3LAPA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-canavanine.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
149
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator/dna
total genus 46
structure length 149
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lapA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lapA02
5FLXK 4KC6A 2P4WA 2FBIA 1UHWA 1J2XA 4IJAA 3BY6A 5L3DA 1TW3A 1B4BA 1EH6A 4N9HA 5LEJA 4PGGA 5HS7A 2E1NA 2VT2A 3K1NA 1BJTA 1XXCA 4A0XA 1I5ZA 3I59B 4CICA 4WWCA 1QPMA 2RGVA 3KP5A 3GLXA 3HRSA 5J8CA 4RGSA 5EEHA 1T98A 3RYPA 4HX8A 1O7LA 2HWVA 2NNYA 1VTNC 4KDPA 2ESNA 2OU2A 3TGNA 3KP3A 5F6FA 2JPCA 5ICEA 2DQRA 1O57A 2DAOA 3I0TA 3FMQA 2K7LA 4UV8A 3SHFA 1EV7A 3F8BA 2HGCA 4JQFA 2NS0A 3F3XA 1O7FA 3V7CA 3WTZA 2ZFZA 4L9VA 2G7UA 1ZGJA 4A0YA 3H92A 2CGPA 4MQVA 4OMYA 3RDIA 2R7FA 2O3FA 2KIMA 3Q9VA 3GF2A 3IHUA 2O03A 3M1EA 3V4GA 3HUGA 3KETA 3BJAA 3GUDA 2W25A 3KE2A 4KA4A 3CDHA 1DUXC 2OBPA 5ILSA 3TO7A 1H0MA 1ON2A 3TDZC 1WQ2A 2A3SA 3P9CA 2FF4A 4RAZA 2QZ8A 3HSFA 1V3FA 3MZHA 2VXZA 4S05A 1R7JA 3KFWX 5LGNA 1ZG5A 1KQ8A 5ED4A 3QRFF 3WODF 1ZAOA 5H20A 3O2PE 5DD4A 4KIBA 3RKXA 3L4KA 1MKMA 4IHTA 2F5CA 1FZPB 2E7XA 2CQKA 3F8CA 2IJLA 3H3UA 2HS5A 3L9FA 3DP7A 1ZHFA 4M9ZA 3TDUC 3VODA 3GFJA 2QUFA 2YPRA 1HXDA 5ICGA 2EA4A 4BQAA 2DU9A 5TJJA 2FQ3A 1P2FA 2H94A 1E2XA 4A2UA 3VEPA 2RQPA 3BPVA 3BP8A 2B0LA 3R0AA 2Z99A 1Z6RA 5LHIA 3KZYA 5DCMA 4OOIA 2O61A 4UXNA 4Q48A 4YFXF 5CYVA 4I0BA 3DFGA 1IN4A 4I2OA 2VONA 3NUHA 1K6OA 4KN4X 2DT5A 5EEGA 1RUNA 2JZYA 4Y17A 3ZPLA 3F6OA 2L02A 1MDMA 5D5VB 2PJPA 2K02A 2F5EA 3ZMVA 3IL2A 3Q5FA 3B73A 4I09A 3E3VA 1T0FA 1BC7C 1XMKA 2P6SA 2BE5F 1FC3A 1D8JA 1SD7A 2PBIA 2H6BA 5E1XA 3E97A 3ZMSA 2ISYA 3HHHA 2Y75A 1KYZA 4WCGA 2Z3YA 2M45A 5FD6A 1J75A 2GWRA 3HYIA 3F6VA 4GCVA 5BPDA 1DPRA 2DPUA 5LRRA 2VC1A 1Y0UA 5HOOA 4KNYA 3ZMTA 5IT9Z 2GA2A 2MA3A 1XCBA 4G6QA 2CFXA 1HKQA 2KRFA 3E5QA 4UHTA 2MLGA 4CGZA 4Q5SF 4I0AA 2FBKA 4LMYA 3BJOA 2LKPA 2FE3A 4HV5A 4CDGA 3E6MA 1MGTA 4ENNA 3KP7A 1J5YA 5FGMA 3GW2A 3K2ZA 2YX4A 2BV6A 2HZTA 2FA5A 3V8JA 1FSEA 1MJAA 3GX4X 1XSXA 6PAXA 3E5UA 3I4PA 4ZYGA 4WXDA 4KB2A 3I53A 3BWGA 3ISPA 1LVAA 2PN6A 1IAWA 1ON1A 3DXJF 1IRGA 1UFMA 5BQTA 2G7HA 5BOXA 2VBYA 3KLOA 3ZN0A 4MTDA 2MD5A 4EM2A 4WX9A 3U2RA 4UV9A 2VC0A 5K5OA 2ZMEB 4MTEA 3ULQB 1ODDA 2K86A 1FYMA 3CUOA 2FSWA 1REPC 2HOEA 1XD7A 4N0BA 2D2WA 3JSOA 4G8XA 1D8KA 4K2EA 2HQNA 1DP7P 3RPUA 1C0WA 2QWWA 2XGXA 1R58A 3V7SA 3RIRA 1GXQA 4YFKF 4S04A 1D5VA 4UVAA 4P96A 1FWZA 4EGYA 2DTRA 3FM3A 1PUEE 2OQRA 4A6EA 5K5RA 5HS9A 4LK0F 3RPQA 1SAXA 1XMAA 2HYGD 1G6NA 1T38A 2PFBA 4KN7X 4BNCA 2LSOA 1CF7A 3IRRA 1W7PB 1TQMA 4U0VA 4ENKA 1T6SA 1KQ0A 4HLXA 4PCQA 1ZRFA 4BHBA 1T39A 5HDNA 4LJZF 1STZA 4HA8A 4GO1A 2HQRA 3FZVA 5LEKA 4BHPA 3IWFA 4HYEA 2BBYA 3KZZA 3KP6A 1WIHA 2DQLA 1FLIA 1SMYF 1J9IA 2D1HA 3I58A 1YTYA 3ABUA 5L3GA 1GHCA 1MJ9A 3LAPA 1IUYA 1YFHA 4WXCA 1WWXA 4O6JA 4IRHA 3BOQA 2TDXA 4M9XA 3COAC 1LDDA 1R36A 5DUIA 4IXAA 2CYYA 2P7VB 2V9VA 3ZMDA 4EJOA 2WC2A 1Z9CA 1O3SA 3FWEA 1PDNC 2HFHA 2RGRA 1BOAA 2IW5A 3J81K 2RC4A 4EMSA 2HTSA 1BI0A 2FEZA 3I59A 3W6KB 5DUKA 2LDUA 3CO7C 3KEOA 2ZCWA 3FXQA 4ETSA 1ZG1A 3OREA 1FSHA 3LFKA 1P4XA 2ETHA 2W84A 2ISZA 1F5TA 2DW4A 1G3YA 5CVVA 5HDKA 2FMYA 2EWNA 1TW2A 2EB7A 1U78A 4HAMA 4U0WA 3RI4A 2M5WA 5BPIA 4N9IA 4IRIA 2EV6A 3Q9SA 4P55A 2FBHA 4HX4A 1SD4A 5DD8A 2XAJA 5KK1A 2IRFG 2EA2A 2PMHA 3L09A 2PMUA 2ZXJA 2QQ9A 4KAWX 4A0ZA 1XXBA 3E6BA 3I71A 4MNUA 2QBYB 4IVNA 1BI3A 4B8XA 2IA1A 1R00A 1QNTA 4UNOA 1V4RA 3NEUA 4JK1X 1EH8A 2QVOA 1XN7A 4M73A 2V6CA 1GVJA 2F5FA 4A12A 2HKXA 2J5OA 3FHZA 3K0LA 2JPBA 2RVCA 1JHFA 4HF0A 5HLIA 1Z05A 5LGTA 1QZZA 3HTSB 3GO5A 2GXGA 1HKSA 3TOAA 1IZ1A 2RNJA 1KU3A 2M87A 4A6DA 3RYRA 2V1UA 2XV4S 4L9TA 4MQ9F 3ERED 3CUQC 1XXAA 2MH9A 1BBYA 1QQIA 3OPFA 3O6BB 2J5PA 2OAZA 1HW1A 1L3LA 2VBXA 2XHKA 2DLLA 1G3SA 4U88A 1J59A 5K1YA 2AS5F 3VA7A 1WRJA 3D0SA 3FOEA 3VFZA 1YS7A 4AIKA 3HOSA 5L3FA 4G94A 1YG2A 1ZGAA 2JT1A 3OOPA 2NRAC 1U6GA 4ZYDA 5HDGA 1JGSA 3C18A 4CHUA 2FMLA 4D0PA 4OMZA 2ZKZA 2M1BA 2F2EA 2XKOA 1UB9A 1FP1D 4HBLA 2IA0A 3MEXA 1S6LA 1O3QA 3ABTA 1FYKA 1HKTA 2EFNA 2FU4A 4P9UA 1BIBA 4RB1A 4UVBA 4LB6B 2VOPA 4PGHA 1LEBA 4QWQA 2ZBKA 4RS8A 1Z1DA 2E1CA 2XROA 1BN5A 5E20A 5CVIA 3TOBA 3KP4A 3RKYA 2K4BA 2LF8A 3U9GA 3SQNA 1MZBA 2O8XA 2BGCA 3WTTC 2A07F 1U3EM 2QM3A 2Q2EA 1OR7A 2HTJA 4E70A 4O3MA 5JFRA 2P6TA 4B09A 4CZZA 4OIOF 1W4MA 1KU7A 1WQGA 2ZJ2A 1U8RA 3WTVC 5LGUA 3CJNA 3HTUA 4GFQA 3F8NA 3MZYA 1IXSB 1ONVA 5D8LB 2HDCA 1L0OC 1HW2A 4HQEA 4U7DA 5DCFA 3CAGA 3H3ZA 4IRGA 4Q4ZF 2V79A 4FX4A 5CJ9A 4ESJA 1O3TA 3D5LA 1XSDA 1YLFA 4OIQF 2L01A 3R4KA 2P8TA 4Z2YA 2EFOA 3LAJA 3E6CC 3HRTA 1QO0D 5H6QA 2VBZA 1W7PD 2H09A 4G9YA 2XAGA 2Q0OA 2W24A 3WG9A 3FF5A 2KJCA 4L0ZB 3C3WA 2NNNA 4AVPA 1AOYA 1JE8A 1IN8A 1CGPA 3LA7A 1WSUA 2WWYA 2GXBA 1K78A 1F4KA 3QX3A 3JTGA 2VOOA 2XCRB 2UXNA 2XAQA 2ELHA 3QOPA 1EK8A 4NQWA 2UXXA 4AIJA 1R1UA 4HDUA 3GFLA 2H27A 3K1MA 3WU1B 5L3BA 3M8EA 5J8FA 1DPUA 3QAHA 1YW8A 3GYHX 3IKVA 3M7GA 2ZMEA 3BZ6A 2DFIA 1IXRC 3C1DA 4UUVA 3T8TA 1DD5A 4F7ZA 2KWAA 3ZMUA 4XLNF 3E5XA 3GZ6A 2MH2A 4YG2F 4J3NA 4AIHA 5HVQC 3I64A 1Z7UA 2GZWA 5DEQA 1ULYA 3HSEA 3CO6C 1K78B 1GXPA 3TQNA 1KA8A 1SD5A 2KJBA 5LBQA 3K1PA 4GXOA 5ICFA 1MD0A 1TLHB 5ILVA 1P6RA 4KYWA 1F1ZA 3FXUA 1G4DA 3DKWA 4I7HA 1WKMA 1U5TB 3N97A 2GAUA 3J7AO 2XASA 1JXSA 3WE2A 3JTHA 2VE8A 3GFIA 2IPQX 3HRMA 5JR3A 1W7PA 4ZH4F 4GYIA 2F5DA 4WK8F 4KDDA 5AIPA 4KICA 5F1RA 1SFUA 5FO5A 3R0JA 5FD5A 2PG4A 3WE3A 5CVUA 4M6XA 1IW7F 1I6XA 3L2CA 1OMIA 3DV8A 1B4AA 3GWZA 1R5HA 1RI7A 5AIQA 3I54A 2Y3PA 1S7OA 4AD9A 3WU0A 2Z9OA 3R6SA 4HW0A 5BS6A 4EGZA 3O3KA 5E8IA 1Q1HA 3FX3A 2MC3A 3V8KA 2DK8A 1XGMA 5JI6A 3WGGA 2H6CA 2Y0MA 2P5VA 3WTSC 4AWXB 1O3RA 1BM9A 5LHGA 3ELKA 1YW9A 2GQQA 4I02A 4RB2C 3HIFA 1FX7A 1ZVUA 2FOKA 4HLYA 3J81Z 4KUMA 1R1VA 1YS6A 1S8NA 4G7ZF 4KB4A 4EJVA 4FM9A 2ADUA 4LD5A 2K27A 3IRQA 2HEOA 3VB2A 3EUHA 3ML6A 2MBFA 3LA2A 4BXUA 1SMTA 3W6JB 2QLZA 4KT5C 1HQCA 2EJRA 3IC7A 2GA1A 1WI9A 5JHUA 2D45A 4H0EA 3BROA 1Z6TA 4HF2A 3KLNA 4OU0A 1NHAA 2HYFA 3F21A 3K9TA 5D8KB 1J7KA 3RTRA 5D4SA 4NHJA 1UHMA 3L00A 5DV5A 3VOEA 1BIAA 3P9IA 1IRFA 4M71A 2QBYA 4XLPF 3F22A 4KIFA 5D4RA 2QQBA 2ZFWA 1SFXA 1AB4A 1U2WA 5J6XA 2DO7A 2KKOA 1BGWA 4ZYHA 4A5MA 3DQVC 4ESFA 3R60A 1IS1A 2IP2A 4L0YB 4QLCU 2VT3A 3T8RA 3EDPA 3DPLC 2EFPA 5D6EA 3LWFA 4YIIA 4ESBA 3ZP5A 1XGOA 3B02A 3J80Z 1XGSA 3L7WA 2COMA 1ZG3A 1B9MA 3PFIA 2W85A 3BDDA 4L9JA 2ZNYA 1R23A 3LSTA 1S7AA 5IT3A 5AONA 3FM5A 1EH1A 1ZRCA 1QGPA 1KU2A 3R61A 4XRFA 2XAHA 3HOTA 2L54A 1YW7A 3WGIA 2C6YA 1TNSA 3OV8A 2STWA 1S29A 2OZUA 1UCRA 2A61A 1FBQA 3KEQA 4MGRA 2XCOA 3HRUA 1K7AA 2M30A 4XSZF 4ZZDA 2DPDA 1E17A 2W57A 3TO6A 1P92A 3CUQB 3F23A 2QYOA 1OYYA 1H9TA 1JHHA 2HR3A 2XIGA 5HLHA 2K4JA 2NAZA 2DBBA 2JTVA 1K79A 3J80K 2XRNA 5DYMA 4HF1A 3ECHA 4R8HA 2VN2A 4OIPF 3FOFA 3WGHA 4KFCA 1Z91A 2RN7A 2QQAA 2FNAA 3JW4A 1FYLA 3EETA 1HBXG 1X3UA 1KGSA 2FNPA 4RAYA 4EJWA 3NRVA 4EM0B 5CVJA 2RV8A 3GFMA 4HDVA 2FRHA 3CTAA 1F9NA 1HSJA 3TKYA 5CLSA 4ASNA 2BYVE 2XKPA 5E18F 5E8GA 1OPCA 1DDNA 4P5OA 4ON0A 3BJ6A 5ICCA 4FX0A 4DDQA 4G0UA 2O0YA 4I98B 1HW5A 2A6EF 1W5SA 1RNLA 2RKHA 3QPHA 4RGXA 4R1HA 3F72A 4BHCA 1I1GA 1FOKA 3MWMA 1XB4A 1QZYA 3GXOA 3MAJA 5FFXA 5TRDA 1RIOH 3EQLF 2RDPA 3M9AA 3T1BA 3QU3A 2Q8KA 3OEPA 2IVMA 3QP6A 1OYIA 1ZH5A 2AXLA 3QP5A 5D5WB 2ACJA 2QENA 4EV0A 3L4JA 1IN6A 4NB5A 4M6YA 2M8EA 3AAFA 3WTXC 3CLOA 2XVCA 1WQFA 1FY7A 2LF7A 4YFNF 1TBXA 2VE9A 2LNBA 3ECOA 4LB5A 3SFZA 4U0YA 2A69F 3I5UA 3MMLB 2A68F 2EV0A 1LEAA 2CW0F 2JRTA 3ZMZA 3IKTA 3MFKA 1GE9A 4CO8A 3F8FA 5FB2A 4LFUA 1LQ1A 3K69A 1XGNA 1FP2A 4EJUA 1USSA 3M8FA 2OD5A 4FT8A 5DDGA 2VODA 3MCZA 1USTA 2YU3A 5F64A 2NYXA 3HHGA 3V8LA 5ERIA 1IXCA 3KCCA 2CSOA 2YX7A 4TV7A 5LLQA 2P5MA 4KIGA 1I27A 4CYDA 2Z5UA 4MEYF 3JSPA 2CWEA 3EYIA 1B6AA 2IA2A 1P4AA 2PQ8A 2ESHA 1TTYA 1XDUA 4HOBA 1ZARA 1RZ4A 1IF1A 2XCQA 4EQQA 4MHGA 5D6FA 1KYWA 4LG0A 4G7HF 4BYYA 3N4MA 3MQ0A 2P5KA 2R3SA 1LDKB 2CG4A 4HQMA 4U7BA 2E7WA 5CVRA 4RB0A 1HSTA 1KQ9A 4FHTA 1B1BA 1U5TA 2VBWA 2Z33A 5DCMB 4IPAA 1OKRA 3T5XA 5HS8A 2V1XA 1AWCA 4RB3C 3BUEA 2JSCA 3BPXA 4L5IA 4LGWA 3DF8A 1YYVA 1OYWA 1ISEA 3WTYC 5E1ZB 4LG0B 3GEZA 1LB2A 2FXAA 1S3JA 1ZYRF 1MDMB 2OZ6A 3DEUA 1XSVA 4ENMA 4RGRA 2V1DA 2KIFA 4A5NA 4CXFA 5L3CA 3TO9A 3V7RA 5H6RA 2L4AA 3RJPA 1B9NA 3P7NA 4KMFA 2P7CB 2Y48A 2HKOA 1A04A 2STTA 1RUOA 3FXRA 4R79A 3IWZA 4LLGF 2XUBA 4WXHA 4L5JA 5A2QZ 2O6GE 3ZQ7A 4LLNA 2EFQA 4P9FA 1BI2A 4M74A 5D5XB 4L9NA 1BC8C 4ZYEA 1FBUA 1LNWA 4KMUX 4HZFA 3KP2A 3F8MA 4RGUA 1BI1A 5E1WA 5IT9K 2A5YB 4I01A 3ZN1A 3HSRA 5D5UB 4DQ2A 4Q47A 1TNTA 4OINF 2OA4A 1FT9A 1U5TC 1FPQA 4JBAA 1SFEA 2IT0A 1QBJA 1R22A 5BMZA 2L4MA 4Y13A 3G73A 3DPTA 1YIOA 2KIUA 3FMRA 3C7JA 4M9SA 5A2QK 5FFZA 5K5QA 1B59A 2DI3A 4LLLA 3S2WA 3PQJA 1ZRDA 4GYGA 4PZJA 3SZPA 5ILUA 4G0WA 3G3ZA 3WTUC 1SD6A 3FMSA 2YR2A 3EYYA 3JAMZ 1ZN2A 3SXYA 5E17F 2P5LC 1W5TA 1XDSA 1TQPA 1XCVA 2CO5A 4G0VA 1MJBA 2YSRA 3LQQA 5LHHA 4G7OF 4M72A 3GZ5A 3QPTA 1ZREA 2EV5A 2X0LA 4EVIA 4MEXF 4XSXF 2EK5A 4GGGA 4O5VA 3P9KA 1PP8F 4EM1A 3NQOA 1YQAA 5JVTA 2PEXA 2X4HA 3E6DA 1ZLJA 2WV0A 3PQKA 1R5GA 4YIFA 1G3WA 5KVRA 2XAFA 2PLYA 4OIRF 2WTEA 2GIVA 1PP7U 4L18B 2EFWA 3RKWA 2D1VA 1IN7A 2UWMA 4LK1F 3GVAA 4DNCA 5LRSA 3T0YA 5FLXZ 2OQGA 3LPXA 1ZLKA 1FNNA 1KU9A 3QU6A 2MLKA 4Y15A 1LDJA 3WTWC 1TQIA 4UVCA 4BAYA 4PDKA 1I1SA 3LQRA 2ZNZA 1P4WA 2DK5A 2BEOA 1YO5C 3JAMK 1EH7A 3LA3A 1D3YA 1FBSA 1CF7B 4BH9A 2ZO4A 4WF2A 4HX7A 3U1DA 3CUQA 4EJTA 1T2KA 2L3DA 2PI0A 1WQHA 4G6DA 1IN5A 4HV6A 3REOA 5JVOA 2UZKA 1BJAA 1J0RA 4XBFA 5L3EA 4ENJA 2A6HF 1LJ9A 1R1TA 4ZZLA 3SZTA 4IHSA 1H9GA 1G3TA 4IF4A 2G9WA 2R7DA 3ROUA 5HLGA 2PHCB
chains in the Genus database with same CATH superfamily
5FLXK 4KC6A 1ENHA 1IDZA 2P4WA 4BE0A 3K70C 2FBIA 2DA1A 1SANA 2PMZA 1UHWA 1J2XA 4IJAA 3BY6A 3J7YJ 2NVYA 1X1AA 5L3DA 1TW3A 2HOAA 1I50C 2M0CA 3S1NC 1B4BA 3ZQFA 1EH6A 3TFJA 1V5EA 4N9HA 4XLAA 5LEJA 2XC7A 4BBSC 4PGGA 5FLVA 5HS7A 2ZXWH 2X1DA 3AD8C 3LMMA 2H1LA 2E1NA 1K83K 2VT2A 3G1OA 3K1NA 4XRSA 4FETA 1BJTA 4DZJA 2BY3A 1O2FB 4A0XA 1XXCA 1WGXA 3A01B 3IH2A 2WB1N 1I5ZA 5LFAA 1X1DA 5J40A 3I59B 4D1QA 3DXJA 4CICA 4CA0A 4WWCA 4PK4A 1J6WA 4LIVA 5EGOA 1QPMA 5KNLA 2L9VA 3ADAC 2RGVA 1YNNA 3CDLA 2EBBA 2JA7A 3KP5A 3GLXA 1BOBA 3HRSA 5J8CA 3PO2J 4RGSA 1XPXA 1Y8QB 1UELB 3E1SA 1SFOC 5J4YA 4C3IJ 5EEHA 3GTPJ 4QIWN 4G6TB 2AHQA 2E2HA 1VQ9I 3EPZA 3LNQA 5IYCJ 1T98A 4BJ6C 2MC4A 1RR7A 3RYPA 5IP9K 5EYRA 4HX8A 1O7LA 1P7IA 1NG6A 4A3CJ 2E2HK 1BW5A 2NS7A 4F92B 3HKZA 2HWVA 9ANTA 2I5UA 4JYKA 3S8PA 2LG4A 2NNYA 3FXMA 3S17K 1QRYA 2VKVA 1JTYA 2BXYA 1VTNC 3KIOA 4KDPA 2ESNA 2OU2A 4JK1A 3JSTA 3PNTA 3TGNA 2IS1A 3KP3A 3KX2A 5F6FA 2VJIA 4CYCA 2YS9A 1Z67A 3H9JA 4QSHA 2JPCA 5ICEA 2WAQA 2DQRA 1FTTA 1O2AA 1O57A 1X1CA 4XKVA 2DAOA 3I0TA 5C44J 3FMQA 2HVQA 4YFKA 2K7LA 4UV8A 3SYTA 5TMFA 4XLCA 3SHFA 1EV7A 3F8BA 3S15K 3HOUC 2LH9A 1YITI 1WJAA 2E34A 1R9TK 2WV1A 2DA5A 3TP0A 4LQYA 5C4JJ 2HGCA 1JUPA 3GTGJ 5CQEA 4A3LJ 3ZCOA 3CCRI 4JQFA 2CV2A 2E35A 4BY1J 5M5YK 2JA8C 2NS0A 2W7VA 2N8GA 3F3XA 1O7FA 1YJ9I 3V7CA 3WTZA 2ZFZA 5M5WK 1Y1WA 4L9VA 3OYEA 2QQ8A 1OCRH 1YHQI 2G7UA 1XMXA 1ZGJA 4A0YA 3H92A 3K7AJ 1SAUA 1X31C 1VRQC 2EQRA 3HGYA 2CGPA 4PABA 3S14J 2OUMA 4MQVA 4OMYA 1Z77A 3S1MJ 4ZDOA 2OTJI 3RDIA 2GAHC 2R7FA 2O3FA 1R4NB 2KIMA 2W82A 4BQQA 3DTIA 2NVYC 2HU9A 3HPGA 3Q9VA 1SVMA 2TRTA 2XF7A 3GF2A 3IHUA 3QYBA 3SZGA 5DS9A 2O03A 1YRNA 3M1EA 3Q0VA 2E2IA 3V4GA 2IBDA 3HUGA 5IP6A 3KETA 1K83C 2BXZA 3BJAA 2DMPA 3GUDA 3DEWA 5EG0B 2W25A 3KE2A 4KA4A 4LJZA 4A3MK 5GPCA 3CDHA 1DUXC 3VWBA 1TWFK 2HOTA 2OBPA 1DCHA 5ILSA 3TO7A 1HI9A 1YCLA 5GADJ 1H0MA 1ON2A 3TDZC 4V19K 1WQ2A 2A3SA 3CQZJ 3P9CA 5F04A 2FF4A 4RAZA 4F52A 1SMYA 3L2UA 5FRNA 2L9RA 2HVRA 2QZ8A 3E0JB 1Z3XA 3HSFA 4BBRK 1V3FA 3MZHA 3A02A 2VXZA 4S05A 4XR6A 1R7JA 3KFWX 5LGNA 1ZG5A 1KQ8A 1EFWA 1B72A 5ED4A 5DM7F 1HOMA 5B3SH 1Y39A 3QRFF 3WODF 1ZAOA 1JQWA 3HL2A 5H20A 3ESWB 3H35A 3O2PE 5DD4A 2EPFA 4KIBA 3LSPA 3RKXA 4GFBA 3L4KA 3AG4H 5KAIC 1MKMA 1D0XA 2E2HC 4IHTA 2F5CA 2FUG2 2H8RA 1FZPB 1OISA 2E7XA 3PL8A 1J6VA 2CQKA 3BQYA 3F8CA 3RCOA 3S17C 2ID3A 2IJLA 2RQQA 2GIZA 4C3HC 3H3UA 1EA3A 2HS5A 3GTLA 3L9FA 3DP7A 1IG7A 1PVEA 1WFXA 1ZHFA 4M9ZA 2ZJQF 3TDUC 4F55A 1DCPA 3S3NA 3VODA 2MSYA 4Y7NJ 1O28A 3GFJA 1UV7A 2QUFA 2YPRA 1WVRA 1YRNB 3I4NJ 1HXDA 2D6FC 4M3GA 5ICGA 2EA4A 3RZDJ 4BQAA 2GOXB 3S15C 2DU9A 5TJJA 1ZGWA 2FQ3A 1P2FA 2H94A 4A3EJ 1E2XA 1D0YA 4C3JJ 4AIDA 4U87A 3MN2A 3GTMA 4A2UA 5FJ8J 3VEPA 4O2DA 2OJED 2KDOA 2RQPA 1NG7A 3BPVA 4E7ZA 4BBSJ 4XONA 1DU6A 3BP8A 2R7SA 2B0LA 3SEQA 5C3EJ 3R0AA 2KLOA 2Z99A 2QCOA 1Y1WC 2L7KA 3EUAA 4ZDLA 3HOWK 4A69C 1Z6RA 5LHIA 2L2OA 3KZYA 1W36C 1D1BA 5DCMA 2O9LA 2NVQK 4OOIA 2O61A 1MMGA 4UXNA 4Q48A 4YFXF 5CYVA 2K9SA 4I0BA 5IOQA 3DFGA 3LSKA 1IN4A 4I2OA 2VONA 3BZCA 4A3MC 3NUHA 3QPSA 4A3KK 2DFFA 2LKSA 4XIDA 1TWCK 1K6OA 2NOGA 4KN4X 2DT5A 5EEGA 1RUNA 2R0QC 1TWFC 1VLOA 2JZYA 4Y17A 4V2FA 3ZPLA 3F6OA 4FZBA 4EATA 3UKGA 2L02A 5FKOA 4ZDPA 5JFEA 1MDMA 3BG9A 5D5VB 4BBRC 3BCBA 2PJPA 2K02A 2F5EA 3ZMVA 1LE8B 2Q2EB 1ETQA 3H36A 3LSMA 3L2VA 3IL2A 3ABKH 2VASA 3Q5FA 3B73A 4I09A 2EZLA 3E3VA 1T0FA 1RC9A 1BC7C 2IXSA 3FKIA 1XMKA 1LPQA 4Y3OA 2P6SA 1TWGA 1O27A 4AYBD 3DWLE 2BE5F 1FC3A 1D8JA 2VLAA 2ICWG 1SD7A 2PBIA 1VQMI 1WZ2A 2ZUEA 2H6BA 1MMSA 3H1CA 3E97A 5E1XA 3ZMSA 2R7ZJ 4XL9A 1O2BA 1X19A 2V26A 1Z21A 2ISYA 2JSPA 3JRFA 3HHHA 2VQGA 2ZJRF 1E3OC 3IPJA 5GTIC 2Y75A 1KYZA 4WCGA 1F93A 2Z3YA 2LK2A 1BJZA 3OSFA 3H0GA 2M45A 3GZNB 5FD6A 3CMAI 1J75A 2GWRA 3OYMA 3HYIA 3F6VA 2JA6A 2BW3B 2JA8J 4GCVA 2JUCA 3CCEI 3Q0UA 1DPRA 5BPDA 2DPUA 5LRRA 2DYSH 3AQPA 4GDFA 2VC1A 3J7AY 4MQ9A 4RBOA 2CQQA 1ACIA 1UJ8A 1FTZA 1XZQA 3TL4X 1Y0UA 3PO2K 5HOOA 3OL3A 4KNYA 3OYAA 1PUFA 2HXIA 3ZMTA 5IT9Z 2GA2A 4DYCA 5H2FC 2MA3A 1XCBA 4C3IK 3GTPK 4G6QA 2X6YA 3RQ4A 3GLLA 2CFXA 1HKQA 5IYCK 1SC7A 3H3VL 2NVYJ 2KRFA 2P0WA 3E5QA 4UHTA 1RU0A 4A3CK 1ETXA 5HLTA 3GCMA 2HNHA 2MLGA 4FTHA 2R7RA 4CGZA 1UHSA 5GAHJ 1Y6IA 4Q5SF 3HOWC 4RDUA 4I0AA 2EH3A 4NBQA 2FBKA 4LMYA 3BJOA 4F93B 2LKPA 2FE3A 4HV5A 4XRMA 4CDGA 3E6MA 1S5LC 2HVSA 1UG0A 1MGTA 2DCEA 4ENNA 3KP7A 1J5YA 2NVQC 5FGMA 3GW2A 3K2ZA 2YX4A 5C44K 3SFIA 5KCMA 2BV6A 2HZTA 2FA5A 3V8JA 1FSEA 2WY7Q 1QVTA 3GIRA 4DOZA 1AKHB 4A3KC 2JA7J 2F6CA 1MJAA 1TWCC 5C4JK 3GTGK 3GSIA 3GX4X 4A3LK 3GTQA 4BY1K 3HXAA 1XSXA 6PAXA 3E5UA 3I4PA 5HL8A 3BG6A 2R93A 4ZYGA 4W97A 2DFHA 1BL0A 2DODA 3QYEA 4WXDA 5M3MJ 2E2HJ 3OR1C 4KB2A 5IOSA 3I53A 2NVXA 4NQWB 3BWGA 3JRGA 3ISPA 1LVAA 2FQ4A 4IKFA 3K7AK 2PN6A 3BTIA 5K7FA 1JOEA 1IAWA 3OOUA 2VQLA 3S17J 1ON1A 3SEZA 4XKCA 3DXJF 3S14K 1IRGA 4C3HJ 1UFMA 1VNDA 2BVMA 4DIQA 5BQTA 3I4MC 2G7HA 3AFHA 1WPKA 3GMEA 5BOXA 2VBYA 3KLOA 3ZN0A 3WODA 4MTDA 1LFBA 2AXTC 2MD5A 2F48A 4EM2A 4WX9A 3U2RA 4UV9A 2VC0A 2AO9A 5K5OA 2ZMEB 1MSFC 2K3PA 5FROA 4IHWA 3A8KA 4MTEA 1FIPA 3ULQB 1ODDA 2K86A 1FYMA 1HDDC 3HEFA 3L1PA 4X0GA 1WCMA 3CUOA 5GP9A 1I6HJ 4P5AA 1X1PA 2FSWA 1REPC 5K7HA 2HOEA 3LSJA 2NOJB 1XD7A 1Y1VA 3HB9A 4N0BA 1NTCA 4BU2A 2D2WA 2EILH 3PM1A 1Y56A 3CQZK 4AU7A 3JSOA 1MNDA 4B4CA 1ZQ1C 3MD2A 4G8XA 3MKLA 4XN3A 1D8KA 5FKKA 4K2EA 2HQNA 1IGNA 2M9HA 3ZRGA 1DP7P 1Y1WJ 3S16J 3RPUA 1XZPA 1C0WA 3K4NA 1X3WB 2QA4I 4C3IC 2QWWA 4Y4RA 2XGXA 1R58A 2Y69H 3OS2A 3V7SA 2MYSA 4KASA 5IYCC 3RIRA 4KISA 4CCOA 1GXQA 4YFKF 4S04A 1D5VA 4GTBA 1SEUA 4A3CC 1DU0A 4RM2A 4P96A 1FWZA 4UVAA 4EGYA 5JVGF 4X6AC 1BR1A 4JX4A 2DTRA 1FMWA 3FM3A 1PUEE 4OIOA 2OQRA 3FK6A 2CFAB 4NC8A 2MABA 2GAGC 1YI2I 1ZELA 4GTEA 4A6EA 5K5RA 5HS9A 4LK0F 3RPQA 2E2IJ 1TWAA 1QHGA 3BG5A 2JA5A 3HG9A 1JUMA 5CQGA 1SAXA 1H88C 3X2QH 1XMAA 2HYGD 1IJWC 1G6NA 1T38A 2PMZD 4Y7NK 2PFBA 2ZXIA 4KN7X 4V2GA 4BNCA 3I4NK 5C44C 2LSOA 1CF7A 3IRRA 4BBRJ 2QEXI 4LR2A 3RZDK 1W7PB 4M3DA 1TQMA 4U0VA 4J01A 4ENKA 1T6SA 4Q4ZA 4OWRB 2VJ4A 4A3EK 3DEEA 2CV1A 5DTDA 4G12A 5C4JC 1KQ0A 4C3JK 3GTGC 4A3LC 5IYDC 5FJ8K 4BY1C 4HLXA 4BL0B 1LUJB 3UNGC 4PCQA 1I3QA 1ZRFA 2Y31A 4BHBA 4F91B 4A3FK 3GTQC 4BBSK 4OIQA 1T39A 5C3EK 5HDNA 1WOSA 4LJZF 1STZA 4HA8A 4Z6YA 1FIAA 2R93C 3K7AC 4GO1A 2HQRA 2ZJPF 3FXKA 3FZVA 5LEKA 4BHPA 3IWFA 4D5CA 3A1YA 4HYEA 2QSGX 2VQCA 2BBYA 3KZZA 3KP6A 4BEHA 1WIHA 1SVOA 2DQLA 2LLKA 1FLIA 1SMYF 2O8KA 1YX5A 1J9IA 2D1HA 3I58A 5CKTA 3RSNA 3GTLJ 5LD2C 3VYUB 1YTYA 1WOOA 3ABUA 2OCEA 5L3GA 1GHCA 3RQIA 4Y7NC 1MJ9A 3LAPA 1IUYA 3H5RA 1YFHA 1LFPA 3CCYA 4WXCA 3HOZJ 2BE5A 3ZQLA 2V6UA 1WWXA 2ZUFA 4XNFA 1YE9A 1IRXA 4O6JA 4IRHA 3BOQA 2TDXA 4E7SA 4M9XA 3COAC 2KZVA 1LDDA 1R36A 5DUIA 4IXAA 1MIJA 1QZEA 2CYYA 2Q1ZB 2P7VB 2V9VA 1HF0A 3ZMDA 4XMYA 4BJTA 3OS0A 4KMDA 3ABMH 3M8JA 4EJOA 2LR8A 3GTMJ 2HQAA 1HLVA 2WC2A 1UG2A 1Z9CA 1O3SA 3FWEA 1PDNC 2HFHA 2RGRA 1BOAA 2IW5A 2WAQD 3J81K 3A01A 2RC4A 4F3QA 2M3AA 2KRHA 4EMSA 4FCYA 3BQZA 2HTSA 1BI0A 2KPMA 4XRSG 4XN0A 2FEZA 3AG3H 3I59A 4C2TA 3W6KB 5DUKA 3PFYA 2R92A 2LDUA 3CO7C 3KEOA 2VIXA 3BG7A 2ZCWA 2IS6A 4CSWA 2EIMH 3FXQA 3HGGA 4ETSA 1ZG1A 3OREA 5B1BH 1FSHA 4WJ4A 3LFKA 1P4XA 2ETHA 2W84A 2ISZA 2R7ZK 2P81A 1I39A 4CCLA 1F5TA 2E5ZA 4P5BA 1V5VA 2DJNA 3I56I 2DW4A 1G3YA 5CVVA 5HDKA 1TT5B 2EWNA 2FMYA 2XPUA 2E1MC 1TW2A 2EB7A 2DA2A 1U78A 4LG3A 4HAMA 4BEHB 4U0WA 3RI4A 5IPAA 1IC8A 1D0ZA 2M5WA 5BPIA 2JA8K 4N9IA 4IRIA 3CZ6A 2EV6A 1X1BA 3Q9SA 4P55A 1KONA 2FBHA 4HX4A 3I4NC 2L5QA 1SD4A 5DD8A 2XAJA 4H4KC 3IH3A 5KK1A 2IRFG 1LVKA 2EA2A 2M4GA 4GRIA 3RZDC 4YG2A 3SZYA 1JVIA 2L9SA 2PMHA 3L09A 3G4CA 4IOCF 2PMUA 2ZXJA 4A3EC 4C3JC 2QQ9A 3I4MJ 1ETWA 2EINH 1N78A 4KAWX 4A0ZA 2YU9A 2M7BA 1XXBA 2NVYK 4A3FC 3PSIA 3E6BA 2CW8A 3FKIJ 3Q0WA 4XKBA 3U21A 4ZTJA 2Y0SL 5C3EC 1I3AA 2MD0A 4AYBL 3I71A 1TWGJ 4MNUA 2QBYB 2LD5A 4IVNA 1BI3A 3C2GA 3DTEA 1X4PA 2CRGA 4B8XA 1IL2A 4YEJA 2DT7B 1NH3A 3C2HA 2IA1A 1VQ7I 2CW7A 1R00A 1QNTA 4UNOA 1DCOA 3H0GJ 1A36A 2ECBA 1V4RA 3NEUA 4JK1X 1VQOI 4LITA 1EH8A 3OYFA 1IV6A 2QVOA 2JA6J 3B6AA 1XN7A 4M73A 1XC5A 4IHVA 2R4GA 2V6CA 1GVJA 2F5FA 2OPTA 4A12A 2HKXA 2J5OA 5CHPA 2JA7K 3FHZA 3K0LA 4PJ0C 4ZH4A 2JPBA 2PA8L 2RVCA 1F7UA 1JHFA 2JVGA 3BTCA 4HF0A 5HLIA 1Z05A 4IQ4A 3PO3J 5LGTA 1QZZA 2CQ7A 3HTSB 5M3MK 3DPUA 1J09A 5EF6A 4X6AJ 2XB0X 3GO5A 2GXGA 3LL7A 5EG0A 4I6ZA 1HKSA 3TOAA 3KYLA 1IW7A 1IZ1A 1PJ6A 2RNJA 4C3HK 1KU3A 3DU6A 2M87A 4A6DA 3B6CA 2LKXA 3ZQQA 4PFPA 3K4MA 3RYRA 3BLYA 4IX7A 2XV4S 2V1UA 1GV5A 2W1OA 4L9TA 4MQ9F 3ERMA 3ERED 4E7HA 3CUQC 1XXAA 3JCUC 2M8GX 4DZPA 3NARA 2MH9A 1BBYA 1QQIA 1FJLA 1DGWY 3OPFA 2R7ZC 3O6BB 2J5PA 4AC0A 5F0HA 2OAZA 1HW1A 1L3LA 2LC2A 5IORA 4GTDA 2Y0SN 1I6HK 2VBXA 1EJ9A 3AD7C 2XHKA 4RAFA 2FQOA 2DLLA 4D5FA 1G3SA 2DA4A 3FISA 4B43A 1JT6A 4U88A 4LK0A 5IYDJ 1J59A 5K1YA 2AS5F 1VGXA 3VA7A 1WRJA 2ME6A 2W7NA 1R49A 3S2HC 3D0SA 3GTQJ 3FOEA 2LREA 3VFZA 1YS7A 4AIKA 2VUMA 3HOSA 5L3FA 4G94A 3Q3QA 2R93J 3CCUI 1IRZA 1YG2A 3RZOC 1ZGAA 2ME0A 1Y1WK 2JT1A 4PJJA 4ANJA 3S16K 2NVXJ 3OOPA 2NRAC 3MKZA 1U6GA 4ZYDA 4GTLA 1I6VA 2K5CA 4XK4A 1JGSA 5HDGA 3C18A 5E3MA 4E7IA 3SZZA 4G7ZA 1MMAA 4CHUA 1OCOH 2FMLA 4DJAA 4D0PA 1WJDA 4OMZA 2ZKZA 1A6IA 2XDVA 2M1BA 4QTRA 2F2EA 2XKOA 1UB9A 5IYBJ 3HOXJ 1FOXA 3BTLA 1FP1D 2IGNA 4HBLA 2IA0A 3MEXA 3GTJA 3CCMI 1S6LA 1O3QA 3ABTA 4DW6A 3I9V2 2E2IK 1FYKA 1HKTA 4E4HA 2EFNA 3CMMA 3K4BA 2FU4A 4UB6C 4PJNA 4P9UA 1WCMJ 1BIBA 4RB1A 4UVBA 4DGWB 2CMPA 4BGDA 3MZ8A 4LB6B 1Y1VJ 2VOPA 4PGHA 1QPIA 1LEBA 4QWQA 2VJ5A 2ZBKA 4LIUA 3L2RA 2FJ1A 3W2AA 2HDWA 4RS8A 1Z1DA 2K9MA 2JA7C 2E1CA 3OYBA 3WHCA 2XROA 1BN5A 4BDYA 5E20A 5CVIA 3TOBA 1W1WE 1BR2A 2V7FA 5FRMA 3KP4A 3RKYA 3S2DJ 3CCVI 2K4BA 4J19A 3ZQIA 1TC3C 1V5GA 1FOYA 4QJVA 5F1JA 2LF8A 2GLOA 2Y9YA 1V54H 1AU7A 3U9GA 4XLPA 2RNGA 3SQNA 2X1CA 2DOAA 2BY2A 4ZC3A 1MZBA 3FIWA 2O8XA 2BGCA 3WTTC 1TWAJ 2M4KA 2A07F 3GTLK 1U3EM 2JA5J 4ZTFA 2DMUA 3CMYA 2QM3A 3HOZK 4RAGA 4KATA 1LE8A 2Q2EA 2CQXA 1T56A 2XGEA 1Z0XA 1OR7A 1KQ4A 3S1RC 1I6HC 3BTJA 2HTJA 4M3BA 4E70A 4EEFG 3BC8A 2EZHA 3P5JA 3HPHA 4O3MA 5JFRA 2P6TA 4B09A 2X85A 4BS9A 2NS8A 3S3OA 4CZZA 5J1YA 4OIOF 4A3FJ 1W4MA 3OWTA 5F08A 1KU7A 1IE0A 3GTMK 1WQGA 2ZJ2A 1U8RA 2H1KA 1Z7LA 1JTXA 3WTVC 5LGUA 2NVUB 3CJNA 2NVTJ 4BQNA 3HTUA 2VUMC 3S16C 4GFQA 3F8NA 1FOWA 3MZYA 3QPLA 1IXSB 1ONVA 5D8LB 2HDCA 1L0OC 3JRCA 2BW3A 1HW2A 3DBLB 5EZHA 4HQEA 4QPOA 4U7DA 5DCFA 3CAGA 3CF2A 3H3ZA 4IRGA 5FLMJ 3LSRA 1ERDA 5TISC 4Q4ZF 4C2MJ 2Y9ZA 4QJVB 2V79A 2LRDA 2XAUA 1HDPA 4XOPA 4FX4A 5CJ9A 4BKXA 1OJLA 3HXLA 4ESJA 1O3TA 1XPPA 2E2IC 1W5CC 1JUSA 5J3LA 3D5LA 2OV7A 4XLEA 1XSDA 5HNHA 2VB6A 4XQFA 4DYQA 3FXJA 5E3OA 3OY9A 3DCFA 1YLFA 4PUSA 1W0UA 4OIQF 2Z16A 2L01A 4A3IJ 3HKZL 3WU2C 3R4KA 2P8TA 4Z2YA 2EFOA 2XRLA 3OYJA 3LAJA 4MFDA 3E6CC 2DA3A 3SDBA 1ORKA 3HRTA 2XSDC 3T02A 1EKEA 4N4NB 1MBFA 1GVDA 1QO0D 5H6QA 3ZQCA 1P9QC 2ZFUA 2VBZA 1W7PD 2H09A 4G9YA 2XAGA 2Q0OA 4D9JA 2IGMA 3C2BA 2W24A 2R7UA 2WAQL 3I4MK 3WG9A 4AM3A 3FF5A 2KJCA 3EUKL 3DLLF 4L0ZB 3FKIK 1VI0A 3C3WA 2IEKA 3ASOH 1TWGK 2NNNA 4AVPA 4YRVA 1AOYA 2R92J 4BJ5C 1JE8A 5F0FA 2HOSA 4JX6A 4OAYA 1IN8A 1K6YA 1CGPA 1AKHA 2Z1DA 3LA7A 1WSUA 4XLFA 2WWYA 2GXBA 2VI6A 2BY0A 3TW6A 1K78A 1F4KA 3QX3A 1IBAA 3JTGA 2IGOA 4RM3A 2VOOA 4MFEA 3RPUD 2XCRB 2UXNA 3H0GK 3GTLC 2CUZA 2E2JJ 1Y0NA 4OIPA 1VJEA 3S2HJ 2XAQA 2ELHA 2JA6K 3QOPA 1EK8A 4NQWA 3HOZC 2UXXA 2KFDA 4AIJA 2RREA 5GPAA 1R1UA 4HDUA 3GFLA 3QODA 2H27A 3RZOJ 3K1MA 3WU1B 5L3BA 3GTKA 4XCHA 5EZGA 1Y8RB 3M8EA 1OLTA 3VPRA 3MKYB 3N05A 3CP2A 3OYHA 3A0BC 2JMWA 5J8FA 1DPUA 2XF5A 5B5EC 3QAHA 1YW8A 3PO3K 2HZDA 2IGKA 3GTMC 5GAEJ 4E7JA 3GYHX 3IKVA 2YU9J 1JI8A 3M7GA 2ZMEA 4X6AK 2CUJA 3CCSI 3DKXA 4ZJZA 3HKZN 3BZ6A 3BP8C 1ETOA 2DFIA 3TMOA 1INNA 1IXRC 3C1DA 2DOFA 3LSIA 4UUVA 4LOWA 1JT0A 2DTZA 3T8TA 1DD5A 4F7ZA 1PJ7A 2KWAA 4MIMA 2A5WA 3ZMUA 1JKPC 2LTPA 4XLNF 3E5XA 2PPBA 4B3AA 2ZXHA 3GZ6A 2MH2A 4YG2F 4J3NA 4AIHA 5HVQC 3I64A 1Z7UA 2GZWA 3CC2I 4P9SA 5DEQA 1ULYA 4BACA 3G2BA 5GTHC 1P7JA 4YELA 4BY7J 2DMQA 2JH3A 4HSTA 3CF5F 3FK7A 3HSEA 3CO6C 2WB1A 4BXXC 5IYDK 1K78B 1GXPA 2A6EA 1E3HA 4FISA 3TQNA 4UY8I 2B63A 3GTQK 1KA8A 2CUEA 1SD5A 1S7EA 2WAEA 2KJBA 1RKTA 3AG2H 5LBQA 2V6EA 3K1PA 2CFAA 4GXOA 5ICFA 1MD0A 1TLHB 5ILVA 1NK2P 2KQRA 1O25A 3GTOA 2R93K 1P6RA 2OF7A 2GBYA 4KYWA 1X2NA 3PIPF 1F1ZA 4Y52J 2NVXK 3FXUA 2JJ7A 2TCTA 1G4DA 3DKWA 4M3FA 3DTKA 4I7HA 1WKMA 3PSFA 1U5TB 3N97A 2GAUA 3J7AO 1T0FC 2XASA 3EQLA 4C30A 3FKIC 5IYBK 1JXSA 3WE2A 3HOXK 1AA7A 3JTHA 2CH0A 2VE8A 3S93A 1TWGC 1U0JA 2IPQX 2K3FA 3HRMA 3GFIA 4C9YA 2OC6A 5JR3A 1W7PA 1ZXOA 4ZH4F 2DFEA 4GYIA 3S1RJ 1N77A 2F5DA 4WK8F 2M0MA 2WADA 2DA6A 4KDDA 2KL4A 1D1CA 3O8HA 1J6XA 4B3XA 2HPIA 3PNVA 1WCMK 2DN0A 3QWLA 5AIPA 1RETA 2XF6A 4KICA 5F1RA 1SFUA 2R7XA 3H0GC 5FO5A 3CJRB 3R0JA 3G6EI 5FD5A 3K4KA 2PG4A 3OSGA 1Y1VK 3WE3A 5CVUA 2JA6C 4M6XA 4IO9F 1B8IB 1IW7F 1I6XA 2KT0A 4CCMA 3L2CA 1OMIA 3DV8A 4CH7A 2VQHA 2VL8A 1B4AA 3K2AA 3GWZA 1R5HA 5K7ZA 4YFNA 1RI7A 5AIQA 4IEJA 3I54A 2VUMJ 2Y3PA 1WOPA 1S7OA 4AD9A 3WU0A 1GT0C 2Z9OA 2GXAA 5KAFC 2QF7A 2G0EA 3R6SA 4GZYA 1DP3A 4HW0A 2R7QA 3S2DK 5BS6A 2JQ7A 4EGZA 3GTKC 3O3KA 3ZQGA 5E8IA 3I3LA 4AUXA 1Q1HA 3FX3A 2MC3A 3PO3C 3V8KA 2A69A 2XB5A 1BDFA 3KYDB 4RLFA 2DA7A 1WH5A 4KMUA 2PX9A 2DK8A 2A68A 1XGMA 5JI6A 3WGGA 2KP6A 5M5XJ 2H6CA 2CW0A 1A5JA 2Y0MA 1XTAA 2P5VA 2EZIA 2ZMEC 3WTSC 3GTJJ 4AWXB 4GTFA 2MW8A 2CJJA 1O3RA 1GUUA 1BM9A 1WH7A 5LHGA 3ELKA 1YW9A 1TWAK 2GQQA 1GDTA 5JLXA 3NWTA 2JA5K 4I02A 4RB2C 3HIFA 1FX7A 2X6WA 4KARA 3O8GA 1ZVUA 4MO7A 3OIQA 2FOKA 3G4SI 4HLYA 3J81Z 3IV5A 3ZGKA 4KUMA 1R1VA 3F0CA 1FMVA 1VQPI 1YS6A 1S8NA 4G7ZF 1NK3P 4EJVA 4KB4A 3F9KA 4FM9A 2ADUA 4LD5A 2UUZA 2K27A 1TWHA 3IRQA 2HEOA 3AG1H 3VB2A 3CC4I 3EUHA 1R4MB 3ML6A 4E7LA 2MBFA 3LA2A 2LFBA 2XGDA 3TP3A 2KDZA 4BXUA 1SMTA 2ZSIB 3OMYA 3W6JB 5J1RA 1I3QK 2QLZA 2V1NA 1A6QA 1WJCA 3JREA 4KT5C 1IV8A 2NVTK 1HQCA 1T95A 2EJRA 2X6XA 3IC7A 1MBJA 2GA1A 4MEYA 2NVXC 2K40A 3H9QA 4NC7A 1WI9A 4DBRA 5JHUA 2QGUA 1WSVA 1I50A 2R5ZA 1SVLA 2D45A 4H0EA 3BROA 2JVHA 3CDIA 3AKZA 2R7VA 1O4XA 2BHYA 1OCPA 4MLOA 3A2KA 1Z6TA 2CFOA 2O7OA 3KLNA 4OU0A 2OTLI 4HF2A 2D5VA 3AL0B 1NHAA 5IYBC 3HOXC 2HYJA 3FXOA 5FLMK 5C4XC 2ELKA 2HYFA 3F21A 2L0KA 2ZSHB 3K9TA 4C2MK 5D8KB 5JHFA 3OL4A 1J7KA 1HC8A 4G7HA 5KHDA 3RTRA 2UV1A 5D4SA 3E7LA 4NHJA 3CMEI 4GT9A 1UHMA 2XSJC 3L00A 5DV5A 3VOEA 2IS2A 1MNMC 1WCMC 3JRDA 4A3IK 3S1QJ 1BIAA 3L2WA 3P9IA 1IRFA 4M71A 1Y1VC 4D7NA 2QBYA 4KMHA 4XLPF 1MBGA 3F22A 4KIFA 5D4RA 3H5NA 2QQBA 4JOMA 2ZFWA 1SFXA 3BR1A 1U2WA 1AB4A 2E1MB 5J6XA 1SFOA 4M1XA 2DO7A 2V9PA 2ZB9A 2KKOA 1BGWA 4RMNA 4ZYHA 4A5MA 3DQVC 2O5IA 4ESFA 3S2DC 2F4OB 3R60A 1IS1A 4AH6A 2IP2A 4L0YB 3CP8A 2R92K 4QLCU 5E79C 1ZKGA 2VT3A 3T8RA 3EDPA 1MH4A 3DPLC 2EFPA 5D6EA 2LY1A 5M3FJ 3LWFA 4YIIA 1K4SA 4ESBA 3LOCA 1YIJI 2R5ZB 3ZP5A 4BXXJ 1TWAC 2RH6A 4CCKA 1R5ID 2JA5C 1XGOA 3B02A 3DLAA 3MVPA 2E2JK 2MG4A 3S2HK 3CCLI 1VQ4I 3J80Z 4XSZA 1XGSA 4XLNA 4LOCA 3L7WA 2E60A 5L46A 1WJ5A 1WJFA 2L7FP 1ZR2A 2DDBA 2COMA 3RZOK 1ZG3A 1ZYRA 1B9MA 4PJMA 5EJCA 3PFIA 1R71A 2W85A 3BDDA 4L9JA 2GSOA 2ZNYA 4WJ3M 1R23A 2BVLA 1S7AA 3LSTA 4KT6A 3S32A 5IT3A 5AONA 3FM5A 4II2A 4BXFA 2KHMA 1EH1A 1ZRCA 2YU9K 5GAGJ 1QGPA 1KU2A 3R61A 1I3QC 1IO2A 2VPRA 4XRFA 3HM5A 3AQOA 1D1AA 2XAHA 2DXIA 1G2HA 2FQTA 2NVTC 4XICA 2A05A 1YW7A 2L54A 3HOTA 2HDDA 3WGIA 2C6YA 2W4SA 1UAAA 3DKYA 3G71I 3DU5A 4UUTA 1TNSA 3OV8A 2STWA 1IUFA 3TTGA 3H3VD 4JX5A 1S29A 1DQUA 3M07A 3TEDA 2EIKH 2XPWA 4LLGA 1LKXA 2OZUA 4RA2A 1UCRA 2A61A 1FBQA 3KEQA 4MGRA 3OR2C 2LBFB 3HRUA 2XCOA 5FLMC 1K83A 3M4OJ 4C2MC 2GOMA 5J47A 1K7AA 3W6VA 1VZ0A 2CV0A 4GTCA 3HOYC 1O26A 2M30A 4XSZF 1MSEC 4ZZDA 2DPDA 4BY7K 4JP0A 2XGCA 2HPMA 1VQLI 2AQFA 4UUSB 4C2UA 2XPVA 2JK3A 1E17A 3H9GA 2W57A 1OQYA 3UR3C 4B1RA 4NC6A 3TO6A 3HDDA 3MKWB 1P92A 3CUQB 3F23A 4A3IC 2QYOA 3GTKJ 5C4XK 4X1EA 1OYYA 3VSKA 1H9TA 1JHHA 3U1KA 2BY1A 2BZTA 2HR3A 2XIGA 4I99C 1APLC 2DMTA 5HLHA 2K4JA 2NAZA 3PNYA 2DBBA 2JTVA 2KZGA 1K79A 3J80K 1L0WA 4Y52K 1VQ8I 2XRNA 1G8XA 4B47A 2LVSA 5DYMA 4HF1A 3ECHA 4R8HA 3IUOA 4PSWA 4A3GJ 2VN2A 1G51A 4OIPF 3FOFA 5IOZA 4B44A 2DOEA 4KITB 3OYDA 1RRJA 3WGHA 4KFCA 1Z91A 4OINA 2RN7A 1PJ5A 2QQAA 4A3JC 2FNAA 1BR4A 3JW4A 2R92C 3OYGA 1FYLA 1GV2A 2W00A 2PJRB 3EETA 1HBXG 3H5AA 1X3UA 1KGSA 2E5NA 1X58A 3S1RK 2FNPA 3KYCB 3CESA 4AYBN 4RAYA 1MBKA 4A93J 2LMDA 4EJWA 3NRVA 3QQAA 2GM4A 4EM0B 5CVJA 2O5RA 2RV8A 4IZZA 5FKLA 4IL6C 2R5YA 4ITVA 3GFMA 1UZCA 5IY5H 2E2JC 1MMNA 3OYLA 2V9KA 4HDVA 4A3DJ 2FRHA 3CTAA 1F9NA 3HJEA 3IH4A 1HSJA 2I10A 3ONQA 4CCJA 3TKYA 2B63J 2B7EA 5CLSA 4ASNA 2BYVE 3M3YJ 2XKPA 1VH2A 1R9TA 3KZIC 5E18F 5E8GA 1OPCA 3VYRB 2R7WA 1DDNA 2VUMK 4FQGA 3GTOJ 4P5OA 3W3CA 1JJ8C 4ON0A 3BJ6A 3ZR8X 5ICCA 4FX0A 3FBNB 2YU9C 3V42A 3K6GA 4XLHA 4DDQA 2V6SA 4G0UA 3BR2A 3K4LA 3M1CA 5EGOB 5C4XJ 1E0EA 3TFHA 3WG7H 5M5XK 2O0YA 1Q1VA 3IAM2 4NOIA 3GDZA 4I98B 3GTJK 5CPRB 1HW5A 2A6EF 1N75A 3BR6A 1W5SA 3CLQA 1RNLA 4E6KG 2VPLA 2RKHA 1YOVB 3QPHA 1RKWA 4RGXA 4G7OA 4R1HA 3F72A 4BHCA 4CCNA 1I1GA 3OIOA 2K9NA 4MEXA 1FOKA 4XSXA 2WBMA 3MWMA 1XB4A 1QZYA 3GXOA 2X51A 1R6RA 3MAJA 5FFXA 4BY7C 5TRDA 1TWFA 1RIOH 5IOTA 4A3BJ 3FBIB 2VKDA 3W2VA 3H3VK 3EQLF 3K4CA 2RDPA 1JGGA 3GBGA 3M9AA 3T1BA 3QU3A 2Q8KA 3OEPA 4OIRA 2R5YB 2IVMA 3QP6A 1OYIA 1POGA 4CYCB 1ZH5A 2AXLA 3QP5A 4FE7A 5D5WB 5DM6F 4YIRX 2ACJA 2QENA 4EV0A 3L4JA 1IN6A 5IP7J 4LK1A 2ELJA 4NB5A 3N3YA 4M6YA 4Y52C 2M8EA 1LFUP 1ETYA 4N4OB 3AAFA 3W2WA 2BHZA 1WHUA 4B48A 3WTXC 5E68A 3Q3SA 3CLOA 2XVCA 3PUBA 3IAS2 2KIQA 1WQFA 1FY7A 2LF7A 2DDAA 1T08B 4YFNF 5IP9C 1TBXA 2QSFX 1G59A 1TP4A 4WILA 4W1UA 5TMCA 1UMQA 2VE9A 2PMZL 1EI6A 4ABZA 1JKRC 2LNBA 3ECOA 3FKJA 4LB5A 3SFZA 1V5FA 4C45A 3LSGA 2A69F 4U0YA 4PFOA 3CCJI 3I5UA 3MMLB 3S1QK 2A68F 1RESA 2EV0A 1TWHJ 4L5EA 2F4IA 1LEAA 2CW0F 2JRTA 3ZMZA 2DYRH 3N0CA 1IDYA 1ETKA 2NXNB 4RMFA 3IKTA 1I3QJ 4ILDA 3MFKA 1GE9A 4CO8A 5D4DA 3F8FA 3HUGB 5FB2A 4LFUA 1LQ1A 3HBLA 2M7AA 5F0CA 3K69A 1XGNA 2I8DA 4FE4A 1ZQ3P 1R9TC 3HOVK 2AQEA 4P1WA 1FP2A 3TW7A 4EJUA 1USSA 4DYRA 1I50J 3S1NJ 1V55H 3BG3A 3M8FA 2A6HA 2OD5A 4FT8A 2QSHX 5DDGA 2WB1D 2F5VA 3DBHB 2VODA 1AHDP 3OYIA 3MCZA 1USTA 2YU3A 5F64A 3MMYB 2NYXA 3HHGA 3QYFA 5EGHA 1N25A 1QU3A 3DBRB 3HOYJ 3V8LA 1ZR4A 2WY8Q 2VXDA 3GTJC 2V6TA 5M3FK 1B72B 5ERIA 3BP3A 3LSHA 2QKMB 2WA0A 3OIPA 1IXCA 4BXXK 3KEYA 1ZBSA 3KCCA 2CSOA 2YX7A 2CU7A 2ZC2A 1F36A 4TV7A 5LLQA 3BR3A 2P5MA 4KIGA 1I27A 4CYDA 2EIJH 2Z5UA 4MEYF 4QIWD 3JSPA 1K4TA 5TJ3A 2CWEA 2K9LA 1GLNA 5F27A 1H8AC 1TWCA 3EYIA 1B6AA 2IA2A 1P4AA 2CUFA 2ESHA 1TTYA 2PQ8A 1XDUA 3A4CA 1VF9A 2X1EA 5TGTA 4HOBA 1ZARA 1RZ4A 1IF1A 5B66C 4EQQA 1A31A 1YX2A 2XCQA 2MGQA 2PMZN 4MHGA 4DBQA 5D6FA 1SFOJ 1WJEA 2GSUA 1KYWA 4LG0A 4G7HF 2E36A 3KPHA 4Y33A 4A3JJ 3VYSB 4NDLA 1YX3A 3JRBA 4BYYA 3N4MA 3D5SC 3MQ0A 2P5KA 2R3SA 3PUFA 5EDNA 2W48A 2HQ5A 4BE1A 2K9QA 1QHHD 1LDKB 1C0AA 1MBEA 2Y0SD 1S9HA 3JRHA 1U8BA 1VQ6I 2CG4A 2M34A 3M4OK 4HQMA 2M2EA 4U7BA 3BZKA 2E7WA 5CVRA 4RB0A 4KN4A 4KMAA 1HSTA 1KQ9A 3OYNA 1YJNI 1S72I 4FHTA 1OR7C 1XX5A 3A0HC 1HCRA 3HOUJ 1B1BA 1U5TA 2RAEA 3PIOF 2VBWA 2Z33A 4UB8C 3TFIA 3GTKK 1ZTRA 3S1QC 3G1MA 1OCCH 2COBA 3FXLA 3IP4B 1RR8C 5HODA 5DCMB 4IPAA 2ID6A 3J7ZI 1OKRA 5EGEA 3K10A 2F4MB 3T5XA 5HS8A 3T01A 2V1XA 1AWCA 4RB3C 3VSLA 3GTPA 3BUEA 2JSCA 3SJMA 1VQ5I 1ETVA 2PA8D 3AH5A 4A3GK 3BPXA 1YJWI 4L5IA 3HOVC 2JUGA 1A35A 4LGWA 2H8WA 3DF8A 1YYVA 1WSRA 1PJRA 1OYWA 1ISEA 3WTYC 3JR9A 2B9SA 1X4OA 5E1ZB 1B8IA 3HZJA 3GEZA 4BE2A 1LB2A 4LG0B 2FXAA 2WAQN 1S3JA 2YUSA 4XOTA 1ZYRF 1O29A 1MDMB 1K83J 2LP0A 3DEUA 2OZ6A 4XORA 3OS1A 4BLBA 4PSXA 1XSVA 4ENMA 4QPQA 2E19A 2Z2SB 4A93K 3BT9A 4RGRA 2V1DA 2KIFA 3K70D 4A5NA 4CXFA 5L3CA 1QVUA 4HNTA 3AD9C 3TO9A 3V7RA 1OCTC 1FEXA 1E3PA 1USMA 1JKQC 2VKEA 4KM9A 1J98A 2E1OA 4AVZA 5H6RA 2L4AA 4A3DK 3RJPA 1B9NA 2CQNA 3P7NA 4KMFA 2P7CB 4HNVA 2Y48A 2B63K 3HC7A 4ZYAA 1XS9A 1WORA 3M3YK 2HKOA 1A04A 2STTA 3GTGA 3ABLH 2Y30A 1RUOA 3FXRA 2GSNA 4R79A 3IWZA 3K4JA 3GTOK 4LLGF 2XUBA 2LYCA 1D5YA 2VKHA 4M6VA 4GTAA 4WXHA 4L5JA 5A2QZ 3FHNA 3BCAA 1U9NA 3L2QA 2O6GE 3ZQ7A 4LLNA 2EFQA 2X6OA 4P9FA 1BI2A 1WI3A 4M74A 5IP9J 1MMDA 4BUPA 5J4VA 1T33A 5D5XB 4L9NA 1BC8C 1RPWA 3VDXA 4XM3A 4ZYEA 1FBUA 4M3EA 2WAFA 1LNWA 4KMUX 4HZFA 3ASNH 2E71A 1XZQB 4NNJA 3KP2A 3OYKA 3S1MK 1PUFB 3F8MA 4RGUA 1BI1A 1F43A 1TL8A 5E1WA 2ECCA 1BW6A 5BNGA 5IT9K 1O24A 2A5YB 4I01A 3M4OC 3CJTB 3HSRA 3ZN1A 5D5UB 4DQ2A 4HG2A 4Q47A 1USOA 1MH3A 2MFZA 4A3BK 3GEIA 2Y0SA 1TNTA 3D5RC 2LOOA 4AYBA 3S15J 1OCZH 4OINF 3CC7I 2OA4A 3CQZA 2A6TA 2FOWA 1R9TJ 1VQNI 1FT9A 1Z3YA 1F7VA 1U5TC 5M5YJ 3I55I 3A8IA 2R7OA 2KRCA 2L7ZA 2JWTA 1FPQA 1YNJA 5M5WJ 4E7KA 1X3ZB 5IP7K 4XKWA 3TBIA 4JBAA 3JRAA 1HA8A 1SFEA 2IT0A 1VQKI 3PO2C 1QBJA 1X2MA 1R22A 5BMZA 4A3GC 2L4MA 4Y13A 3GTPC 3G73A 3DPTA 1YIOA 5E3NA 2DMNA 3QOEA 2KIUA 3FMRA 3C7JA 4M9SA 1T8IA 5A2QK 4BKWA 5FFZA 1MW7A 5K5QA 4NUBA 1B59A 2K85A 2DI3A 1JKOC 2BOLA 3FDYA 4LLLA 3S2WA 3PQJA 3S3MA 4HRIA 1ZRDA 4A93C 2Y2ZA 2VJJA 3VYTB 4A3MJ 4IHYA 4GYGA 4PZJA 3JRIA 4PAAA 3RKQA 3SZPA 3ZXSA 3N0BA 1TWFJ 3CD6I 5ILUA 4G0WA 3G3ZA 4RLQA 3WTUC 1SFKA 1SD6A 1U9OA 3FMSA 3WHBA 1TWHK 4KM8A 2YR2A 3EYYA 2L7MP 3JAMZ 1ZN2A 4D7MA 1JJ6C 3SXYA 3D1NI 5J1UA 1CQTA 4A3DC 5E17F 2P5LC 3GEEA 1W5TA 1KZHA 2JN6A 2B63C 4BQOA 1XDSA 3M3YC 1TQPA 1XCVA 2CO5A 4G0VA 4YFXA 3BR0A 1MJBA 2YSRA 3LQQA 5LHHA 4G7OF 4M72A 3GTOC 3GZ5A 2X48A 3QPTA 3S0XA 1ZREA 2EV5A 2X0LA 4I76A 5E3LA 4EVIA 4MEXF 1I50K 3S1NK 3BR5A 4XSXF 2EK5A 4GGGA 4O5VA 3P9KA 3ZOBA 2IS4A 2O5JA 1MBHA 2CS3A 4IQJA 1PP8F 4EM1A 3GEHA 2LY9A 3NQOA 1YQAA 3NAUA 5JVTA 2PEXA 2X4HA 5IOYA 3T00A 2FX0A 3E6DA 2JA2A 3HOYK 1ITYA 1ZLJA 2WV0A 3PQKA 1R5GA 4YIFA 1G3WA 3S14C 5KVRA 2XAFA 5JLWA 1BS2A 2PLYA 4OIRF 1TT0A 2WTEA 1XZPB 3S1MC 3CCQI 2KISA 4KN7A 4CUGA 1QA6A 2GIVA 1PP7U 4L18B 2EFWA 3RKWA 1ZK8A 2D1VA 1IN7A 4HNUA 4LK1F 2UWMA 2FD5A 3GVAA 4DNCA 5LRSA 3T0YA 3H0DA 5FLXZ 1MNEA 2OQGA 2IAIA 1ZLKA 3LPXA 1FNNA 1KU9A 3A03A 3QU6A 2MLKA 2L9NA 3NWSA 3ZQHA 2DT6A 4BLAA 4A3BC 3OYCA 4Y15A 4BDZA 1LDJA 4S0HB 3WTWC 1W0TA 3HKZD 3HOVJ 1SFOK 1TQIA 4FASD 4CZCA 2LBFA 3CQZC 4UVCA 4BAYA 4A3JK 4IHXA 4PDKA 1I1SA 3LQRA 3AL0C 2HI3A 1HQMA 1EQRA 2OCCH 2ZNZA 1P4WA 2JRMA 4OAZA 2DK5A 2BEOA 1DGRM 5FKNA 5IP7C 1YO5C 2WB1L 3JAMK 1H89C 1EH7A 3LA3A 1D3YA 1FBSA 3SDGA 1CF7B 4KJZA 2DJIA 4UUSA 5FKMA 4BH9A 5HNFA 2EBIA 2ZO4A 3HOWJ 4WF2A 4HX7A 3U1DA 3CUQA 5B1AH 2V4JC 1T2KA 4EJTA 2L3DA 4PJLA 2PI0A 1WQHA 4G6DA 1IN5A 2R7ZA 4HV6A 3REOA 2EZKA 2NVQJ 5JVOA 4HSRA 2UZKA 1BJAA 1EF4A 2HXOA 4IOAF 1OFCX 1BA5A 1PYVA 1J0RA 1WJBA 4XBFA 5L3EA 4ENJA 4QIWL 1IQ0A 3HOUK 5EEAA 3LFUA 2A6HF 1LJ9A 4A3KJ 1TWCJ 1R1TA 3G1LA 4HPQA 1K61A 4ZZLA 3CJQB 3SZTA 1TWHC 4IHSA 4Q5SA 4HEA2 1H9GA 1TZLA 1W36D 1M1EB 2LY2A 3EUHC 1G3TA 4J00A 1VFCA 3A8JA 4IF4A 2G9WA 1XG1A 2R7DA 2X9DA 3ROUA 5HLGA 2PJRA 3G4AA 2KMUA 2PHCB 4II3A 2QKLB 3PJRA 2R7TA
chains in the Genus database with same CATH topology
5FLXK 4KC6A 2P4WA 2FBIA 2NVYA 1UHWA 1J2XA 4IJAA 3BY6A 5L3DA 1TW3A 1B4BA 1EH6A 4N9HA 5LEJA 4PGGA 5HS7A 2E1NA 2VT2A 3K1NA 1BJTA 1XXCA 4A0XA 1I5ZA 3I59B 4CICA 4WWCA 1QPMA 2RGVA 2JA7A 3KP5A 3GLXA 3HRSA 5J8CA 4RGSA 5EEHA 2E2HA 1T98A 3RYPA 4HX8A 1O7LA 2HWVA 2NNYA 1VTNC 4KDPA 2ESNA 2OU2A 3TGNA 3KP3A 5F6FA 2JPCA 5ICEA 2DQRA 1O2AA 1O57A 2DAOA 3I0TA 3FMQA 2K7LA 4UV8A 3SHFA 1EV7A 3F8BA 4LQYA 2HGCA 4JQFA 2NS0A 3F3XA 1O7FA 3V7CA 3WTZA 2ZFZA 1Y1WA 4L9VA 2G7UA 1ZGJA 4A0YA 3H92A 2CGPA 4MQVA 4OMYA 3RDIA 2R7FA 2O3FA 2KIMA 3Q9VA 3GF2A 3IHUA 2O03A 3M1EA 2E2IA 3V4GA 3HUGA 3KETA 3BJAA 3GUDA 2W25A 3KE2A 4KA4A 3CDHA 1DUXC 2OBPA 5ILSA 3TO7A 1H0MA 1ON2A 3TDZC 1WQ2A 2A3SA 3P9CA 2FF4A 4RAZA 2QZ8A 3HSFA 1V3FA 3MZHA 2VXZA 4S05A 1R7JA 3KFWX 5LGNA 1ZG5A 1KQ8A 5ED4A 3QRFF 3WODF 1ZAOA 5H20A 3O2PE 5DD4A 4KIBA 3RKXA 3L4KA 1MKMA 4IHTA 2F5CA 1FZPB 2E7XA 2CQKA 3F8CA 2IJLA 4C3HC 3H3UA 2HS5A 3GTLA 3L9FA 3DP7A 1ZHFA 4M9ZA 3TDUC 3VODA 1O28A 3GFJA 2QUFA 2YPRA 1HXDA 5ICGA 2EA4A 4BQAA 2DU9A 5TJJA 2FQ3A 1P2FA 2H94A 1E2XA 3GTMA 4A2UA 3VEPA 2RQPA 3BPVA 3BP8A 2B0LA 3R0AA 2Z99A 1Z6RA 5LHIA 3KZYA 5DCMA 4OOIA 2O61A 4UXNA 4Q48A 4YFXF 5CYVA 4I0BA 5IOQA 3DFGA 1IN4A 4I2OA 2VONA 3NUHA 1K6OA 4KN4X 2DT5A 5EEGA 1RUNA 2JZYA 4Y17A 3ZPLA 3F6OA 4FZBA 2L02A 5JFEA 1MDMA 5D5VB 2PJPA 2K02A 2F5EA 3ZMVA 3IL2A 3Q5FA 3B73A 4I09A 3E3VA 1T0FA 1BC7C 3FKIA 1XMKA 2P6SA 1TWGA 1O27A 2BE5F 1FC3A 1D8JA 1SD7A 2PBIA 2H6BA 5E1XA 3E97A 3ZMSA 1O2BA 2ISYA 3HHHA 2Y75A 1KYZA 4WCGA 2Z3YA 3H0GA 2M45A 5FD6A 1J75A 2GWRA 2JA6A 3HYIA 3F6VA 4GCVA 5BPDA 1DPRA 2DPUA 5LRRA 3AQPA 2VC1A 1Y0UA 5HOOA 4KNYA 3ZMTA 5IT9Z 2GA2A 2MA3A 1XCBA 4G6QA 2CFXA 1HKQA 2KRFA 3E5QA 4UHTA 2MLGA 4CGZA 4Q5SF 4I0AA 2FBKA 4LMYA 3BJOA 2LKPA 2FE3A 4HV5A 4CDGA 3E6MA 1MGTA 4ENNA 3KP7A 1J5YA 5FGMA 3GW2A 3K2ZA 2YX4A 2BV6A 2HZTA 2FA5A 3V8JA 1FSEA 1MJAA 3GX4X 3GTQA 1XSXA 6PAXA 3E5UA 3I4PA 2R93A 4ZYGA 4WXDA 5IOSA 2NVXA 4KB2A 3I53A 3BWGA 3ISPA 1LVAA 2PN6A 1IAWA 1ON1A 3DXJF 1IRGA 1UFMA 5BQTA 2G7HA 5BOXA 2VBYA 3KLOA 3ZN0A 4MTDA 2MD5A 4EM2A 4WX9A 3U2RA 4UV9A 2VC0A 5K5OA 2ZMEB 4MTEA 3ULQB 1ODDA 2K86A 1FYMA 1WCMA 3CUOA 4P5AA 2FSWA 1REPC 2HOEA 1Y1VA 1XD7A 4N0BA 2D2WA 3JSOA 4G8XA 1D8KA 4K2EA 2HQNA 1DP7P 3RPUA 1C0WA 4C3IC 2QWWA 2XGXA 1R58A 3V7SA 4KASA 3RIRA 1GXQA 4YFKF 4S04A 1D5VA 4GTBA 4UVAA 4P96A 1FWZA 4EGYA 2DTRA 3FM3A 1PUEE 2OQRA 2CFAB 4GTEA 4A6EA 5K5RA 5HS9A 4LK0F 3RPQA 1TWAA 2JA5A 1SAXA 1XMAA 2HYGD 1G6NA 1T38A 2PFBA 4KN7X 4BNCA 2LSOA 1CF7A 3IRRA 4LR2A 1W7PB 1TQMA 4U0VA 4ENKA 1T6SA 1KQ0A 4HLXA 4PCQA 1I3QA 1ZRFA 4BHBA 1T39A 5HDNA 4LJZF 1STZA 4HA8A 4GO1A 2HQRA 3FZVA 5LEKA 4BHPA 3IWFA 4HYEA 2BBYA 3KZZA 3KP6A 1WIHA 2DQLA 1FLIA 1SMYF 1J9IA 2D1HA 3I58A 1YTYA 3ABUA 5L3GA 1GHCA 1MJ9A 3LAPA 1IUYA 1YFHA 4WXCA 1WWXA 4O6JA 4IRHA 3BOQA 2TDXA 4M9XA 3COAC 1LDDA 1R36A 5DUIA 4IXAA 2CYYA 2P7VB 2V9VA 3ZMDA 4KMDA 4EJOA 2WC2A 1Z9CA 1O3SA 3FWEA 1PDNC 2HFHA 2RGRA 1BOAA 2IW5A 3J81K 2RC4A 4EMSA 2HTSA 1BI0A 2FEZA 3I59A 3W6KB 5DUKA 2R92A 2LDUA 3CO7C 3KEOA 2ZCWA 3FXQA 4ETSA 1ZG1A 3OREA 1FSHA 3LFKA 1P4XA 2ETHA 2W84A 2ISZA 1F5TA 4P5BA 2DW4A 1G3YA 5CVVA 5HDKA 2FMYA 2EWNA 1TW2A 2EB7A 1U78A 4HAMA 4U0WA 3RI4A 2M5WA 5BPIA 4N9IA 4IRIA 2EV6A 3Q9SA 4P55A 2FBHA 4HX4A 1SD4A 5DD8A 2XAJA 5KK1A 2IRFG 2EA2A 2PMHA 3L09A 3G4CA 2PMUA 2ZXJA 4C3JC 2QQ9A 2YU9A 4KAWX 4A0ZA 1XXBA 3E6BA 3I71A 4MNUA 2QBYB 4IVNA 1BI3A 4B8XA 2IA1A 1R00A 1QNTA 4UNOA 1V4RA 3NEUA 4JK1X 1EH8A 2QVOA 1XN7A 4M73A 2V6CA 1GVJA 2F5FA 4A12A 2HKXA 2J5OA 5CHPA 3FHZA 3K0LA 2JPBA 2RVCA 1JHFA 4HF0A 5HLIA 1Z05A 5LGTA 1QZZA 3HTSB 3GO5A 2GXGA 1HKSA 3TOAA 1IZ1A 2RNJA 1KU3A 2M87A 4A6DA 3RYRA 2V1UA 2XV4S 4L9TA 4MQ9F 3ERED 3CUQC 1XXAA 2MH9A 1BBYA 1QQIA 3OPFA 3O6BB 2J5PA 2OAZA 1HW1A 1L3LA 5IORA 4GTDA 2VBXA 2XHKA 2DLLA 1G3SA 4U88A 1J59A 5K1YA 2AS5F 3VA7A 1WRJA 3D0SA 3FOEA 3VFZA 1YS7A 4AIKA 2VUMA 3HOSA 5L3FA 4G94A 3Q3QA 1YG2A 1ZGAA 2JT1A 3OOPA 2NRAC 4GTLA 1U6GA 4ZYDA 5HDGA 1JGSA 3C18A 4CHUA 2FMLA 4D0PA 4OMZA 2ZKZA 2M1BA 2F2EA 2XKOA 1UB9A 1FP1D 4HBLA 2IA0A 3MEXA 3GTJA 1S6LA 1O3QA 3ABTA 1FYKA 1HKTA 2EFNA 2FU4A 4P9UA 1BIBA 4RB1A 4UVBA 4LB6B 2VOPA 4PGHA 1LEBA 4QWQA 2ZBKA 4RS8A 1Z1DA 2E1CA 2XROA 1BN5A 5E20A 5CVIA 3TOBA 3KP4A 3RKYA 2K4BA 2LF8A 3U9GA 3SQNA 1MZBA 2O8XA 2BGCA 3WTTC 2A07F 1U3EM 2QM3A 4KATA 2Q2EA 1OR7A 1KQ4A 2HTJA 4E70A 4O3MA 5JFRA 2P6TA 4B09A 4CZZA 4OIOF 1W4MA 1KU7A 1WQGA 2ZJ2A 1U8RA 3WTVC 5LGUA 3CJNA 3HTUA 4GFQA 3F8NA 3MZYA 1IXSB 1ONVA 5D8LB 2HDCA 1L0OC 1HW2A 4HQEA 4U7DA 5DCFA 3CAGA 3H3ZA 4IRGA 4Q4ZF 2V79A 4FX4A 5CJ9A 4ESJA 1O3TA 3D5LA 1XSDA 1YLFA 4OIQF 2L01A 3R4KA 2P8TA 4Z2YA 2EFOA 3LAJA 3E6CC 3HRTA 1QO0D 5H6QA 2VBZA 1W7PD 2H09A 4G9YA 2XAGA 2Q0OA 2W24A 3WG9A 3FF5A 2KJCA 4L0ZB 3C3WA 2NNNA 4AVPA 1AOYA 1JE8A 1IN8A 1CGPA 3LA7A 1WSUA 2WWYA 2GXBA 1K78A 1F4KA 3QX3A 3JTGA 2VOOA 2XCRB 2UXNA 2XAQA 2ELHA 3QOPA 1EK8A 4NQWA 2UXXA 4AIJA 1R1UA 4HDUA 3GFLA 2H27A 3K1MA 3WU1B 5L3BA 3GTKA 3M8EA 5J8FA 1DPUA 3QAHA 1YW8A 3GYHX 3IKVA 3M7GA 2ZMEA 3BZ6A 2DFIA 1IXRC 3C1DA 4UUVA 3T8TA 1DD5A 4F7ZA 2KWAA 3ZMUA 4XLNF 3E5XA 3GZ6A 2MH2A 4YG2F 4J3NA 4AIHA 5HVQC 3I64A 1Z7UA 2GZWA 5DEQA 1ULYA 2JH3A 3HSEA 3CO6C 1K78B 1GXPA 3TQNA 2B63A 1KA8A 1SD5A 2KJBA 5LBQA 3K1PA 2CFAA 4GXOA 5ICFA 1MD0A 1TLHB 5ILVA 1O25A 3GTOA 1P6RA 4KYWA 1F1ZA 3FXUA 1G4DA 3DKWA 4I7HA 1WKMA 1U5TB 3N97A 2GAUA 3J7AO 2XASA 1JXSA 3WE2A 3JTHA 2VE8A 3GFIA 2IPQX 3HRMA 5JR3A 1W7PA 1ZXOA 4ZH4F 4GYIA 2F5DA 4WK8F 4KDDA 5AIPA 4KICA 5F1RA 1SFUA 5FO5A 3R0JA 5FD5A 2PG4A 3WE3A 5CVUA 4M6XA 1IW7F 1I6XA 3L2CA 1OMIA 3DV8A 1B4AA 3GWZA 1R5HA 1RI7A 5AIQA 3I54A 2Y3PA 1S7OA 4AD9A 3WU0A 2Z9OA 3R6SA 4HW0A 5BS6A 4EGZA 3O3KA 5E8IA 1Q1HA 3FX3A 2MC3A 3V8KA 2DK8A 1XGMA 5JI6A 3WGGA 2H6CA 2Y0MA 2P5VA 3WTSC 4AWXB 4GTFA 1O3RA 1BM9A 5LHGA 3ELKA 1YW9A 2GQQA 4I02A 4RB2C 3HIFA 1FX7A 4KARA 1ZVUA 2FOKA 4HLYA 3J81Z 4KUMA 1R1VA 1YS6A 1S8NA 4G7ZF 4KB4A 4EJVA 4FM9A 2ADUA 4LD5A 2K27A 1TWHA 3IRQA 2HEOA 3VB2A 3EUHA 3ML6A 2MBFA 3LA2A 4BXUA 1SMTA 3W6JB 2QLZA 4KT5C 1HQCA 2EJRA 3IC7A 2GA1A 1WI9A 5JHUA 1I50A 2D45A 4H0EA 3BROA 1Z6TA 4HF2A 3KLNA 4OU0A 1NHAA 2HYFA 3F21A 3K9TA 5D8KB 1J7KA 3RTRA 5D4SA 4NHJA 4GT9A 1UHMA 3L00A 5DV5A 3VOEA 1BIAA 3P9IA 1IRFA 4M71A 2QBYA 4KMHA 4XLPF 3F22A 4KIFA 5D4RA 2QQBA 2ZFWA 1SFXA 1AB4A 1U2WA 5J6XA 1SFOA 4M1XA 2DO7A 2KKOA 1BGWA 4ZYHA 4A5MA 3DQVC 4ESFA 3R60A 1IS1A 2IP2A 4L0YB 4QLCU 2VT3A 3T8RA 3EDPA 3DPLC 2EFPA 5D6EA 3LWFA 4YIIA 4ESBA 3ZP5A 2RH6A 1XGOA 3B02A 3J80Z 1XGSA 3L7WA 2COMA 1ZG3A 1B9MA 3PFIA 2W85A 3BDDA 4L9JA 2GSOA 2ZNYA 1R23A 3LSTA 1S7AA 5IT3A 5AONA 3FM5A 1EH1A 1ZRCA 1QGPA 1KU2A 3R61A 4XRFA 3AQOA 2XAHA 3HOTA 2L54A 1YW7A 3WGIA 2C6YA 1TNSA 3OV8A 2STWA 1S29A 2OZUA 1UCRA 2A61A 1FBQA 3KEQA 4MGRA 2XCOA 1K83A 3HRUA 4C2MC 1K7AA 4GTCA 1O26A 2M30A 4XSZF 4ZZDA 2DPDA 1E17A 2W57A 3TO6A 1P92A 3CUQB 3F23A 2QYOA 1OYYA 1H9TA 1JHHA 2HR3A 2XIGA 5HLHA 2K4JA 2NAZA 2DBBA 2JTVA 1K79A 3J80K 2XRNA 5DYMA 4HF1A 3ECHA 4R8HA 2VN2A 4OIPF 3FOFA 3WGHA 4KFCA 1Z91A 2RN7A 2QQAA 2FNAA 3JW4A 1FYLA 3EETA 1HBXG 1X3UA 1KGSA 2FNPA 4RAYA 4EJWA 3NRVA 4EM0B 5CVJA 2RV8A 3GFMA 4HDVA 2FRHA 3CTAA 1F9NA 1HSJA 3TKYA 5CLSA 4ASNA 2BYVE 2XKPA 1R9TA 5E18F 5E8GA 1OPCA 1DDNA 4P5OA 4ON0A 3BJ6A 5ICCA 4FX0A 4DDQA 4G0UA 2O0YA 4I98B 1HW5A 2A6EF 1W5SA 1RNLA 2RKHA 3QPHA 4RGXA 4R1HA 3F72A 4BHCA 1I1GA 1FOKA 3MWMA 1XB4A 1QZYA 3GXOA 3MAJA 5FFXA 5TRDA 1TWFA 1RIOH 5IOTA 3EQLF 2RDPA 3M9AA 3T1BA 3QU3A 2Q8KA 3OEPA 2IVMA 3QP6A 1OYIA 1ZH5A 2AXLA 3QP5A 5D5WB 2ACJA 2QENA 4EV0A 3L4JA 1IN6A 4NB5A 3N3YA 4M6YA 2M8EA 3AAFA 3WTXC 3CLOA 2XVCA 1WQFA 1FY7A 2LF7A 4YFNF 1TBXA 2VE9A 2LNBA 3ECOA 4LB5A 3SFZA 4U0YA 2A69F 3I5UA 3MMLB 2A68F 2EV0A 1LEAA 2CW0F 2JRTA 3ZMZA 3N0CA 3IKTA 4ILDA 3MFKA 1GE9A 4CO8A 3F8FA 5FB2A 4LFUA 1LQ1A 3K69A 1XGNA 1FP2A 4EJUA 1USSA 3M8FA 2OD5A 4FT8A 5DDGA 2VODA 3MCZA 1USTA 2YU3A 5F64A 2NYXA 3HHGA 5EGHA 3V8LA 5ERIA 1IXCA 1ZBSA 3KCCA 2CSOA 2YX7A 4TV7A 5LLQA 2P5MA 4KIGA 1I27A 4CYDA 2Z5UA 4MEYF 3JSPA 5TJ3A 2CWEA 1TWCA 3EYIA 1B6AA 2IA2A 1P4AA 2PQ8A 2ESHA 1TTYA 1XDUA 4HOBA 1ZARA 1RZ4A 1IF1A 2XCQA 4EQQA 4MHGA 5D6FA 2GSUA 1KYWA 4LG0A 4G7HF 4BYYA 3N4MA 3MQ0A 2P5KA 2R3SA 1LDKB 2CG4A 4HQMA 4U7BA 2E7WA 5CVRA 4RB0A 4KMAA 1HSTA 1KQ9A 4FHTA 1B1BA 1U5TA 2VBWA 2Z33A 5DCMB 4IPAA 1OKRA 5EGEA 3T5XA 5HS8A 2V1XA 1AWCA 4RB3C 3GTPA 3BUEA 2JSCA 3AH5A 3BPXA 4L5IA 4LGWA 3DF8A 1YYVA 1OYWA 1ISEA 3WTYC