3LAPA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-canavanine.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
149
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator/dna
molecule keywords Arginine repressor
total genus 46
structure length 149
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lapA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lapA02
3EYIA 1PUEE 3RYPA 1HKTA 1FBSA 3NUHA 2FBHA 1O7FA 2PBIA 1XDUA 3PQJA 4BH9A 1ZRFA 5L3BA 4HDUA 2PLYA 3R61A 1ZHFA 4WX9A 1ZRCA 4HYEA 4FX0A 2PG4A 3BDDA 4DDQA 3T0YA 2MBFA 3WTYC 4KAWX 1TNTA 4OIOF 1ON1A 3ZPLA 1IN7A 1W5TA 2TDXA 3WU1B 1FP2A 1R58A 3F8MA 2UXNA 1AB4A 4Q48A 4B09A 2PMUA 4EGYA 1LNWA 1B59A 1RI7A 2P8TA 1ZYRF 2P4WA 1MDMB 1MJ9A 1U5TC 3LSTA 4G7OF 5EEGA 2FQ3A 1WQ2A 3HIFA 5KK1A 1WQFA 1TQMA 1XB4A 1HW2A 2HYGD 4KN7X 2FBIA 4QLCU 1FX7A 4KIBA 5ILSA 2KIUA 1QBJA 2IA2A 2FOKA 3AAFA 3ZMVA 3R0JA 1GXPA 3T8RA 3RKXA 4F7ZA 2XAQA 1BGWA 4KA4A 3J81K 1K7AA 3ZMTA 2XRNA 2DBBA 3NRVA 1IZ1A 4ZYEA 5EEHA 4BHCA 2HZTA 2PQ8A 3DF8A 4HA8A 3F8NA 2JSCA 3N4MA 1Z7UA 4E70A 4CICA 1AWCA 2KWAA 2CW0F 1O3RA 4HDVA 1O3TA 3K0LA 4RS8A 3J80K 1IF1A 2DK5A 1XMKA 2G9WA 4M9ZA 3C1DA 3GLXA 2F5CA 1GE9A 4U0YA 3GX4X 4GXOA 5E17F 1IS1A 4A0XA 2KIFA 4KYWA 2A6HF 1U2WA 2ZJ2A 3MZYA 3QPHA 4AIKA 3HSFA 2NNYA 5LRSA 1FY7A 1XSDA 4UUVA 3IKVA 3U2RA 4UVAA 2ADUA 1Q1HA 4I02A 3KLNA 1XGMA 1I6XA 3GZ6A 4ZYHA 1J0RA 1J59A 3DEUA 2Y75A 4MEYF 2M30A 3GEZA 3K1PA 3VEPA 1ZRDA 2M45A 3FXRA 4RGRA 2FNPA 1O7LA 3M8EA 5HOOA 3GUDA 2IT0A 4I0BA 5E1WA 2FA5A 4AWXB 3PFIA 3K2ZA 3WGHA 3KEOA 2VT2A 1B4BA 3OREA 1YO5C 2L4AA 4M6YA 2MH2A 4LGWA 4KB2A 1BIBA 5FFXA 4O3MA 2V9VA 2L01A 1SFXA 1F4KA 2QZ8A 2P5KA 2FF4A 3T5XA 2O6GE 2HQNA 1B9NA 4G0VA 1FPQA 1WI9A 1QPMA 5A2QZ 1TQIA 4M9XA 4HF0A 1W4MA 4EM2A 2EB7A 3I64A 3CO6C 1CF7A 1OMIA 4HV5A 2FRHA 2MLGA 2VOOA 3T8TA 1WRJA 1TW2A 2LKPA 4UXNA 2XKPA 5ICGA 1Z9CA 2LNBA 3GZ5A 3HRUA 2EWNA 4G8XA 3P9IA 4U7DA 3CAGA 4LG0B 4KT5C 4LK0F 2D45A 3F6VA 1HBXG 4LD5A 4UHTA 2GAUA 1KGSA 2ESHA 3ECHA 2W57A 1IN4A 4HZFA 5CVJA 3GYHX 2M8EA 4LB5A 2G7HA 3QP6A 3GF2A 3I54A 1JHFA 4LLLA 2W24A 3M8FA 4EM0B 4ON0A 1FC3A 4GCVA 5CJ9A 3ECOA 4OMZA 4ZZLA 2BGCA 5HVQC 2K02A 1XXAA 2J5PA 3TO9A 5D8LB 1J5YA 1BC7C 5AIPA 1WSUA 1BIAA 1J2XA 2P6TA 5BMZA 5ILUA 1S7AA 1L3LA 2NRAC 4U88A 1XD7A 2BV6A 3G73A 1BOAA 3JSOA 4BHBA 2UZKA 5ILVA 2IPQX 4IRIA 5BPDA 3BPVA 1R1VA 2HGCA 2STWA 4HLYA 2V79A 1GXQA 1B6AA 2EFNA 3CO7C 5DCMB 1FBQA 4FM9A 1R7JA 1USTA 1IRFA 3RI4A 2OQRA 4JK1X 4EGZA 2OQGA 3L4KA 4GGGA 1SD6A 4FHTA 4HX7A 1HW5A 2B0LA 4A12A 3V7SA 3HRMA 1FP1D 4HF2A 1IN8A 1FYMA 1XGSA 4YIFA 4QWQA 4IRHA 5D8KB 2DPUA 1JE8A 3I5UA 5AONA 2IJLA 1CF7B 1YLFA 2NNNA 2XVCA 2ZFWA 3HHHA 3R0AA 2O0YA 4G0UA 3P7NA 1TLHB 2VE9A 1A04A 3KETA 1MZBA 3RJPA 3F6OA 3E97A 3KP4A 2ESNA 3WTZA 2QWWA 3QX3A 4Y13A 3HRTA 1F9NA 1B4AA 1JHHA 3TDUC 3RKWA 3KEQA 5IT3A 3IRQA 3DP7A 3EYYA 1BI2A 4YIIA 3H3UA 2H6BA 3BJAA 2JTVA 3ZMSA 2XV4S 3GVAA 2YR2A 5D6FA 3WTTC 3Q5FA 3BZ6A 3ULQB 3M9AA 3J80Z 5H20A 3WTWC 2HQRA 5FO5A 4MTEA 3CUQB 3TQNA 2ZNYA 1T6SA 2FE3A 2GZWA 3B73A 2YSRA 3E6BA 1WWXA 3CUOA 1H9GA 2ZO4A 2Y48A 2CYYA 3WE2A 1LJ9A 2QENA 3ZMUA 3H92A 1XCVA 4YFNF 1SD7A 3FMRA 1D8JA 1MGTA 1ZG5A 3ROUA 2G7UA 4CHUA 1BI1A 1S6LA 2CSOA 2JZYA 1NHAA 1R5GA 5DEQA 4Y17A 1LQ1A 3ZMDA 5LGTA 1ZLJA 1OYWA 4P9FA 4MGRA 3QAHA 2ZMEA 4HLXA 1T98A 1LB2A 4I0AA 4A0ZA 5J6XA 3I0TA 2O3FA 5LEKA 4O6JA 3WODF 3LQRA 4AIJA 1O3SA 1OYYA 2WV0A 4S05A 5ICFA 1EH7A 4OIQF 3HHGA 1ISEA 4ASNA 5LRRA 3QPTA 2ISYA 2HTJA 3COAC 4UVCA 1KQ0A 1HKQA 1EK8A 1H0MA 1FNNA 2KKOA 2Z5UA 1E2XA 5BPIA 2V1XA 3F8CA 4ENNA 4KDPA 2OA4A 4I09A 2DT5A 1P92A 4I2OA 2EFWA 3LAPA 2P7VB 3W6JB 3ZN0A 4IXAA 1SMTA 4N9HA 1G3WA 3FOFA 5FLXK 3ML6A 4G94A 1P6RA 4P9UA 3F8BA 5KVRA 4G6QA 2XGXA 3NQOA 3BP8A 3F72A 4EV0A 1XMAA 5FGMA 1XXBA 1XSVA 2P5VA 2H27A 3K1MA 3VB2A 2QM3A 4G7ZF 2X4HA 2VC1A 3GXOA 3HSRA 1XXCA 3EETA 2RDPA 2EA4A 3RTRA 5F64A 4IHSA 1DUXC 1GVJA 1OYIA 4L0ZB 1LEAA 1WQGA 3BROA 2FXAA 2IA0A 2R3SA 1UFMA 4ESJA 3ZN1A 2PMHA 1PP8F 2F5FA 3KZZA 1SD5A 4WXHA 3LA2A 2MA3A 1HW1A 3W6KB 2HKOA 1JXSA 5J8CA 3L09A 5L3EA 2RGRA 3DXJF 2D1HA 1ZVUA 3KZYA 2RVCA 2VC0A 2Q2EA 4HX8A 4LLNA 3L4JA 4A6EA 2W85A 4CDGA 2FNAA 2BYVE 3RPQA 1IXSB 1ZGAA 3QRFF 4IHTA 3I59A 5L3FA 1BJTA 3WE3A 3L9FA 1E17A 4LLGF 2A69F 1IXCA 5LHGA 2XAGA 3V7CA 4XLPF 2RKHA 2AXLA 2ZBKA 2Z99A 1YFHA 1G3TA 2IVMA 4GYGA 3E5QA 1YTYA 2DQRA 2OZ6A 3FM5A 4L9VA 2K4BA 3LWFA 5D4RA 1C0WA 1FOKA 1D8KA 2P5LC 2RGVA 3TO7A 2ZCWA 4MQVA 2UWMA 3OOPA 5K5OA 5ED4A 3E5XA 1EH8A 3CLOA 3MWMA 2R7DA 2OBPA 3VA7A 2BE5F 4M74A 1ULYA 4HW0A 1TW3A 3D0SA 4BAYA 1RUNA 3FHZA 3CUQA 1LDJA 1XCBA 5D4SA 2JRTA 1ZREA 1S3JA 3BJOA 2HTSA 1SD4A 1HSJA 3LPXA 3L7WA 3JTGA 1BBYA 3IKTA 2WWYA 1U5TA 5HS9A 2XASA 4ZYGA 2M5WA 4GFQA 4ESBA 4XSXF 1F1ZA 1GHCA 4XSZF 3MMLB 1K78A 2KIMA 5F6FA 1ZAOA 2VBYA 2V6CA 3TOBA 1DPRA 3MCZA 4K2EA 2VBWA 4HF1A 2Z33A 1FT9A 2LF8A 3IL2A 3C3WA 4KN4X 3N97A 4KC6A 2XKOA 5HDKA 1EH1A 2L54A 1SAXA 4MTDA 2IA1A 2EK5A 1ZARA 3WGIA 2VBXA 4PGGA 3EUHA 3V8KA 3I4PA 4EJWA 3VFZA 3K69A 1XN7A 4N9IA 3DPLC 4I98B 2FU4A 1KU3A 1KU7A 1FLIA 3FX3A 5HLGA 1JGSA 4CYDA 5D5WB 2GXGA 2GWRA 1FZPB 3QOPA 1ZG3A 4NQWA 4KICA 3FWEA 4R8HA 3BWGA 3MQ0A 5JI6A 4L5IA 2CG4A 2V1DA 2EV0A 1BM9A 3E5UA 2ZXJA 3VODA 2WC2A 3V4GA 3OPFA 3QU3A 4EMSA 5HDGA 2XHKA 2HFHA 4WXDA 4P5OA 3R4KA 1OKRA 1SMYF 5K1YA 2E7XA 5CVVA 4OIPF 1K6OA 3WTXC 2QQAA 2ZMEB 4MNUA 3D5LA 3B02A 4LK1F 1R23A 4ETSA 5LGNA 4HAMA 4CZZA 1P4AA 4D0PA 4NHJA 1K79A 5E8GA 1S8NA 5H6RA 3ISPA 2IW5A 3HUGA 1B1BA 4U7BA 5JVOA 3LFKA 3IRRA 5E20A 3BPXA 4OU0A 2HDCA 4BNCA 5CLSA 4EJVA 5FB2A 2M87A 3TKYA 5DUIA 1F5TA 5IT9Z 2CQKA 5D5XB 3IC7A 1IRGA 4EM1A 1J7KA 1QZZA 3JAMK 1W7PA 2WTEA 4Z2YA 4FX4A 1HSTA 4OMYA 2H94A 4LG0A 5BS6A 3SZPA 1IXRC 4A5MA 4LMYA 4LB6B 2Z3YA 4RGSA 2A07F 1P4WA 2OD5A 3FXUA 4PZJA 4ENKA 1ON2A 3WG9A 2LSOA 4RAYA 3MEXA 2V1UA 1W7PB 2K7LA 2EV6A 1D3YA 2QYOA 3HOTA 2FSWA 4R1HA 3IWZA 4RB2C 3MAJA 3V7RA 3RYRA 3KP6A 2YU3A 3HTUA 4L9TA 5HLIA 1I27A 4G6DA 3LQQA 1VTNC 4IJAA 1UHWA 1SFUA 5D5VB 1UHMA 1ODDA 3O2PE 2P7CB 2EFOA 5A2QK 2K27A 4I7HA 2HS5A 2XUBA 2LDUA 5LEJA 2BBYA 3FM3A 1YG2A 4N0BA 5DD8A 2W84A 1OPCA 1J75A 4M71A 2MLKA 2D1VA 4PCQA 2DK8A 4RAZA 3IHUA 3GFLA 5D5UB 4HOBA 1B9MA 3ZP5A 4J3NA 3ERED 3K9TA 1W5SA 1MD0A 5LGUA 5FD5A 3WGGA 4LFUA 5DDGA 1YYVA 4HQEA 2A6EF 1FSEA 3DPTA 2H09A 4RGXA 4OIRF 3E3VA 1XGNA 4HQMA 2R7FA 2W25A 5ERIA 2RV8A 3TDZC 1R00A 1FBUA 4MQ9F 3CTAA 3FZVA 3IWFA 3ZQ7A 4Q5SF 2DTRA 2NAZA 1ZN2A 2XCQA 1REPC 4PGHA 1YS7A 2YX4A 4KDDA 5DD4A 4Q4ZF 1YW7A 4AIHA 3I53A 1U3EM 4KIFA 1RNLA 4A0YA 1CGPA 3WU0A 3Q9VA 5LLQA 3I71A 5FLXZ 2OU2A 2ZKZA 4ENMA 5JHUA 2NS0A 2F5DA 4KUMA 1QGPA 5DUKA 4FT8A 4DQ2A 4G0WA 3HOSA 4UVBA 4A6DA 5TRDA 2GIVA 5JVTA 4DNCA 2KJCA 3Q9SA 1J9IA 3L2CA 4KIGA 2PEXA 5CYVA 5J8FA 1YW8A 1P4XA 4P96A 4S04A 2NYXA 2GA1A 3C7JA 2XAJA 3J7AO 4OINF 1DD5A 3GWZA 3L00A 1U5TB 3REOA 3S2WA 4G7HF 2GXBA 2ZFZA 3P9CA 6PAXA 4IF4A 3SHFA 3HTSB 2XROA 1TQPA 3HRSA 2PJPA 1O3QA 2X0LA 2DI3A 3VOEA 4A2UA 1EV7A 4RB3C 2A3SA 4CO8A 2PN6A 3SFZA 3RPUA 1BI3A 2XIGA 3F22A 5DCFA 1FYKA 1QNTA 3NEUA 5F1RA 2ACJA 1T39A 4A5NA 4Y15A 3GFJA 1PP7U 1QQIA 2VT3A 2KJBA 1RZ4A 3FXQA 4GYIA 1X3UA 2ZNZA 1UCRA 1BI0A 1T2KA 4EJOA 5DYMA 1Y0UA 2EFPA 3K1NA 1DP7P 2DFIA 3LA3A 1MDMA 4TV7A 5E1ZB 1YS6A 4JQFA 2HKXA 3I59B 1O57A 3R6SA 1P2FA 1Z05A 3JTHA 1Z91A 4ZH4F 2RN7A 2GA2A 3CJNA 4HV6A 4U0WA 4WCGA 1I5ZA 4UV9A 4AD9A 4IVNA 4L5JA 4GO1A 1Z6TA 3T1BA 5HLHA 4P55A 1YQAA 1TTYA 2VN2A 3FF5A 5AIQA 5ICCA 1LDKB 5L3CA 2Y3PA 4YFXF 2M1BA 1H9TA 4ENJA 1BC8C 3G3ZA 1R22A 3F8FA 5BQTA 5LHHA 5FD6A 2L4MA 2DU9A 3CUQC 3BY6A 1KQ9A 5K5RA 4EJTA 1IUYA 1G4DA 4BXUA 3DQVC 2DLLA 2J5OA 4OOIA 3O3KA 3DV8A 2O8XA 1UB9A 5IT9K 1KA8A 4KMUX 4MEXF 3J81Z 4KNYA 5CVRA 4B8XA 4ESFA 3QP5A 3JAMZ 1PDNC 1TNSA 1WKMA 2IP2A 4HBLA 4RGUA 5L3DA 2KRFA 2EA2A 3DFGA 1KU9A 1MJBA 1K78B 1IN5A 3DKWA 2XAHA 4MHGA 2PFBA 4EJUA 2DW4A 1OR7A 3WTUC 3V8JA 3WTVC 3HYIA 3BOQA 2P5MA 4LJZF 2UXXA 2IRFG 2XAFA 1ZG1A 1T38A 4WF2A 1FYLA 2VBZA 5DCMA 1G6NA 3MFKA 1I1SA 4CGZA 4ZZDA 1YW9A 4L0YB 3WTSC 5JR3A 3RKYA 2EJRA 1KQ8A 4CXFA 2CGPA 2YPRA 1R1UA 1MJAA 2E7WA 3HSEA 2F2EA 2C6YA 2P6SA 4IRGA 3KP7A 1G3YA 2ETHA 3KP5A 2VONA 5ICEA 2QQ9A 4YFKF 2PHCB 2XCRB 1IW7F 2CWEA 3F21A 3JSPA 5CVUA 1SFEA 1IN6A 2YX7A 1I1GA 3F23A 1S29A 3ELKA 1WIHA 2RC4A 4WXCA 5JFRA 1XDSA 1S7OA 4R79A 1DDNA 2GQQA 1TBXA 2QUFA 1QZYA 2HYFA 2HEOA 1R36A 2Y0MA 4KMFA 1V3FA 1W7PD 4M72A 1IAWA 3BUEA 1RIOH 3GO5A 4L9NA 2A5YB 1HXDA 3O6BB 2FMLA 2FMYA 2K86A 5DV5A 2XCOA 2STTA 4WWCA 3ABUA 2DAOA 3BJ6A 3OEPA 2AS5F 1U8RA 3ABTA 4EQQA 4IPAA 4L18B 2Q8KA 4Q47A 3CDHA 1XSXA 5CVIA 4HX4A 2L3DA 4KFCA 1U78A 2JT1A 2FBKA 4YG2F 1USSA 3TO6A 5HDNA 3TOAA 3KCCA 2D2WA 3SZTA 1V4RA 4KB4A 3U1DA 5K5QA 1XGOA 4U0VA 2K4JA 1U6GA 2DPDA 1KU2A 3M7GA 5L3GA 4EVIA 2RQPA 5LHIA 3KP3A 5FFZA 1R1TA 2RNJA 3FMQA 1WQHA 2Q0OA 2JPBA 1FSHA 2MC3A 4M6XA 3U9GA 4RB0A 4M73A 2VE8A 3EQLF 3C18A 2Z9OA 2LF7A 1Z6RA 3LAJA 1YIOA 3RDIA 3SXYA 2JPCA 3SQNA 1BJAA 2A61A 2QVOA 4XRFA 3R60A 4XBFA 2OAZA 2DO7A 4UNOA 3OV8A 2COMA 3KE2A 4M9SA 4XLNF 3TGNA 3P9KA 5LBQA 2HR3A 4NB5A 5H6QA 5E18F 4H0EA 2E1CA 1T0FA 2VXZA 3GFIA 4BHPA 2BEOA 1R5HA 2HWVA 4O5VA 2O61A 2OZUA 4I01A 4WK8F 1EH6A 1RUOA 2EV5A 1ZGJA 3MZHA 2VOPA 3E6DA 3F3XA 4L9JA 1ZH5A 1HQCA 2QQBA 2HOEA 1AOYA 1KYWA 2MH9A 2QLZA 2VODA 2ELHA 3QU6A 1D5VA 2FEZA 5HS7A 1FWZA 3V8LA 2ISZA 2F5EA 5E8IA 2H6CA 1LVAA 2A68F 3H3ZA 4G9YA 1QO0D 1ONVA 3LA7A 4RB1A 1G3SA 2CFXA 3M1EA 4ZYDA 1HKSA 2MD5A 3GFMA 2PI0A 3I58A 4AVPA 5E1XA 2L02A 3JW4A 5TJJA 1L0OC 1ZLKA 4BQAA 3E6CC 1BN5A 4PDKA 2QBYB 5BOXA 3RIRA 1STZA 3FOEA 4UV8A 1LDDA 2E1NA 1DPUA 2O03A 1MKMA 2CO5A 5HS8A 2QBYA 5D6EA 3PQKA 3E6MA 3KFWX 3KP2A 3GW2A 1LEBA 3ZMZA 2DQLA 3FMSA 4JBAA 1Z1DA 4BYYA 2EFQA 3KLOA 3EDPA 1KYZA
chains in the Genus database with same CATH superfamily
3EYIA 1PUEE 3RYPA 3MKLA 1SC7A 3HXLA 2BY2A 2V6UA 1HKTA 1FBSA 3NUHA 2FBHA 1O7FA 2PBIA 1XDUA 1RR8C 3HOWJ 2AQFA 2DA5A 3HOYJ 4A3FJ 4XCHA 1ERDA 4FQGA 3CCLI 3PQJA 4BH9A 1ZRFA 4XR6A 5L3BA 4BBRJ 4HDUA 4GTDA 3K10A 3TFIA 2PLYA 3R61A 2WAQD 2M2EA 1ZHFA 3EUHC 4AYBL 4WX9A 1BW5A 5GAHJ 3BR0A 1ZRCA 1OJLA 1TWFJ 2KRHA 4RLFA 4A93J 1PVEA 4HYEA 1WGXA 4FX0A 3ZQQA 4KMAA 1I50A 3GTOC 2CV1A 3GTOJ 2PG4A 3BDDA 2KLOA 4OAZA 3T0YA 4ZDPA 4DDQA 4E7ZA 1JTYA 2XF5A 2MBFA 5DM6F 1M1EB 4IOAF 3WTYC 3CCRI 2O5IA 2VUMC 1A5JA 4KAWX 1TNTA 2H1LA 4HEA2 3ZRGA 4C3HK 1Y1WC 4OIOF 1ON1A 2ID6A 3ZPLA 1IN7A 1R71A 1W5TA 4OIRA 3HOWK 5HNFA 2TDXA 3G1OA 3CCMI 2R7SA 4X6AJ 3WU1B 1FP2A 4II2A 1R58A 2VKDA 1PJRA 2ZFUA 4BUPA 2LMDA 3JSTA 1TT5B 2LP0A 3H1CA 1X1BA 3U21A 1J6XA 3QPLA 1YNJA 1TWHK 5M5XK 2HU9A 3EPZA 3U1KA 4PJJA 4PUSA 3F8MA 1BOBA 4LLGA 2UXNA 1AB4A 3OYDA 4B4CA 4Q48A 1Z67A 3K4JA 1MW7A 4B09A 2PMUA 1YJ9I 4IKFA 4B48A 3MKWB 4EGYA 1LNWA 1B59A 1RI7A 2R7OA 1CQTA 2P8TA 1ZYRF 2P4WA 3BR1A 1MDMB 3SDBA 1OFCX 4XM3A 1JJ6C 1UAAA 2BOLA 3DKYA 1MJ9A 1U5TC 3LSTA 3H0DA 2WAFA 4AYBD 2R5YB 4BE1A 3OL4A 4BLBA 4G7OF 3LSGA 2WBMA 1B8IA 5EEGA 4LG3A 2FQ3A 1WQ2A 2IAIA 3FBIB 3HIFA 3H3VL 5KK1A 3LSRA 3A2KA 4A3CC 1Y1WJ 2HOTA 3S1NK 1PYVA 2DA7A 3TTGA 5IYCC 1WQFA 2Y0SN 1UZCA 4QTRA 1TQMA 2M0MA 5IP9J 4C2TA 3MKZA 2NVQJ 1XB4A 1HW2A 2HYGD 5KAIC 4KN7X 5B1AH 1P7JA 2FBIA 4QLCU 3K4MA 1FX7A 4KIBA 5ILSA 2KIUA 3OSFA 2GM4A 4KMDA 3H36A 3CF5F 1QBJA 1I3QK 5IP7J 4BBRC 2IA2A 2FOKA 2W1OA 2DXIA 3AAFA 1FTTA 3ZMVA 3WHBA 3R0JA 1GXPA 1AU7A 1I50J 1WCMK 3A0BC 3T8RA 3RKXA 4F7ZA 2BE5A 2WB1A 3PIOF 1XZQA 1TWCA 5EEAA 1U9OA 2XAQA 1BGWA 4LIUA 3K6GA 4KA4A 3J81K 2R93K 1K7AA 4NC6A 3ZMTA 3DU5A 1MMDA 2XRNA 2DBBA 4QJVB 3JRDA 3NRVA 1IZ1A 1K83J 2EPFA 4ZYEA 1K83C 5EEHA 2BW3A 4BQOA 2L7MP 3SZGA 2HZTA 4BHCA 3N0BA 3HOXC 3HOXK 2PQ8A 3DF8A 2R7ZC 1XX5A 3C2BA 1FMVA 3FXKA 4KM9A 4HA8A 1SFOA 4BY7C 3F8NA 2L9VA 3S17K 2JSCA 3N4MA 5IOTA 1Z7UA 4E70A 5IOQA 2JWTA 4CICA 1AWCA 2KWAA 2VXDA 2CW0F 4Y52C 4GTLA 1JUMA 1O3RA 2M4GA 3IPJA 2K9MA 4HDVA 3T02A 1V5EA 1X1PA 2ME6A 1O3TA 2JUCA 3K0LA 4RS8A 4LK0A 2IGOA 3J80K 1E0EA 3GTLK 1FTZA 1IF1A 2DK5A 5HLTA 2KZVA 3BLYA 1XMKA 3CD6I 2OCEA 1DCHA 1E3OC 4BGDA 2G9WA 4FZBA 4DZPA 4BXXJ 1VQ9I 1XG1A 4M9ZA 3C1DA 3GLXA 1WH5A 2DODA 5EG0A 4E7SA 2F5CA 1NK3P 1ZQ3P 1GE9A 4U0YA 2E2HC 3GX4X 1OR7C 2HI3A 5KHDA 4QIWL 4GXOA 5E17F 1QA6A 1IS1A 3GTPK 4A0XA 3OYLA 2X1DA 5F0FA 3MKYB 3S3OA 2KIFA 4KYWA 4EEFG 1K83K 4XOPA 3BR3A 1O2FB 2A6HF 1U2WA 2ZJ2A 4NUBA 2X48A 3TP0A 2CFAA 5J1RA 3MZYA 3QPHA 2B7EA 3HSFA 5F04A 4AIKA 4PFOA 2NNYA 2R7TA 5LRSA 1FY7A 3I3LA 1XSDA 4UUVA 3IKVA 3U2RA 1KQ4A 4UVAA 4XONA 2DFFA 2ADUA 2E2HA 3VDXA 3FXMA 3O8GA 1Q1HA 3HM5A 4I02A 4RDUA 3KLNA 4B43A 1XGMA 4A3LC 3OR2C 1I6XA 3GZ6A 4LJZA 1F7VA 4ZYHA 1J0RA 1J59A 5EF6A 3DEUA 3K4BA 3K70C 3OOUA 3CCQI 2Y75A 4MEYF 4CYCB 2JVHA 3W3CA 2M30A 1ETOA 3GEZA 4OIOA 2M7AA 5FRMA 2JA7K 3K1PA 4BY1C 3VEPA 1ZRDA 2M45A 3FXRA 5IYCK 4RGRA 3FXOA 2ZXHA 3E1SA 3OYJA 2FNPA 3MD2A 1O7LA 3M8EA 2DYSH 5HOOA 4AYBA 4GTAA 3DPUA 3GUDA 2IT0A 1O2AA 1R6RA 3CQZK 4I0BA 5E1WA 2Q1ZB 3CF2A 3CMYA 2FA5A 3PO3J 3CJQB 4AWXB 3PFIA 1N77A 2NOGA 3K2ZA 2VJ5A 3WGHA 1JI8A 3OYAA 3Q0VA 3KEOA 2HQAA 2LD5A 4RM2A 2PA8D 2VT2A 4C3IC 2KHMA 1Z7LA 1OISA 1D1CA 1B4BA 2E5ZA 3OREA 1YO5C 2L4AA 2K40A 5EZGA 4AYBN 4M6YA 2MH2A 4LGWA 4KB2A 1BIBA 1SAUA 5FFXA 1USMA 1WI3A 3FIWA 4O3MA 2R0QC 2V9VA 2Q2EB 2L01A 2HQ5A 1W36D 1SFXA 1FIPA 4F55A 3ABLH 3OYHA 4ZDOA 1RR7A 1F4KA 2ZSIB 3FISA 4B44A 2OV7A 5DS9A 2QZ8A 1TWAK 3BCAA 5E3MA 2P5KA 3ZQCA 4X1EA 2FF4A 4CSWA 3T5XA 3S2DK 2O6GE 2HQNA 1TWCK 1B9NA 4G0VA 1RU0A 3W2WA 1ZXOA 1FPQA 1WI9A 3AH5A 1QPMA 5A2QZ 1TQIA 4RAGA 4C3HC 1Y1WK 3GTQA 4M9XA 4HF0A 4D1QA 4V2GA 3OYEA 1EFWA 3AD9C 5GTIC 3M4OC 3BQZA 1G51A 1W4MA 2HPIA 3N05A 4EM2A 5B5EC 3OYBA 5F27A 2EB7A 3I64A 2K3FA 2M4KA 3CO6C 2CMPA 1CF7A 2JA6C 2EINH 5FKOA 3FKIK 3VSKA 1OMIA 1LKXA 4HV5A 3GTJA 4PFPA 3JRGA 2FRHA 1T95A 4F93B 1OQYA 2MLGA 2VOOA 3C2GA 3T8TA 1WRJA 1TW2A 2LKPA 4H4KC 2LC2A 1FOXA 4UXNA 5FKNA 3RPUD 4PSXA 1X19A 2XKPA 5ICGA 2DCEA 2DTZA 2P81A 3I4NJ 5FLMJ 1YX5A 1Z9CA 1DCPA 2LNBA 1HOMA 3VSLA 3GZ5A 2R92C 3DU6A 2GAHC 4PJLA 4S0HB 3HRUA 3AL0C 2EWNA 1VRQC 3M3YK 4P5AA 4OWRB 2R7ZJ 3S16K 1SFKA 5C3EC 1TWCJ 2V26A 4G8XA 4ZTFA 2LVSA 3P9IA 1VQOI 4U7DA 3CAGA 5IORA 1QU3A 1IL2A 5E3OA 2MG4A 4LG0B 1OCRH 4KT5C 1VQKI 3GTLJ 4LK0F 3VYRB 2D45A 4RBOA 3F6VA 3I55I 4C3IJ 4DZJA 1HBXG 1R9TA 4LD5A 1IRZA 1USOA 2CU7A 4UHTA 2GAUA 1Y1VC 5IYBC 1KGSA 4KATA 2ESHA 3BTLA 1IV6A 2QKLB 2XB0X 1RKTA 2O5RA 2CRGA 1T33A 4PJNA 3RZOC 3ECHA 3K4CA 2W57A 1IE0A 2H8RA 2TCTA 3GTQC 2CW8A 1IN4A 4A3IJ 1F43A 1POGA 4KARA 4HZFA 5CVJA 3GYHX 2M8EA 3GTKA 1X4PA 4LB5A 2HYJA 3I4MK 2G7HA 1WORA 3QP6A 2L9SA 3GF2A 3RCOA 4YFNA 2NVYC 1J09A 2GBYA 3I54A 2QSGX 1JHFA 4LLLA 2W24A 3G6EI 3K7AC 3GTMA 3M8FA 4EM0B 4ON0A 1FC3A 1WHUA 1FIAA 2O9LA 3HOZK 4D7MA 1I6VA 3BQYA 4GCVA 5CJ9A 3ECOA 3SZZA 4XN0A 4OMZA 4ZZLA 4XKCA 2XF7A 4A69C 2BGCA 1WCMJ 1I50K 3CCVI 5HVQC 2K02A 3D5RC 1Y1WA 4BXFA 4DBRA 3L2WA 1XXAA 5M3FJ 2J5PA 3TO9A 1JKRC 5D8LB 4YFKA 3S17C 1J5YA 4BY7K 1BC7C 2EQRA 5AIPA 1A6QA 2F5VA 2LG4A 1WSUA 1B72A 1BIAA 3QYEA 2NVXJ 1B8IB 1J2XA 2P6TA 1QVTA 3I4MJ 5BMZA 5ILUA 3GIRA 1S7AA 4A3GC 4FTHA 1L3LA 4DW6A 1Y0NA 1GDTA 4P1WA 2NRAC 1E3PA 1XD7A 2BV6A 4U88A 1VQPI 2AO9A 3G73A 1BOAA 3JSOA 4XK4A 3K7AJ 4BHBA 2YU9A 2R93C 3HC7A 2UZKA 3PNYA 2IPQX 3AFHA 4NNJA 5ILVA 4IRIA 5BPDA 3CC4I 3BPVA 4CYCA 4D5FA 5CPRB 1R1VA 2HGCA 2STWA 2R7XA 3QWLA 2Y31A 2Z16A 4KMHA 4HLYA 2V79A 2VUMJ 1GXQA 3DBLB 1O27A 2FQTA 3GTMK 1B6AA 5FLVA 3F9KA 2EFNA 3CO7C 3HB9A 5DCMB 1YJNI 1FBQA 4FM9A 1R7JA 1USTA 5K7HA 1IRFA 4U87A 4Q5SA 4GTBA 3RI4A 1QHHD 2OQRA 2JQ7A 5E3LA 3GDZA 4DBQA 2R93A 1MH4A 4JK1X 4C3HJ 4IOCF 3S93A 4C3JC 3HXAA 2V9KA 1A31A 3QODA 1XC5A 1PJ7A 4EGZA 3AQPA 1T0FC 4XKVA 2OQGA 4YEJA 3I56I 5K7ZA 3L4KA 4GGGA 1SD6A 1DP3A 4FHTA 4HX7A 2ZMEC 1HW5A 4FE7A 2WAQN 4A3MC 3HOUK 2B0LA 4A12A 3V7SA 3HRMA 4AUXA 1FP1D 3S15J 3S8PA 3OYKA 1NG6A 1Y56A 4CCOA 2ZJQF 4HF2A 1NTCA 1VQ4I 5EJCA 2CW0A 3LOCA 3FKIJ 3H5AA 1U9NA 1IN8A 1FYMA 1XGSA 4YIFA 4QWQA 5TJ3A 4IRHA 5D8KB 2WV1A 2EIMH 2DPUA 4BEHB 3I5UA 3LL7A 1JE8A 5AONA 4BY1K 2IJLA 1CF7B 3GTPJ 3JRHA 1X31C 1ZQ1C 1YLFA 2NNNA 2XVCA 2ZFWA 3HHHA 3R0AA 2O0YA 2HXOA 4G0UA 3P7NA 5FJ8K 1TLHB 2RAEA 3BG9A 3PUBA 2OUMA 2VE9A 3CC2I 1VLOA 4JK1A 1A04A 3KETA 1MZBA 3RJPA 3F6OA 3G4AA 2EBBA 2NVQC 1JJ8C 3E97A 2WB1L 3KP4A 5JVGF 2ESNA 2FUG2 3WTZA 3QOEA 2QWWA 1SFOJ 1TP4A 2VUMK 2ID3A 3C2HA 3QX3A 4Y13A 3HRTA 4XRMA 4Y33A 1F9NA 5JHFA 2VIXA 1B4AA 1JHHA 3GTOK 3TDUC 3RKWA 3KEQA 3PSFA 5IT3A 3IRQA 3FHNA 2EIJH 3DP7A 3EYYA 1TWFK 2HVSA 1WJDA 1BI2A 2WB1N 4GZYA 1A35A 2DT7B 3ABMH 4YIIA 3H3UA 3EUAA 2H6BA 3BJAA 4HRIA 2JTVA 2DOEA 1I3QA 3GTPC 3ZMSA 2XV4S 3GVAA 4Y4RA 4A3DC 2YR2A 5D6FA 4C3JK 3WTTC 3Q5FA 3BZ6A 3ULQB 3M9AA 3J80Z 3EQLA 5H20A 3WTWC 3HPHA 2HQRA 4A3EJ 5FO5A 4MTEA 3CUQB 3TQNA 2ZNYA 1YHQI 5C4XC 4NBQA 1T6SA 5IYDK 2X6OA 4BJ5C 2FE3A 3SEZA 2GZWA 3B73A 2A6EA 2YSRA 3E6BA 3BTJA 1FEXA 1WWXA 4C2MC 2E1OA 3CUOA 1H9GA 2ZO4A 4CCKA 3VYTB 2Y48A 2CYYA 1R49A 1EI6A 3WE2A 1LJ9A 1R4NB 1UELB 2QENA 3AD7C 3TBIA 3ZMUA 1MH3A 3H92A 3HOZJ 3JR9A 1TC3C 1XCVA 4YFNF 3EUKL 4Y52K 2PMZA 2WAQL 1SD7A 3FMRA 1D8JA 4ILDA 1MGTA 1ZG5A 3ROUA 3S2HJ 2DN0A 3DKXA 2G7UA 1LFBA 1MBGA 2YUSA 4PJMA 4CHUA 1BI1A 1S6LA 2CSOA 2JZYA 1NHAA 2JH3A 2CS3A 1R5GA 2IS4A 3ERMA 5DEQA 4Y17A 1LQ1A 3ZMDA 1JT0A 5LGTA 3JRAA 1ZLJA 1OYWA 4P9FA 3SYTA 2JA8J 3BP3A 4MGRA 5M5WJ 3QAHA 2ZMEA 3CMMA 4A3CJ 1IJWC 1LE8A 1RKWA 4HLXA 1T98A 1LB2A 1QPIA 2A5WA 2HXIA 1OCZH 3KIOA 4C30A 4KM8A 2LBFB 4I0AA 4B1RA 1XTAA 1Y39A 4A0ZA 4MFEA 3RKQA 1S5LC 1JT6A 3I0TA 5J6XA 2O3FA 4GFBA 5LEKA 3GEHA 2QKMB 4O6JA 4E7LA 1NK2P 3WODF 4BBRK 2QSFX 1DGWY 2WA0A 2E2IC 2ZXWH 3W2AA 3S15K 3G4SI 3LQRA 4M1XA 4AIJA 3H35A 4A3EC 3HOYK 1O3SA 1OYYA 2WV0A 4S05A 2NVYK 1LFPA 5ICFA 1EH7A 2K9QA 2JA5J 1J98A 2CUZA 3HL2A 4OIQF 1BL0A 5EZHA 3HHGA 1ISEA 3ONQA 4ASNA 5LRRA 3QPTA 4XRSA 2ISYA 5EGHA 3G4CA 2WB1D 2HTJA 4MO7A 1N78A 1IG7A 3COAC 3GMEA 2JSPA 4UVCA 1KQ0A 2W4SA 4XIDA 2LFBA 1K4TA 5BNGA 1HKQA 2CQNA 3DEWA 4Z6YA 1EK8A 1H0MA 5GAEJ 4XLAA 1FNNA 2DA2A 2KKOA 1E2XA 2Z5UA 5BPIA 1I6HC 2E36A 2V1XA 3F8CA 4ENNA 4KDPA 1WOPA 3L2QA 4HNTA 2OA4A 4I09A 2DT5A 1P92A 3ASOH 4I2OA 2EFWA 2XDVA 3RQIA 4G7OA 5E68A 4YFXA 3LAPA 2P7VB 3W6JB 5C44C 3IAM2 2IGKA 3ZN0A 4KN7A 4IXAA 1SMTA 4N9HA 3GTJC 4IHXA 1G3WA 3FOFA 1Y1VA 5KAFC 5J1UA 2LLKA 2XGEA 2QF7A 4I76A 3H9GA 1ZK8A 5FLXK 3ML6A 4G94A 4KMUA 3FK6A 1P6RA 3KPHA 4P9UA 3F8BA 4KITB 2R92K 3CLQA 5KVRA 4G6QA 2XGXA 3NQOA 3BP8A 3F72A 1OCPA 2FOWA 4HNUA 4EV0A 1XMAA 5FGMA 5J40A 3HPGA 4A3LJ 1XXBA 1Y8QB 1XSVA 3HOWC 2IS6A 4QIWN 2CJJA 2P5VA 2H27A 2IEKA 3TL4X 1O2BA 1SFOK 3K1MA 3DTIA 2CQXA 4A3JK 3VB2A 2QM3A 4G7ZF 2JN6A 1N75A 2E2IA 4AU7A 2PJRB 1Z21A 1ETQA 2X4HA 2EIKH 2VC1A 3GXOA 3HSRA 1W0UA 1XXCA 1WZ2A 2WY8Q 3BP8C 4IHWA 2VJJA 2RDPA 2EA4A 3EETA 3M8JA 5F64A 3RTRA 3OS1A 3GTJJ 1DUXC 4IHSA 1GVJA 1OYIA 1FMWA 4L0ZB 3RZDC 4JYKA 5GP9A 1LEAA 1WOSA 1O26A 1JKOC 1WQGA 3BROA 1ZR4A 2FXAA 1SFOC 3IP4B 2IA0A 2R3SA 5GAGJ 1UFMA 5IP6A 2WY7Q 4ESJA 3ZN1A 2VQHA 2PMHA 1NH3A 1Z77A 1PP8F 1ZTRA 2DJNA 1JVIA 2F5FA 3ABKH 1SD5A 3KZZA 4WXHA 4I6ZA 3A8KA 1YX3A 3LA2A 2GOXB 2K5CA 4XQFA 3A1YA 5B1BH 4BE0A 2MA3A 1WJFA 1HW1A 2EZLA 2WAQA 3DLAA 2EZIA 2HKOA 3W6KB 1JXSA 4Y7NC 5J8CA 3L09A 5L3EA 2RGRA 2XPVA 3DXJF 2V6SA 2D1HA 3LSKA 1ZVUA 3OYFA 3KZYA 1F93A 3CZ6A 2RVCA 2VC0A 2Q2EA 3PO2C 4HX8A 1JGGA 4MIMA 4X6AK 3G1LA 5C4JK 2OF7A 4LLNA 1SVLA 4P9SA 3L4JA 4A6EA 2W85A 3D1NI 3S17J 4ZH4A 2FNAA 4CDGA 2BYVE 5M5YK 3RPQA 1ACIA 2GSOA 1IXSB 1ZGAA 3QRFF 4GT9A 2OJED 3I59A 4IHTA 2YU9K 5L3FA 4CCLA 4BQNA 4M3GA 1BJTA 3L9FA 3OWTA 3WE3A 1E17A 4LLGF 2A69F 1PJ6A 3CCJI 1IXCA 5IOYA 2NVUB 3CDLA 2XAUA 1BJZA 5LHGA 2XAGA 3V7CA 1WJ5A 4XLPF 4XLCA 2RKHA 4OIPA 2AXLA 4BXXC 4BBSC 4HNVA 2ZBKA 2QSHX 4DGWB 2Z99A 3ADAC 1QVUA 2DMTA 3DTEA 4L5EA 4LK1A 1YFHA 1G3TA 3K2AA 3S1QC 2IVMA 3J7AY 2R4GA 1IDZA 1O24A 5EDNA 4GYGA 3M07A 3E5QA 4Y3OA 1YTYA 2DQRA 4A3KC 2KP6A 2NVTK 2OZ6A 3FM5A 1VQNI 4L9VA 2K4BA 3LWFA 5D4RA 1C0WA 1FOKA 1WOOA 1JKQC 1D8KA 2XRLA 3S0XA 3WODA 1XMXA 2FX0A 1Y6IA 1GUUA 2P5LC 2RGVA 2K9NA 3TO7A 2ZCWA 4MQVA 3DLLF 4FE4A 2UWMA 3OOPA 3H3VK 5K5OA 5ED4A 1VQ8I 3T01A 4OIQA 2FD5A 5B66C 3NARA 1Q1VA 3K4KA 3E5XA 4XLFA 5JLWA 2E2HK 1EH8A 3CLOA 1P7IA 3MWMA 4C45A 2R7DA 2OBPA 3VA7A 1LPQA 3GZNB 3PSIA 2BE5F 4BE2A 3RZDK 4M74A 1UHSA 1ULYA 4HW0A 1TW3A 3S1NJ 2CV2A 3D0SA 4BAYA 4MEXA 1RUNA 3TFJA 3FHZA 3CUQA 1T56A 1TWAJ 1LDJA 1XCBA 2A6TA 3ZQGA 1MBKA 4XLEA 1XPPA 5D4SA 3S1MC 3H9JA 3JCUC 4MFDA 1ZR2A 2JRTA 1ZREA 2LTPA 1SEUA 1S3JA 3BJOA 2HTSA 1SD4A 1HSJA 3CQZJ 4ZDLA 3L7WA 3JTGA 4J01A 3LPXA 1BBYA 3ZR8X 4KASA 4CUGA 3IKTA 2WWYA 1U5TA 1WPKA 2XSDC 2CFAB 5HS9A 3ZQIA 3GSIA 2B63J 2XASA 4ZYGA 1X4OA 2V6EA 4JX6A 4DOZA 1L0WA 2M5WA 2MABA 1X1DA 4GFQA 4ESBA 4XSXF 1F1ZA 1GHCA 2X51A 3HOVC 2R7ZK 4XSZF 1UMQA 3OYNA 1MSFC 5TMCA 3VWBA 3MMLB 1FOWA 1K78A 2KIMA 5F6FA 4LOWA 1ZAOA 2VBYA 2V6CA 1VF9A 1Y1VJ 5IYBJ 2CQQA 5JLXA 3TOBA 9ANTA 4XMYA 1DCOA 1DPRA 2VB6A 4BDYA 4Y52J 2Y2ZA 3MCZA 3SFIA 4K2EA 2VBWA 4HF1A 3PNTA 2EILH 2Z33A 1FT9A 2V1NA 2LF8A 3IL2A 5M3MJ 3BG7A 2PMZD 2NVTC 3C3WA 4KN4X 3N97A 3BG5A 4KC6A 2KL4A 3LSPA 4YG2A 4IO9F 2XKOA 2L2OA 5HDKA 1EH1A 3E7LA 1HLVA 1YE9A 2L54A 2V7FA 3RQ4A 2L7KA 1S9HA 1UG2A 3AG2H 2CUJA 1AKHA 4BEHA 3HKZN 1I3QC 3GTPA 1SAXA 4MTDA 3CQZA 2IA1A 3HOXJ 4BXXK 2DOFA 3I9V2 1JQWA 5C4XJ 2EK5A 1ZARA 1X1AA 3OYMA 1ETVA 3WGIA 3I4NC 1EF4A 2VBXA 4PGGA 5CHPA 3EUHA 4G7HA 3FKIA 2Y69H 4D9JA 3V8KA 3I4PA 2VJIA 3KEYA 4EJWA 1E3HA 3VFZA 3PJRA 3K69A 2W7NA 1XN7A 1K61A 4N9IA 3DPLC 2Z2SB 2JA5A 2R7WA 3H3VD 3LSJA 2FU4A 1KU3A 4I98B 1KU7A 1FLIA 1I39A 3X2QH 3FX3A 4B3XA 4NDLA 5K7FA 2WAEA 5HLGA 1JGSA 4CYDA 1ENHA 1MBJA 2GXGA 5HNHA 5D5WB 2E2JC 4GTEA 3TMOA 1IUFA 2JA6J 3FXLA 4F3QA 2GWRA 1FZPB 3QOPA 3DXJA 2KRCA 1Z3XA 1ZG3A 4NQWA 4BU2A 1VZ0A 5IP9K 1LVKA 3Q0UA 3CCYA 4KICA 1KZHA 3FWEA 3VPRA 2XPUA 4UUSA 3IH2A 3ZQLA 1PUFB 4R8HA 1DU6A 3BWGA 3MQ0A 4M3BA 2KISA 5JI6A 4L5IA 2CG4A 2ZSHB 3GTGJ 2V1DA 3LFUA 3LNQA 2EV0A 1BM9A 1O4XA 2FJ1A 3E5UA 2ZXJA 3VODA 1HC8A 3GTOA 2RQQA 3OS2A 2WC2A 3MVPA 5F0HA 3V4GA 3OS0A 3QU3A 3A8IA 4EMSA 3OPFA 3QYBA 5HDGA 2XHKA 2HFHA 5C3EJ 4WXDA 1I3QJ 4P5OA 1J6WA 3R4KA 1OKRA 1SMYF 5K1YA 4XLPA 4E4HA 2E7XA 5J1YA 5CVVA 1R9TK 4OIPF 3A4CA 2MFZA 4F91B 3WTXC 2QQAA 1K6OA 3FKJA 2ZMEB 1PJ5A 1OCCH 4MNUA 2GSUA 2XSJC 3HKZD 1IDYA 3D5LA 1IQ0A 3B02A 4LK1F 5FLMC 2NVXA 1R23A 2DOAA 4ETSA 4CCNA 5LGNA 4ABZA 1NG7A 4HAMA 1P9QC 4CZZA 1VNDA 2L0KA 4BL0B 4FASD 2DFEA 1BR4A 1P4AA 4D0PA 4NHJA 1K79A 2EH3A 2NVYJ 5E8GA 1S8NA 1ZBSA 5H6RA 2CH0A 3PM1A 3ISPA 2IW5A 3HUGA 1B1BA 2PX9A 5KCMA 3E0JB 4XOTA 4U7BA 4A3KJ 3H9QA 1EJ9A 1GV5A 3CCEI 5JVOA 4A3IK 3LFKA 3K4NA 3GBGA 3IH3A 3IRRA 3JRFA 2H1KA 1J6VA 3PUFA 5E20A 4ZTJA 4BY1J 3BPXA 2Y30A 4OU0A 2HDCA 4BNCA 5CLSA 4EJVA 2ELKA 5FB2A 3CCSI 5JFEA 3S1MK 1G2HA 1I3AA 3S1QJ 1H88C 2M87A 1O28A 3G2BA 3GTJK 1HQMA 3Q3SA 1HDDC 5M5WK 4JOMA 1VFCA 3TKYA 5DUIA 1F5TA 2R5ZA 5IT9Z 2CQKA 5D5XB 3I4MC 4RA2A 5FKKA 1MSEC 4XRSG 3IC7A 5F1JA 3GCMA 1J7KA 3B6AA 1QZZA 4EM1A 3JAMK 1W7PA 2WTEA 4Z2YA 2ZJRF 2K3PA 5GPCA 4ZYAA 4BJTA 4FX4A 1HSTA 2M3AA 3DTKA 1I6HK 4OMYA 3BZKA 1FOYA 3GTMJ 1UV7A 2WADA 2H94A 4LG0A 4P5BA 1MMNA 4OINA 1TWHJ 5BS6A 5M5XJ 1Y1VK 2RREA 5IYBK 3SZPA 4B47A 1IXRC 4A5MA 4LMYA 4LB6B 1HCRA 1JUSA 4WJ4A 1F36A 2Z3YA 4RGSA 2A07F 2MYSA 1P4WA 2OD5A 3FXUA 4PZJA 2R92J 2W7VA 4ENKA 3N0CA 1ON2A 2COBA 3WG9A 2LSOA 4RAYA 3MEXA 2V1UA 1W7PB 2K7LA 2B63A 2EV6A 2LKSA 1D3YA 2QYOA 3HOTA 2JA8C 2FSWA 4R1HA 3IV5A 1O25A 4A3EK 2LR8A 3IWZA 4FETA 3WU2C 5GADJ 4RB2C 4BS9A 3M3YC 3MAJA 3S1QK 1MNDA 2DMQA 4M3FA 3MZ8A 3RYRA 3V7RA 3KP6A 3KYCB 1W0TA 4IZZA 2YU3A 3HTUA 4L9TA 5HLIA 4D7NA 1MIJA 1I27A 4G6DA 3OYCA 1BW6A 2D6FC 2ZB9A 3LQQA 2HVQA 1YITI 1VTNC 4KT6A 4IJAA 1UHWA 4J00A 1SFUA 2R93J 5D5VB 3W6VA 5IYCJ 1UHMA 1ODDA 3O2PE 4XORA 2EFOA 2P7CB 5A2QK 2K27A 3K4LA 4MLOA 1BA5A 2M7BA 3DEEA 2DDBA 1BDFA 2P0WA 1TWGA 4A3FK 5IPAA 2DJIA 2KQRA 4I7HA 4UUTA 5FKLA 4YELA 2HS5A 5H2FC 4XLNA 2XUBA 3UKGA 2LDUA 5LEJA 2BBYA 4XNFA 4F92B 2K9LA 2LK2A 3WG7H 2E19A 3FM3A 1YG2A 1JOEA 1D5YA 2JA6K 4N0BA 5DD8A 2R5ZB 1X2MA 4I99C 1OLTA 2W84A 1OPCA 1J75A 4M71A 2MLKA 2D1VA 2BY1A 4PCQA 2DK8A 4RAZA 2IGNA 3IHUA 4QPQA 3GFLA 1SVOA 5D5UB 4A3MJ 4HOBA 1B9MA 3ZP5A 1D0XA 2X6XA 5GPAA 1RESA 4J3NA 3ERED 3K9TA 1W5SA 1MD0A 3GTGC 3BG3A 5LGUA 5FD5A 2LYCA 4WJ3M 3WGGA 4Y7NK 3PO3K 3LMMA 2F4OB 4LFUA 5DDGA 1YYVA 2L7ZA 4HQEA 2A6EF 1WH7A 5J4YA 3K70D 3BCBA 1FSEA 3DPTA 2H09A 1TL8A 5TISC 4II3A 4RGXA 4OIRF 3E3VA 4JX5A 2X9DA 1XGNA 2DMUA 3HJEA 3L2VA 4HQMA 1O29A 2R7FA 2E34A 1INNA 2W25A 5ERIA 2D5VA 5IP9C 3W2VA 1TWGK 4RM3A 4BKXA 4AIDA 4LQYA 4BBSJ 1TWFC 1VQMI 2RV8A 2E1MB 2YS9A 4NQWB 4XL9A 1EA3A 3TDZC 5M5YJ 2IS2A 4XKBA 1ZGWA 3G71I 1R00A 1XZPA 1FBUA 2IS1A 5FLMK 4MQ9F 3BR2A 2ECBA 3CTAA 5EGOA 1B72B 1SMYA 3CQZC 2E2JK 3FZVA 3RZDJ 3TW6A 4C2UA 3PL8A 3IWFA 3ZQ7A 2R7VA 4Q5SF 2DTRA 2NAZA 4KISA 1ZN2A 2XCQA 2CW7A 1KONA 1REPC 4PGHA 3DCFA 1YS7A 2YX4A 4KDDA 5DD4A 1V5FA 4Q4ZF 3B6CA 2JA7C 1YW7A 3FBNB 2Y0SA 4AIHA 3I4NK 3I53A 1U3EM 5J3LA 3QPSA 3IAS2 1OCOH 2M0CA 1DQUA 4KIFA 1RNLA 4A0YA 1CGPA 3OIQA 3WU0A 4QIWD 3Q9VA 1HF0A 1A36A 5LLQA 3I71A 4M6VA 4E7HA 2R7UA 1VH2A 2VJ4A 2JA2A 5FLXZ 5J47A 2OU2A 2ZKZA 4AH6A 3OYGA 3TP3A 4ENMA 1VI0A 3HKZL 2IXSA 2XB5A 2NS0A 1WVRA 4BQQA 5JHUA 2F5DA 4XSZA 1QRYA 1JUPA 4KUMA 1QGPA 1ETXA 3BR5A 5DUKA 1APLC 1IC8A 4FT8A 4DQ2A 5IP7K 4G0WA 3HOSA 4EATA 2XGDA 4UVBA 3BC8A 4A6DA 5TRDA 3GEIA 4AVZA 2GIVA 1LUJB 3UNGC 4DNCA 5JVTA 2KJCA 3JRIA 2BZTA 3Q9SA 1V54H 1J9IA 2KZGA 2ZC2A 1TWGC 3HOVJ 4KN4A 2VPRA 3L2CA 3S1RK 4KIGA 2R92A 2PEXA 5CYVA 3BR6A 5J8FA 1YW8A 1P4XA 4P96A 3SZYA 2CUEA 4S04A 2NYXA 3DBRB 2GA1A 3C7JA 3DBHB 3GTKC 2M9HA 2XAJA 5DTDA 4QJVA 3CESA 3J7AO 3CDIA 4OINF 1DD5A 3GWZA 4D5CA 4E7IA 3L00A 3HOYC 4HSTA 3GTMC 1U5TB 3REOA 3S2WA 4G7HF 3TW7A 2GXBA 4A3GJ 3P9CA 2ZFZA 3GTGK 3GTLC 6PAXA 4M3EA 4O2DA 4IF4A 3SHFA 5EGEA 5CKTA 4J19A 2JA5C 3HTSB 3G1MA 1YRNA 1VGXA 3LSIA 2BHZA 2XROA 2E2IJ 1TQPA 3HRSA 2PJPA 3VYUB 1O3QA 1MBFA 1S7EA 2X0LA 3MN2A 2DI3A 3VOEA 2PA8L 4A2UA 2X6WA 2BVLA 3ZXSA 1EV7A 4KJZA 2Z1DA 2A3SA 4RB3C 2HVRA 4CO8A 2PN6A 3SFZA 1G59A 3FDYA 1YNNA 3UR3C 3RPUA 1BI3A 3AD8C 2XIGA 3F22A 5DCFA 1FYKA 4RMFA 1IO2A 1QNTA 2HDWA 1ORKA 3NEUA 2LY1A 2GSNA 5F1RA 2ACJA 3HZJA 4CZCA 1T39A 4XN3A 4A5NA 4IX7A 1V5VA 4Y15A 2L7FP 1EKEA 3GFJA 3VYSB 1PP7U 3M3YJ 1QQIA 5FKMA 2VT3A 3M4OJ 2KJBA 5J4VA 4A3BK 1YX2A 1C0AA 2ZJPF 5GTHC 1HI9A 3HOZC 1RZ4A 2XPWA 2IGMA 3FXQA 2Y0SL 3DWLE 2XF6A 3K7AK 1K83A 4NOIA 3SJMA 2W00A 4GYIA 2JA8K 1X3UA 1N25A 2ZNZA 2BXYA 1UCRA 3OIOA 5IYDJ 1ZYRA 2LBFA 1BI0A 1T2KA 4EJOA 1V55H 1X3ZB 5EGOB 2VKEA 5DYMA 5D4DA 1Y0UA 1JTXA 3S1NC 2EFPA 4IHVA 3K1NA 1MNEA 4C9YA 1IW7A 4A3BJ 4A3CK 3S2HK 1DP7P 2DFIA 2E5NA 2E35A 1UJ8A 1FJLA 2X1EA 3LSMA 2YU9C 1T8IA 3LA3A 1MDMA 3ASNH 4TV7A 2OC6A 5E1ZB 2W82A 5F08A 1YS6A 1RPWA 4DYQA 4JQFA 2HKXA 3I59B 1O57A 2ZXIA 1Z3YA 2H8WA 3PO2J 3L1PA 4QSHA 2VPLA 2DFHA 1WSVA 3R6SA 1P2FA 2HOSA 1Z05A 1PUFA 3JTHA 4X6AC 1Z91A 4ZH4F 2DT6A 2RN7A 2GA2A 3N3YA 4FCYA 1WSRA 2DMNA 2K85A 3CJNA 4HV6A 4U0WA 4WCGA 5C3EK 2O7OA 1I5ZA 2UUZA 2I8DA 2A69A 3H0GK 2F48A 4UV9A 4AD9A 1X2NA 2MC4A 4IVNA 2OPTA 4L5JA 4GO1A 1Z6TA 3T1BA 4A93C 3J7YJ 5HLHA 3GTGA 4OAYA 1YQAA 1TTYA 4P55A 1U0JA 2VN2A 4IEJA 5IOZA 3ZQHA 1D1BA 3FF5A 2OTLI 1SVMA 4A3IC 3A03A 5AIQA 3IUOA 5ICCA 3RSNA 3SEQA 1LDKB 2B63C 1YRNB 2HDDA 4Q4ZA 2XC7A 5L3CA 1ITYA 2VL8A 2B9SA 2NVXK 4QPOA 4UB6C 2VQGA 2Y3PA 2F4MB 4CH7A 3H0GJ 3S32A 1HDPA 3NAUA 4YFXF 2BXZA 1BR2A 2M1BA 4N4OB 1X3WB 1H9TA 1D0ZA 2GLOA 3FKIC 4F52A 2F6CA 4ENJA 1AKHB 3LSHA 1BC8C 3G3ZA 2KDZA 1R22A 3PNVA 3F8FA 3S1RJ 4A3MK 1GT0C 5BQTA 3S16J 3PO2K 3WHCA 5LHHA 5FD6A 2JA7J 2L4MA 2DU9A 3CUQC 3BY6A 4FISA 1R9TC 1KQ9A 5K5RA 1ZELA 2LOOA 2DYRH 2NVTJ 2IBDA 1GV2A 2PJRA 4EJTA 1IUYA 1G4DA 2KDOA 4BXUA 4HPQA 3DQVC 2DLLA 1ETYA 2J5OA 4OOIA 1IRGA 1ZKGA 3O3KA 4IL6C 4JX4A 3DV8A 2O8XA 2R7ZA 1UB9A 5IT9K 1KA8A 4KMUX 1YIJI 3J81Z 1WJBA 4MEXF 1WJEA 4KNYA 3ZQFA 5CVRA 4B8XA 4ESFA 3QP5A 3JAMZ 1PDNC 1TNSA 1MNMC 5M3MK 1WKMA 2AXTC 2HOAA 5C44J 2IP2A 4HBLA 4RGUA 1UG0A 4GDFA 4C3IK 2QEXI 3RZOJ 5L3DA 1VQ5I 2EBIA 2KRFA 2EA2A 2A6HA 3OR1C 3S14C 5IY5H 2L5QA 3DFGA 1KU9A 1MJBA 3GLLA 4B3AA 1K78B 1IN5A 4PJ0C 3DKWA 2XAHA 4IQ4A 2PFBA 4MHGA 4EJUA 2DW4A 3JREA 3HOUJ 2JVGA 1OR7A 2M8GX 4A3JC 2W48A 3WTUC 2NVXC 2AHQA 4A3FC 2JK3A 3V8JA 2B63K 2GIZA 3WTVC 3QYFA 1YI2I 3CMEI 1K4SA 3HYIA 3BOQA 2P5MA 3AG1H 4LJZF 3BT9A 3A02A 2E60A 2UXXA 3FXJA 3H0GA 1XZQB 2L9NA 1RC9A 2IRFG 2XAFA 1W36C 5LD2C 1ZG1A 5F0CA 2BHYA 3QQAA 5E79C 1XS9A 1T38A 4WF2A 1FYLA 2VBZA 4E6KG 4A93K 5DCMA 2KPMA 1G6NA 2OCCH 3MFKA 3S15C 2ICWG 2LRDA 1I1SA 3H0GC 1K6YA 4CGZA 3HUGB 3S14J 2LKXA 2O5JA 4ZZDA 2JMWA 2I5UA 1YW9A 2ELJA 1SANA 3MMYB 3WTSC 1XPXA 5JR3A 4L0YB 2DDAA 2FQ4A 3RKYA 4DJAA 2EJRA 1KQ8A 1GVDA 4CXFA 2CGPA 1G8XA 5HL8A 2MGQA 2YPRA 1R1UA 4MQ9A 3GTQK 1MJAA 2E7WA 2A05A 3HSEA 2F2EA 4NC7A 2P6SA 4IRGA 3KP7A 2C6YA 4V19K 1XZPB 1G3YA 3CJRB 2ETHA 1H89C 3KP5A 5HODA 5FROA 3HOVK 2XGCA 3S2HC 1IRXA 2VONA 5ICEA 2QQ9A 4YFKF 2PHCB 2XCRB 3HEFA 1IW7F 2DA1A 2CWEA 3F21A 3JSPA 4X0GA 3KZIC 5CVUA 3ZCOA 1SFEA 3NWSA 1IN6A 2YX7A 1I1GA 3F23A 1S29A 4AC0A 2HNHA 3ELKA 1TWFA 2E2IK 1WIHA 2LREA 2RC4A 4UY8I 4E7JA 2HPMA 3AG3H 4WXCA 4NC8A 5JFRA 1R5ID 2K9SA 1AHDP 4A3BC 2PMZN 1LE8B 1XDSA 1S7OA 4R79A 1DDNA 2KMUA 2E71A 2GQQA 5IYDC 5KNLA 1TBXA 2QUFA 2PMZL 3T00A 5C4XK 1QZYA 2HYFA 3M1CA 3KYLA 1X58A 4XKWA 3GTKJ 2HEOA 1R36A 1AA7A 2E2HJ 2Y0MA 4A3DK 2MW8A 2JA6A 2VLAA 3CP8A 2Y9YA 2A68A 2M34A 1X1CA 4KMFA 1V3FA 2GAGC 1W7PD 4M72A 1IAWA 3BUEA 1RIOH 3GO5A 5B3SH 4L9NA 5EYRA 2A5YB 2EZKA 1HXDA 3HGGA 2EZHA 2VASA 2LY2A 3O6BB 3P5JA 2FMLA 4PSWA 2FMYA 2QGUA 5CQGA 2K86A 3JRBA 3ZOBA 4BACA 3M4OK 3BZCA 5DV5A 2DMPA 1BS2A 4ZJZA 2XCOA 5L46A 1I6HJ 5LFAA 3A0HC 2DA4A 3H5NA 3SDGA 3IH4A 1JKPC 2JA5K 2MSYA 2STTA 4BJ6C 1VQLI 4WWCA 1VQ6I 3CC7I 3KX2A 3ABUA 2E2JJ 2DAOA 3H5RA 3OYIA 4XSXA 4C2MK 3BJ6A 3J7ZI 4W97A 2R7QA 3OEPA 4WILA 2AS5F 3CP2A 1U8RA 4DYRA 3ABTA 4EQQA 4IPAA 1H8AC 4L18B 2Q8KA 2OTJI 4Q47A 3CDHA 1XSXA 3GTKK 5CVIA 4HX4A 1MMAA 2L3DA 2FQOA 4KFCA 4HG2A 1U78A 4RLQA 3CCUI 3S1RC 3GTLA 2JT1A 2FBKA 4XICA 4YG2F 4E7KA 1USSA 3TO6A 5HDNA 2JJ7A 3S3NA 3GEEA 3O8HA 4A3DJ 3TOAA 1U8BA 2X1CA 3KCCA 2D2WA 2X6YA 2NS8A 3SZTA 1LFUP 5IP7C 2KT0A 1V4RA 1ETKA 3JRCA 1DU0A 2ZUFA 3HOUC 4Y7NJ 2R7RA 3U1DA 5K5QA 4KB4A 1XGOA 3OSGA 4U0VA 2AQEA 2K4JA 1U6GA 4XLHA 2DPDA 1KU2A 3L2RA 3HBLA 3M7GA 5L3GA 4EVIA 2RQPA 4YIRX 4G12A 5LHIA 3KP3A 5FFZA 1R1TA 2NVQK 2HZDA 1TWGJ 2RNJA 3FMQA 1ETWA 5IOSA 1WQHA 3A01A 1MMGA 2Y9ZA 2Q0OA 4V2FA 1QZEA 4LIVA 4CA0A 2JPBA 2LH9A 4G6TB 1T08B 1FSHA 2BVMA 2MC3A 1GLNA 4M6XA 5TGTA 3U9GA 2I10A 2QA4I 4YRVA 2UV1A 4A3LK 4RB0A 4M73A 2CQ7A 5FRNA 2VE8A 3EQLF 3C18A 2Z9OA 4ITVA 2LF7A 1DGRM 1Z6RA 4N4NB 3LAJA 3AG4H 1IBAA 2GXAA 2QCOA 1YIOA 1S72I 3RDIA 3SXYA 2JPCA 3SQNA 3TEDA 2G0EA 1BJAA 4GTCA 2A61A 3F0CA 2QVOA 3FK7A 3KYDB 3R60A 4XRFA 2NS7A 2OAZA 4XBFA 3V42A 2DO7A 3AKZA 3OV8A 4UNOA 4A3GK 3CMAI 2COMA 3KE2A 4M9SA 4XLNF 2VQCA 3AL0B 1D1AA 4CCJA 1YJWI 4W1UA 3TGNA 3ESWB 3P9KA 5LBQA 2V6TA 4A3JJ 2HR3A 4UUSB 4LOCA 4NB5A 4PK4A 5H6QA 2R5YA 1IGNA 5E18F 4H0EA 2L9RA 2E1CA 1T0FA 2V9PA 2RNGA 2VXZA 2VQLA 3Q0WA 3NWTA 3GFIA 4BHPA 2BEOA 3BG6A 4ANJA 2RH6A 3Q3QA 1I50C 1IV8A 1R5HA 2ECCA 2HWVA 4O5VA 5C4JJ 2VKVA 2O61A 2OZUA 5FJ8J 1MBHA 3HG9A 4UB8C 3PO3C 1MBEA 4I01A 4GTFA 3A8JA 1WJCA 2E1MC 4WK8F 1EH6A 1RUOA 2EV5A 1ZGJA 3HKZA 3MZHA 2DA3A 4DYCA 2VOPA 1BR1A 4PAAA 2BY3A 5DM7F 2JA7A 3E6DA 3F3XA 2N8GA 1YOVB 4L9JA 4M3DA 1ZH5A 5C44K 1HQCA 5E3NA 2QQBA 2HOEA 1AOYA 4MEYA 1EQRA 4AM3A 1KYWA 1WJAA 3OL3A 5CQEA 3OIPA 2TRTA 2MH9A 2QLZA 2Y0SD 2V4JC 2VODA 1D0YA 1VJEA 2VUMA 2ELHA 1W1WE 1Z0XA 3QU6A 1R4MB 2MD0A 4JP0A 4C2MJ 3RZOK 3AQOA 3S1MJ 1D5VA 1TZLA 2CFOA 1F7UA 2FEZA 2NXNB 1FWZA 3HGYA 5HS7A 3V8LA 2NVYA 4BY7J 2ISZA 2DA6A 2F5EA 2YU9J 5E8IA 3TFHA 1V5GA 2H6CA 3CJTB 1LVAA 2NOJB 5EG0B 2PPBA 2A68F 2CV0A 3H3ZA 4IQJA 2VKHA 4G9YA 1A6IA 4A3KK 1QO0D 1ONVA 3LA7A 4LITA 4RB1A 1WCMC 1G3SA 4LR2A 2CFXA 4CCMA 1HA8A 2BY0A 2F4IA 3M1EA 2QQ8A 2VI6A 1RRJA 3BTCA 1HKSA 4ZYDA 1TWHA 3S3MA 1TWAA 3A01B 3GFMA 2MD5A 2GOMA 2PI0A 2KFDA 3I58A 1VQ7I 4BBSK 4AVPA 5E1XA 3HDDA 2CUFA 3PIPF 2L02A 3JW4A 1WCMA 4BLAA 5TJJA 2JRMA 4C3JJ 1WFXA 3ZGKA 1L0OC 1ZLKA 3PFYA 1YCLA 4BQAA 3E6CC 1BN5A 4PDKA 4BDZA 3GTQJ 4PABA 2QBYB 2LY9A 5BOXA 4IHYA 3RIRA 4HSRA 1STZA 4GRIA 1QHGA 3FOEA 4UV8A 4RMNA 1LDDA 2O8KA 3D5SC 1OCTC 2E1NA 2BW3B 1DPUA 2O03A 2X85A 1MKMA 4DIQA 1Y8RB 3L2UA 3S14K 5C4JC 3OY9A 1W5CC 4BKWA 2JUGA 1MMSA 2ZUEA 2CO5A 5HS8A 5M3FK 4G7ZA 1TT0A 4ZC3A 2QBYA 5D6EA 3PQKA 1RETA 3E6MA 3KFWX 3KP2A 3GW2A 3S16C 1LEBA 3ZMZA 2DQLA 2KIQA 3FMSA 1TWCC 2ME0A 1R9TJ 3OMYA 5TMFA 3S2DC 4JBAA 1Z1DA 4RAFA 4BYYA 3S2DJ 2EFQA 1TWHC 3KLOA 1TWAC 3EDPA 3BTIA 1KYZA
chains in the Genus database with same CATH topology
3EYIA 1PUEE 3RYPA 1HKTA 1FBSA 3NUHA 2FBHA 1O7FA 2PBIA 1XDUA 3PQJA 4BH9A 1ZRFA 5L3BA 4HDUA 4GTDA 2PLYA 3R61A 1ZHFA 4WX9A 1ZRCA 4HYEA 4FX0A 4KMAA 1I50A 2PG4A 3BDDA 4DDQA 3T0YA 2MBFA 3WTYC 4KAWX 1TNTA 4OIOF 1ON1A 3ZPLA 1IN7A 1W5TA 2TDXA 3WU1B 1FP2A 1R58A 3F8MA 2UXNA 1AB4A 4Q48A 4B09A 2PMUA 4EGYA 1LNWA 1B59A 1RI7A 2P8TA 1ZYRF 2P4WA 1MDMB 1MJ9A 1U5TC 3LSTA 4BLBA 4G7OF 5EEGA 2FQ3A 1WQ2A 3HIFA 5KK1A 1WQFA 1TQMA 1XB4A 1HW2A 2HYGD 4KN7X 2FBIA 4QLCU 1FX7A 4KIBA 5ILSA 2KIUA 4KMDA 1QBJA 2IA2A 2FOKA 3AAFA 3ZMVA 3R0JA 1GXPA 3T8RA 3RKXA 4F7ZA 1TWCA 2XAQA 1BGWA 4KA4A 3J81K 1K7AA 3ZMTA 2XRNA 2DBBA 3NRVA 1IZ1A 4ZYEA 5EEHA 4BHCA 2HZTA 3N0BA 2PQ8A 3DF8A 4KM9A 4HA8A 1SFOA 3F8NA 2JSCA 3N4MA 5IOTA 1Z7UA 4E70A 5IOQA 4CICA 1AWCA 2KWAA 2CW0F 4GTLA 1O3RA 4HDVA 1O3TA 3K0LA 4RS8A 3J80K 1IF1A 2DK5A 1XMKA 2G9WA 4FZBA 4M9ZA 3C1DA 3GLXA 2F5CA 1GE9A 4U0YA 3GX4X 4GXOA 5E17F 1IS1A 4A0XA 2KIFA 4KYWA 2A6HF 1U2WA 2ZJ2A 2CFAA 3MZYA 3QPHA 4AIKA 3HSFA 2NNYA 5LRSA 1FY7A 1XSDA 4UUVA 1KQ4A 3IKVA 3U2RA 4UVAA 2ADUA 2E2HA 1Q1HA 4I02A 3KLNA 1XGMA 1I6XA 3GZ6A 4ZYHA 1J0RA 1J59A 3DEUA 2Y75A 4MEYF 2M30A 3GEZA 3K1PA 3VEPA 1ZRDA 2M45A 3FXRA 4RGRA 2FNPA 1O7LA 3M8EA 5HOOA 4GTAA 3GUDA 2IT0A 1O2AA 4I0BA 5E1WA 2FA5A 4AWXB 3PFIA 3K2ZA 3WGHA 3KEOA 2VT2A 4C3IC 1B4BA 3OREA 1YO5C 2L4AA 4M6YA 2MH2A 4LGWA 4KB2A 1BIBA 5FFXA 4O3MA 2V9VA 2L01A 1SFXA 1F4KA 2QZ8A 2P5KA 2FF4A 3T5XA 2O6GE 2HQNA 1B9NA 4G0VA 1ZXOA 1FPQA 1WI9A 3AH5A 1QPMA 5A2QZ 1TQIA 4C3HC 3GTQA 4M9XA 4HF0A 1W4MA 4EM2A 2EB7A 3I64A 3CO6C 1CF7A 1OMIA 4HV5A 3GTJA 2FRHA 2MLGA 2VOOA 3T8TA 1WRJA 1TW2A 2LKPA 4UXNA 2XKPA 5ICGA 1Z9CA 2LNBA 3GZ5A 3HRUA 2EWNA 4P5AA 4G8XA 3P9IA 4U7DA 3CAGA 5IORA 4LG0B 4KT5C 4LK0F 2D45A 3F6VA 1HBXG 1R9TA 4LD5A 4UHTA 2GAUA 1KGSA 4KATA 2ESHA 3ECHA 2W57A 1IN4A 4KARA 4HZFA 5CVJA 3GYHX 2M8EA 3GTKA 4LB5A 2G7HA 3QP6A 3GF2A 3I54A 1JHFA 4LLLA 2W24A 3GTMA 3M8FA 4EM0B 4ON0A 1FC3A 4GCVA 5CJ9A 3ECOA 4OMZA 4ZZLA 2BGCA 5HVQC 2K02A 1Y1WA 1XXAA 2J5PA 3TO9A 5D8LB 1J5YA 1BC7C 5AIPA 1WSUA 1BIAA 1J2XA 2P6TA 5BMZA 5ILUA 1S7AA 1L3LA 2NRAC 4U88A 1XD7A 2BV6A 3G73A 1BOAA 3JSOA 4BHBA 2YU9A 2UZKA 5ILVA 2IPQX 4IRIA 5BPDA 3BPVA 1R1VA 2HGCA 2STWA 4KMHA 4HLYA 2V79A 1GXQA 1O27A 1B6AA 2EFNA 3CO7C 5DCMB 1FBQA 4FM9A 1R7JA 1USTA 1IRFA 4GTBA 3RI4A 2OQRA 2R93A 4JK1X 4C3JC 3AQPA 4EGZA 2OQGA 3L4KA 4GGGA 1SD6A 4FHTA 4HX7A 1HW5A 2B0LA 4A12A 3V7SA 3HRMA 1FP1D 4HF2A 1IN8A 1FYMA 1XGSA 4YIFA 4QWQA 5TJ3A 4IRHA 5D8KB 2DPUA 1JE8A 3I5UA 5AONA 2IJLA 1CF7B 1YLFA 2NNNA 2XVCA 2ZFWA 3HHHA 3R0AA 2O0YA 4G0UA 3P7NA 1TLHB 2VE9A 1A04A 3KETA 1MZBA 3RJPA 3F6OA 3G4AA 3E97A 3KP4A 2ESNA 3WTZA 2QWWA 3QX3A 4Y13A 3HRTA 1F9NA 1B4AA 1JHHA 3TDUC 3RKWA 3KEQA 5IT3A 3IRQA 3DP7A 3EYYA 1BI2A 4YIIA 3H3UA 2H6BA 3BJAA 2JTVA 1I3QA 3ZMSA 2XV4S 3GVAA 2YR2A 5D6FA 3WTTC 3Q5FA 3BZ6A 3ULQB 3M9AA 3J80Z 5H20A 3WTWC 2HQRA 5FO5A 4MTEA 3CUQB 3TQNA 2ZNYA 1T6SA 2FE3A 2GZWA 3B73A 2YSRA 3E6BA 1WWXA 4C2MC 3CUOA 1H9GA 2ZO4A 2Y48A 2CYYA 3WE2A 1LJ9A 2QENA 3ZMUA 3H92A 1XCVA 4YFNF 1SD7A 3FMRA 1D8JA 4ILDA 1MGTA 1ZG5A 3ROUA 2G7UA 4CHUA 1BI1A 1S6LA 2CSOA 2JZYA 1NHAA 2JH3A 1R5GA 5DEQA 4Y17A 1LQ1A 3ZMDA 5LGTA 1ZLJA 1OYWA 4P9FA 4MGRA 3QAHA 2ZMEA 4HLXA 1T98A 1LB2A 4KM8A 4I0AA 4A0ZA 5J6XA 3I0TA 2O3FA 5LEKA 4O6JA 3WODF 3LQRA 4M1XA 4AIJA 1O3SA 1OYYA 2WV0A 4S05A 5ICFA 1EH7A 4OIQF 3HHGA 1ISEA 4ASNA 5LRRA 3QPTA 2ISYA 5EGHA 3G4CA 2HTJA 3COAC 4UVCA 1KQ0A 1HKQA 1EK8A 1H0MA 1FNNA 2KKOA 2Z5UA 1E2XA 5BPIA 2V1XA 3F8CA 4ENNA 4KDPA 2OA4A 4I09A 2DT5A 1P92A 4I2OA 2EFWA 3LAPA 2P7VB 3W6JB 3ZN0A 4IXAA 1SMTA 4N9HA 1G3WA 3FOFA 1Y1VA 5FLXK 3ML6A 4G94A 1P6RA 4P9UA 3F8BA 5KVRA 4G6QA 2XGXA 3NQOA 3BP8A 3F72A 4EV0A 1XMAA 5FGMA 1XXBA 1XSVA 2P5VA 2H27A 1O2BA 3K1MA 3VB2A 2QM3A 4G7ZF 2E2IA 2X4HA 2VC1A 3GXOA 3HSRA 1XXCA 3EETA 2RDPA 2EA4A 3RTRA 5F64A 4IHSA 1DUXC 1GVJA 1OYIA 4L0ZB 1LEAA 1O26A 1WQGA 3BROA 2FXAA 2IA0A 2R3SA 1UFMA 4ESJA 3ZN1A 2PMHA 1PP8F 2F5FA 3KZZA 1SD5A 4WXHA 3LA2A 2MA3A 1HW1A 3W6KB 2HKOA 1JXSA 5J8CA 3L09A 5L3EA 2RGRA 3DXJF 2D1HA 1ZVUA 3KZYA 2RVCA 2VC0A 2Q2EA 4HX8A 4LLNA 3L4JA 4A6EA 2W85A 4CDGA 2FNAA 2BYVE 3RPQA 2GSOA 1IXSB 1ZGAA 3QRFF 4GT9A 4IHTA 3I59A 5L3FA 1BJTA 3WE3A 3L9FA 1E17A 4LLGF 2A69F 1IXCA 5LHGA 2XAGA 3V7CA 4XLPF 2RKHA 2AXLA 2ZBKA 2Z99A 1YFHA 1G3TA 2IVMA 1O24A 4GYGA 3E5QA 1YTYA 2DQRA 2OZ6A 3FM5A 4L9VA 2K4BA 3LWFA 5D4RA 1C0WA 1FOKA 1D8KA 3S0XA 2P5LC 2RGVA 3TO7A 2ZCWA 4MQVA 2UWMA 3OOPA 5K5OA 5ED4A 3E5XA 1EH8A 3CLOA 3MWMA 2R7DA 2OBPA 3VA7A 2BE5F 4M74A 1ULYA 4HW0A 1TW3A 3D0SA 4BAYA 1RUNA 3FHZA 3CUQA 1LDJA 1XCBA 5D4SA 2JRTA 1ZREA 1S3JA 3BJOA 2HTSA 1SD4A 1HSJA 3LPXA 3L7WA 3JTGA 1BBYA 4KASA 3IKTA 2WWYA 1U5TA 2CFAB 5HS9A 2XASA 4ZYGA 2M5WA 4GFQA 4ESBA 4XSXF 1F1ZA 1GHCA 4XSZF 3MMLB 1K78A 2KIMA 5F6FA 1ZAOA 2VBYA 2V6CA 3TOBA 1DPRA 3MCZA 4K2EA 2VBWA 4HF1A 2Z33A 1FT9A 2LF8A 3IL2A 3C3WA 4KN4X 3N97A 4KC6A 2XKOA 5HDKA 1EH1A 2L54A 3GTPA 1SAXA 4MTDA 3CQZA 2IA1A 2EK5A 1ZARA 3WGIA 2VBXA 4PGGA 5CHPA 3EUHA 3FKIA 3V8KA 3I4PA 4EJWA 3VFZA 3K69A 1XN7A 4N9IA 3DPLC 2JA5A 4I98B 2FU4A 1KU3A 1KU7A 1FLIA 3FX3A 5HLGA 1JGSA 4CYDA 5D5WB 2GXGA 4GTEA 2GWRA 1FZPB 3QOPA 1ZG3A 4NQWA 4KICA 3FWEA 4R8HA 3BWGA 3MQ0A 5JI6A 4L5IA 2CG4A 2V1DA 2EV0A 1BM9A 3GTOA 3E5UA 2ZXJA 3VODA 2WC2A 3V4GA 3OPFA 3QU3A 4EMSA 5HDGA 2XHKA 2HFHA 4WXDA 4P5OA 3R4KA 1OKRA 1SMYF 5K1YA 2E7XA 5CVVA 4OIPF 1K6OA 3WTXC 2QQAA 2ZMEB 4MNUA 2GSUA 3D5LA 3B02A 4LK1F 2NVXA 1R23A 4ETSA 5LGNA 4HAMA 4CZZA 1P4AA 4D0PA 4NHJA 1K79A 5E8GA 1S8NA 1ZBSA 5H6RA 3ISPA 2IW5A 3HUGA 1B1BA 4U7BA 5JVOA 3LFKA 3IRRA 5E20A 3BPXA 4OU0A 2HDCA 4BNCA 5CLSA 4EJVA 5FB2A 5JFEA 2M87A 1O28A 3TKYA 5DUIA 1F5TA 5IT9Z 2CQKA 5D5XB 3IC7A 1IRGA 4EM1A 1J7KA 1QZZA 3JAMK 1W7PA 2WTEA 4Z2YA 4FX4A 1HSTA 4OMYA 4P5BA 2H94A 4LG0A 5BS6A 3SZPA 1IXRC 4A5MA 4LMYA 4LB6B 2Z3YA 4RGSA 2A07F 1P4WA 2OD5A 3FXUA 4PZJA 4ENKA 3N0CA 1ON2A 3WG9A 2LSOA 4RAYA 3MEXA 2V1UA 1W7PB 2K7LA 2B63A 2EV6A 1D3YA 2QYOA 3HOTA 2FSWA 4R1HA 1O25A 3IWZA 4RB2C 3MAJA 3V7RA 3RYRA 3KP6A 2YU3A 3HTUA 4L9TA 5HLIA 1I27A 4G6DA 3LQQA 1VTNC 4IJAA 1UHWA 1SFUA 5D5VB 1UHMA 1ODDA 3O2PE 2P7CB 2EFOA 5A2QK 2K27A 1TWGA 4I7HA 2HS5A 2XUBA 2LDUA 5LEJA 2BBYA 3FM3A 1YG2A 4N0BA 5DD8A 2W84A 1OPCA 1J75A 4M71A 2MLKA 2D1VA 4PCQA 2DK8A 4RAZA 3IHUA 3GFLA 5D5UB 4HOBA 1B9MA 3ZP5A 4J3NA 3ERED 3K9TA 1W5SA 1MD0A 5LGUA 5FD5A 3WGGA 4LFUA 5DDGA 1YYVA 4HQEA 2A6EF 1FSEA 3DPTA 2H09A 4RGXA 4OIRF 3E3VA 1XGNA 4HQMA 1O29A 2R7FA 2W25A 5ERIA 4LQYA 2RV8A 3TDZC 1R00A 1FBUA 4MQ9F 3CTAA 3FZVA 3IWFA 3ZQ7A 4Q5SF 2DTRA 2NAZA 1ZN2A 2XCQA 1REPC 4PGHA 1YS7A 2YX4A 4KDDA 5DD4A 4Q4ZF 1YW7A 4AIHA 3I53A 1U3EM 4KIFA 1RNLA 4A0YA 1CGPA 3WU0A 3Q9VA 5LLQA 3I71A 5FLXZ 2OU2A 2ZKZA 4ENMA 5JHUA 2NS0A 2F5DA 4KUMA 1QGPA 5DUKA 4FT8A 4DQ2A 4G0WA 3HOSA 4UVBA 4A6DA 5TRDA 2GIVA 5JVTA 4DNCA 2KJCA 3Q9SA 1J9IA 3L2CA 4KIGA 2R92A 2PEXA 5CYVA 5J8FA 1YW8A 1P4XA 4P96A 4S04A 2NYXA 2GA1A 3C7JA 2XAJA 3J7AO 4OINF 1DD5A 3GWZA 3L00A 1U5TB 3REOA 3S2WA 4G7HF 2GXBA 2ZFZA 3P9CA 6PAXA 4IF4A 3SHFA 5EGEA 3HTSB 2XROA 1TQPA 3HRSA 2PJPA 1O3QA 2X0LA 2DI3A 3VOEA 4A2UA 1EV7A 4RB3C 2A3SA 4CO8A 2PN6A 3SFZA 3RPUA 1BI3A 2XIGA 3F22A 5DCFA 1FYKA 1QNTA 3NEUA 2GSNA 5F1RA 2ACJA 1T39A 4A5NA 4Y15A 3GFJA 1PP7U 1QQIA 2VT3A 2KJBA 1RZ4A 3FXQA 1K83A 4GYIA 1X3UA 2ZNZA 1UCRA 1BI0A 1T2KA 4EJOA 5DYMA 1Y0UA 2EFPA 3K1NA 1DP7P 2DFIA 3LA3A 1MDMA 4TV7A 5E1ZB 1YS6A 4JQFA 2HKXA 3I59B 1O57A 3R6SA 1P2FA 1Z05A 3JTHA 1Z91A 4ZH4F 2RN7A 2GA2A 3N3YA 3CJNA 4HV6A 4U0WA 4WCGA 1I5ZA 4UV9A 4AD9A 4IVNA 4L5JA 4GO1A 1Z6TA 3T1BA 5HLHA 3GTGA 4P55A 1YQAA 1TTYA 2VN2A 3FF5A 5AIQA 5ICCA 1LDKB 5L3CA 2Y3PA 4YFXF 2M1BA 1H9TA 4ENJA 1BC8C 3G3ZA 1R22A 3F8FA 5BQTA 5LHHA 5FD6A 2L4MA 2DU9A 3CUQC 3BY6A 1KQ9A 5K5RA 4EJTA 1IUYA 1G4DA 4BXUA 3DQVC 2DLLA 2J5OA 4OOIA 3O3KA 3DV8A 2O8XA 2R7ZA 1UB9A 5IT9K 1KA8A 4KMUX 4MEXF 3J81Z 4KNYA 5CVRA 4B8XA 4ESFA 3QP5A 3JAMZ 1PDNC 1TNSA 1WKMA 2IP2A 4HBLA 4RGUA 5L3DA 2KRFA 2EA2A 3DFGA 1KU9A 1MJBA 1K78B 1IN5A 2JA7A 3DKWA 2XAHA 4MHGA 2PFBA 4EJUA 2DW4A 1OR7A 3WTUC 3V8JA 3WTVC 3HYIA 3BOQA 2P5MA 4LJZF 2UXXA 3H0GA 2IRFG 2XAFA 1ZG1A 1T38A 4WF2A 1FYLA 2VBZA 5DCMA 1G6NA 3MFKA 1I1SA 4CGZA 4ZZDA 1YW9A 4L0YB 3WTSC 5JR3A 3RKYA 2EJRA 1KQ8A 4CXFA 2CGPA 2YPRA 1R1UA 1MJAA 2E7WA 3HSEA 2F2EA 2C6YA 2P6SA 4IRGA 3KP7A 1G3YA 2ETHA 3KP5A 2VONA 5ICEA 2QQ9A 4YFKF 2PHCB 2XCRB 1IW7F 2CWEA 3F21A 3JSPA 5CVUA 1SFEA 1IN6A 2YX7A