3LAPA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-canavanine.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
149
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator/dna
molecule keywords Arginine repressor
total genus 46
structure length 149
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lapA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lapA02
1HSTA 3FMRA 1U78A 1ZHFA 4O6JA 2L3DA 3HOTA 1MJAA 2EK5A 3L9FA 5L3DA 2R7FA 4UVCA 4GO1A 5FLXZ 3BWGA 1LDJA 2ISYA 3G73A 2JT1A 4JK1X 2XCRB 2GA2A 4GYIA 2DI3A 1WQ2A 3LA3A 1F1ZA 1XMKA 2A6EF 1IN4A 5AIPA 1XMAA 5E1WA 1ZRDA 2D1VA 4WK8F 2DTRA 1O3TA 2W25A 3RDIA 1AOYA 1I5ZA 1S3JA 5FFXA 2FQ3A 3CLOA 5JVTA 1MZBA 1OMIA 3D5LA 2GZWA 1B1BA 1I1GA 4XBFA 3T5XA 2O3FA 5ED4A 2BGCA 2G7UA 5ILSA 1BI0A 5D4SA 2O61A 1ZN2A 2RN7A 2IA0A 2HYGD 3GF2A 1SMTA 3LWFA 5J8FA 1FSEA 1BI1A 4G0UA 3L4KA 5TJJA 4DDQA 3MFKA 4HW0A 2F5CA 1I6XA 2EFNA 1D3YA 4KA4A 5HLHA 4OOIA 3WTWC 2DW4A 3KP5A 5LBQA 2WV0A 3TQNA 3QPTA 1HW2A 1KQ0A 2OQRA 1O57A 1TW2A 3DEUA 4HX7A 3U2RA 2G9WA 3R60A 2VN2A 3RTRA 3WTXC 3BROA 1QZYA 1G3TA 4M9XA 4MNUA 3M8EA 4U0WA 4L9JA 5H6QA 2P5LC 2M30A 2NS0A 3C18A 1ZVUA 3TDUC 4P96A 3J7AO 3RKWA 5K5OA 3JSPA 2DU9A 2PEXA 2DPDA 1O7LA 1XDUA 4WF2A 3O6BB 2M5WA 3BJ6A 3F72A 2CW0F 2FEZA 3G3ZA 2XAJA 4G0VA 3GUDA 1KYWA 1G3WA 3B02A 4IRIA 2XAQA 3V8KA 3ABTA 2P6SA 1PUEE 5DCMA 4Q5SF 1FYKA 4Y17A 2FMLA 4LK1F 5FD6A 4LLGF 2WC2A 4PZJA 1S8NA 2PQ8A 4U7DA 4L0YB 4OIPF 3R6SA 2VOOA 4AIJA 4RAZA 1WQGA 3V7CA 4BXUA 4FX0A 5E17F 1LB2A 1QO0D 3PQJA 4ON0A 2Q8KA 1IRFA 1FWZA 4I02A 4G6DA 5E8IA 3PFIA 1FY7A 1IRGA 3K69A 3V8LA 2KIFA 1FYLA 1ULYA 4L9VA 2XCQA 1XGSA 4IRGA 2LKPA 3L2CA 4EM2A 1XGOA 4MEYF 4RS8A 1KQ9A 1TNTA 3B73A 2HQNA 4HF0A 2Z9OA 4LJZF 2IVMA 1FPQA 2ZXJA 1H0MA 4TV7A 2GXGA 1FP1D 1XCVA 1WQHA 4EV0A 5IT9K 4G7HF 1FC3A 3J81K 2FBHA 2VT2A 4HOBA 4ENMA 2JSCA 2MH2A 3FF5A 3KP2A 1R1VA 5AIQA 3BUEA 2A07F 5HVQC 3F8BA 2P6TA 2P5MA 2L02A 5ICCA 5FB2A 3F23A 1SFEA 2TDXA 2HFHA 1WI9A 3ZPLA 4OINF 2L01A 3COAC 4IRHA 4LD5A 4HLXA 3U1DA 3EQLF 2VT3A 3HSEA 2RVCA 4EM0B 1R5HA 1WWXA 1PP8F 2JRTA 6PAXA 5BOXA 3GO5A 2KJBA 3WTUC 2HGCA 2CYYA 1ISEA 1F4KA 3RKXA 1SD6A 2Z33A 1FNNA 1TW3A 2L54A 3ZMVA 3LA2A 3M7GA 1IW7F 2VC1A 2XV4S 3K0LA 1WQFA 4WWCA 2ZNZA 3CJNA 3MAJA 3CUQA 2VBWA 1WRJA 3VEPA 2C6YA 2DK5A 4HA8A 1LQ1A 5EEHA 3D0SA 3GVAA 4KT5C 2LSOA 2QM3A 2K4JA 5A2QZ 1ZRFA 1DP7P 4KNYA 4YFNF 1IN8A 2NRAC 2B0LA 2VC0A 3I5UA 3O3KA 4A0XA 4HV6A 3GYHX 2QQ9A 5FFZA 5HS7A 2VBXA 1MDMB 1OYWA 3BPXA 4CICA 2CSOA 4ESBA 1CF7A 2OAZA 3L09A 2E1CA 5F6FA 1ZH5A 4IF4A 1BC7C 4GFQA 1FZPB 5CVVA 1IN6A 2FMYA 3ZMSA 2Y0MA 4HQEA 3E6MA 2VE9A 1VTNC 1GXQA 3KZZA 4PDKA 3HHGA 1G3SA 2XRNA 4L5IA 3TOAA 2KIUA 5AONA 5K5QA 4IXAA 3GXOA 2DK8A 1HXDA 4HZFA 2ESNA 2ACJA 5H20A 4G94A 1MDMA 5HDGA 3TDZC 2R3SA 2FNPA 3SZTA 4FT8A 2IJLA 1LVAA 3EETA 2EFOA 3REOA 3GFMA 4RB0A 2VE8A 3P9KA 1ZG5A 4HQMA 4MGRA 3MEXA 4ZYEA 5E1ZB 1O7FA 1BJAA 3KEOA 4MHGA 2IPQX 4YIIA 5HDNA 2GIVA 5HS8A 1O3RA 1B6AA 4N9HA 1WSUA 3ZMDA 4BHPA 1B9NA 2KJCA 5JI6A 4L5JA 5CVRA 1RIOH 3KZYA 2XCOA 2P7CB 2IP2A 4P9UA 3KETA 4KDDA 4ZZDA 2OBPA 2FNAA 3FWEA 3K1MA 3HRSA 4CZZA 1A04A 5DUKA 3QPHA 5ILVA 1LNWA 1STZA 1ZYRF 4K2EA 3RKYA 3Q5FA 4MEXF 2HZTA 1EK8A 3GFIA 3T0YA 4FX4A 4HYEA 2CG4A 1USSA 1ZARA 1BGWA 4HF1A 3CAGA 5JR3A 1WIHA 1BI2A 1FYMA 1Z1DA 1ZLJA 4D0PA 3C1DA 3R0JA 2XASA 1PDNC 1R7JA 3K9TA 2P5KA 4B09A 1XXBA 3EUHA 2PFBA 3CTAA 3DKWA 1DPRA 1P4WA 1FBQA 1LDKB 1E2XA 2PJPA 1BJTA 1KU3A 1IUYA 2COMA 2YPRA 3V8JA 1RI7A 4GXOA 1DDNA 2AS5F 2KKOA 2YX7A 2GWRA 3QU3A 3TKYA 3I54A 1ZREA 3U9GA 4UVAA 4EM1A 4HF2A 3ZN1A 5BS6A 4R1HA 3L4JA 4O5VA 2MD5A 4EJTA 2O0YA 2IA1A 1TQIA 4LMYA 4I09A 1XXAA 3L00A 5E20A 5ICEA 3FZVA 5LRRA 3DP7A 4PGGA 2Y75A 1TQMA 2JPCA 1T98A 2DQRA 5D6FA 4DNCA 2HYFA 2D1HA 3AAFA 3ABUA 3QP5A 2JZYA 4KMFA 4ZYGA 1F9NA 3CUQC 3WU0A 5D4RA 4CYDA 2VODA 3LAPA 4ZH4F 1KQ8A 4HAMA 3JSOA 1QBJA 1JGSA 3KE2A 5E8GA 1LEBA 1YW8A 3QAHA 2RGVA 3V7RA 3HYIA 3GW2A 4KN7X 1R58A 1ZAOA 4JQFA 3WTTC 2XROA 4IPAA 2ZKZA 4RB1A 4IVNA 1ONVA 4XRFA 3JTGA 1XSXA 5DCMB 2W24A 3BP8A 3GFLA 2CQKA 4A6EA 3FHZA 2E7XA 1HKSA 1EV7A 1MKMA 2A5YB 2GAUA 5EEGA 3Q9SA 4ESJA 3IKVA 3DFGA 4WXCA 1MGTA 3LQQA 3K2ZA 2MC3A 3NUHA 1HBXG 3OV8A 2VBYA 1S29A 2XAGA 1JXSA 2ZBKA 1DPUA 2V1XA 3I53A 3WODF 3FOEA 1AB4A 1RUNA 1XSVA 1P92A 1IZ1A 2F5DA 5HLIA 1OPCA 1SD5A 1D5VA 2XGXA 3WE2A 4S04A 2W85A 3IWZA 2BBYA 4LFUA 3ZMZA 4MQ9F 3I71A 5FO5A 5LGTA 4BYYA 1BM9A 1SD4A 2LF8A 2EJRA 1IN7A 2LNBA 2UWMA 1K78B 4L9TA 2DAOA 3HRUA 1QGPA 2NNNA 4G7ZF 2FE3A 5DUIA 2PLYA 5L3FA 1MD0A 4MTDA 2STWA 3N4MA 4EGYA 4G6QA 1YG2A 2M87A 3EYYA 3F3XA 4M6YA 3IKTA 4KFCA 2OQGA 1Z9CA 2ETHA 5BPDA 5D6EA 5LEJA 2IA2A 3ZMUA 3J80Z 4L0ZB 1YS7A 4KUMA 1EH6A 4P9FA 1UCRA 4R79A 1U5TB 4BAYA 2M8EA 2UXNA 1EH7A 1XSDA 1BN5A 1F5TA 1O3SA 4KIGA 1IXSB 5BPIA 4U7BA 2H6CA 1IF1A 2QYOA 2GA1A 1J5YA 1YQAA 3QOPA 3M9AA 1JE8A 2WTEA 2J5OA 1XXCA 1BC8C 4EVIA 3BZ6A 4I0BA 4I98B 2NYXA 4EQQA 4XSXF 2ELHA 2UZKA 2PI0A 2QQBA 2P5VA 4ENNA 1P4XA 3JAMZ 1K7AA 4PCQA 1T38A 3O2PE 1CGPA 4I2OA 2CFXA 1CF7B 2RC4A 3HSRA 3CO7C 1HSJA 1W5SA 2OD5A 5ILUA 1IAWA 3MZYA 3WTSC 4EJUA 2EV5A 4RGXA 1RZ4A 3LAJA 1S7OA 2O03A 5D5XB 2CO5A 2DT5A 2Q2EA 2UXXA 2PG4A 2XKPA 5DDGA 1TNSA 2W57A 1JHFA 2K7LA 3BJAA 2M1BA 1ODDA 4AWXB 3VOEA 2DFIA 2VBZA 1IN5A 3R0AA 3HTUA 4E70A 3F8MA 1T2KA 2IRFG 2V9VA 3H92A 2RV8A 3HTSB 1D8JA 4N0BA 5D5VB 4MQVA 1Z91A 3HUGA 5A2QK 1KGSA 3MMLB 2OZUA 2XUBA 1LEAA 1ZLKA 2PMHA 4Q4ZF 3E5XA 1MJBA 5LRSA 1AWCA 1FT9A 1Z6RA 1W5TA 1IS1A 3P9IA 2Y3PA 1ON1A 2Z5UA 3KP4A 3E5QA 1SD7A 5CLSA 3ISPA 3NRVA 4Z2YA 3WU1B 1RNLA 4AVPA 1P4AA 4EJOA 4IJAA 1QPMA 3I0TA 1ON2A 4M9ZA 2A61A 4U88A 5CVUA 3E6DA 4A0ZA 3KFWX 4LGWA 3OPFA 1R00A 5K1YA 4KMUX 1IXRC 4UHTA 4NHJA 2D2WA 2CWEA 1R1TA 3I59A 2KRFA 1S6LA 1T6SA 2STTA 2FOKA 3EDPA 1T39A 2RQPA 5LHGA 3LA7A 2K27A 2MBFA 4OIOF 5LHIA 1HW1A 2HR3A 2XAFA 2Z99A 2IT0A 2NNYA 1J75A 3T8RA 3KP7A 2YU3A 1LJ9A 3VB2A 1OYYA 5KVRA 2M45A 2DPUA 1FP2A 4A2UA 4M9SA 2MLKA 2LDUA 3ML6A 3GWZA 4CDGA 4JBAA 2H6BA 1L0OC 3ZQ7A 1LDDA 2XKOA 3KLNA 2DLLA 2KIMA 5ICGA 3F6VA 2H09A 2LF7A 3FX3A 4M72A 5D8KB 1YW9A 3W6KB 3J81Z 2EV0A 5E18F 3HSFA 2H27A 2XIGA 2YR2A 1OR7A 4L18B 5CVJA 4RGRA 2YX4A 4M74A 1EH1A 4KDPA 2HKXA 4RGSA 1XB4A 2K02A 2QBYB 1R1UA 2R7DA 4CXFA 3I58A 2A69F 2HTSA 5HDKA 1QZZA 1U6GA 3S2WA 5K5RA 3TO9A 5L3CA 2A3SA 3ROUA 2GQQA 2ZNYA 2F2EA 5BMZA 3W6JB 1U2WA 4OIRF 2A68F 1YTYA 1H9TA 5E1XA 1YFHA 3DF8A 3F6OA 4YG2F 1FLIA 1KA8A 1JHHA 1C0WA 1V3FA 5FGMA 4A6DA 5L3BA 2BYVE 2QLZA 2QVOA 1QNTA 3ECOA 3SXYA 2PHCB 3V4GA 2MLGA 3J80K 4ENKA 3C7JA 1USTA 4YFKF 4A5MA 2ESHA 3CO6C 4XLNF 4KICA 1EH8A 3DXJF 4F7ZA 3WTZA 3IRRA 5KK1A 3WTYC 2ZMEA 3ERED 4KAWX 3RPUA 4KB2A 1HKTA 1R22A 3K1NA 4A0YA 2HEOA 2HKOA 4H0EA 1ZGAA 3QX3A 4EJWA 3MZHA 3QU6A 4GGGA 3F8FA 3P9CA 1TLHB 3FOFA 2EB7A 4UUVA 4Q47A 1FBUA 5DD8A 3JAMK 3OREA 5CVIA 5D5WB 3MQ0A 3WG9A 3WGIA 4AIKA 3GZ6A 1YIOA 3SQNA 4G7OF 5F1RA 3LQRA 4IHSA 2QQAA 3CUQB 2OZ6A 4UV9A 2G7HA 4NQWA 4N9IA 2EV6A 4R8HA 3KCCA 2ZMEB 4UXNA 1I1SA 3H3ZA 3JW4A 2P4WA 2RNJA 2W84A 1G4DA 2FSWA 3PQKA 1KU7A 1B59A 4ZZLA 4MTEA 5L3GA 3M1EA 2ZO4A 2ZJ2A 2H94A 4GCVA 1BI3A 4DQ2A 2QBYA 4M71A 2X0LA 3GFJA 5LGNA 5D8LB 1Z6TA 2O8XA 2XVCA 4CGZA 2WWYA 1SFXA 4B8XA 3WTVC 4G0WA 1U5TC 1E17A 3GX4X 3LFKA 2E7WA 3IWFA 5H6RA 2K4BA 1J0RA 1G6NA 4M73A 1GHCA 2EFPA 4HX4A 4RB2C 5F64A 4RB3C 2V6CA 4YIFA 3VA7A 2O6GE 2ZFWA 1GXPA 1XDSA 1HQCA 4A5NA 2BE5F 2BEOA 2FF4A 3HRTA 4OMZA 2CGPA 4CHUA 3P7NA 5DV5A 1HKQA 2EA2A 2D45A 3CUOA 2RDPA 3NQOA 1W7PB 1D8KA 2DQLA 4O3MA 2FXAA 4HLYA 3QP6A 3H3UA 3F22A 1PP7U 4KYWA 2ADUA 4P55A 3TOBA 4OIQF 5BQTA 3KP3A 3DPTA 2AXLA 4FM9A 3C3WA 4OU0A 3E6BA 2EWNA 4EMSA 2JPBA 5JFRA 1TBXA 1REPC 4L9NA 2J5PA 4RAYA 1RUOA 3RPQA 4EGZA 3HRMA 2FU4A 1WKMA 2OU2A 1R36A 5FD5A 1YLFA 4LG0A 4HDUA 4S05A 3KEQA 1SFUA 1H9GA 4YFXF 1O3QA 1L3LA 1UB9A 3JTHA 4EJVA 1T0FA 3I59B 4WX9A 1ZGJA 1BIBA 4UV8A 3WGHA 3IHUA 5JHUA 1B9MA 3EYIA 1Q1HA 4WXHA 5HOOA 3OEPA 5CYVA 5DEQA 2PMUA 3FM3A 1I27A 1FSHA 3VFZA 3RIRA 5ERIA 1BIAA 1ZG1A 4G9YA 1K6OA 4HV5A 2L4AA 2HS5A 1MJ9A 3F21A 4U0VA 2MH9A 2IW5A 1Z7UA 4LB6B 1U5TA 3BY6A 3IC7A 3Q9VA 2XHKA 5HLGA 2GXBA 3I4PA 2P8TA 2XAHA 1OYIA 2OA4A 1SMYF 4P5OA 1G3YA 1KYZA 3TO6A 4ZYHA 1UHMA 2QZ8A 2X4HA 2NAZA 1HW5A 3LPXA 2DO7A 4FHTA 5TRDA 3L7WA 4QLCU 3KLOA 1K79A 2BV6A 1DD5A 2E1NA 3HHHA 4Y13A 4G8XA 2ISZA 4QWQA 1UHWA 2F5FA 1GVJA 5L3EA 5ICFA 3IL2A 3NEUA 2EFWA 3OOPA 1B4BA 2A6HF 4XSZF 5J6XA 5LEKA 5IT9Z 2PBIA 3VODA 1B4AA 5JVOA 4BHBA 3HOSA 3IRQA 3E6CC 2ZCWA 1BBYA 5J8CA 4XLPF 1W7PD 2VONA 3SZPA 2KWAA 3ULQB 1YYVA 4ENJA 5LGUA 3GZ5A 1UFMA 2EA4A 3LSTA 1W7PA 4KB4A 2FRHA 3E3VA 3GEZA 1Z05A 3T1BA 3TGNA 4HBLA 4BH9A 1XD7A 4I7HA 3KP6A 2QWWA 2F5EA 1P2FA 4M6XA 2QENA 3DPLC 2HOEA 4BNCA 3ZP5A 4AIHA 1Y0UA 4J3NA 4LLLA 1R5GA 4WXDA 3FXRA 5D5UB 2V1UA 3E97A 1DUXC 1QQIA 1IXCA 3RYPA 1BOAA 4IHTA 2VXZA 5HS9A 1X3UA 3FXUA 1XGMA 4KC6A 3WGGA 2DBBA 5DYMA 2YSRA 2RGRA 2MA3A 2PN6A 2HDCA 1P6RA 2FBIA 1YS6A 4CO8A 1YO5C 4BQAA 1TQPA 3SHFA 3ECHA 1U8RA 3DV8A 4LK0F 5CJ9A 3BDDA 1J7KA 3RI4A 3RYRA 1K78A 2HWVA 3FMSA 3BJOA 1J9IA 1YW7A 3MCZA 1ZG3A 4HDVA 1KU2A 1KU9A 4KIBA 2FBKA 3T8TA 2QUFA 3DQVC 4NB5A 4ZYDA 4UNOA 1U3EM 3R61A 2V79A 1XCBA 2V1DA 4LG0B 3V7SA 3M8FA 4KN4X 1W4MA 1TTYA 2Z3YA 5IT3A 4RGUA 2VOPA 1FOKA 5FLXK 1NHAA 2ZFZA 3F8CA 4LB5A 3I64A 4AD9A 3BOQA 4ESFA 3TO7A 3MWMA 1XGNA 2Y48A 4Q48A 3ELKA 1J2XA 2Q0OA 2HTJA 3GLXA 2JTVA 2K86A 5LLQA 4OMYA 3SFZA 4BHCA 3ZMTA 4LLNA 4PGHA 4A12A 4WCGA 3FMQA 2P7VB 2L4MA 4U0YA 1SAXA 3R4KA 1V4RA 4UVBA 4HX8A 2EFQA 1J59A 3ZN0A 4I01A 1R23A 4KIFA 2HQRA 3HIFA 3QRFF 3FXQA 1XN7A 1FBSA 1FX7A 3FM5A 4ASNA 1OKRA 1S7AA 3E5UA 5DCFA 2FA5A 3CDHA 1ZRCA 1GE9A 5DD4A 4ETSA 3RJPA 3N97A 2RKHA 4GYGA 3K1PA 3WE3A 4I0AA 5LHHA 3F8NA 4Y15A 3BPVA
chains in the Genus database with same CATH superfamily
1HSTA 1WH7A 3FMRA 1U78A 1ZHFA 4O6JA 3HDDA 4OIPA 2L3DA 3HOTA 1MJAA 2EK5A 3L9FA 5L3DA 3FHNA 5JLXA 2R7FA 4UVCA 4GO1A 1GLNA 3BWGA 5FLXZ 5TISC 5F27A 1LDJA 2YU9J 3CQZA 2W82A 2LBFB 1TWHA 3M4OC 2ISYA 4IKFA 3AH5A 1PYVA 4UB8C 2JT1A 4JK1X 3G73A 2E1MC 2GXAA 2XCRB 1FMWA 4IZZA 1D0YA 4JX6A 2KHMA 2Y69H 4C3IK 1J6VA 2GA2A 2KLOA 4GYIA 1EI6A 2DI3A 3MKWB 1WQ2A 2DMQA 3LA3A 2R7OA 1JKOC 2EIJH 1TWGK 1F1ZA 3CMMA 1XMKA 2PX9A 2A6EF 1IN4A 2LY9A 2NVXK 5AIPA 1XMAA 1ZKGA 5E1WA 1ZRDA 2D1VA 4WK8F 2DTRA 1O3TA 3AL0C 3S1QJ 2W25A 4LR2A 3RDIA 1AOYA 4FISA 1I5ZA 1S3JA 4A93J 5FFXA 3SZZA 3C2GA 5DS9A 3HOUC 4M6VA 4I6ZA 5IORA 2FQ3A 3CLOA 5JVTA 1MZBA 2BY3A 4A3LJ 1OMIA 1TWFK 3D5LA 4AIDA 2GZWA 1B1BA 4PJMA 2KRHA 5EEAA 3S15J 1IC8A 1I1GA 1X19A 3M3YK 3S1MJ 4XBFA 3GTOA 3BQZA 3T5XA 5IOTA 1O2AA 2M7BA 2O3FA 5ED4A 4E7SA 4B48A 1A36A 2BGCA 1TC3C 2G7UA 4BS9A 5FKNA 2W7VA 3K2AA 5ILSA 2R5YA 3CCJI 1BI0A 5D4SA 2O61A 3PUBA 1ZN2A 4KATA 3BG3A 4BBSC 3HOWJ 3GTGC 4MIMA 4XLFA 2RN7A 2IA0A 5J1YA 2CFAB 3AFHA 2HYGD 5IYBK 3GF2A 1U9NA 1SMTA 1WPKA 3LWFA 1MH4A 4BACA 5J8FA 1FSEA 1BI1A 1Y39A 4G0UA 2XRLA 3BR2A 5GADJ 3L4KA 4EATA 2R93C 5TJJA 4F92B 4DDQA 5IYDK 3MFKA 3FBIB 2CQXA 4HW0A 5IP7K 2NVQK 3FXKA 1VQLI 2F5CA 2QGUA 3EUAA 5GP9A 3G4SI 5B5EC 3BR1A 2OTJI 2Q2EB 3ASOH 3CP8A 4YELA 2VKVA 4JX5A 2VJ5A 3LSIA 5EZHA 1I6XA 2EFNA 1R49A 1HQMA 3T00A 4A3DJ 1D3YA 2V9KA 1O25A 4KN4A 3HOWK 4KA4A 1LE8B 5HLHA 1AKHA 3WHCA 4OOIA 3WTWC 2PPBA 3GTLK 3FXMA 2DW4A 1Z7LA 3KP5A 5LBQA 2WV0A 3ASNH 1G51A 4OINA 3TQNA 1USMA 3OL4A 1FOWA 1IBAA 1DGWY 3QPTA 2H1KA 2GLOA 4RM2A 2ZXHA 3AQOA 3K4MA 2PMZN 4XONA 1HW2A 1R9TA 4PSXA 2HVRA 1KQ0A 4Y7NC 2G0EA 4BXXK 4XLAA 2Y2ZA 2OQRA 1N75A 2QCOA 5J3LA 4C3HK 1O57A 3BR5A 1TW2A 3DEUA 1BR2A 1JTXA 4IO9F 5BNGA 4HX7A 1PVEA 3U2RA 4BKWA 2G9WA 3S15C 3LMMA 3R60A 2VN2A 3RTRA 1X1AA 2H8WA 3BROA 3S32A 3WTXC 4RAFA 1QZYA 1G3TA 1WFXA 4M9XA 3M8EA 4MNUA 3GTQC 1ACIA 3T01A 5FRNA 1QVTA 4U0WA 4L9JA 2M7AA 5TMCA 5H6QA 2P5LC 4XR6A 2M30A 2NS0A 3C18A 1XS9A 1ZVUA 3CCQI 1G59A 1ZELA 3OR1C 3TDUC 4P96A 3PO3J 3QYEA 3I4NC 3J7AO 3RKWA 5K5OA 3JSPA 2DU9A 2PEXA 3K70D 3MD2A 4BUPA 2DPDA 1O7LA 2AHQA 1EKEA 1XDUA 2K9LA 1UG2A 4WF2A 3O6BB 2H8RA 3H5RA 2M5WA 3BJ6A 5K7FA 4IOAF 3K4NA 3FKIK 2XSJC 3F72A 5JFEA 1IV8A 2CW0F 2FEZA 3G3ZA 2XAJA 2GOMA 5E3NA 3GUDA 3D5SC 4G0VA 3OL3A 1KYWA 1G3WA 3B02A 3CJQB 2XAQA 2MGQA 3V8KA 4F93B 3ABTA 2P6SA 4IRIA 3TFHA 1PUEE 5DCMA 4Q5SF 3DTEA 1FYKA 2WV1A 4XSZA 4A3DK 4Y17A 2KMUA 4A3JC 2FMLA 4LK1F 5FD6A 1YJWI 1BW5A 4RMNA 4ZH4A 3ZRGA 1TWGC 2CUEA 3K4KA 4LLGF 2WC2A 4PZJA 1S8NA 2PQ8A 1VQ7I 4LQYA 4YFNA 4U7DA 4L0YB 4OIPF 3GEIA 3KIOA 3R6SA 2VOOA 2E1OA 3JRFA 4AIJA 4C3IC 4BE1A 4XCHA 4RAZA 1WQGA 5DM6F 4XKCA 5GTIC 1BOBA 3V7CA 4BXUA 4FX0A 2HI3A 1LVKA 3S1MC 5E17F 1NG6A 2X1CA 1LB2A 3M07A 2HQAA 3LFUA 2CW8A 1VQNI 1W5CC 1QO0D 3ERMA 3PQJA 3Q0UA 4ON0A 3U21A 2V6TA 5IOQA 2Q8KA 1IRFA 2Z2SB 1FWZA 3Q3QA 1K83C 1HI9A 4XLHA 4I02A 4G6DA 2L7KA 5E8IA 2WB1L 3G2BA 4C3JC 2HU9A 2GSOA 3PFIA 2JA5J 1FY7A 1JUSA 2O7OA 1IRGA 2A6TA 4AYBN 3K69A 3V8LA 2IS6A 2NS7A 2KIFA 4XLEA 4CA0A 1FYLA 2VUMC 3HM5A 1ULYA 4L9VA 1WJAA 2XCQA 1XGSA 4RAGA 4IRGA 2QSHX 2EILH 1SFKA 2LKPA 4JK1A 4P5AA 3L2CA 2WY8Q 4QPQA 4EM2A 4AU7A 3FBNB 1YX3A 3GTMC 1XGOA 4NC6A 4MEYF 4RS8A 2IXSA 1POGA 1KQ9A 1TNTA 4A3IC 3B73A 2LH9A 5HLTA 2D5VA 1WOPA 1PJRA 1T08B 3LSJA 2IEKA 2HQNA 4HF0A 2R5ZB 2Z9OA 4LJZF 2IVMA 4N4NB 2WADA 2JN6A 1C0AA 1RC9A 3TEDA 2QSGX 3A8IA 1FPQA 2ZXJA 1H0MA 4TV7A 2GXGA 2NOGA 3GTMJ 2GAGC 3WODA 1FOYA 4PABA 1FP1D 1XCVA 4GTBA 1WQHA 4EV0A 5IT9K 5FKKA 4G7HF 5TJ3A 1FC3A 2NVTJ 4AYBD 3A03A 4RA2A 4RBOA 2NVYA 4A3FK 1O2FB 3HKZL 2HQ5A 3J81K 2FBHA 2VT2A 4HOBA 2EZIA 2DFHA 4ENMA 2JSCA 2MH2A 2JQ7A 3HKZA 3UR3C 3FF5A 3KP2A 1R1VA 4A3EC 3AL0B 5FRMA 1Y1VA 3I55I 3NWTA 5AIQA 3BUEA 2A07F 3CJRB 3JRBA 5HVQC 4HNVA 3F8BA 4A3LC 2P6TA 2P5MA 2L02A 5ICCA 3G1MA 1TWFA 3H5AA 5FB2A 2XPUA 3HOVJ 3F23A 2ZJPF 1TWAA 3PIOF 3H5NA 1SFEA 1ZBSA 2TDXA 3QQAA 3HJEA 3SDBA 2HFHA 3G4CA 1WI9A 3QWLA 1YNJA 1UG0A 3ZPLA 1XTAA 4OINF 4X6AK 2L01A 3COAC 4AC0A 4IRHA 3TFJA 3PNVA 2ECCA 4LD5A 3QPSA 3ZCOA 4HLXA 4BBSJ 3U1DA 3EQLF 2VT3A 1BDFA 3HSEA 2M0MA 2W4SA 1IDZA 2RVCA 2ZC2A 3S0XA 4ITVA 4EM0B 1R5HA 1WWXA 1PP8F 1OFCX 2GSUA 1X58A 2JRTA 6PAXA 5BOXA 3GO5A 2KJBA 3WTUC 2HGCA 2CYYA 5EDNA 1ISEA 1F4KA 3RKXA 4L5EA 1SD6A 4CCNA 2Z33A 1FNNA 1TW3A 3L2RA 3DEEA 1I50J 4M1XA 4NOIA 2ZFUA 2L54A 3ZMVA 3OR2C 3RQ4A 3LA2A 3M7GA 2RQQA 1IW7F 2VC1A 2XV4S 2F4MB 1K83A 3GTKK 3K0LA 1OCOH 1WQFA 4WWCA 1UV7A 1T33A 1OLTA 1YX2A 2ZNZA 4H4KC 2QA4I 4D5CA 5J4YA 4J01A 1T0FC 2DA3A 1QHGA 3H35A 3CJNA 3MAJA 3BTJA 3CUQA 2VBWA 1WRJA 5GAEJ 1Y56A 3VEPA 2C6YA 1FTTA 2NVTC 2DK5A 4HA8A 1LQ1A 2EIKH 5EEHA 1MBFA 3D0SA 3OYHA 3GVAA 4KT5C 2LC2A 2R7RA 2LTPA 3RZDK 2LSOA 4Q5SA 2QM3A 1QZEA 2E5NA 1X3WB 2K4JA 4BDZA 5A2QZ 3S1RJ 4LK1A 2E2JK 3HPHA 1ZRFA 1DP7P 3PNTA 4KNYA 4BY1J 2JRMA 1SANA 2XB5A 4YFNF 3TP3A 4XICA 4DBRA 1IN8A 5EG0B 4WJ3M 4C9YA 1OCRH 2K40A 3TBIA 2B0LA 2VC0A 2NRAC 1DU6A 4UUTA 3I5UA 4B4CA 5KNLA 3GCMA 3O3KA 4FASD 2V7FA 4A0XA 4HV6A 5IYCK 3GYHX 2QQ9A 5FFZA 5HS7A 2VBXA 1MDMB 2OCCH 2R7QA 1U8BA 1OYWA 3BPXA 3MMYB 2CSOA 4CICA 4ESBA 1CF7A 4A3GC 2DCEA 2PMZA 1KZHA 1PJ6A 2OAZA 3L09A 1K61A 5C44K 1QRYA 2E1CA 5F6FA 2L7FP 2LD5A 2GM4A 4V2GA 1ZH5A 4IF4A 2LRDA 1VQMI 1BC7C 4GFQA 1FZPB 2Y0SD 4HG2A 1IN6A 4HEA2 5CVVA 2FMYA 4A93K 3ZMSA 2Y0MA 4HQEA 2Y30A 5FJ8K 3E6MA 2JA7J 2VE9A 4BEHB 3FXLA 3S14J 1VTNC 1GXQA 1DCPA 3KZZA 3ADAC 4PDKA 2F48A 3HHGA 3S15K 1G3SA 3I9V2 2XRNA 3K7AJ 1WORA 3OYAA 4L5IA 3A0BC 2EZHA 2F6CA 3TOAA 2KIUA 3CCYA 4MEYA 2WB1D 1WCMJ 3MKLA 5AONA 5K5QA 2FJ1A 4IXAA 3GXOA 2DK8A 1HXDA 4HZFA 2ESNA 1K6YA 1V5FA 2ACJA 2CJJA 5H20A 4BJTA 4G94A 1MDMA 5HDGA 3TDZC 5FKOA 2BXZA 2R3SA 2FNPA 1RR7A 3ZQFA 3S1MK 3IUOA 1JI8A 3SZTA 4FT8A 3X2QH 2IJLA 3QOEA 1LVAA 2M34A 3EETA 2EFOA 3REOA 5M5YK 3GFMA 2K9MA 4RB0A 2VE8A 2CRGA 3P9KA 4B3AA 4G6TB 2JA6J 1ZG5A 2DJNA 4HQMA 2JK3A 3CCMI 2E1MB 4MGRA 3BZKA 2HDDA 1NG7A 3MEXA 4ZYEA 3K4LA 2LY2A 3W2AA 3GSIA 3E1SA 5E1ZB 1O7FA 1BJAA 3KEOA 4MHGA 3ABMH 2IPQX 5CQEA 4BEHA 4DJAA 1MMDA 3DPUA 4ZJZA 1I3QK 4YIIA 3CF5F 5HDNA 5M3MJ 1TL8A 1SEUA 3HBLA 2GIVA 3E7LA 4XQFA 4KMUA 1ZTRA 2JA6C 5GPAA 5HS8A 4XRMA 2R7ZA 2VPRA 2BY2A 3WU2C 1B6AA 1O3RA 5LFAA 1RR8C 3FKIC 4N9HA 4BXFA 1WJFA 2LG4A 5GAGJ 1WSUA 3ZMDA 4BHPA 1QU3A 4KMHA 1QVUA 2CUZA 1DU0A 1B9NA 2KJCA 4BU2A 5JI6A 4L5JA 5CVRA 3VYRB 3GTGK 2WBMA 1RIOH 3KZYA 2XCOA 1MSEC 3CP2A 2IP2A 2P7CB 3VWBA 4P9UA 4Y3OA 3L1PA 2KZGA 1RU0A 2DA4A 2L9VA 3KETA 4KDDA 1ERDA 5J1UA 2VUMK 1F7VA 3I3LA 4ZZDA 2OBPA 4PJNA 4C2MC 3S16K 2FNAA 3FWEA 3GTMA 4NQWB 3K1MA 3HRSA 4CZZA 1A04A 5DUKA 3IAM2 4ILDA 5EGEA 3K4CA 4PJLA 5K7HA 4CCOA 2DYSH 3QPHA 5ILVA 1BA5A 1LNWA 1ORKA 1STZA 1ZYRF 4K2EA 5FKLA 3RKYA 3Q5FA 2HZTA 4MEXF 1EK8A 4P9SA 3HUGB 1S72I 1O29A 3BP8C 2KIQA 3ZGKA 1YOVB 3GFIA 3T0YA 1RESA 5C3EK 1VFCA 2VB6A 4FX4A 3RPUD 4HYEA 2CG4A 2DMTA 2XF7A 1USSA 2Y0SA 1ZARA 4HPQA 1BGWA 4A3JJ 3CCSI 1OCTC 4HF1A 1IW7A 3OYMA 4A3CJ 3CAGA 3GMEA 3H9JA 5JR3A 1WIHA 3D1NI 1BI2A 1FYMA 1Z1DA 1ZLJA 4D0PA 3C1DA 3R0JA 2XASA 1PDNC 1X31C 1R7JA 3K9TA 2P5KA 4B09A 4DW6A 5DM7F 1XXBA 2O9LA 3EUHA 2PFBA 3CTAA 3DKWA 4KJZA 1DPRA 3HOYC 1P4WA 3DKYA 1FBQA 1X1CA 1LDKB 1E2XA 1WVRA 1GUUA 2PJPA 3P5JA 3UNGC 5HNFA 1BJTA 3HOXC 1KU3A 3IP4B 5IYCJ 1IUYA 2COMA 2YPRA 1A31A 3V8JA 1V5GA 1RI7A 4IQ4A 1JT0A 1IRZA 4GXOA 1Z67A 5TGTA 2PA8D 2K9NA 1DDNA 1VQ9I 1D0XA 2L9SA 3JRIA 2AS5F 2AQEA 1W1WE 3GEEA 2JUCA 3OS2A 4GFBA 2YU9K 1TWHC 2CU7A 3CCUI 3CCVI 2R7ZK 1SFOJ 1TWGA 2MG4A 3HGGA 2KKOA 2YX7A 1EFWA 2GWRA 1JVIA 3QU3A 5J40A 3TKYA 3I54A 1ZREA 3U9GA 4UVAA 4EM1A 4HF2A 4BBRK 3ZN1A 5BS6A 3JRAA 2W7NA 2YU9C 4R1HA 3AD9C 4D7MA 3L4JA 4O5VA 2MD5A 2BW3B 2OF7A 2W48A 4EJTA 2O0YA 1BS2A 2IA1A 1TQIA 4LMYA 1LFBA 4AYBL 4I09A 4M3FA 1XXAA 2V4JC 3D5RC 2ELJA 3L00A 4LOCA 2CFOA 2VQLA 2IGKA 2XPWA 5E20A 1I3AA 4JYKA 5ICEA 5JLWA 1NH3A 5C4XJ 5C3EC 3FZVA 5LRRA 3CC4I 1W36C 2CS3A 2GSNA 2FOWA 3OYEA 3DP7A 3A1YA 2Y75A 1TQMA 2JPCA 4PGGA 1T98A 2DQRA 4HNUA 5D6FA 2ZB9A 3HPGA 4DNCA 2HYFA 2D1HA 4A69C 3AD7C 3SDGA 5C3EJ 1S7EA 3AAFA 2R0QC 1Z21A 4D7NA 3ABUA 3OYFA 2JA5C 4B44A 5IYBC 3QP5A 3CDLA 5EF6A 2JZYA 1OCPA 2V9PA 2NVYJ 4F91B 2LR8A 4KMFA 4ZYGA 1XZPB 1F9NA 5JVGF 3CMYA 2A05A 4XSXA 3CUQC 3WU0A 5D4RA 2K3FA 1R9TC 1IG7A 2X48A 4CYDA 3SEQA 1X4OA 1RKWA 5C44J 2VODA 3GTKA 3LAPA 4ZH4F 3ZOBA 4E7JA 1KQ8A 3PJRA 2ZXWH 5J47A 4HAMA 1PUFB 3JSOA 2HOTA 2R4GA 1MBEA 4JX4A 3S3MA 3GTLJ 5EGHA 1X2NA 2WB1A 2E36A 4A3KC 2R7UA 1TWFJ 5B1AH 3RSNA 3H0GC 2VJIA 3SEZA 5F08A 3JRDA 1QBJA 1JGSA 1V54H 3KE2A 5E8GA 1LEBA 1YW8A 3QAHA 2RGVA 3V7RA 3DBRB 3BG5A 4AH6A 2W1OA 3HYIA 3GW2A 4KN7X 1R58A 1ZAOA 4JQFA 1XZQB 1Y1WA 3WTTC 3ZQGA 2XROA 3GZNB 4IPAA 3FK6A 1TWGJ 2ZKZA 2E5ZA 1HA8A 4RB1A 4IVNA 1ONVA 3GTLC 4XRFA 3JTGA 4X0GA 3FKJA 2MFZA 1XSXA 2KPMA 2R93A 4GRIA 1TWCC 5DCMB 4IHVA 1TT0A 2W24A 5JHFA 1WJ5A 4AM3A 1DP3A 3BP8A 1VQOI 1WCMA 1ZXOA 2L9RA 3GFLA 1I6HK 2CQKA 4A6EA 3FHZA 1GT0C 2E7XA 4B3XA 1W0TA 3G71I 1HKSA 1PJ5A 1EV7A 4I99C 5C4XC 4C3JJ 1MBGA 3S93A 4BE2A 1MKMA 2A5YB 2GAUA 2H1LA 2Y31A 1YJ9I 1UZCA 2XF5A 3Q9SA 5EEGA 4S0HB 4ESJA 1WHUA 1FJLA 3IKVA 5E68A 3DFGA 4WXCA 4CSWA 1MGTA 2KRCA 3J7YJ 3LQQA 3H3VL 3NARA 4Y33A 1A35A 2KQRA 2MC3A 3K2ZA 2W00A 4LJZA 4A3LK 1UJ8A 5IOYA 1HBXG 3OV8A 3PM1A 2VBYA 1S29A 3OYNA 3NUHA 5GTHC 1J09A 2XAGA 1JXSA 2FX0A 2ZBKA 3VSKA 3ESWB 3LL7A 4G12A 1DPUA 2CH0A 2V1XA 3I53A 3WODF 4JOMA 3FOEA 1AB4A 2YUSA 3G4AA 2BOLA 1RUNA 1XSVA 2EQRA 3S1QC 4A3CC 2YS9A 4G7HA 1P92A 4BY7K 3BQYA 1X4PA 2ID3A 1JT6A 1IZ1A 2F5DA 3FXOA 3TMOA 5C4JK 4XRSA 2K85A 1I50K 1Z3YA 3DBLB 5HLIA 3BLYA 5C44C 2QSFX 4C3JK 1OPCA 3GTPC 1SD5A 4Q4ZA 2IAIA 1D5VA 2XGXA 1Y0NA 3WE2A 4S04A 4ZC3A 1JOEA 2IBDA 2W85A 3IWZA 2BBYA 2Z1DA 3QYBA 4LFUA 3ZMZA 3CCLI 1NK2P 4KMAA 2ID6A 2R92A 4MQ9F 1JKPC 3K70C 2HOSA 3I71A 5FO5A 5LGTA 4BYYA 1BM9A 2X1DA 3ZQLA 1SD4A 2LF8A 1MBKA 2EJRA 1IN7A 2EINH 2LNBA 3EUKL 2UWMA 1K78B 2JA7K 4L9TA 2DAOA 3HRUA 1QGPA 4CZCA 2NNNA 2NVXA 3HOWC 4W97A 4G7ZF 1ETXA 2FE3A 5DUIA 2PLYA 5LD2C 4V2FA 1IE0A 4A3JK 3WG7H 1MH3A 5L3FA 1MD0A 3DTKA 4MTDA 2STWA 4LIUA 3N4MA 2VIXA 4EGYA 1MBHA 1IL2A 2OPTA 3H36A 5J1RA 4G6QA 3EQLA 1YG2A 2M87A 3EYYA 2L5QA 2BHZA 2LBFA 3F3XA 1BR1A 4M6YA 3GTOJ 3IKTA 4KFCA 2OQGA 4Y7NJ 1Z9CA 2LP0A 3QODA 4IHYA 4YIRX 2ETHA 2UUZA 4J00A 5D6EA 5BPDA 3FIWA 5LEJA 2IA2A 1VQ4I 1K83K 4C2MK 1Y6IA 2L0KA 3ZMUA 1VH2A 3S2DJ 3J80Z 2DFEA 3BP3A 5F0CA 5J4VA 1YI2I 1TWAC 4BY7J 4L0ZB 1YS7A 2E2HA 3K4BA 4KUMA 2B7EA 1EH6A 4A3MC 4P9FA 5GPCA 1UCRA 1VQ5I 4R79A 1U5TB 2FQTA 3BR3A 4BAYA 2UXNA 2M8EA 1EH7A 1XSDA 2KDOA 3FISA 1BN5A 4ZTFA 2E60A 3SFIA 1F5TA 1O3SA 4GTEA 4KIGA 4XOPA 1AHDP 4BDYA 1IXSB 5BPIA 1JTYA 3G6EI 2NVUB 1Z0XA 4U7BA 1W36D 4O2DA 2H6CA 1IF1A 2NVYC 4Y7NK 2QYOA 2BY0A 2GA1A 3NWSA 3H1CA 1W0UA 1J5YA 1YQAA 3QOPA 3M9AA 1JE8A 3MN2A 2WTEA 4XL9A 2J5OA 1XXCA 3EUHC 1BC8C 1T8IA 3BZ6A 4EVIA 4I0BA 4I98B 2NYXA 4EQQA 2HXIA 1I6HC 4XSXF 3BTCA 3H0GA 3M4OJ 2DFFA 3S14C 2ELHA 2UZKA 2PI0A 4E7LA 1DCOA 3ONQA 2BXYA 1WZ2A 3HXAA 3JCUC 2QQBA 3ZQIA 4CCKA 1X3ZB 2JUGA 4N4OB 1WOSA 5HL8A 4BBRC 2E2IC 2P5VA 4M3GA 3KZIC 3HOZK 4ENNA 1P9QC 1P4XA 2F4OB 4CUGA 3JAMZ 3RZOC 1K7AA 4PSWA 4PCQA 1T38A 3O2PE 1CGPA 3BR0A 5D4DA 4LITA 4I2OA 1I50A 4QPOA 2CFXA 1CF7B 1HOMA 3BC8A 5M3MK 2TCTA 2JA8K 2RC4A 5E79C 2I5UA 3I56I 1B8IB 4DBQA 2RAEA 1O26A 3HSRA 2JMWA 3CO7C 4A3EK 4A3DC 4A3BK 3AG1H 1K83J 2CUFA 1MMSA 2ZMEC 5IP7J 2NVQJ 1HSJA 3WHBA 2B9SA 1W5SA 3C2HA 1PUFA 2OD5A 5ILUA 2O5JA 5KHDA 3IH3A 2LVSA 5K7ZA 1IAWA 3MKZA 3MZYA 2DOEA 5KAFC 1AA7A 5EZGA 1HDDC 3WTSC 4EJUA 2EV5A 4RGXA 1F36A 2CUJA 1RZ4A 3LAJA 1S7OA 2O03A 3PSFA 3HOXK 1ETWA 5D5XB 2CO5A 4AVZA 3GTLA 2DT5A 2Q2EA 3BTIA 2UXXA 4NC7A 5IYBJ 1I3QC 1SFOA 2CV1A 2PG4A 2XKPA 5DDGA 1GDTA 4FETA 1TNSA 3GTKJ 2W57A 1I6VA 2E2HJ 2RREA 1JHFA 2K7LA 3RZOK 1D1AA 3BJAA 2M1BA 1ODDA 1HLVA 3H0DA 4AWXB 5M5YJ 3VOEA 1VQKI 2DFIA 2VBZA 2QKMB 4OIRA 2DA7A 1IN5A 4B47A 3R0AA 3HTUA 4XMYA 1ZK8A 3BT9A 2X1EA 3OS1A 1N77A 4E70A 3UKGA 3CLQA 3F8MA 1T2KA 2IRFG 2V9VA 1FEXA 4YG2A 2HNHA 1XC5A 3H92A 2Z16A 2RV8A 3HTSB 1D8JA 4CCJA 4N0BA 5D5VB 4MQVA 1XMXA 2DA5A 3K6GA 1Z91A 4B43A 3GLLA 1H88C 1NK3P 5F1JA 1ZR2A 1E3HA 3HUGA 3GTJK 5A2QK 2MSYA 3FXJA 4CYCA 3S1NJ 1ETKA 1KGSA 3OMYA 2HVQA 3MMLB 2OZUA 2XUBA 1XG1A 1X2MA 1LEAA 2BVLA 2F5VA 3OWTA 1LPQA 3K7AK 3H3VD 1R5ID 1ZLKA 2EIMH 3S2HK 4UUSB 2PMHA 4Q4ZF 3E5XA 4IEJA 1MJBA 5LRSA 4XLNA 2MW8A 1O28A 1UELB 1AWCA 1FT9A 1Z6RA 1W5TA 2WAQA 3S1NC 3L2QA 1IS1A 3P9IA 2Y3PA 4MQ9A 1ON1A 2EPFA 2Z5UA 2WAQL 3KP4A 3E5QA 1SD7A 5CLSA 2HYJA 3ISPA 2WA0A 2JA2A 3K4JA 1RNLA 3NRVA 4Z2YA 4AVPA 1P4AA 4EJOA 3WU1B 4IJAA 3N0CA 4E4HA 1QPMA 4DZJA 1YX5A 3I0TA 1ON2A 4G7ZA 1OR7C 4M9ZA 3GTOK 1ENHA 2A61A 2MC4A 4U88A 5CVUA 3E6DA 4A0ZA 3KFWX 4LGWA 3OPFA 1R4MB 2L7ZA 1R00A 5K1YA 4KMUX 2M2EA 3ZQQA 1IXRC 1B72A 2DXIA 1LFPA 4UHTA 1YRNB 4RLQA 4NHJA 1T56A 3QYFA 2D2WA 2X6OA 3OYJA 2CWEA 3HOXJ 3TTGA 1R1TA 2COBA 3I59A 2KRFA 3CJTB 3W2WA 1E0EA 1S6LA 1SAUA 3PO2C 3PO3C 1T6SA 4XRSG 2STTA 2FOKA 3EDPA 1T39A 2RQPA 5LHGA 3CQZK 3LA7A 1F43A 3HL2A 2IGOA 4IOCF 2K27A 1ZYRA 1EJ9A 2MBFA 4XOTA 2DT6A 4OIOF 4MEXA 4HRIA 3S14K 1ZQ1C 5LHIA 1MSFC 3DTIA 1HW1A 2HR3A 4A3BJ 3ZXSA 3HKZN 1FIPA 1LUJB 2XAFA 2Z99A 2IT0A 5IP9C 1VJEA 2NNYA 4XLCA 1J75A 4XKBA 3T8RA 2IGMA 2XAUA 3KP7A 2YU3A 1LJ9A 3VB2A 2R93K 1TWHK 3B6CA 4PFPA 1OYYA 4D1QA 5KVRA 4BJ5C 2V26A 3FKIA 2M45A 2VI6A 2X85A 2BHYA 3DU5A 3HZJA 3GBGA 2DPUA 3I4NK 1FP2A 2AQFA 3S1QK 4A2UA 4M9SA 4QSHA 2DA2A 2LDUA 2MLKA 3ML6A 3AD8C 4A3BC 3GWZA 1J6WA 2DA1A 4JBAA 4CDGA 1WCMC 2PMZD 3S1NK 2H6BA 4W1UA 4NUBA 2CV2A 2DT7B 4FQGA 1L0OC 5B1BH 4C2TA 2ECBA 3ZQ7A 2R92C 1LDDA 2RH6A 2XKOA 2JJ7A 3ZQCA 3KLNA 2DLLA 1GVDA 3CF2A 2KIMA 1MIJA 3F6VA 5ICGA 2E2IJ 2H09A 5DTDA 2LF7A 3FX3A 4E7ZA 2DDBA 3KEYA 4M72A 5CQGA 5D8KB 1YW9A 3W6KB 3J81Z 2EV0A 3Q0WA 1TWCA 3FDYA 3AG4H 5E18F 1TWAJ 1WSVA 3HSFA 4M3BA 2H27A 2XIGA 2YR2A 5FKMA 1OR7A 3DLLF 4L18B 3CCEI 3W2VA 4RGRA 2YX4A 4M74A 1P7JA 5CVJA 4A3MJ 1EH1A 4KDPA 4A3GJ 5F0HA 4OAYA 2HKXA 4RGSA 3HXLA 1XB4A 2K02A 2QBYB 2XGDA 4PFOA 3N0BA 1MNEA 2GIZA 1R1UA 2R7DA 1DGRM 2P81A 3ZR8X 3S16C 3CMEI 4CXFA 3I58A 2A69F 5EGOB 2HTSA 3GTMK 2E34A 5HDKA 1QZZA 1U6GA 3OIQA 3S2WA 1FTZA 5K5RA 1Y1VJ 3G1OA 1RPWA 3EPZA 5CPRB 1V5VA 1IRXA 4J19A 1EQRA 4Y52K 2JA5A 3TO9A 1YRNA 5KAIC 5L3CA 5IYDC 1JJ6C 5M5WJ 2HOAA 2VKDA 2A3SA 1RETA 2GQQA 4X1EA 3ROUA 1VGXA 3K7AC 2ZNYA 3A2KA 2VUMA 2XPVA 3RKQA 2AO9A 4Z6YA 2F2EA 5BMZA 3N3YA 3W6JB 1U2WA 4OIRF 2QQ8A 2A68F 3ABLH 3HOUJ 1YTYA 1H9TA 1M1EB 5E1XA 2BE5A 1JGGA 2VPLA 1YFHA 2DMNA 4RLFA 3DF8A 3F6OA 4YG2F 4BE0A 1FLIA 1KA8A 2JWTA 3TFIA 1JHHA 1A5JA 5E3OA 1C0WA 3I4MJ 3IH4A 1V3FA 5FGMA 2GOXB 4A6DA 5L3BA 4FE4A 2BYVE 2QLZA 2QVOA 3LNQA 2KDZA 2IS4A 5TMFA 1QNTA 3CDIA 3ECOA 1XX5A 4QTRA 1BW6A 3J7ZI 3SXYA 3CC7I 5M5WK 1VQ6I 4DOZA 2PHCB 3V4GA 2MLGA 3J80K 4ENKA 2HDWA 4UY8I 2LK2A 1E3OC 3C7JA 1USTA 4YFKF 4A5MA 2ESHA 3CO6C 2KISA 4XLNF 4KICA 3HOUK 1EH8A 3DXJF 4F7ZA 2WAFA 2ZSIB 2R5YB 4PAAA 5GAHJ 4RDUA 3WTZA 2LMDA 3IRRA 4V19K 4KASA 4ZDPA 4I76A 5M5XK 1D0ZA 4U87A 5KK1A 2K9QA 2IGNA 2NVYK 2QF7A 3I4MK 1Z3XA 4A3IK 3WTYC 2ZMEA 3ERED 1U0JA 3A01B 4KAWX 3RPUA 4KB2A 1HKTA 4PK4A 2GBYA 3A01A 2DN0A 1R22A 5B3SH 1Y1VK 3K1NA 3S1RK 2DOFA 1WJCA 3LSMA 4A0YA 2HEOA 3DKXA 2HKOA 4Y52C 4H0EA 2WAQD 1ZGAA 3A8JA 4ZYAA 3PSIA 3QX3A 1TZLA 4EJWA 2RNGA 3MZHA 2DA6A 1D5YA 3BR6A 3QU6A 3VSLA 4GGGA 2IS1A 1FMVA 4A3FC 3F8FA 3P9CA 1TLHB 3FOFA 2EB7A 4UUVA 4Y52J 4Q47A 1FBUA 3S8PA 3HC7A 5DD8A 3JAMK 4CCLA 3OREA 2PA8L 3RZDJ 2K9SA 5CVIA 3IV5A 3VPRA 3L2UA 2DTZA 5D5WB 3MQ0A 2QKLB 1HC8A 3WG9A 3H0GJ 3WGIA 3RCOA 1UHSA 1YIOA 3GZ6A 2HXOA 2LYCA 3SQNA 4AIKA 3HOZJ 4G7OF 1O2BA 5F1RA 3LQRA 5F04A 4IHSA 2QQAA 2HPIA 3CUQB 3AQPA 2OZ6A 2XC7A 4C2UA 2NOJB 4UV9A 3OYIA 3CCRI 1Y1WJ 2G7HA 3JRCA 1ZGWA 3MZ8A 4BY1K 2JA5K 4ANJA 2LY1A 4NQWA 4N9IA 4A3KK 2EV6A 4R8HA 2E19A 3KCCA 3PO2K 2ZMEB 2CV0A 4UXNA 1B72B 3HB9A 4GTFA 1I1SA 3DLAA 3H3ZA 2P4WA 3JW4A 5IP6A 2JH3A 2K5CA 2RNJA 2W84A 1G4DA 2FSWA 3PQKA 1L0WA 2WAEA 4B1RA 3BTLA 4KITB 1KU7A 5KCMA 1B59A 1LKXA 4ZZLA 4MTEA 5L3GA 1NTCA 1D1CA 1G8XA 2PJRA 1WH5A 3M1EA 1Y1WC 5M3FK 5E3LA 2O8KA 1U9OA 2ZO4A 2ZJ2A 3KYCB 4XN0A 2CQ7A 2HPMA 3GTPK 2H94A 4GCVA 1VQ8I 1BI3A 3VYSB 2R7ZJ 4RMFA 1F7UA 3S3OA 2B63A 1APLC 1SFOC 4DQ2A 2QBYA 1D1BA 4E6KG 2BZTA 4AYBA 5H2FC 3HEFA 1FIAA 4M71A 2X0LA 3W3CA 3GFJA 3VYUB 1A6IA 2M8GX 5LGNA 4PJ0C 5D8LB 1E3PA 2R7ZC 1JKQC 1Z6TA 2O8XA 2JA6A 2XVCA 4GTDA 2Q1ZB 4M3EA 1VF9A 4CGZA 1SFOK 2WWYA 1YNNA 3KYLA 1WJDA 2VLAA 1SFXA 4B8XA 1BR4A 4DZPA 4C3HC 4UB6C 4LG3A 3OYKA 3PNYA 1ETYA 5IY5H 3Q3SA 3BZCA 3WTVC 2JA8J 4G0WA 3S17K 1U5TC 3C2BA 4XNFA 3O8HA 2EBBA 1E17A 3GX4X 3LFKA 2E7WA 4D9JA 3IWFA 2R7SA 3KYDB 5H6RA 1TT5B 2K4BA 3LSKA 1J0RA 1G6NA 3BCBA 3PL8A 1F93A 4M73A 2A6HA 1GHCA 2EFPA 4HX4A 4RB2C 5FLMK 3HOYK 3S2DC 2LREA 3OY9A 3GTOC 2R7VA 2X51A 1VLOA 5F64A 3HOVK 2M4KA 4C3HJ 4RB3C 2V6CA 1SVLA 4YIFA 3VA7A 3VDXA 2A5WA 3BG6A 3DU6A 2ZFWA 2O6GE 5F0FA 4NNJA 4XLPA 1XZQA 5C4JC 1WSRA 3GTJA 1GXPA 3CESA 1XDSA 4KM8A 1VI0A 1HQCA 1UAAA 2VXDA 1GV5A 1IUFA 4NBQA 4A5NA 2BE5F 3QPLA 3Q0VA 2BEOA 3MVPA 3SJMA 2ZUEA 3S2HJ 3TL4X 2FF4A 3A4CA 1OISA 3HRTA 3M3YJ 5C4JJ 4OMZA 2CGPA 4CHUA 4CYCB 3P7NA 5DV5A 1J6XA 1HKQA 3AG2H 1S9HA 4LOWA 2EA2A 1YIJI 1N78A 1KONA 2LOOA 2D45A 3CUOA 2RDPA 2EZKA 4BQQA 1FOXA 3DEWA 3V42A 2ZJQF 5M5XJ 3GTKC 4IHWA 4BXXC 3CD6I 3NQOA 1DQUA 4XM3A 3BG9A 1W7PB 3OS0A 4A3CK 5C4XK 1D8KA 1I39A 2DQLA 2XGCA 4O3MA 4WJ4A 2FXAA 1ETQA 4HLYA 3T02A 1R9TK 4YFKA 1Q1VA 3QP6A 4BQOA 3H3UA 3H9QA 3S16J 4OWRB 4BKXA 3F22A 1X1PA 5IP9K 1PP7U 3DXJA 5E3MA 4KYWA 1SC7A 2ADUA 2WB1N 1YCLA 1UMQA 4P55A 3TOBA 3J7AY 4OIQF 5BQTA 3GTGJ 3KP3A 3DPTA 2AXLA 2LFBA 4FM9A 3LSGA 3C3WA 4OU0A 3KPHA 2L2OA 3E6BA 3HOZC 3LSHA 3RZOJ 2ME0A 4GTLA 2EWNA 2B63C 1QHHD 4EMSA 2JPBA 2ME6A 5JFRA 4QJVA 1TBXA 1GV2A 2OC6A 4A3IJ 2CW7A 5FLVA 4XN3A 1REPC 1H8AC 4L9NA 2J5PA 2VQHA 4A3KJ 4RAYA 1VQPI 4FZBA 1RUOA 3RPQA 4EGZA 2KZVA 3HRMA 2E2JJ 2LLKA 4E7IA 1HF0A 2FU4A 1WKMA 5IP7C 2DMUA 2F4IA 2NVQC 2OU2A 1R36A 5FD5A 1YLFA 4LG0A 2NXNB 1IO2A 5HNHA 4YRVA 2CMPA 4HDUA 1RRJA 2Y9YA 3BG7A 4S05A 2NVXC 3KEQA 1SFUA 2VASA 3M1CA 1H9GA 3L2VA 3GDZA 2XF6A 2ZSHB 4YFXF 1TWCK 3JRHA 1O3QA 1L3LA 1UB9A 1I6HJ 2XSDC 4IHXA 3JTHA 1MBJA 2E2JC 4EJVA 4A3EJ 1T0FA 3I59B 4WX9A 1ZGJA 2R92K 4GZYA 1BIBA 1KQ4A 4UV8A 1BL0A 1XZPA 2KL4A 3WGHA 3IHUA 2V6UA 5JHUA 1B9MA 3EYIA 1WJEA 3H9GA 2NVXJ 2D6FC 4G7OA 1ZR4A 1Q1HA 4WXHA 1TWAK 5HOOA 3OEPA 5CYVA 3S2HC 2V1NA 5DEQA 4II3A 2PMUA 3S17J 4KM9A 4LK0A 3M3YC 3FM3A 1I27A 1H89C 1FSHA 1K4TA 3VFZA 1S5LC 3TP0A 2TRTA 3ABKH 3JSTA 4C45A 4A3GK 3GTPJ 3RIRA 1V55H 1T95A 3IH2A 5ERIA 3GTQA 1JKRC 3PO2J 1TWHJ 3JREA 3JRGA 2HZDA 1AU7A 1EF4A 1BIAA 1ZG1A 3OSGA 4G9YA 1K6OA 1EA3A 2JA8C 2OTLI 4HV5A 2L4AA 1AKHB 2HS5A 1MJ9A 4DIQA 1WJBA 4F3QA 3S17C 4D5FA 3F21A 4U0VA 3OIPA 4QIWL 2MH9A 2B63K 2IW5A 1Z7UA 3NAUA 4BGDA 3OYGA 3SYTA 4LB6B 1A6QA 1U5TA 3BY6A 1XPPA 2JVGA 3GEHA 1P7IA 4DYRA 3IC7A 2MYSA 3TW6A 3Q9VA 2VKEA 2ICWG 2XHKA 1IDYA 5HLGA 2GXBA 5IOZA 3SZGA 3RZDC 2R7XA 3I4PA 2P8TA 2XAHA 1OYIA 1MMGA 2OA4A 4BLAA 3GTPA 3OYLA 1SMYF 4P5OA 1IGNA 1G3YA 4E7KA 4UUSA 4MLOA 2R7WA 1KYZA 2E2IA 3TO6A 3A8KA 4ZYHA 1UHMA 2QZ8A 2X4HA 3O8GA 2NAZA 1HW5A 4P5BA 1VZ0A 3LPXA 2DO7A 2R92J 4FHTA 5TRDA 3L7WA 4QLCU 3KLOA 4OIOA 3PFYA 1K79A 1I3QA 2EZLA 2BV6A 1DD5A 2E1NA 4DGWB 3HHHA 4P1WA 4Y13A 4BBSK 4G8XA 2ISZA 4QWQA 2OV7A 1UHWA 5IPAA 2F5FA 4XORA 3M8JA 1GVJA 1X1BA 3PIPF 4GDFA 2OJED 5ICFA 1OCZH 4BBRJ 5L3EA 3NEUA 3IL2A 3OOPA 2EFWA 1B4BA 1O4XA 4MO7A 1MNDA 2A6HF 3IAS2 4XSZF 5J6XA 3S1RC 1MMNA 4QJVB 5LEKA 5IT9Z 2PBIA 3VODA 1B4AA 2P0WA 5JVOA 3IPJA 4BHBA 3HOSA 3IRQA 3E6CC 1O27A 5CHPA 3GTGA 2E2IK 4FE7A 3OIOA 1WOOA 3F9KA 2ZCWA 1BBYA 5J8CA 4XLPF 1W7PD 4BY1C 2VONA 1TWFC 3SZPA 2KWAA 1Z77A 3ULQB 1YYVA 2X9DA 4NC8A 2X6YA 5LGUA 4II2A 4ENJA 2B63J 3GZ5A 4KISA 1UFMA 2EA4A 3LSTA 4XKVA 1YJNI 1W7PA 2BVMA 1OQYA 4KB4A 2FRHA 2CFAA 3E3VA 5FJ8J 3GEZA 5EJCA 4ZDOA 3N05A 4CCMA 1Z05A 4BXXJ 1VNDA 3JR9A 3T1BA 3TGNA 3PO3K 2I10A 3DBHB 4HBLA 3L2WA 4BH9A 1XD7A 1Y8RB 4I7HA 3KP6A 4DYQA 2QWWA 1IJWC 2F5EA 4WILA 2XGEA 3GTQK 1P2FA 2L9NA 3LSPA 1R6RA 2PMZL 4M6XA 2QENA 9ANTA 2VQGA 3U1KA 5FROA 2EBIA 3DPLC 2HOEA 4KT6A 3H0GK 4BNCA 1CQTA 3ZP5A 4OIQA 4AIHA 3CQZJ 1JQWA 2YU9A 3HGYA 4BJ6C 4AUXA 1Y0UA 1LE8A 4C3IJ 4J3NA 4LLLA 2XDVA 4HSRA 2CQNA 4KN7A 4HNTA 1R5GA 1TP4A 1WGXA 2M3AA 1HDPA 4WXDA 4E7HA 1Y1WK 3FXRA 5D5UB 4MFEA 4IQJA 2V1UA 3E97A 1DUXC 2ZUFA 2FQ4A 3W6VA 1QQIA 4OAZA 1IQ0A 2V6SA 1IXCA 3RYPA 1BOAA 4IHTA 2VXZA 2K3PA 5L46A 3SZYA 2M0CA 3B6AA 3CQZC 3A0HC 5HS9A 1X3UA 1SVMA 1WI3A 2QEXI 4JP0A 4YFXA 3FXUA 1N25A 3F0CA 1XGMA 2A68A 4KC6A 3WGGA 2E2HK 3HOVC 2DBBA 5DYMA 2YSRA 2ZXIA 3OSFA 2MA3A 2RGRA 2JA6K 4ZTJA 2PN6A 5IOSA 1MW7A 2JSPA 2HDCA 4X6AC 1P6RA 2FBIA 3AG3H 1LFUP 1JJ8C 5EGOA 1V5EA 1JUMA 1YS6A 4CO8A 1YO5C 2Y0SN 1I3QJ 3FKIJ 2WAQN 4BQAA 3CZ6A 1TQPA 1OCCH 3PUFA 3H3VK 5M3FJ 4A3FJ 3SHFA 3ECHA 3DCFA 5HODA 1XPXA 5CKTA 1U8RA 4ABZA 3DV8A 4LK0F 2R5ZA 2A6EA 5CJ9A 5B66C 3OYBA 3BDDA 1J7KA 3RI4A 3RYRA 2FQOA 1K78A 3GTJJ 1YHQI 2XB0X 4EEFG 2HVSA 3KX2A 3K10A 3GIRA 4MFDA 2HWVA 3FMSA 3BJOA 4A3MK 2FUG2 4QIWN 1J9IA 1YW7A 3MCZA 4A93C 2JA7A 1ZG3A 4IL6C 4HDVA 1Y1VC 1KU2A 3OYDA 4M3DA 1KU9A 4KIBA 2FBKA 2BW3A 4C2MJ 2GAHC 3T8TA 2QUFA 2PJRB 2V6EA 3GTJC 2DODA 1ETVA 2X6WA 3DQVC 1BJZA 4NB5A 2L7MP 4ZYDA 4C30A 2VQCA 4GTAA 4UNOA 1U3EM 2WY7Q 2FD5A 4CH7A 4RM3A 5FLMC 1QA6A 3HG9A 2OCEA 3S3NA 3R61A 2V79A 1XCBA 1X1DA 2V1DA 2BY1A 5EG0A 1MNMC 4LG0B 4BL0B 3V7SA 3VYTB 4F55A 1SMYA 3M8FA 4XIDA 3FK7A 4KN4X 5FLMJ 1MMAA 1W4MA 1TTYA 2Z3YA 5IT3A 4F52A 4RGUA 2VOPA 2JA7C 1FOKA 1ETOA 5FLXK 1NHAA 2O5RA 3GTQJ 1PJ7A 4QIWD 1R71A 2R93J 1HCRA 2LKSA 4PUSA 3CC2I 3M4OK 3LSRA 2Y0SL 5IYCC 2ZFZA 3F8CA 4PJJA 4FCYA 4LB5A 2IS2A 1Y8QB 3I64A 4AD9A 4GT9A 2NVTK 4KMDA 2DJIA 2N8GA 4GTCA 2DOAA 3BOQA 4BQNA 4ESFA 1ZQ3P 1USOA 4LIVA 2Y9ZA 2A69A 3TO7A 3MWMA 4KARA 4XK4A 1XGNA 4Y4RA 2Y48A 1I50C 4Q48A 3ELKA 1J2XA 4YEJA 3G1LA 1INNA 3DWLE 1SVOA 2Q0OA 2KFDA 2VJ4A 2HTJA 3A02A 1RKTA 2ELKA 2O5IA 3GLXA 4BLBA 2JTVA 2X6XA 2K86A 5LLQA 1IV6A 4OMYA 3SFZA 1WCMK 4BHCA 3ZMTA 2KT0A 2NS8A 1YE9A 2DMPA 2AXTC 4DYCA 4LLNA 4PGHA 3HKZD 4A12A 2MABA 5IP9J 4WCGA 1B8IA 4HSTA 4FTHA 3FMQA 2P7VB 3LOCA 2L4MA 3ZQHA 1J98A 3I4MC 4U0YA 2UV1A 1SAXA 3R4KA 1JUPA 1V4RA 4UVBA 4HX8A 1R9TJ 2DDAA 2EFQA 2JVHA 3CMAI 1J59A 3ZN0A 2E35A 2VKHA 4I01A 1K4SA 1O24A 1QPIA 1R23A 3OYCA 4KIFA 2KP6A 2EH3A 2HQRA 3AKZA 3HIFA 3S2DK 3QRFF 3MKYB 2OUMA 3FXQA 1VRQC 1G2HA 3TW7A 1XN7A 1FBSA 1FX7A 3E0JB 2VUMJ 3HOYJ 2VL8A 2E71A 4X6AJ 2E2HC 4NDLA 3I4NJ 3FM5A 2VJJA 4ASNA 2MD0A 3BCAA 1OKRA 1S7AA 3E5UA 5DCFA 2FA5A 3OOUA 4BY7C 3CDHA 1ZRCA 2CW0A 1R4NB 5DD4A 1GE9A 1DCHA 2I8DA 2LKXA 5EYRA 4ETSA 1OJLA 2R7TA 2M4GA 3RQIA 2CQQA 3RJPA 4ZDLA 4XKWA 3N97A 2M9HA 2DYRH 2RKHA 2ZJRF 1YITI 4GYGA 3K1PA 3WE3A 1TWCJ 4I0AA 5LHHA 3F8NA 1ITYA 4Y15A 3BPVA 4LLGA 5IYDJ 4IX7A
chains in the Genus database with same CATH topology
1HSTA 3FMRA 1U78A 1ZHFA 4O6JA 2L3DA 3HOTA 1MJAA 2EK5A 3L9FA 5L3DA 2R7FA 4UVCA 4GO1A 5FLXZ 3BWGA 1LDJA 3CQZA 1TWHA 2ISYA 3AH5A 3G73A 2JT1A 4JK1X 2XCRB 2GA2A 4GYIA 2DI3A 1WQ2A 3LA3A 1F1ZA 1XMKA 2A6EF 1IN4A 5AIPA 1XMAA 5E1WA 1ZRDA 2D1VA 4WK8F 2DTRA 1O3TA 2W25A 4LR2A 3RDIA 1AOYA 1I5ZA 1S3JA 5FFXA 5IORA 2FQ3A 3CLOA 5JVTA 1MZBA 1OMIA 3D5LA 2GZWA 1B1BA 1I1GA 4XBFA 3GTOA 3T5XA 5IOTA 1O2AA 2O3FA 5ED4A 2BGCA 2G7UA 5ILSA 1BI0A 5D4SA 2O61A 4KATA 1ZN2A 2RN7A 2IA0A 2CFAB 2HYGD 3GF2A 1SMTA 3LWFA 5J8FA 1FSEA 1BI1A 4G0UA 3L4KA 5TJJA 4DDQA 3MFKA 4HW0A 2F5CA 1I6XA 2EFNA 1D3YA 1O25A 4KA4A 5HLHA 4OOIA 3WTWC 2DW4A 3KP5A 5LBQA 2WV0A 3TQNA 3QPTA 3AQOA 1HW2A 1R9TA 1KQ0A 2OQRA 1O57A 1TW2A 3DEUA 4HX7A 4BKWA 3U2RA 2G9WA 3R60A 2VN2A 3RTRA 3WTXC 3BROA 1QZYA 1G3TA 4M9XA 4MNUA 3M8EA 4U0WA 4L9JA 5H6QA 2P5LC 2M30A 2NS0A 3C18A 1ZVUA 3TDUC 4P96A 3J7AO 3RKWA 5K5OA 3JSPA 2DU9A 2PEXA 2DPDA 1O7LA 1XDUA 4WF2A 3O6BB 2M5WA 3BJ6A 3F72A 5JFEA 2CW0F 2FEZA 3G3ZA 2XAJA 4G0VA 3GUDA 1KYWA 1G3WA 3B02A 4IRIA 2XAQA 3V8KA 3ABTA 2P6SA 1PUEE 5DCMA 4Q5SF 1FYKA 4Y17A 2FMLA 4LK1F 5FD6A 4LLGF 2WC2A 4PZJA 1S8NA 2PQ8A 4LQYA 4U7DA 4L0YB 4OIPF 3R6SA 2VOOA 4AIJA 4C3IC 4RAZA 1WQGA 3V7CA 4BXUA 4FX0A 5E17F 1LB2A 1QO0D 3PQJA 4ON0A 5IOQA 2Q8KA 1IRFA 1FWZA 3Q3QA 4I02A 4G6DA 5E8IA 4C3JC 2GSOA 3PFIA 1FY7A 1IRGA 3K69A 3V8LA 2KIFA 1FYLA 1ULYA 4L9VA 2XCQA 1XGSA 4IRGA 2LKPA 4P5AA 3L2CA 4EM2A 1XGOA 4MEYF 4RS8A 1KQ9A 1TNTA 3B73A 2HQNA 4HF0A 2Z9OA 4LJZF 2IVMA 1FPQA 2ZXJA 1H0MA 4TV7A 2GXGA 1FP1D 1XCVA 4GTBA 1WQHA 4EV0A 5IT9K 4G7HF 5TJ3A 1FC3A 2NVYA 3J81K 2FBHA 2VT2A 4HOBA 4ENMA 2JSCA 2MH2A 3FF5A 3KP2A 1R1VA 1Y1VA 5AIQA 3BUEA 2A07F 5HVQC 3F8BA 2P6TA 2P5MA 2L02A 5ICCA 1TWFA 5FB2A 3F23A 1TWAA 1SFEA 1ZBSA 2TDXA 2HFHA 3G4CA 1WI9A 3ZPLA 4OINF 2L01A 3COAC 4IRHA 4LD5A 4HLXA 3U1DA 3EQLF 2VT3A 3HSEA 2RVCA 3S0XA 4EM0B 1R5HA 1WWXA 1PP8F 2GSUA 2JRTA 6PAXA 5BOXA 3GO5A 2KJBA 3WTUC 2HGCA 2CYYA 1ISEA 1F4KA 3RKXA 1SD6A 2Z33A 1FNNA 1TW3A 4M1XA 2L54A 3ZMVA 3LA2A 3M7GA 1IW7F 2VC1A 2XV4S 3K0LA 1WQFA 4WWCA 2ZNZA 3CJNA 3MAJA 3CUQA 2VBWA 1WRJA 3VEPA 2C6YA 2DK5A 4HA8A 1LQ1A 5EEHA 3D0SA 3GVAA 4KT5C 2LSOA 2QM3A 2K4JA 5A2QZ 1ZRFA 1DP7P 4KNYA 4YFNF 1IN8A 2NRAC 2B0LA 2VC0A 3I5UA 3O3KA 4A0XA 4HV6A 3GYHX 2QQ9A 5FFZA 5HS7A 2VBXA 1MDMB 1OYWA 3BPXA 4CICA 2CSOA 4ESBA 1CF7A 2OAZA 3L09A 2E1CA 5F6FA 1ZH5A 4IF4A 1BC7C 4GFQA 1FZPB 5CVVA 1IN6A 2FMYA 3ZMSA 2Y0MA 4HQEA 3E6MA 2VE9A 1VTNC 1GXQA 3KZZA 4PDKA 3HHGA 1G3SA 2XRNA 4L5IA 3TOAA 2KIUA 5AONA 5K5QA 4IXAA 3GXOA 2DK8A 1HXDA 4HZFA 2ESNA 2ACJA 5H20A 4G94A 1MDMA 5HDGA 3TDZC 2R3SA 2FNPA 3SZTA 4FT8A 2IJLA 1LVAA 3EETA 2EFOA 3REOA 3GFMA 4RB0A 2VE8A 3P9KA 1ZG5A 4HQMA 4MGRA 3MEXA 4ZYEA 5E1ZB 1O7FA 1BJAA 3KEOA 4MHGA 2IPQX 4YIIA 5HDNA 2GIVA 5HS8A 2R7ZA 1O3RA 1B6AA 4N9HA 1WSUA 3ZMDA 4BHPA 4KMHA 1B9NA 2KJCA 5JI6A 4L5JA 5CVRA 1RIOH 3KZYA 2XCOA 2P7CB 2IP2A 4P9UA 3KETA 4KDDA 4ZZDA 2OBPA 4C2MC 2FNAA 3FWEA 3GTMA 3K1MA 3HRSA 4CZZA 1A04A 5DUKA 4ILDA 5EGEA 3QPHA 5ILVA 1LNWA 1STZA 1ZYRF 4K2EA 3RKYA 3Q5FA 4MEXF 2HZTA 1EK8A 1O29A 3GFIA 3T0YA 4FX4A 4HYEA 2CG4A 1USSA 1ZARA 1BGWA 4HF1A 3CAGA 5JR3A 1WIHA 1BI2A 1FYMA 1Z1DA 1ZLJA 4D0PA 3C1DA 3R0JA 2XASA 1PDNC 1R7JA 3K9TA 2P5KA 4B09A 1XXBA 3EUHA 2PFBA 3CTAA 3DKWA 1DPRA 1P4WA 1FBQA 1LDKB 1E2XA 2PJPA 1BJTA 1KU3A 1IUYA 2COMA 2YPRA 3V8JA 1RI7A 4GXOA 1DDNA 2AS5F 1TWGA 2KKOA 2YX7A 2GWRA 3QU3A 3TKYA 3I54A 1ZREA 3U9GA 4UVAA 4EM1A 4HF2A 3ZN1A 5BS6A 4R1HA 3L4JA 4O5VA 2MD5A 4EJTA 2O0YA 2IA1A 1TQIA 4LMYA 4I09A 1XXAA 3L00A 5E20A 5ICEA 1K83A 3FZVA 5LRRA 2GSNA 3DP7A 4PGGA 2Y75A 1TQMA 2JPCA 1T98A 2DQRA 5D6FA 4DNCA 2HYFA 2D1HA 3AAFA 3ABUA 3QP5A 2JZYA 4KMFA 4ZYGA 1F9NA 3CUQC 3WU0A 5D4RA 4CYDA 3GTKA 2VODA 3LAPA 4ZH4F 1KQ8A 4HAMA 3JSOA 5EGHA 1QBJA 1JGSA 3KE2A 5E8GA 1LEBA 1YW8A 3QAHA 2RGVA 3V7RA 3HYIA 3GW2A 4KN7X 1R58A 1ZAOA 4JQFA 1Y1WA 3WTTC 2XROA 4IPAA 2ZKZA 4RB1A 4IVNA 1ONVA 4XRFA 3JTGA 1XSXA 2R93A 5DCMB 2W24A 3BP8A 1WCMA 1ZXOA 3GFLA 2CQKA 4A6EA 3FHZA 2E7XA 1HKSA 1EV7A 1MKMA 2A5YB 2GAUA 5EEGA 3Q9SA 4ESJA 3IKVA 3DFGA 4WXCA 1MGTA 3LQQA 3K2ZA 2MC3A 3NUHA 1HBXG 3OV8A 2VBYA 1S29A 2XAGA 1JXSA 2ZBKA 1DPUA 2V1XA 3I53A 3WODF 3FOEA 1AB4A 3G4AA 1RUNA 1XSVA 1P92A 1IZ1A 2F5DA 5HLIA 1OPCA 1SD5A 1D5VA 2XGXA 3WE2A 4S04A 2W85A 3IWZA 2BBYA 4LFUA 3ZMZA 4KMAA 2R92A 4MQ9F 3I71A 5FO5A 5LGTA 4BYYA 1BM9A 1SD4A 2LF8A 2EJRA 1IN7A 2LNBA 2UWMA 1K78B 4L9TA 2DAOA 3HRUA 1QGPA 2NNNA 2NVXA 4G7ZF 2FE3A 5DUIA 2PLYA 5L3FA 1MD0A 4MTDA 2STWA 3N4MA 4EGYA 4G6QA 1YG2A 2M87A 3EYYA 3F3XA 4M6YA 3IKTA 4KFCA 2OQGA 1Z9CA 2ETHA 5BPDA 5D6EA 5LEJA 2IA2A 3ZMUA 3J80Z 4L0ZB 1YS7A 2E2HA 4KUMA 1EH6A 4P9FA 1UCRA 4R79A 1U5TB 4BAYA 2M8EA 2UXNA 1EH7A 1XSDA 1BN5A 1F5TA 4GTEA 1O3SA 4KIGA 1IXSB 5BPIA 4U7BA 2H6CA 1IF1A 2QYOA 2GA1A 1J5YA 1YQAA 3QOPA 3M9AA 1JE8A 2WTEA 2J5OA 1XXCA 1BC8C 4EVIA 3BZ6A 4I0BA 4I98B 2NYXA 4EQQA 4XSXF 3H0GA 2ELHA 2UZKA 2PI0A 2QQBA 2P5VA 4ENNA 1P4XA 3JAMZ 1K7AA 4PCQA 1T38A 3O2PE 1CGPA 4I2OA 1I50A 2CFXA 1CF7B 2RC4A 1O26A 3HSRA 3CO7C 1HSJA 1W5SA 2OD5A 5ILUA 1IAWA 3MZYA 3WTSC 4EJUA 2EV5A 4RGXA 1RZ4A 3LAJA 1S7OA 2O03A 5D5XB 2CO5A 3GTLA 2DT5A 2Q2EA 2UXXA 1SFOA 2PG4A 2XKPA 5DDGA 1TNSA 2W57A 1JHFA 2K7LA 3BJAA 2M1BA 1ODDA 4AWXB 3VOEA 2DFIA 2VBZA 1IN5A 3R0AA 3HTUA 4E70A 3F8MA 1T2KA 2IRFG 2V9VA 3H92A 2RV8A 3HTSB 1D8JA 4N0BA 5D5VB 4MQVA 1Z91A 3HUGA 5A2QK 1KGSA 3MMLB 2OZUA 2XUBA 1LEAA 1ZLKA 2PMHA 4Q4ZF 3E5XA 1MJBA 5LRSA 1O28A 1AWCA 1FT9A 1Z6RA 1W5TA 1IS1A 3P9IA 2Y3PA 1ON1A 2Z5UA 3KP4A 3E5QA 1SD7A 5CLSA 3ISPA 3NRVA 4Z2YA 3WU1B 1RNLA 4AVPA 1P4AA 4EJOA 4IJAA 3N0CA 1QPMA 3I0TA 1ON2A 4M9ZA 2A61A 4U88A 5CVUA 3E6DA 4A0ZA 3KFWX 4LGWA 3OPFA 1R00A 5K1YA 4KMUX 1IXRC 4UHTA 4NHJA 2D2WA 2CWEA 1R1TA 3I59A 2KRFA 1S6LA 1T6SA 2STTA 2FOKA 3EDPA 1T39A 2RQPA 5LHGA 3LA7A 2K27A 2MBFA 4OIOF 5LHIA 1HW1A 2HR3A 2XAFA 2Z99A 2IT0A 2NNYA 1J75A 3T8RA 3KP7A 2YU3A 1LJ9A 3VB2A 1OYYA 5KVRA 3FKIA 2M45A 2DPUA 1FP2A 4A2UA 4M9SA 2MLKA 2LDUA 3ML6A 3GWZA 4CDGA 4JBAA 2H6BA 1L0OC 3ZQ7A 1LDDA 2RH6A 2XKOA 3KLNA 2DLLA 2KIMA 5ICGA 3F6VA 2H09A 2LF7A 3FX3A 4M72A 5D8KB 1YW9A 3W6KB 3J81Z 2EV0A 1TWCA 5E18F 3HSFA 2H27A 2XIGA 2YR2A 1OR7A 4L18B 5CVJA 4RGRA 2YX4A 4M74A 1EH1A 4KDPA 2HKXA 4RGSA 1XB4A 2K02A 2QBYB 3N0BA 1R1UA 2R7DA 4CXFA 3I58A 2A69F 2HTSA 5HDKA 1QZZA 1U6GA 3S2WA 5K5RA 2JA5A 3TO9A 5L3CA 2A3SA 3ROUA 2GQQA 2ZNYA 2VUMA 2F2EA 5BMZA 3N3YA 3W6JB 1U2WA 4OIRF 2A68F 1YTYA 1H9TA 5E1XA 1YFHA 3DF8A 3F6OA 4YG2F 1FLIA 1KA8A 1JHHA 1C0WA 1V3FA 5FGMA 4A6DA 5L3BA 2BYVE 2QLZA 2QVOA 1QNTA 3ECOA 3SXYA 2PHCB 3V4GA 2MLGA 3J80K 4ENKA 3C7JA 1USTA 4YFKF 4A5MA 2ESHA 3CO6C 4XLNF 4KICA 1EH8A 3DXJF 4F7ZA 3WTZA 3IRRA 4KASA 5KK1A 3WTYC 2ZMEA 3ERED 4KAWX 3RPUA 4KB2A 1HKTA 1R22A 3K1NA 4A0YA 2HEOA 2HKOA 4H0EA 1ZGAA 3QX3A 4EJWA 3MZHA 3QU6A 4GGGA 3F8FA 3P9CA 1TLHB 3FOFA 2EB7A 4UUVA 4Q47A 1FBUA 5DD8A 3JAMK 3OREA 5CVIA 5D5WB 3MQ0A 3WG9A 3WGIA 4AIKA 3GZ6A 1YIOA 3SQNA 4G7OF 1O2BA 5F1RA 3LQRA 4IHSA 2QQAA 3CUQB 3AQPA 2OZ6A 4UV9A 2G7HA 4NQWA 4N9IA 2EV6A 4R8HA 3KCCA 2ZMEB 4UXNA 4GTFA 1I1SA 3H3ZA 3JW4A 2P4WA 2JH3A 2RNJA 2W84A 1G4DA 2FSWA 3PQKA 1KU7A 1B59A 4ZZLA 4MTEA 5L3GA 3M1EA 2ZO4A 2ZJ2A 2H94A 4GCVA 1BI3A 2B63A 4DQ2A 2QBYA 4M71A 2X0LA 3GFJA 5LGNA 5D8LB 1Z6TA 2O8XA 2JA6A 2XVCA 4GTDA 4CGZA 2WWYA 1SFXA 4B8XA 4C3HC 3WTVC 4G0WA 1U5TC 1E17A 3GX4X 3LFKA 2E7WA 3IWFA 5H6RA 2K4BA 1J0RA 1G6NA 4M73A 1GHCA 2EFPA 4HX4A 4RB2C 5F64A 4RB3C 2V6CA 4YIFA 3VA7A 2O6GE 2ZFWA 3GTJA 1GXPA 4KM8A 1XDSA 1HQCA 4A5NA 2BE5F 2BEOA 2FF4A 3HRTA 4OMZA 2CGPA 4CHUA 3P7NA 5DV5A 1HKQA 2EA2A 2D45A 3CUOA 2RDPA 3NQOA 1W7PB 1D8KA 2DQLA 4O3MA 2FXAA 4HLYA 3QP6A 3H3UA 3F22A 1PP7U 4KYWA 2ADUA 4P55A 3TOBA 4OIQF 5BQTA 3KP3A 3DPTA 2AXLA 4FM9A 3C3WA 4OU0A 3E6BA 4GTLA 2EWNA 4EMSA 2JPBA 5JFRA 1TBXA 1REPC 4L9NA 2J5PA 4RAYA 4FZBA 1RUOA 3RPQA 4EGZA 3HRMA 2FU4A 1WKMA 2OU2A 1R36A 5FD5A 1YLFA 4LG0A 4HDUA 4S05A 3KEQA 1SFUA 1H9GA 4YFXF 1O3QA 1L3LA 1UB9A 3JTHA 4EJVA 1T0FA 3I59B 4WX9A 1ZGJA 1BIBA 1KQ4A 4UV8A 3WGHA 3IHUA 5JHUA 1B9MA 3EYIA 1Q1HA 4WXHA 5HOOA 3OEPA 5CYVA 5DEQA 2PMUA 4KM9A 3FM3A 1I27A 1FSHA 3VFZA 3RIRA 5ERIA 3GTQA 1BIAA 1ZG1A 4G9YA 1K6OA 4HV5A 2L4AA 2HS5A 1MJ9A 3F21A 4U0VA 2MH9A 2IW5A 1Z7UA 4LB6B 1U5TA 3BY6A 3IC7A 3Q9VA 2XHKA 5HLGA 2GXBA 3I4PA 2P8TA 2XAHA 1OYIA 2OA4A 4BLAA 3GTPA 1SMYF 4P5OA 1G3YA 1KYZA 2E2IA 3TO6A 4ZYHA 1UHMA 2QZ8A 2X4HA 2NAZA 1HW5A 4P5BA