BRLA 3OT9A 5IYDK 2CG8A 1ZTTA 4K2XA 1S9EB 3TAMB 5GMDA 1UPPA 1VHFA 2UXCJ 5B0BA 5C25A 1RU1A 4DV6J 3CF5Q 1X5PA 2RU9A 3S2HC 1XMOJ 2HQFA 1UCNA 3DYAB 3CQZC 3N0VA 2XHCA 3UDCA 2FY1A 1IKYA 1PYTA 4IO9Q 1T9VA 4ILMA 3MZIA 4W92B 1RT6B 4A3MK 5DDQC 3GTPC 3DLHA 1IQ0A 3T5HA 4FVCA 1OS5A 4J9NA 3CIMA 3GTGC 2BABA 4LR7A 1WI6A 3BN4A 2BANA 2UU9F 3RW7A 4NRUA 1X4AA 4P7TA 4FKYA 4BY7C 1RAFB 2BRKA 3PJWA 2QJ3A 2HFVA 3P5BP 1ITPA 3C6UB 2ZC4A 4LVOP 4I2PA 3PX4A 4B3MJ 3Q86A 2EC2A 3FEXB 1NSPA 5J2MA 1V3RA 5L1KA 2W7VA 2FC8A 4KV8A 4ES3A 2CA9A 3CWJA 3H2VE 4QU6A 5KFOA 1QJHA 2QV6A 2R4FA 3PYFA 2AHOB 3R2CJ 4CNZA 2WBRA 5K9FA 4TY8B 4YFUA 2RDDA 2F1FA 1J98A 4Z7YA 3I5AA 2MKKA 1RP5A 2RRNA 2OGUA 2KFZA 1FNMA 1N8RT 5EWFA 4YMEA 3ADAC 3CJKA 5J2PA 3FCHA 2EG2A 3A8IA 4BC7A 2KI2A 2JLEA 1TL5A 4Y6IA 1EARA 4LF5J 5LMNF 5FDLB 4X64J 1JLEB 1HHTP 4LF2A 4ZJOA 3BB5A 1MLAA 1UTAA 1VRTB 2YWKA 3UW1A 2P9GA 2RRBA 1RTZA 4ZP7A 4YR2A 4CTAB 1QSSA 2D3UA 1YI2S 2JVOA 2FYXA 2YU9A 2ZUFA 1IL2A 2AYGA 3M8QA 1NHKL 1U09A 4OI6A 5E3CA 3PRVA 3PFEA 4CCHA 1U1NA 3V4GA 4GRSA 1TFYA 1SJQA 3H42A 1VLYA 3TJ8A 4FZBA 9RUBA 2R9LA 1ZA2B 2V67A 4CLPA 2HLUA 4Y2AA 3HKZL 3NG8A 5DJBA 2AU0A 3MCSA 2GVDA 1H7WA 4WFAQ 2HRYA 2GV1A 4W4MA 1B4BA 3L7OA 3HJVA 2HQCA 1MG7A 3SCKE 3MM7A 4BBRC 5GAGI 5I42A 4F3QA 1KQSR 5DM6Q 4DN0A 2FUG9 2C3UA 3MMJA 4O4GA 1UETA 5ITHA 5EUHA 1RT1A 4UOGA 2DH8A 1TKXB 2R2SA 4L75A 3MAHA 2UXBJ 4WP3A 3U1NA 3CC4S 4ED7A 3QZ7A 4WJBA 4DV5J 1HD0A 2K7KA 5E5NA 1YIJS 3SYZA 2GHVC 4KRWA 2DNQA 4DPTA 1QTMA 2HGMA 1AB4A 1NUEA 4YY3J 3PRDA 1OMSA 3DXJA 3LH2S 2Y0SL 4LSNA 4ECQA 2HHTA 5CHPA 3N4WA 2YQ1A 3EE3A 4QWCA 1QAYA 1DURA 1HNZJ 1O2FB 1HWLA 3EXCX 5AXKA 1I5OB 3P5TL 5KFPA 1DLOB 1ZS6A 2OPPA 1MN7A 2B9WA 3D1OA 2FVCA 4EO8A 4E98A 3CMES 1P1LA 3M8YA 3FFIA 4J9UE 1N34F 1BY9A 3TUIC 1EQMA 4DL4A 1N36J 1JVIA 2P5VA 1VH2A 3UWTA 4C3LA 3K5LA 1HWJA 2X1BA 1QSYA 4DR5J 2JA8K 1NSKL 1BQMB 1J2VA 1X4HA 4TYBA 1FJGF 3GCWP 3OLAA 4OHYA 3QLHA 4OZ1A 5G0RA 3DLJA 4FNIA 5IT9Y 1VQKS 5AXNA 4DV5F 2AP6A 1WQFA 5KAKA 4YB7A 2YNFB 2HRUA 4WZQA 4OV6A 2E29A 1GMWA 3H7HB 1JLQB 3NLCA 5CH7B 1RAOA 4JI6F 1BLUA 2KTQA 1XZPB 2ROGA 2FB0A 1FJCA 3QRQA 2YKQA 1SFOA 3OL8A 4ATNA 3HVAA 1VQ8S 2JEGA 2GJFA 1S6QA 4LOWA 4LSZB 3VGTA 1VLOA 3TFHA 1KN6A 2C3OA 1XERA 2NXEA 3KHGA 4B3OB 1UAWA 3H0GC 3UNGC 1KQFB 4ID5A 2WVFA 4A3FK 3GTGA 4C2MK 4XDDA 2W9BB 4EO6A 2GZOA 1K83K 3TJ9A 4Y52C 4DZ6A 4EZ9A 2P6SA 1RT2B 2IRYA 2LDIA 4KTQA 3M3YC 2NS1B 4HLBA 3BUEA 1C0UA 2G9OA 4RW6B 1RB0A 1P1TA 2Y3PA 3NOCA 3I0RB 2DGVA 3S17K 2CDQA 4WFYA 2BJ9A 3CJQA 1S1XA 1UVLA 4DR7F 1MU2A 3ONQA 1HBNB 2DXDA 3DRXA 3GFZA 4E2FB 4KBIA 5DM7Q 1Q16B 3ENVA 3UO0A 3MEEA 1VQNS 1LNQA 4V19X 2PC6A 2CQ1A 4K4WA 2J7KA 2PEBA 3IA0A 1YITS 2GGPB 3CB4A 4DSKA 3I4MC 4RX6A 4DG1A 3VQTA 1JMTA 2VD3A 3M9OB 2KT3A 3KLGA 3B54A 3SMZA 4EZ6A 4DQQA 2QA4S 4YS2A 8AT1B 2DY1A 5LM7E 4J91A 3W63A 4CLUA 1OQ6A 3RR8A 1TKTA 5B0EA 4GVBA 1MW7A 1RI7A 3LAPA 2ROPA 1HQEB 3ITHB 1ULRA 2OPSB 2GO9A 2HVEA 1L3VA 1J6XA 5IV4A 2ACYA 3NS6A 2HHVA 1AT1B 2IM1A 1FEHA 1F5CA 1Y4ZB 4J9MA 2V34A 3NWGA 1TZ0A 1N52B 1FHTA 4DSIA 3AJ1A 3I4NK 4DL0C 1USMA 4PQUA 1NKBA 4PUOB 4BBSC 5FD1A 1H0HB 1T3OA 3EUNA 3C3LA 3W8PA 1MWZA 1Y0HA 3GTQA 2HLTA 2N4DA 1JOEA 2I5JA 3CCSS 2UZAA 2AYEA 3D7SB 1B70B 1GMWD 2ZZNA 1S48A 5C44C 2HIQA 4WXWA 1TKZB 3I96A 5DS7A 5LOQA 3HHLB 3C16B 4WE1B 5IT0A 5F8NA 2QA2A 5KFZA 4F4AA 4NOHA 1OY8A 2D41A 4C8NA 2YTCA 5CD4H 1CG2A 2Z2LA 2HZVA 2QEXS 2LEAA 3BREA 4P2XA 2BEFA 3J7YI 3TVKA 1DFDA 1ZBTA 3MPYA 3DDKA 5ETMA 2FQTA 3GSDA 3ZZUA 1VC5A 4BY7K 5EGEA 4C98A 3TTGA 4NLPA 4HACB 2VBWA 2IVMA 2BE5A 5FLXU 1SQEA 1RU0A 2B56A 4FNHA 1U4BA 2VU5A 1HNVB 5KT7A 2V4RA 2ILZA 2B9YA 3OHBA 3NGTA 1C0TA 1RWVB 2NXNA 4K4ZA 4LR9A 1NU4A 1S9GB 3KLIB 2DH7A 3QT7A 2QZ8A 2APOA 4EEYA 3GFHA 4ETZA 1O51A 4IDKB 1IUJA 3WZ0A 1EAYC 4DMZA 3DKDA 1DRZA 3G6ES 1LWFB 1TWHK 4KGZB 3G87A 3UDEA 3H2UB 4O3OA 2B3TB 2V5HG 4I56A 3C15B 4ZK7M 4C8LA 2E5LF 3OPFA 3KHRA 2Z2ZA 3J7AN 4LQYA 4Y2IA 5L1IA 2XWYA 2XS7A 4NMLA 5T41A 3A13A 4PCQA 4K8RA 3OFFA 1X9WA 4B9TA 2GIFA 1XJWB 4RW4B 2IVYA 1R8HA 3A8KA 1JQGA 1SJ4P 5IYBK 3ZZRA 3OL9A 4XSZA 1CQNA 1R0AB 2HQDA 2EVZA 5C24B 3CCTA 2R7ZK 4AFFA 2MY7A 2HZCA 3RZAA 3NNHA 4U8VA 3DLKA 4OZJA 2J8AA 2ERRA 5KFJA 4Y52K 4YUDA 3VR1A 5JVGQ 3ZZ0A 1RAHB 4CLKA 2VV5A 3FCWA 1LQ9A 3WX4A 4DV3J 1X0PA 4N7TA 3R8YA 1PJ5A 4XTTA 1MROA 2OEMA 3W2WB 3ILIA 3M6UA 1T8EA 1FCAA 2IC3B 1I51B 3FNNA 1QM9A 4C3MA 4CO5A 5C5JA 1Q79A 4FYVB 3FMWA 4DR2F 3RB0A 4A3CK 4TLQA 2VASA 2YU9K 3QGHA 4F8RA 4AYBL 2NZCA 3TJAA 5HN0A 2ASDA 3RTVA 5KFKA 1H38A 1REGX 3CCZA 3HHLD 4PRFA 2R8KA 4AL7A 2OHDA 1LWCB 3M32A 2HNZB 2QX0A 2V94A 3G2XA 2BACA 1UL3A 3JSYA 2RD5C 1RHQB 4A8OA 4DR1F 3GWCA 1Q0NA 3PO2C 4QIWL 4Q5VA 2WSEC 4FBUA 3M8PA 4P74A 2E9RX 4C11B 1EFWA 5B0CA 3R27A 3ZTSA 1XMQJ 1WOOA 2KHCA 2FVPA 1O28A 2C3PA 4C7QA 4DV3F 4QBUA 2DNRA 3I5BA 2IBKA 5ETKA 1S49A 1TWGK 2JFDA 1K8AT 2MTLA 4CYUB 5U47A 2CJAA 2E2IK 2D3O1 3NBPB 3L4JA 4GKJJ 7FD1A 1GX6A 3CJ0A 1H98A 2L48A 2VG5A 5L1LA 1Y5LB 2J7WA 1Y1VK 4BWMA 4OYXA 1S1VB 1U47A 4USMA 2FJDB 3FKBA 3MF5A 4DS4A 2GIRA 4P71A 2J6TA 3KK3A 2OUGA 4LFCF 3K2YA 4M8LA 4AQYF 2OLWA 2PN6A 2YWEA 3FUYA 2A69A 2BA9A 1F3VA 5LSRA 2FLNA 4FP9A 1T05A 1Y5NB 1KOOA 1AXQA 5AE1A 4MYUA 4WTOB 2XGQA 2Y1RI 1EHWA 3B6BA 2LA6A 2J9DE 3IRXB 3PR4A 2UUBJ 2RT3A 4HTJA 4B3SJ 3G4SS 5I3UA 1YJ9S 4WFBQ 1FX2A 4BY1K 2FQQB 1U0SA 1H73A 2FHOB 3H25A 2I2YA 2YWFA 3V6DB 3R5CA 1YRUA 1BWVA 1I1GA 4K4UA 3GB0A 4OZLA 2W4PA 4DXLA 2DVIA 2UV8A 1Y3KA 4U7UD 2J0SD 3H20A 4K4SA 1TWAA 2YKNB 5KFGA 1J5OB 2GSNA 4LRDA 4ZLPA 3D9BA 3IO1A 2CDRB 1HD1A 4XPEA 2NVTK 1IJFB 4YP3A 2ZC3A 2QSFA 3MEDA 2VZ9A 4GVLA 3VAHA 3AT1B 3B82A 1Z2LA 1Q78A 4UF4A 5KFQA 4OLOA 1KSPA 3TR5A 2CJQA 3QYYA 2DPIA 4HTIA 4NZ0A 2JEJA 5MLCV 3PM9A 5C42B 2A6EA 1XMBA 2QLXA 1XXBA 1R8AA 2PA3A 1SH3A 4DR7J 3LW5C 2R7RA 2KO1A 2WW8A 4G0UA 4G1QB 4KKOB 3BDEA 4YQWA 1G3OA 5F0WA 4BC9A 4IG0A 2VKZG 1RHUB 2OO4A 3KNGA 4ZCLA 1UJ4A 3I4HX 3KHHA 3ET6B 2AJFE 3MD3A 1U1LA 1O5JA 2DK2A 4UTGA 3I6PA 2BOPA 4O3RA 4NPOA 2CPFA 2CQ0A 3G8TA 3T1YJ 5TMCA 4LQ3A 1TMJA 3FEYB 3AXKA 4R0JA 3ZXWA 4C2MC 3DOKB 2KXFA 2C2OB 4DV0J 2V2ZA 2BVZA 4JI2F 1WEZA 3QAUA 3LP1B 4LIWA 1TP7A 5T14A 3Q8VA 4NRTA 1VK3A 5K8PA 2D1CA 5KG7A 1WHYA 3GG1A 3K0JA 4AXJA 4B3TJ 4B9LA 3OSPA 2IIHA 1RT3A 3S1NC 4NLWA 4M5HA 3JYTB 1CEZA 3JQKA 2W24A 4NI2B 1RA6A 4URQU 1NH7A 3NCQA 1W2IA 4ERDA 1GNKA 4XAKA 2CQHA 1YHQS 5KG5A 2VHGA 1RLCL 9ATCB 4DX5A 3G96A 1SJ1A 2W1BA 2FD2A 4KKOA 4DF8A 1R6YA 4I67A 4YDDB 4ZP8A 4YB5A 4WWSA 2HFNA 1B99A 2RHQB 2NXUA 3P4UB 1CULB 3BH7B 4F2SA 1PIEA 4QIVA 5KT5A 1AFIA 3BO2A 2NVXK 5FJ4A 4OJHA 4B3SF 3K57A 4DR1J 3D6MB 3J81Y 2DKOB 2FC9A 3BPSP 2OFGX 4WIIA 4C8YA 5IP7K 3PYDA 2BV3A 3UPFA 3OL6A 2PPBA 4TN2A 1F60B 1XNQF 1ZYQA 3DHWC 1NK0A 3DLEB 5DLFA 4C4WA 1LFPA 2B63C 1NDPA 2VA3A 4MTPA 2V2KA 4B9NA 3VA7A 3Q8SB 1ACMB 1RWUA 1CC7A 2H1YA 4TLRA 1SFOK 1REVB 1JKHB 5D77A 3TZYA 2Q79A 4B17A 8RUCA 1FJ7A 2HRTA 2LU2A 3NXZA 2DD8S 4KHRA 1U6FA 1HYSA 2HFSA 3THVA 1Y1WC 4RW8A 4ENOA 5HROB 4Y34A 2AKWB 2IDLA 2G13A 2CPDA 4QR2A 4ZOSA 2RDIA 3IRXA 4A3EK 5DQIA 4A8XA 3E51A 3MR2A 1T05B 1NZ8A 2MQQA 4UOFA 4NLOA 3MUTP 2KJVA 3PV8A 1WTFA 3KLFA 5HJXA 1WCMA 3W9HA 4WTYA 1S0VA 2VC0A 1AZSB 2VIHA 4ECWA 3AB2B 4JI4J 3DNCA 1EZZB 4NEYA 4RWXA 2XMKA 1BGWA 4FXWA 4FYDA 2FZCB 5C4JC 3A3OB 3HOXC 2QLWA 3FOEA 3CDEA 1D09B 3QX3A 1QDUB 1H2VZ 2P5MA 3TA2A 3I87A 1FJGJ 4ALZA 3BYRA 3NBPA 1E6VB 4CYUA 2CQ2A 1WOPA 2N82B 2QLBB 1VQOS 3T01A 1RCXB 2BR0A 5IQ6A 3JSRA 2IMOA 4C9DA 3RW6A 5AXMA 4C11A 3J7A1 4P75A 2FDNA 3OXLA 2MKSA 4ILDA 2W7OA 2PMHA 2HNDA 3HOVC 4QJVA 2RKIB 3GR0A 3CJTA 4Q5SA 2LQ9A 4DV4F 3QJLA 4PYDA 4K4TA 4NCBA 2AJQA 3N0CA 4WJ3M 4RNNA 1SL1A 2NVYA 5K14B 1QSLA 4ZVGA 4WYLA 4O3NA 4LRAA 4LSLB 3DLLQ 2A18A 4XIUA 4U7CA 3CCLS 4JI2J 3ETOA 4F0KA 2Z8QA 2QL5B 3MR7A 3ENQA 1GEHA 4ITSA 2Y8YA 4ZP6A 2JA6K 1VCTA 5J2QA 4X4RA 2HS3A 2L9DA 3IWNC 1NKCA 2GHPA 1B64A 3QJPA 4RL1A 4OYWA 3C14A 2VUGA 1WOSA 3DLKB 2VG7B 2DEJA 4ECZA 4X4VA 4OHWA 1B4SA 1U1QA 1DAXA 2JRSA 2N4CA 3CQZK 4KB4A 1F6TA 1PBAA 4LBHA 1R0AA 3OW2R 2DHHA 2AD9A 4Y2CA 2FLOA 4C0OC 3UN5A 1M5KC 3C66A 1RXOB 1K9MT 4B3RJ 2DNMA 4RW4A 3NY0A 3A3NB 2GQ2A 5DDPC 1HBMB 4X65F 4C97A 4I7FB 4ANEA 2OMLA 5B0AA 1VQLS 1C0AA 1HW9A 3VAJA 1TL1A 1YK9A 2F63A 3EWGA 3C15A 1XQIA 1TL3A 4X66J 2QG9B 2RNEA 1KQGB 1H6KX 1AROP 2IAJB 1XN9A 3BR8A 4A8MP 2AEMA 2E1MC 2ZD1B 3H5YA 1S9GA 4FXVA 4NASA 3CSKA 3PJ9A 3W64A 3V2UC 1FT8A 5L1JA 1X31C 8ATCB 4DCJB 5F41A 1U2FA 3HOVK 5HVGA 2XO6A 4H4OB 3DRSA 2AJ1A 4OMFG 3PR5B 1TWCK 2F9JA 3GFXA 4ZDNA 4NA2A 3LOUA 1NK9A 3GYGA 4DR3J 1FRJA 4DUTA 1PCAA 5AJ3J 4A3BK 1K1QA 2RQMA 4BWJA 4PXCA 3RRKA 5BYSA 1SIZA 4DPUA 4QWAA 3TQ1A 1UV7A 3GEHA 2H5EA 1CJTB 2VDHA 1CJKA 1UP1A 1BQNB 3RJMB 1RGVA 2DGSA 4R0EA 5C4JK 1ZQ1C 1JLBB 4X4SA 1KKHA 1I6HK 3GIRA 4PUOA 3CE8A 3OTCA 2VQFF 3GU0A 2GW8A 4USUA 3KXDA 2U2FA 3SQGB 1N6QB 4ANCA 2CXEA 4U7UK 2MQOA 4Q8EA 4WBFA 4HI1A 1YKWA 1R9TK 1EETB 4JI0J 2DR8A 4UW2A 2DRBA 2WOMA 5CABA 2JEFA 4FF2A 4HDGA 1F2HA 2DHSA 3ERED 3PYGA 3PHEA 3TAQA 1ZH5A 2YVSA 3M8SA 4XDCA 2LQBA 1UW9A 3GTJK 4AXIA 1Y1WA 3L95X 3MECB 1FWKA 3AAWB 4A93K 1PYOB 1BXNA 4JI3J 4A3IC
chains in the Genus database with same CATH topology
3T5HA 4FVCA 1OS5A 3SEOA 4YEAA 3EYZA 3CCJS 4J9NA 2UV8G 3CIMA 3LWLA 1RYSA 2BABA 4DG1B 5J1EB 3OQ2A 1WI6A 2XY5A 3BN4A 2BANA 2FJAB 4JUZA 2DCLA 2UU9F 5KT2A 3D54A 4PKDB 4B9MA 3HHNB 3FRZA 3RW7A 4OJ1A 3A8EA 4NRUA 2POKA 3TO8A 1X4AA 4IFVB 4KAWX 4P7TA 1SH0A 2C2RA 1FXRA 2YNHB 4ZHRB 1REVA 2EKYA 2BRKA 5K8NA 3IN5A 4OI4A 4OL8A 3BQ2A 3PJWA 3MEEB 5IWAF 1CQMA 4O3PA 1WQHA 4WU3A 2O1PA 3M6XA 1Z1ZA 1YGYA 3HI9A 3N6MA 1QY7A 3LAKA 4GO5X 4ILRA 3V6KA 5CXTA 4Q45A 1T94A 4WCEQ 3C6UB 1N5SA 2E7XA 2EBGA 2ZC4A 2WSCC 1LW2B 4I2PA 4LVOP 4DX8H 3PX4A 2XNRA 3F44A 3KLEB 5KFTA 2GNKA 2M7SA 3FEXB 4ED5A 3LALA 2R92A 4DQSA 5J2MA 2GSOA 1V3RA 5L1KA 1VQ5S 4DSLA 2UXCF 1S1XB 1VBZA 2UVRA 3OUYB 4IFVA 2KM8C 1IR0A 1S0MA 2CJKA 1BC6A 3GTLA 1VOMA 4OIXA 4QOTA 2MKJA 4FM9A 4YY3F 2FC8A 5LSLA 1IBKF 1KS2A 2FVQA 2LCWA 1BJTA 4KV8A 4GC7A 4ES3A 2E9ZA 2DT9A 5GMKa 2AGPA 1NRKA 3CWJA 1WD6A 3PVXA 4X4QA 3H2VE 4NYOA 2CPJA 1LXJA 5KFOA 3BR9A 2XSJA 3HHEA 4QU6A 3H0GA 2RH6A 1QJHA 2QV6A 4C8OA 2R4FA 2ZOGA 4MYTA 1NK5A 2DIVA 4FS2A 4KHPF 4KFBA 4CNZA 2WBRA 1R7IA 5K9FA 4TY8B 1XC9A 2LXFA 1VMBA 4YFUA 3KNAA 2F1FA 3LPXA 4OHVA 1IKYB 3I5AA 1QUPA 1FNXH 2MKKA 3CULA 1Q8BA 1RP5A 2RRNA 3D0IE 4FN5A 2RJZA 2KFZA 3M6WA 1G7CB 1IKWA 1Q4RA 5D78A 3CCES 4G3IA 1FNMA 1S97A 1XNRF 3X1LB 3DYAA 3PEHA 1SC6A 4RU9A 1N8RT 3FHZA 5EWFA 1HI0P 4DSJA 3OR2A 4YMEA 4NLGA 7FDRA 1BWEA 3Q8RB 2ZZMA 3CJKA 5J2PA 1X4EA 3FCHA 2EG2A 3NKYA 3HT3A 4BC7A 2ASLA 1M5PC 1JJ2R 2DH9A 2KI2A 2JLEA 1X5SA 1TL5A 4Y6IA 5C25B 1YWXA 3DFEA 5LMNF 2WOMB 3T3FA 2W25A 2A3JA 1HQUB 5FDLB 3EPIA 1JLEB 1HHTP 2Q43A 3KK3B 1X8DA 5HQ8A 1S9EA 3BB5A 2BE2A 2NYIA 1VRTB 2YX4A 2KU7A 2YWKA 3N01A 3UW1A 4ECYA 4CH1A 2P9GA 2RRBA 5CYMB 1FA0A 4ZP7A 4YR2A 4Y28C 2CVIA 3IFEA 3RAMA 4B3TF 4IO1A 4CTAB 1QSSA 3RB4A 3R5AA 1V3ZA 4IH7A 1S1VA 2D3UA 4OV1A 3UR0A 5D6GA 1YI2S 3GTMA 2JVOA 1S76D 5KG4A 4IRCA 2YU9A 3CC2S 2VG5B 5LXYA 3PW0A 1QAJA 2R7XA 3PZPA 1VC6A 2F3JA 3OVBA 5F8GA 1BD6A 1M90T 2AYGA 3M8QA 1U09A 2CZVC 4HT7A 4OI6A 4OI1A 3QGGA 3NP5A 1M0SA 5E3CA 1VQYA 3T1AA 5GAEI 3PFEA 4MK9A 2UUBF 4CCHA 1JLBA 3CDAA 2HGNA 1UVIA 1XTZA 4RBVA 1P8GA 1U1NA 3V4GA 4OZ5A 2ZH4A 1EP4B 1TFYA 1SJQA 4KJIA 5B08A 1VLYA 4URSA 1MWYA 4FZBA 2B7CB 2UXBF 1BQNA 5E33A 1FKAF 2R9LA 2WTFA 1G1XA 1RTIA 4R5PA 2NVXA 2DITA 3R5BA 2YNFA 1KLMA 3M05A 3BEGB 2MB0B 2HLUA 4Y2AA 2YNGA 5KG2A 2R7SA 1ZAVA 4ED6A 2PGCA 3NG8A 2D9PA 1KLNA 3IR5B 5DG9A 4D3HA 5DJBA 3US5A 2AU0A 1IBLF 4KM9A 1LXNA 3MCSA 1H7WA 4WFAQ 3HVRA 2HRYA 2LU1A 3IR6B 2MZQA 1FJEB 2GV1A 2AX1A 1B4BA 1RT5B 3L7OA 3KLHB 1IN0A 3SCKE 3MM7A 3CC7S 4E8UA 5GAGI 3M8PB 4QWBA 5I42A 3RR7A 2I1RA 4F3QA 4LT6A 1CSJA 2MZJA 3FSIA 5JJBA 4F4YA 1KQSR 1KFDA 4ECXA 1R8PA 5M2UA 2I8EA 4P6QA 3VZHA 5DM6Q 3K8VA 5GAHI 5E3QA 3OTDA 5E3RA 4DN0A 3I55S 2JDJA 2FUG9 4NCGB 4WXOA 2LVWA 5A8RA 2C3UA 3MMJA 2RQKA 1MNEA 4O4GA 1UETA 2D74B 2FHJD 2V8DA 5EUHA 1CC8A 1ZM4A 1RT1A 4A46A 5ITHA 3GIIA 2DH8A 2AGOA 1TK8A 1TKXB 4X84A 2B51A 2R2SA 1C1BA 3MAHA 1IKVB 1DTQA 2O01C 2V8GA 1B0VA 3R5DA 5F8HA 4J9OA 4J9KA 5BJRA 1YG0A 4EUVA 2VQEF 2NQPA 3U1NA 4BHQA 2WBMA 4H4KA 3CC4S 4IFYA 3FZBA 3F41A 4ED7A 4OX9F 3M2VB 2HNZA 3QZ7A 1NK4A 1LWCA 5IOQA 4WJBA 1YRTA 3K8WA 3NCPA 1HD0A 3OFGA 1FDAA 2K7KA 4I2QB 4IG0B 2DBBA 5E5NA 5D3GB 4KC6A 4IQXA 1YIJS 2R7VA 1GQEA 3SYZA 3V6HA 2QA1A 2V9KA 1A7GE 2DR9A 2GHVC 2XCAA 2GX8A 4KRWA 1SJRA 2B4PA 4B9UA 3T1YF 2DNQA 4WZMA 1QTMA 2HGMA 5DGBA 1AB4A 1NO8A 1DBDA 1OWXA 1HNIB 3PRDA 4NLXA 3LGNA 2GQCA 2QRRA 1JNZB 1L3UA 4G0WA 2DPJA 2FHMA 3MDFA 5KFBA 2GHWA 5C42A 1SXLA 4DQPA 5J2NA 1GH8A 3LH2S 1RKJA 4C3IC 3H2LA 1VI7A 4LSNA 1T7PA 3W2WA 4ECQA 2HHTA 3V6JA 5CHPA 2IAJA 3N4WA 4N8NA 1S1TA 1KHWA 3DRPA 4QWCA 2V9WA 5IZHA 5GADU 1GTEA 4EBEA 2RSQA 3LP2B 2HHHF 2AJ0A 2E5HA 1QAYA 5KFCA 3H98A 1DURA 1T3NA 4M1XA 5H9EJ 1Q8LA 3HZGA 1HWLA 3EXCX 2HHQA 3DU6A 5CQGA 5AXKA 5D3GA 1U1PA 2Z4PA 1JX4A 2FLLA 3MEDB 5IS2A 2YX7A 2ZH6A 1WELA 2A1BA 3MR3A 5F8JA 1JLFA 3P5TL 3MR5A 5KFPA 1DLOB 2OPPA 3A1YG 1TL1B 2B9WA 3D1OA 4I64A 1NHVA 2FVCA 4OLPA 4EO8A 4E98A 2OAUA 3CMES 1P1LA 1IKVA 1DTQB 3FFIA 1N34F 2FJXA 4DWIA 3L4KA 3BGUA 1BY9A 1RT1B 3TUIC 5E7OB 1SH2A 3I9V9 4BCAA 1J5OA 3TA1A 4ECTA 4DL4A 2CPEA 2DO4A 2P5VA 2E7WA 3E01B 1HBMA 2CJBA 3HVTB 3UWTA 2QYCA 2F8HA 4DL7A 4C3LA 4DDFA 3K5LA 4DLGA 3MOJB 1HWJA 3G6YA 2B9XA 5TJ3A 3LQVA 2HWHA 2X1BA 1S1UA 1URNA 1LK5A 2E1CA 4I68A 1QSYA 2WCXA 1BQMB 1J2VA 1X4HA 4TYBA 3TNVA 1FJGF 2UVVA 3TUJC 1SKRA 4GTAA 3OLAA 4OHYA 2COLA 3QLHA 5KOXA 2ZH9A 1D9DA 1ZZNA 2FVSA 5ADZA 4OZ1A 1FDBA 3QIPA 5G0RA 5LL6d 3AA9A 5B0DA 4G0VA 3DLJA 4FNIA 1QVGR 2B5JA 5IT9Y 3V4MA 3V6DA 4NZ7A 5AXNA 4RBTA 2R8IA 1VQKS 2KFNA 4DV5F 3R3TA 2AP6A 2YNGB 2RS8A 1WQFA 5KAKA 1KR4A 2CRLA 3MI7X 4YB7A 2YNFB 2HRUA 2XS5A 2UXDF 4DFPA 4WZQA 2E29A 2DRAA 1JLQB 2RH3A 3NLCA 5I3UB 3CJ4A 5F8IA 3J7ZT 2CQDA 4DF4A 3DMJA 2DHXA 1N5TA 5CH7B 1EP4A 3ULHA 4J9QA 4WFXA 4JI6F 1BLUA 2KTQA 2Q6CA 1G2EA 4F26A 2ROGA 2FB0A 1JLAA 1FJCA 2YKQA 1SFOA 3OL8A 4ATNA 1KTQA 2RIJA 2ZOFA 3DOMA 4DDQA 5J2QB 3HVAA 3M8QB 1HWUA 2UUTA 5F0UA 1VQ8S 4ECUA 4HH1A 2KG1A 2JEGA 4BS2A 2AJ4A 1S6QA 3QPIA 4EFAC 1DTTA 5HBMB 3GV7B 1TFWA 5B7WA 4QPTA 5F8LA 1KN6A 4MJKA 4V19J 3JTPA 3FMBA 4MK8A 1R89A 2C3OA 3GIJA 2MQLA 3KK2B 1UFWA 1XERA 4PG5A 3KHGA 2FJVA 4B3OB 4GT9A 4QYRA 2BE2B 1UAWA 3UCGA 3OPKA 3U1MA 3UNGC 1OO0B 1WHWA 2YKPA 2YNIB 4P2SA 1KQFB 2EFVA 1JLEA 4ID5A 2MPUA 4ID8A 2VUMA 3H4DA 1MMDA 3N0BA 4LVNP 1FKOA 2X51A 4I1TA 4MIWA 4QIEA 4GKJF 2XNQA 2KFYA 2K2PA 2L9NA 3PW2A 3N3YA 1XXAA 3GTGA 3MPWA 4XDDA 1WNEA 1C1CA 1X4FA 1YJTA 2I9SA 3OR2B