3LAPA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-canavanine.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
149
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords Arginine repressor
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 46
structure length 149
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lapA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lapA02
4E70A 3FOFA 4L18B 3B73A 4LGWA 2CG4A 2CYYA 5K5QA 2O3FA 1J0RA 1ZRFA 1YTYA 2XRNA 2HKXA 4OIOF 3SFZA 4IF4A 5L3FA 2Z9OA 3HTSB 5FFXA 5HLHA 4Y13A 1IN6A 4OMZA 2HDCA 1OYWA 1KU9A 3QX3A 1B6AA 5D5XB 2IVMA 1MGTA 2D1HA 4HLXA 4GCVA 2HKOA 4LG0B 3HSFA 4ESBA 3CJNA 3U1DA 5AIQA 1D8JA 3V7CA 1KQ8A 4FX4A 3CUQC 1QZYA 1BN5A 4K2EA 2FOKA 4EM1A 1BJTA 1Z7UA 4N9IA 2PG4A 1HSJA 2YSRA 1CGPA 4U0VA 1LEAA 3JSOA 4A12A 4ZYGA 3I64A 2DQRA 4OOIA 4ON0A 1U3EM 1V4RA 4HF2A 4AIKA 4GYIA 3QP5A 1XB4A 1IN5A 2EA4A 3M8FA 3IWZA 1R1UA 1X3UA 1IRGA 3F8FA 1XMKA 5H6RA 1G3SA 1YW8A 1F1ZA 3SZTA 1B59A 3GVAA 2EA2A 1XCVA 4HZFA 2DQLA 1YS7A 3JSPA 2RVCA 2X4HA 1XD7A 3L7WA 1KYZA 2L01A 1R58A 2XCRB 2KWAA 3PFIA 5CVVA 2K27A 1Z9CA 3WG9A 1B9MA 1ZLKA 3IL2A 1L3LA 2WV0A 4AD9A 3R61A 2PBIA 5H6QA 3KFWX 2QBYB 3WTYC 2PQ8A 1EH1A 1OR7A 1BI3A 2V79A 4KDPA 2DAOA 1UB9A 4OIPF 1TQPA 3CUQB 4KUMA 4LLLA 2ZXJA 3HRMA 2A6HF 2AXLA 2C6YA 1GXQA 1UCRA 1LDDA 2Y3PA 1WQGA 1FY7A 4CO8A 2NRAC 4AIHA 2A6EF 4MTEA 1IAWA 4YIFA 1IN8A 5CVJA 3K1MA 3OEPA 1PDNC 1I5ZA 2KIUA 5D6EA 2Z33A 2BV6A 1F4KA 1MDMA 5E1WA 2EB7A 3G3ZA 4CGZA 4AVPA 3FHZA 4G94A 2LF8A 2JZYA 3F3XA 5HS8A 1REPC 3GX4X 1FC3A 4G0UA 1G6NA 3FMSA 3ZP5A 1NHAA 5IT3A 5E18F 3HYIA 2ZBKA 2M5WA 3FM3A 3TO7A 1T2KA 5E8GA 1P4XA 3J80K 2WC2A 2ETHA 1QPMA 3DP7A 1IXSB 4HYEA 1E17A 1IF1A 3DPLC 2VODA 4D0PA 1WQFA 4U7BA 2R7FA 5DCMA 2FBHA 2M30A 2EFOA 4RB3C 1YS6A 1ZVUA 3TOBA 2HYFA 3WGHA 1ZREA 2QWWA 2GWRA 3E6MA 1T98A 1YQAA 1SFEA 4EVIA 5JVTA 4CICA 5JFRA 4OMYA 5FB2A 4HW0A 2CO5A 3RKXA 3ZMZA 1OYYA 3KLOA 2DFIA 2G9WA 3MCZA 2XROA 2VN2A 1FYKA 1W5SA 3RYRA 3FZVA 2XAHA 4UVCA 1FT9A 2V6CA 2H09A 2EWNA 3WE2A 2LNBA 1Z6TA 3WGIA 1MD0A 4M6YA 3DV8A 1T39A 2CGPA 3E5UA 3KP7A 1IS1A 3QU6A 2XIGA 4XRFA 3H3ZA 1DDNA 5D8LB 4XSXF 4S05A 2G7UA 4WX9A 4A2UA 1YLFA 2OBPA 3I54A 4FX0A 2DPUA 4RGUA 3KEOA 2EFPA 5BQTA 1G4DA 3E6BA 3R4KA 1JXSA 2IJLA 3CDHA 3OPFA 1ULYA 1IXRC 5F1RA 2O0YA 1E2XA 1XGSA 3I5UA 4ENMA 2PEXA 1DPUA 3C1DA 3WTXC 1IUYA 4P96A 1XXBA 2DI3A 2P5MA 1ON1A 4L9TA 2YX7A 4EGYA 4QWQA 3WTUC 1PUEE 2P7VB 2F5DA 4CZZA 4UVBA 1XGOA 2MH2A 1FLIA 1BGWA 1XXAA 3T8TA 1MZBA 1MKMA 2XUBA 4WXDA 1O3TA 3U2RA 4I09A 4EM0B 2A68F 1UHMA 2FNPA 1R23A 1ZH5A 3ZMVA 3ZMDA 3F8BA 5E8IA 3COAC 5LBQA 2HQRA 1WQ2A 1BBYA 2JSCA 1WRJA 2AS5F 4UXNA 2R3SA 3GWZA 1WWXA 2OAZA 4KIBA 4A0XA 3Q9VA 3W6KB 4IRHA 1RIOH 4UHTA 3T0YA 3V8KA 1XSXA 3EDPA 5L3EA 3KZZA 1EH7A 4LMYA 4OU0A 2A61A 4HA8A 3WTSC 1WQHA 3F6VA 4LK0F 5TJJA 2EFWA 4ZYHA 4L5IA 2ZMEA 2D1VA 1YYVA 2DT5A 3I58A 4BYYA 2MC3A 1BIAA 2EK5A 4I02A 4ASNA 1ZN2A 2HTSA 2QQAA 4WXHA 5TRDA 1S7AA 4Y17A 2K4JA 1USSA 4HLYA 3MZYA 2F5FA 4KA4A 2OZ6A 2W85A 2LDUA 3P9KA 2VOPA 4RS8A 4KDDA 4LFUA 1WIHA 2RKHA 3DKWA 3FX3A 3ZN1A 1GVJA 4N0BA 4KNYA 3GYHX 3E6DA 2ISYA 1Z1DA 3KZYA 3CAGA 3NEUA 4M9ZA 1XDUA 1SFXA 4EM2A 2HFHA 3ECOA 1LDJA 2W24A 2XVCA 3MQ0A 1P6RA 4XSZF 4IHTA 3WTZA 4G7OF 5IT9Z 4RAZA 4MQVA 5FFZA 3JTHA 5DUIA 3J81Z 1W7PA 5DYMA 2IA0A 2DO7A 2QVOA 3WTVC 1I27A 1FZPB 5KVRA 1TBXA 4NB5A 1HKTA 5ERIA 5FD6A 3GZ6A 3VA7A 1ZLJA 3WU1B 4HV6A 4IHSA 1O7FA 3FXRA 2G7HA 2V1UA 1W7PD 2P6SA 1FYLA 1D5VA 2FF4A 3EETA 3ERED 4HV5A 4RGXA 4I7HA 2PFBA 5BPDA 4I0AA 4CDGA 3GXOA 5J8FA 1U78A 3GFIA 1T6SA 1JHFA 1CF7A 5E1ZB 4KT5C 1EV7A 3GUDA 3P7NA 3R60A 2RNJA 3FXQA 2A3SA 3LPXA 1FP2A 3NRVA 1K79A 4G9YA 2VBZA 1SD5A 2WTEA 4LLGF 4HX8A 3Q9SA 1K7AA 2GZWA 2BBYA 4IRIA 3K2ZA 3O2PE 1LB2A 1WI9A 2RDPA 1KU3A 3LA2A 5AONA 3BJAA 4BAYA 2VE8A 3C7JA 1SD7A 3HIFA 1KQ9A 3ZMTA 2UWMA 3SHFA 1SAXA 3EYIA 4EJWA 1U6GA 3BOQA 1QZZA 2FQ3A 2PI0A 2XKOA 4NHJA 5LHHA 4PZJA 2FMLA 4FT8A 4XLNF 1STZA 4FM9A 3V4GA 5LGNA 1YO5C 1EH8A 5E1XA 3ZMSA 3AAFA 1TQIA 2IW5A 4HDUA 3RKWA 3L4KA 3BWGA 3BJ6A 2NAZA 1RZ4A 5BS6A 2NYXA 5F6FA 3ROUA 5BPIA 3DXJF 2IA1A 4LG0A 1MJBA 2B0LA 2ZJ2A 3DF8A 4PGGA 3L4JA 4I98B 4OINF 4LLNA 2HQNA 3MFKA 3L9FA 2UZKA 4DNCA 1J59A 1MJ9A 2CFXA 3GFJA 2HGCA 4UNOA 2O6GE 2VBXA 3KP2A 1S7OA 2VBWA 5HVQC 4J3NA 3KP5A 1FBUA 4A6DA 4B09A 4HX4A 3V8JA 2YPRA 5CJ9A 1HW2A 3IRRA 2H94A 1J2XA 1B1BA 1OMIA 4Z2YA 3HSEA 3TO6A 5LRRA 2DLLA 1LEBA 5DCMB 2KRFA 4MNUA 3KP3A 4Q48A 1HSTA 2F2EA 3KCCA 4LB6B 4AWXB 3IKTA 5D5WB 1W5TA 5HS9A 2IT0A 2IP2A 3GZ5A 2OA4A 5HDNA 5D8KB 2MH9A 4LJZF 2ACJA 2FSWA 3M8EA 1AOYA 2RC4A 3K1PA 3P9IA 4KB2A 3IRQA 2VT2A 3ULQB 5K5RA 3FMRA 3GLXA 4EJUA 2ZO4A 4Q47A 5FLXZ 2GXBA 2CWEA 3K0LA 3R0AA 5K5OA 2QM3A 4M6XA 4HQEA 3TDZC 2BGCA 4M74A 4RAYA 2ADUA 3LSTA 3GW2A 3F21A 4LK1F 1J5YA 2Q0OA 1RUNA 1FPQA 1HKQA 4F7ZA 1J9IA 1BI2A 4QLCU 3JTGA 2HEOA 2L54A 3R0JA 4IXAA 3QPHA 3PQJA 4LD5A 2V1XA 3MWMA 1R00A 1FYMA 4HDVA 1WKMA 3FXUA 6PAXA 3GEZA 4WF2A 1O3SA 4BNCA 1TW2A 4RGSA 5L3DA 1LDKB 1JGSA 1ZYRF 3RJPA 3KP6A 3F6OA 1GHCA 2ZFWA 3QP6A 1I6XA 1S8NA 2O03A 4L0ZB 2IPQX 3CLOA 3I59B 2UXXA 2D2WA 2RGRA 4EJTA 3KEQA 5HOOA 4ESFA 1BI1A 1Z91A 2QQBA 2YX4A 2Y0MA 2Y75A 3CTAA 4B8XA 2BE5F 4MHGA 3RDIA 2HWVA 3QRFF 3F8MA 2FMYA 5LRSA 1I1GA 3TQNA 3F22A 1R1VA 4IRGA 4KMFA 1FBSA 2DW4A 2LSOA 4M73A 1P4AA 3RPUA 3I4PA 2Z5UA 3F72A 2CSOA 1U5TA 1D8KA 1SMYF 3ECHA 3C18A 3ZPLA 1FNNA 1K6OA 1YIOA 3IHUA 2EV5A 4YFXF 4IVNA 1TW3A 3HSRA 3TOAA 1QO0D 4M9SA 2FRHA 4P5OA 4RGRA 4CYDA 4Q5SF 2VBYA 3V7RA 2OQRA 4PGHA 3JAMK 3L09A 4HQMA 2V9VA 3TDUC 4ENKA 2ZMEB 3HTUA 2JRTA 2DK5A 3LQQA 2M45A 4ZZDA 4UVAA 4A0ZA 2GA1A 1R7JA 3RTRA 2Y48A 1A04A 3J7AO 4L9JA 2XKPA 3GFMA 3IWFA 4MTDA 2Z3YA 1F9NA 3T8RA 5DD8A 4BHCA 4HF1A 1BJAA 1JHHA 1IXCA 4U0WA 3N4MA 3LA3A 1HBXG 5LGTA 3EUHA 1FX7A 3W6JB 2GIVA 1HXDA 5H20A 2EJRA 5IT9K 3WTTC 2K86A 1KGSA 2DK8A 2ESNA 1FSEA 1IW7F 1FWZA 2KJCA 1ZAOA 2RQPA 2XHKA 1ZG1A 3NUHA 1G3WA 1RUOA 4CXFA 4G6QA 1J7KA 2TDXA 4U7DA 2FEZA 2E1CA 3HRTA 1DUXC 3BPVA 1H9GA 4KAWX 1H9TA 5L3BA 1YW9A 5HDKA 3BPXA 1W7PB 4KICA 3KLNA 4IJAA 2XCOA 3IC7A 4Q4ZF 2JTVA 1FBQA 1P4WA 4A6EA 1T0FA 1O3QA 3TGNA 4KC6A 1OPCA 3HRSA 1XMAA 5CYVA 1TTYA 1TQMA 4BQAA 4M9XA 2NNNA 3BJOA 4P9FA 4YIIA 5LGUA 3VODA 2VONA 4I2OA 3BDDA 3ML6A 5CVRA 4P55A 1SD6A 1CF7B 1LQ1A 1D3YA 4BH9A 3LA7A 3VOEA 1GXPA 4M71A 3K1NA 2L3DA 3RKYA 4UV8A 1DP7P 5FGMA 1K78A 4ZZLA 3T1BA 4GGGA 4WXCA 3CO7C 4L0YB 3BROA 2HR3A 5L3CA 2K02A 3O3KA 3L2CA 4KYWA 2FBIA 2COMA 3TO9A 5A2QZ 5LEKA 3PQKA 3ZN0A 1ONVA 2YU3A 4U0YA 2EV0A 1R36A 2DPDA 1XCBA 3K69A 4R1HA 5LHGA 4KIFA 2QQ9A 1HQCA 2DU9A 4XLPF 2FU4A 1EH6A 2FA5A 1P92A 3FWEA 3DFGA 5BOXA 4MGRA 2BYVE 3SQNA 2HTJA 1GE9A 3E6CC 3CO6C 3VEPA 4WCGA 1I1SA 4IPAA 2XV4S 2RGVA 3KE2A 3I0TA 3MMLB 1ZGAA 3HOTA 3SZPA 4GXOA 1S6LA 4RB2C 2E7WA 2XGXA 3VB2A 1KYWA 1JE8A 3V8LA 4UUVA 1ODDA 4HBLA 2DTRA 4R79A 2XAJA 2VC0A 3FF5A 3C3WA 5JI6A 3ZMUA 1R1TA 2XASA 2H6BA 4OIQF 3E5XA 1FP1D 4O6JA 3Q5FA 3WE3A 5ILUA 3RPQA 4ESJA 1YG2A 3ELKA 5JHUA 2GA2A 2NNYA 5CLSA 4A5NA 3BP8A 3MZHA 3ABUA 5E20A 2STTA 2VC1A 4BHPA 3TKYA 2Q8KA 2KKOA 4HX7A 4LB5A 3DQVC 4TV7A 1DD5A 3HOSA 4HAMA 3B02A 5FD5A 3RI4A 5JR3A 3LAJA 1BIBA 1G3YA 2ELHA 5ED4A 2Z99A 2LF7A 1KU7A 1TNTA 4ZYEA 4JBAA 5J8CA 5FLXK 3O6BB 2P7CB 2K7LA 2GAUA 3VFZA 1U2WA 2IA2A 3JW4A 1MDMB 3F23A 1LVAA 3M9AA 3BY6A 2STWA 5E17F 4PDKA 4ENJA 4HOBA 3REOA 1RI7A 3HHHA 1U5TC 5F64A 1XGMA 2P6TA 3F8CA 5HS7A 5LEJA 4KB4A 1R5HA 2L02A 1AWCA 5EEGA 2HS5A 4FHTA 4BHBA 4ZH4F 4RB1A 2EFNA 1BC7C 2XAGA 3I71A 4PCQA 3E97A 2P5LC 3RIRA 4HF0A 5DDGA 4GYGA 3E5QA 1UHWA 2VXZA 2CW0F 2M1BA 4JK1X 5D5VB 1ZGJA 2FXAA 1ZG5A 4G6DA 1QGPA 2JPCA 3EQLF 5CVIA 4U88A 5D6FA 1YW7A 3H3UA 1XDSA 2GQQA 3QOPA 1TLHB 3I53A 1BOAA 2PN6A 1Y0UA 2NS0A 2RV8A 3IKVA 2WWYA 4O3MA 1V3FA 1XSDA 2P4WA 3V7SA 2F5EA 3H92A 4I0BA 3HUGA 3CUOA 3L00A 2MA3A 5BMZA 2IRFG 1MJAA 1S3JA 2K4BA 2A5YB 1WSUA 2J5OA 5ILVA 4L9VA 1PP7U 2QYOA 3FOEA 1BI0A 1EK8A 2ZFZA 1B4BA 2D45A 4UV9A 2W57A 2KJBA 4MQ9F 3GF2A 3M1EA 2ISZA 1RNLA 2QBYA 3WTWC 1KQ0A 4EMSA 4KN7X 4XBFA 4A0YA 2VE9A 1U5TB 4WK8F 2V1DA 1FSHA 2ZKZA 3ABTA 3M7GA 1BC8C 3BUEA 3CUQA 1F5TA 4EJOA 4KMUX 1DPRA 1ZRDA 3SXYA 3HRUA 2E7XA 1IN7A 1Q1HA 3ZQ7A 1XN7A 5DUKA 2P8TA 2QLZA 4MEXF 2HZTA 2X0LA 3QPTA 4DDQA 4G7HF 4YFNF 3RYPA 2L4AA 5ILSA 4L9NA 1HKSA 2H27A 4M72A 1W4MA 1ON2A 1ZG3A 2MD5A 4AIJA 2VT3A 2CQKA 2W25A 1IN4A 1R22A 3EYYA 5J6XA 5JVOA 2ZNZA 2PMHA 2A69F 1HW1A 1XSVA 4Y15A 1PP8F 1IZ1A 4G8XA 2KIFA 2O8XA 1ISEA 3LQRA 4DQ2A 4KIGA 4YFKF 2MBFA 1Z6RA 2J5PA 1LNWA 1KA8A 3P9CA 3D5LA 4ETSA 2ZNYA 4MEYF 5LHIA 1Z05A 4CHUA 1U8RA 5K1YA 3QU3A 3KETA 3MAJA 4YG2F 2PHCB 2DBBA 4S04A 5AIPA 1R5GA 3NQOA 3N97A 3J80Z 2H6CA 1L0OC 4H0EA 3S2WA 4ZYDA 1HW5A 1LJ9A 3MEXA 2M87A 3LFKA 4A5MA 2LKPA 2RN7A 5DCFA 2FE3A 2HYGD 3I59A 3KP4A 5HLIA 1XXCA 3U9GA 1H0MA 2Q2EA 1UFMA 2R7DA 2KIMA 2JPBA 2OZUA 1ZARA 2XAFA 3D0SA 3DEUA 2ZCWA 5ICFA 1QNTA 1AB4A 5HLGA 2QZ8A 2QENA 2EV6A 2MLKA 1C0WA 1B9NA 1O57A 2OD5A 5DV5A 1ZRCA 4OIRF 3F8NA 3LAPA 3K9TA 3BZ6A 3J81K 5DEQA 4GFQA 1SMTA 3HHGA 5A2QK 2OQGA 4G0VA 3WGGA 3OV8A 3E3VA 3FMQA 2VOOA 1ZHFA 3OREA 5D5UB 5CVUA 1K78B 1O3RA 4NQWA 2O61A 3R6SA 1QQIA 2M8EA 2XAQA 2F5CA 1KU2A 5D4RA 2P5VA 5KK1A 2BEOA 2QUFA 4KN4X 4EJVA 4G0WA 3WU0A 2P5KA 2E1NA 4P9UA 2GXGA 5D4SA 1BM9A 2FBKA 3WODF 5ICCA 4BXUA 4L5JA 2YR2A 2OU2A 2JT1A 3GFLA 4KFCA 1S29A 3DPTA 4ENNA 5DD4A 4R8HA 1T38A 4WWCA 1SD4A 4GO1A 3JAMZ 5EEHA 2PJPA 3LWFA 1P2FA 1QBJA 1XGNA 3QAHA 1SFUA 2MLGA 2XCQA 4JQFA 4RB0A 2PLYA 2EFQA 4O5VA 3G73A 4N9HA 2PMUA 2A07F 2L4MA 1VTNC 1TNSA 4EV0A 5ICGA 3OOPA 1G3TA 4EGZA 5HDGA 5LLQA 1J75A 1YFHA 1B4AA 2W84A 3ISPA 1OKRA 3FM5A 2ESHA 1O7LA 2FNAA 3T5XA 1IRFA 4I01A 1FOKA 1USTA 2HOEA 4EQQA 5ICEA 1OYIA 2UXNA 5L3GA 4G7ZF 5FO5A 3GO5A
chains in the Genus database with same CATH superfamily
3D1NI 2JWTA 3DTIA 4E70A 3FOFA 4L18B 3B73A 4LGWA 2CG4A 3HOXJ 2GAHC 2CYYA 2Y0SD 5K5QA 3S1QK 2O3FA 3FXOA 4BKXA 4C30A 2BXYA 3FHNA 1P9QC 4RLFA 1ETQA 2LLKA 3GTGJ 1J0RA 2X6XA 1DCOA 1ZRFA 2K9QA 1YTYA 2XRNA 3FXLA 2HKXA 2L7ZA 2M8GX 3SFZA 3ZCOA 4OIOF 4IF4A 4D7MA 3DCFA 5L3FA 2Z9OA 3HTSB 4ZH4A 4BY1K 5FFXA 1AKHA 4BBRC 5HLHA 2XGCA 4Y13A 4DBRA 1IN6A 4OMZA 2HDCA 2VUMJ 3HOVC 1OYWA 2DFEA 1KU9A 1MBKA 2KRCA 2MD0A 1R9TJ 3QX3A 4CA0A 1VLOA 4BU2A 1B6AA 5C4JC 5D5XB 2IVMA 1MGTA 2D1HA 4NC8A 3PUFA 3AD7C 3CJRB 4HLXA 1F43A 4GCVA 2CW0A 2PA8L 2HKOA 1ZK8A 2CRGA 4RM3A 4LG0B 5TMCA 3HSFA 4ESBA 2JRMA 3CJNA 3L2UA 1ETKA 3U1DA 5AIQA 3K4NA 4B1RA 2GSOA 2DJIA 1D8JA 3V7CA 1KQ8A 1JKPC 4FX4A 2E2HA 1WOPA 3CUQC 1QZYA 1BN5A 4K2EA 2FOKA 4EM1A 5IYCC 3LSHA 1BJTA 2I8DA 1Z7UA 3GEIA 4N9IA 3T01A 2PG4A 2XC7A 4P5AA 1HSJA 4AUXA 2ELKA 2YSRA 1CGPA 4U0VA 4XKWA 4Z6YA 2PA8D 1F7UA 1LEAA 3JSOA 4A12A 2GOXB 2LY2A 2KMUA 1XZQA 4ZYGA 1SFKA 3I64A 2DQRA 1PYVA 4OOIA 4ON0A 1VQ9I 4GZYA 1U3EM 3IPJA 2M34A 4A3MJ 4AH6A 3ZRGA 2DT7B 4BS9A 2Y9YA 1V4RA 2XSJC 1GUUA 1T33A 2E60A 4BY7C 2K9SA 4HF2A 2DMQA 4A3CJ 4AIKA 4GYIA 3QP5A 1XB4A 1IN5A 2EA4A 3M8FA 3K7AK 3IWZA 1R1UA 4BBSC 3GEHA 1U9NA 4XL9A 5IY5H 1X3UA 3KEYA 1IRGA 2MYSA 3F8FA 1XMKA 4UUTA 2LBFB 5H6RA 1X58A 1G3SA 2V4JC 3T00A 1YW8A 1F1ZA 4A3FK 2CMPA 3SZTA 5GPCA 2JVHA 4IQJA 3NARA 1EKEA 3GTOC 1B59A 4XLCA 3GVAA 2EA2A 1XCVA 1BOBA 4XM3A 4HZFA 2DQLA 1YS7A 1I50J 3JSPA 2FOWA 1IV6A 2RVCA 2HVQA 3GTLK 2E34A 1HQMA 1XZPA 1I3QJ 3S15C 3GTPK 5M3FJ 2NS8A 1X1CA 2X4HA 3H0GA 2CFAA 4A3FJ 1XD7A 3MVPA 1G2HA 1V5GA 1Z0XA 2DMNA 2V6SA 3L7WA 1KYZA 2JA7J 2L01A 1VQLI 2DA2A 2N8GA 1R58A 2XCRB 1MNEA 2KWAA 3SDGA 4YRVA 4PAAA 2KHMA 3PFIA 5CVVA 3HB9A 2K27A 4XN0A 3WG9A 1Z9CA 1BL0A 1QPIA 1B9MA 3JR9A 4XRSA 2LC2A 3ASOH 3QYBA 1ZLKA 3IL2A 4MEXA 3LL7A 1IDYA 1L3LA 1DP3A 2WV0A 4AD9A 2DOFA 3S14J 3R61A 2PBIA 4GTBA 5H6QA 2DA5A 1TWFK 4B44A 3KFWX 3ZOBA 2QBYB 1IO2A 1X2NA 2KT0A 3WTYC 2PQ8A 3H9GA 1EH1A 1OR7A 3CQZC 2M3AA 1BI3A 1WOSA 2V79A 2DYSH 3A01B 4KDPA 3S17K 2DAOA 1UB9A 5IORA 1OCTC 2HDDA 3CF2A 2LYCA 1V54H 2QQ8A 4OIPF 5CHPA 1JT6A 2E19A 3NWSA 4D5CA 1TQPA 3B6CA 1TWFJ 2NVYJ 3CUQB 3AD8C 4KUMA 2KFDA 4LLLA 4A3LJ 2ZXJA 3ABLH 3G2BA 2JA6K 2GIZA 3HRMA 3VYTB 2A6HF 4FCYA 2AXLA 4RLQA 1X2MA 3MN2A 2C6YA 2QSGX 3LNQA 3Q3SA 3FBIB 4XLHA 5IOYA 1GXQA 4ZTJA 3GTJA 3J7ZI 1E3PA 1OCRH 1Q1VA 5FKLA 1UCRA 1Y8RB 4N4OB 4GTLA 1LDDA 2Y3PA 2NVXJ 2JA6J 1WQGA 1FY7A 4CO8A 2NRAC 4AIHA 2A6EF 1ETYA 5GTHC 3DTEA 1WVRA 2CV0A 3HZJA 4MTEA 1YCLA 1IAWA 4YIFA 1IN8A 4Y52C 3GTMC 3A8IA 2L7MP 2R7ZK 1YIJI 5CVJA 2L7FP 3K1MA 3OEPA 1A6QA 2DMPA 3M3YK 3OL3A 5J4VA 1PDNC 3AG2H 1I5ZA 2KIUA 5D6EA 2Z33A 2BV6A 1F4KA 4MEYA 1MDMA 3JRFA 1MH3A 5E1WA 2BY1A 4ZYAA 3DKXA 1K83C 2EB7A 3G3ZA 5B1AH 4CGZA 1EF4A 1MMDA 4AVPA 3FHZA 9ANTA 4G94A 4B48A 2LF8A 2JZYA 3F3XA 5CKTA 4CCNA 2JVGA 2XDVA 1Y39A 1Y1VA 4NOIA 2B63C 2Y31A 3SFIA 5HS8A 1REPC 4ABZA 3GX4X 3QOEA 1FC3A 4BJTA 1JGGA 1TWHA 4UB6C 5B5EC 3BC8A 4L5EA 4DIQA 1O27A 4G0UA 3ZQQA 1G6NA 3FMSA 1EQRA 2AHQA 1WJEA 3LSPA 3ZP5A 3CCEI 1NHAA 4E7IA 1DCHA 3U1KA 5IT3A 5E3LA 5E18F 3HYIA 5KCMA 2ZBKA 4YIRX 2M5WA 4BBRK 4XOPA 1BS2A 3FM3A 2MFZA 1X1BA 3PUBA 3TO7A 1T2KA 1PJ6A 5TGTA 2JA5C 5E8GA 1P4XA 3J80K 5IP7K 2WC2A 2ETHA 3LSKA 4J00A 1QPMA 3DP7A 1IXSB 4BUPA 1PJRA 2JA8K 1VF9A 4HYEA 1OJLA 2EINH 5IOZA 1TWAK 4PJJA 5IP6A 1A6IA 2K3PA 1E17A 1Y1WC 5EZHA 1IF1A 2R5ZB 1VQ4I 1PJ7A 2R93C 4DOZA 3DPLC 1FTZA 3S1NK 5EG0A 2VODA 3O8HA 4EEFG 5E3NA 1ACIA 2LREA 1VRQC 3Q0VA 3DLLF 3HOVJ 4A3EK 4D0PA 2X6WA 3Q0UA 1WQFA 4U7BA 2R7FA 5DCMA 5J3LA 1R4NB 2FBHA 2M30A 2WV1A 4BQNA 3HOYC 1YS6A 2EFOA 3DU5A 4RB3C 3RZDK 1JT0A 3RKQA 1ZVUA 5IYCK 5C4JJ 4EATA 2CUEA 3HGGA 3TOBA 2HYFA 2BHZA 3HDDA 3RZOJ 3WGHA 3FXJA 3KPHA 1IRXA 3CDLA 3OYEA 1ZREA 2EQRA 4OIRA 2QWWA 2F4IA 3EPZA 4D5FA 4GTAA 4FQGA 4YEJA 1J98A 2GWRA 3GTQC 3E6MA 3OYKA 2PMZA 1T98A 1YQAA 2PMZL 1SFEA 4EVIA 5JVTA 4KM9A 4CICA 2AQFA 5JFRA 4OMYA 3N3YA 5FB2A 2YU9C 2DN0A 4HW0A 5IYCJ 3CCQI 2PJRA 2CO5A 4BY7K 4JYKA 3RKXA 5J1YA 1FOYA 3ZMZA 1OYYA 1J6WA 3GTKA 2K9NA 3KLOA 2Q2EB 1JUSA 2DFIA 3PO2K 5IOTA 2G9WA 2R7RA 3MCZA 3OSGA 1TT0A 2XROA 2VN2A 1O25A 5J47A 4ANJA 2JMWA 1UG0A 2R7XA 1FYKA 1W5SA 2OC6A 2PMZD 4ZDOA 3FZVA 3RYRA 2XAHA 3CC7I 4UVCA 1FT9A 2V6CA 4CYCA 2AO9A 4KISA 1E0EA 1KQ4A 2H09A 5IYBC 2NS7A 2XPVA 2EWNA 3WE2A 1B8IA 2LNBA 1RESA 1Z6TA 1WOOA 3S8PA 4BBSJ 1B72A 2O5RA 3DEEA 2E2IA 3BG5A 1Y0NA 3WGIA 2ZSHB 4CCKA 3JRAA 1MD0A 5EGOB 4M6YA 3S2DC 3OS1A 3DV8A 1ZXOA 2ICWG 2EILH 4ZC3A 1T39A 2CGPA 5FRNA 2HVRA 3KYLA 3E5UA 3KP7A 1IS1A 4LK0A 1ENHA 3QU6A 4LIVA 3GTOJ 2CFOA 2R4GA 2XIGA 4XRFA 3ZQIA 3H3ZA 4BJ5C 3SZZA 2QCOA 2I10A 1DDNA 4HEA2 2R7UA 2JUCA 2CW8A 3S15J 5D8LB 2R92K 4XSXF 4S05A 2G7UA 4WX9A 3JRGA 2M2EA 4A2UA 1ZQ1C 1YLFA 1TWGA 2OBPA 3I54A 3LSRA 4FX0A 2DPUA 4RGUA 3M4OC 3KEOA 2EFPA 5BQTA 2VB6A 1G4DA 5F27A 5KAIC 2CV2A 3NAUA 3E6BA 3R4KA 2IS6A 4F92B 4E7JA 2VIXA 1F36A 1YX2A 5GP9A 1JXSA 4A3JC 2IJLA 1MNDA 3CDHA 3ZGKA 3OPFA 1OLTA 1ULYA 3BQYA 5FJ8K 1IXRC 2OCCH 1RU0A 5F1RA 2M0MA 2O0YA 1E2XA 1XGSA 3I5UA 3M07A 4JX6A 3OYNA 2PEXA 4ENMA 1DPUA 3C1DA 3WTXC 3ZQCA 4P96A 2VL8A 1IUYA 1XXBA 2DI3A 2P5MA 1ON1A 3BR6A 4L9TA 2Z1DA 2LTPA 2YX7A 4B47A 3G71I 4EGYA 1K61A 3A8KA 1JOEA 1KZHA 4QWQA 4IHYA 2EBIA 3IAS2 4A3DC 4BEHB 3WTUC 3L2VA 4WJ3M 3CQZJ 4J01A 1PUEE 1FTTA 5C4XK 2P7VB 2R5YB 1SFOA 2F5DA 4W97A 4B43A 4CZZA 4UVBA 5F04A 1XGOA 2MH2A 3F9KA 1FLIA 1BGWA 1WGXA 1XXAA 3SEQA 1NK2P 3DLAA 4OWRB 3T8TA 4E7SA 1LFBA 2FQTA 3ASNH 1TWCA 1MZBA 1MKMA 2XUBA 3FKJA 4WXDA 1H89C 1O3TA 3U2RA 3I9V2 4I09A 3J7AY 2E2HC 3OIQA 4EM0B 1IRZA 3TFIA 2A68F 1UHMA 2FNPA 2BHYA 4FETA 4BDYA 4XSZA 2O9LA 1R23A 1TL8A 2BW3A 1S9HA 2KLOA 2HXOA 2M4GA 1ZH5A 2X1CA 4G7ZA 1I50C 3ZMVA 2P0WA 2O5JA 2I5UA 2AXTC 3ZMDA 3F8BA 5E8IA 2CW7A 5B66C 1G51A 3COAC 1QHGA 2DA3A 5FLMK 5LBQA 5BNGA 2HQRA 1WSVA 1YNNA 1WQ2A 1BBYA 4QJVA 2JSCA 1WRJA 2AS5F 4UXNA 4PK4A 2A05A 2B63K 2R3SA 3GTMJ 4Y52J 3GWZA 1WWXA 5IOSA 2Z16A 2OAZA 2ZFUA 3OYLA 4KIBA 4A0XA 3Q9VA 3W6KB 4IRHA 1RIOH 3HOUC 4BXXK 4A3KK 1H8AC 4OAYA 4UHTA 2CH0A 3T0YA 3V8KA 1XSXA 3EDPA 1MIJA 5JLWA 3TFHA 2PPBA 3CP2A 3KZZA 5L3EA 1EH7A 1K83J 4II3A 4LMYA 1WORA 1MSEC 4OU0A 2A61A 2EBBA 3MKLA 3ERMA 4HA8A 3WTSC 3GDZA 3OMYA 2JA5K 1WQHA 1BDFA 2X6YA 3F6VA 3BTLA 4LK0F 5TJJA 2EFWA 2QGUA 3CMMA 1NK3P 2F4MB 4ZYHA 4L5IA 2WB1N 1RETA 2O7OA 2ZMEA 4H4KC 2M4KA 3FKIA 3JRIA 5M5XK 2D1VA 1YYVA 1Y1WK 2DT5A 2EPFA 3FXMA 3I58A 3H0GC 3ZQGA 4KT6A 2GSNA 4BYYA 4NDLA 3CLQA 4MLOA 2MC3A 1BIAA 1VI0A 2EK5A 4XKBA 4I02A 1NG6A 2NVTK 2JA5J 4ASNA 1G8XA 3X2QH 1ZN2A 2HTSA 5C3EC 2QQAA 4WXHA 3N0CA 5TRDA 1ZGWA 1S7AA 4Y17A 5HNFA 2K4JA 4X6AC 5M5XJ 2R93J 1USSA 4HLYA 5HODA 4LLGA 3I4MC 4NC7A 3K70D 5FKMA 3QYFA 3MZYA 3BT9A 3PSFA 2KZGA 3OS2A 1T8IA 4RMNA 2F5FA 3DBLB 4KA4A 4XLEA 3HOYJ 2OZ6A 1I6HC 2ZUEA 2W85A 2HI3A 2LDUA 1OR7C 3P9KA 2VOPA 4RS8A 4KDDA 2BZTA 4LFUA 1WIHA 4IHWA 2RKHA 3DKWA 2F48A 3FX3A 4NUBA 3ZN1A 1GVJA 4F93B 2MW8A 4N0BA 3G6EI 4KNYA 3QPLA 3E6DA 3L2QA 3GYHX 2ISYA 1Z1DA 3I4NC 3PNYA 1YRNB 2KL4A 4BQOA 3KZYA 1XPPA 3H3VL 3HJEA 3CAGA 4JOMA 3F0CA 3GTQJ 1U8BA 2VQHA 3NEUA 4AC0A 4M9ZA 3UR3C 1XDUA 2NVUB 3VYSB 4AIDA 2YU9J 1SFXA 2E1OA 2Y0SA 2VJIA 4EM2A 3HOXK 2V6TA 1YITI 3TL4X 2HFHA 3ECOA 1LDJA 2W48A 3G4CA 2W24A 2XVCA 3MQ0A 1P6RA 3BG9A 2L9NA 4XSZF 4BL0B 3GTJC 4IHTA 3WTZA 1XZQB 3GTGK 2Y30A 4G7OF 5IT9Z 4ILDA 3BTJA 4IX7A 4RAZA 3DPUA 4A3GC 4MQVA 3AG1H 1GVDA 1WJAA 5EJCA 5FFZA 3JTHA 5DUIA 2NVQC 2DA6A 4QTRA 3J81Z 3S0XA 4CCMA 1W7PA 5DYMA 1FIPA 2IA0A 5IYBJ 1BW5A 5JFEA 2VUMK 2B9SA 2DO7A 1MW7A 1R9TK 3MKYB 1YNJA 2QVOA 3WTVC 1I27A 2DODA 1FZPB 1YX5A 5KVRA 2M7AA 1TBXA 4NB5A 1HKTA 2DFFA 5ERIA 3S2DJ 5FD6A 2EIKH 3VSLA 3GZ6A 3DXJA 3VA7A 4DBQA 1ZLJA 1Y1VC 5H2FC 3WU1B 4HV6A 4QIWL 4IHSA 3LOCA 2V6UA 3LMMA 1O7FA 2VJ4A 2ZJQF 4CSWA 3FXRA 2G7HA 3QQAA 4QPOA 3EUKL 2V9PA 2V1UA 1W7PD 3DU6A 1TWHC 2P6SA 3CDIA 1FYLA 1D5VA 1BA5A 4OIPA 4Y33A 1HC8A 2E2JC 3RZOC 3K2AA 2FF4A 3EETA 3KIOA 3ERED 4GTFA 2JN6A 4HV5A 4XNFA 3ZQLA 3D5SC 4PSWA 4RGXA 4I7HA 2PFBA 4QPQA 5BPDA 4I0AA 4CDGA 2VXDA 3GXOA 5J8FA 3IP4B 1HCRA 3M4OJ 1VQ6I 2A6HA 4QIWD 1U78A 3GFIA 2KZVA 1T6SA 3C2GA 2XGEA 1JHFA 2IEKA 1CF7A 2MABA 1IC8A 2KRHA 5E1ZB 4KT5C 1EV7A 4A3JJ 3GUDA 1A31A 4A3MK 3P7NA 3R60A 2RNJA 3FXQA 1LE8A 3QPSA 1X4OA 4Y3OA 2A3SA 3LPXA 2NXNB 4A3CK 3K4BA 1QZEA 1FP2A 3NRVA 2EIMH 1I39A 1K79A 4G9YA 1OCCH 1RPWA 3ADAC 2VBZA 1VH2A 1SD5A 2A6EA 4A93C 2WTEA 3G1LA 4XIDA 1GV5A 3GCMA 4LLGF 2CS3A 4HX8A 3Q9SA 4PFOA 4A3DJ 4BQQA 4PJLA 1K7AA 2GZWA 2BBYA 1VQ7I 2BVMA 3MKZA 4IRIA 2FQ4A 3K2ZA 1OCOH 1GDTA 1VQMI 1XC5A 3OL4A 4GRIA 4LJZA 3O2PE 1LB2A 1I50K 3H5NA 1WI9A 1DGRM 2RDPA 5GPAA 1ZBSA 5IYDC 1KU3A 4HNTA 3LA2A 2MG4A 1I3QK 5M3FK 1FIAA 1UAAA 5AONA 3BJAA 2E2HJ 2ZB9A 1LVKA 1K4SA 4BAYA 2VE8A 3C7JA 3SEZA 1NH3A 1SD7A 3HIFA 1KQ9A 3ZMTA 2O8KA 2UWMA 4C2MC 3SHFA 2GAGC 1SAXA 2JA7K 1D0ZA 3EYIA 4EJWA 3OYAA 2OTLI 3GTKC 1U6GA 3BOQA 2KP6A 2L7KA 1QZZA 2FQ3A 4LQYA 2PI0A 3H9QA 2XKOA 3GTLA 5C44C 4X0GA 1LFUP 3GTPA 4MFDA 4NHJA 1D0YA 5LHHA 3HUGB 4PZJA 1INNA 3OR2C 3L2WA 2FMLA 2LY1A 4FT8A 3PSIA 4DJAA 2EZHA 4XLNF 1STZA 5EZGA 4LK1A 3S14K 3GEEA 1WI3A 2KDOA 4JK1A 4FM9A 2KDZA 2WBMA 3V4GA 4DGWB 4RBOA 4PUSA 3HOUJ 2VI6A 5LGNA 5L46A 2JSPA 4JX5A 1YO5C 1EH8A 5CQGA 4RM2A 5E1XA 3ZMSA 3AAFA 1TQIA 2DDBA 2IW5A 2GLOA 3LSJA 2DMTA 4HDUA 5EGHA 3RKWA 3L4KA 3BWGA 4XICA 2IS4A 2GOMA 4BE0A 2QF7A 3BJ6A 3E1SA 2NAZA 1RZ4A 3OYCA 2IS1A 3HG9A 5BS6A 2NYXA 5F6FA 3ROUA 1X1AA 5GADJ 5BPIA 3DXJF 1VQ5I 2IA1A 1TWFA 4LG0A 3OIPA 2NVYK 1MJBA 2B0LA 4A3LK 2ZJ2A 3DF8A 4PGGA 3L4JA 1ZYRA 4I98B 4OINF 4BLBA 4LLNA 1MMGA 1YOVB 5E3OA 2VJ5A 2HQNA 3MFKA 1DQUA 1USMA 2RH6A 3L9FA 1VZ0A 4X6AK 4DNCA 2UZKA 1J59A 4E7HA 1MJ9A 2CFXA 4KITB 3H0GJ 3K6GA 2IGMA 3GFJA 2ZXIA 1TWGC 2HGCA 2K9MA 3K4MA 4UNOA 3PJRA 2O6GE 2RREA 2VBXA 2EZKA 3KP2A 5IPAA 1PUFA 1S7OA 2VBWA 5HVQC 4J3NA 2NVXK 3KP5A 1FBUA 4A6DA 4B09A 4HX4A 5C3EJ 2XF7A 1X4PA 3V8JA 2OPTA 2EIJH 2YPRA 3CCSI 5CJ9A 1HW2A 3IRRA 1R4MB 2H94A 1J2XA 5EG0B 4C3HC 4X6AJ 4GFBA 4UB8C 1B1BA 1OMIA 2WADA 4Z2YA 3HSEA 3TO6A 3I4NK 4MIMA 1I6VA 3OYHA 5LRRA 3I4MJ 2VKVA 2DA7A 2DLLA 3BQZA 5DCMB 1LEBA 1X1DA 2KRFA 3GLLA 1RKWA 4MNUA 4AYBN 3KP3A 3CCUI 1I6HJ 2HU9A 4Q48A 1MMNA 4KN7A 1HSTA 2F2EA 3KCCA 4LB6B 4AWXB 1N75A 3IKTA 2JK3A 4ZDPA 3A1YA 5D5WB 1W5TA 2LBFA 3BG7A 3E0JB 5HS9A 2IT0A 2IP2A 4C3JC 2R7ZA 2LFBA 3GZ5A 3I4NJ 2OA4A 5HDNA 5D8KB 2IS2A 1TWCC 2MH9A 4LJZF 2ACJA 4KMUA 2FSWA 5F0FA 2RAEA 1SEUA 2DFHA 3M8EA 2PJRB 4F55A 1AOYA 3NWTA 2RC4A 2JUGA 3K1PA 3P9IA 4KB2A 3IRQA 1X3WB 2VT2A 2WAQA 3TMOA 4DZJA 2WAQL 3BR2A 3ULQB 1BR2A 1V55H 5K5RA 4YFXA 4XSXA 5EGEA 3GTJJ 3S1MC 4XKCA 3FMRA 3GLXA 3GMEA 4EJUA 3MKWB 2ZO4A 4II2A 2FX0A 4Q47A 3FDYA 2BVLA 5FLXZ 2GXBA 4A3GJ 5FROA 1F93A 2CWEA 4CYCB 3K0LA 3R0AA 2HVSA 2UUZA 1UELB 2NVQJ 5K5OA 3S16C 2QM3A 4M6XA 4HQEA 3TDZC 4Q5SA 2BGCA 4LOCA 4M74A 1MBEA 2IBDA 3OWTA 4BE1A 1B72B 3HOVK 4RAYA 2ADUA 3LSTA 2VLAA 3GW2A 3BCAA 2WAEA 3F21A 4LK1F 1TWHK 2WAQD 2X1EA 2K40A 5F1JA 1J5YA 3RQIA 1DU6A 2Q0OA 1RUNA 1FPQA 1CQTA 5C4JK 2DYRH 1TWAA 1ZQ3P 1HKQA 1ZKGA 4F7ZA 1J9IA 5DS9A 3RZOK 2XAUA 1BI2A 4QLCU 3JTGA 2HEOA 1Y1VJ 2L54A 1OISA 3R0JA 4IXAA 3QPHA 1QHHD 3PQJA 4LD5A 2V1XA 4KJZA 2VKHA 1R5ID 2VQGA 3MWMA 1R00A 1FYMA 4HDVA 1WKMA 3FXUA 4BJ6C 1TWHJ 2IGOA 6PAXA 3GEZA 1Y8QB 1VNDA 3G1MA 4WF2A 4C3IC 1O3SA 4BNCA 1TW2A 4RGSA 5FRMA 2ZMEC 5FKKA 1P7IA 5L3DA 3FKIC 1LDKB 1JGSA 1UG2A 1Y56A 2PMZN 2E2JJ 1ZYRF 3RJPA 1GT0C 3KP6A 3K70C 2E1MC 4E7LA 1UMQA 3FK7A 3F6OA 4Y7NC 4PJ0C 4ZJZA 5M5WJ 1GHCA 2HOAA 4HPQA 2ZFWA 3QP6A 4BGDA 1XS9A 1JKOC 1O2BA 3AKZA 3DKYA 2V6EA 1VJEA 2A68A 1Z21A 1I6XA 1S8NA 2O03A 4L0ZB 3WG7H 2IPQX 2BY3A 3CLOA 3OYIA 3I59B 2UXXA 2D2WA 2XF5A 3S1RC 3CCLI 4UUSA 2RGRA 3QYEA 3OYFA 1IV8A 3KEQA 4EJTA 4BBSK 5HOOA 1O26A 4ESFA 4A93J 1BI1A 1Z91A 2QQBA 2YX4A 2Y0MA 2VJJA 2DXIA 2Y75A 1MH4A 1QVUA 3G4SI 4CCJA 1MNMC 3K4LA 3KZIC 4A3BC 3BTCA 3CTAA 4B8XA 4FISA 3JSTA 2BE5F 4MHGA 3PO3C 3RDIA 2HWVA 3QRFF 3F8MA 2FMYA 2ZUFA 4CUGA 5LRSA 1I1GA 3GTOK 3TQNA 3CC4I 3Q0WA 4IO9F 3SDBA 3F22A 4PSXA 2X9DA 1WCMA 1R1VA 2QKLB 2XPUA 3UKGA 1ZTRA 3W2VA 1HA8A 3ZQHA 4IRGA 5IYDJ 3S15K 4KMFA 4BACA 2DCEA 3JRCA 1ETXA 1U9OA 1FBSA 2DW4A 2LSOA 4M73A 1Y6IA 1W36D 4B3XA 1P4AA 3RPUA 3I4PA 2Z5UA 3F72A 4C2MJ 2CSOA 5DM6F 1U5TA 4A3IC 1V5VA 1D8KA 3GTKJ 1SMYF 3ECHA 2BY0A 3PM1A 3C18A 3ZPLA 1FNNA 3BR3A 1K6OA 3SJMA 1YIOA 5C44J 3IHUA 5FKNA 5JVGF 2LD5A 1JTXA 4QJVB 2EV5A 4YFXF 4IVNA 2L9SA 4IQ4A 2R92A 1TW3A 2JH3A 3HSRA 5GAEJ 3TOAA 4NQWB 1QO0D 4LOWA 4M9SA 2X6OA 4W1UA 4Q4ZA 3RPUD 3W6VA 2FRHA 4P5OA 2LG4A 4RGRA 4CYDA 1D1BA 4Q5SF 2VBYA 3V7RA 3CQZK 2OQRA 4PGHA 2E2IJ 4M3DA 3JAMK 4M3BA 3L09A 4HQMA 2V9VA 3BR0A 1YX3A 4BY1C 3TDUC 2ZXHA 1YE9A 2VQLA 3HBLA 3T02A 4ENKA 4CCOA 2HXIA 3I3LA 2VQCA 2X48A 2ZMEB 3HTUA 1E3HA 1RR7A 3CCVI 2JRTA 2DK5A 3LQQA 2E1MB 2M45A 3CP8A 4ZZDA 4UVAA 4A0ZA 2W1OA 3HC7A 1HI9A 2GA1A 1R7JA 3RTRA 4C9YA 2Y48A 1A04A 1TWGJ 3J7AO 4BLAA 3AG4H 4L9JA 3HOZJ 2XKPA 3HXAA 4FTHA 1YJNI 3GFMA 3S2HC 3IWFA 2P81A 4MTDA 2Z3YA 1F9NA 2HNHA 2MSYA 3T8RA 3WHCA 5DD8A 4C3HJ 4BHCA 3A2KA 1O28A 4KN4A 4HF1A 3GTMK 1BJAA 1JHHA 1IXCA 2XB0X 4U0WA 1ETWA 3N4MA 4G7OA 2W4SA 3LA3A 1HBXG 5LGTA 5D4DA 1R71A 3EUHA 1H88C 1IGNA 1FX7A 3W6JB 2GIVA 1JVIA 3OYDA 1HXDA 3BG6A 3O8GA 5H20A 2EJRA 3ABKH 5IT9K 1FJLA 2L9VA 3WTTC 4KATA 1LUJB 1K83K 2D5VA 1V5FA 2K86A 1KGSA 4J19A 1J6VA 2DK8A 2CJJA 2ESNA 1SFOJ 1FSEA 2B63A 4XKVA 1IW7F 1FWZA 4G6TB 5CQEA 2KJCA 4C3JJ 4RDUA 1ZAOA 4WILA 1O4XA 2RQPA 4V2GA 2DA4A 4XCHA 2XHKA 4NNJA 5M5YJ 1ZG1A 3G1OA 1G3WA 3K7AC 1RUOA 3NUHA 4CXFA 4LR2A 3S1MK 1TWCJ 2ECCA 4BE2A 4E7KA 3CMYA 1NG7A 3A4CA 4G6QA 3I56I 3AD9C 4XLPA 1J7KA 1WH7A 4IOCF 5IP9C 2TDXA 4U7DA 2BOLA 2FEZA 1WZ2A 3S16K 1BR1A 2E1CA 1Z77A 3HRTA 2TRTA 3VYRB 3BPVA 1DUXC 1ZR2A 2MC4A 1YJ9I 2ELJA 2XGDA 1H9GA 4KARA 4KAWX 1H9TA 3S1MJ 5L3BA 1YW9A 3GTLC 1AHDP 1G59A 5HDKA 3GTPC 1T56A 1HF0A 3BPXA 4XR6A 1VQKI 2R93K 1FOWA 3CJQB 1Y1WA 1W7PB 4KICA 1AA7A 5K7HA 1WPKA 2K3FA 3S16J 3HPHA 1OFCX 1AU7A 3KLNA 3A8JA 4IJAA 2XCOA 2VKDA 4CZCA 3HOYK 2Y69H 3IC7A 1FOXA 2FJ1A 4C3IK 3RSNA 4Q4ZF 2JTVA 1FBQA 1SC7A 1P4WA 4A6EA 1T0FA 3FKIK 1APLC 1O29A 1O3QA 1AKHB 4FASD 1RC9A 3TGNA 4IKFA 4Y7NK 4KC6A 2W82A 1OPCA 3HRSA 5DM7F 2WB1A 2WB1L 4QSHA 2QSFX 2W7NA 3GTQK 1XMAA 5CYVA 1IJWC 1TTYA 3HKZN 2F5VA 1TQMA 4C3IJ 3TFJA 4BQAA 4M9XA 5F08A 2YU9K 2NNNA 3BJOA 4P9FA 4YIIA 5LGUA 3VODA 3FKIJ 2VONA 2KQRA 4I2OA 3S17C 3S1RK 2E5NA 4Y7NJ 3BDDA 3ML6A 5CVRA 5JLXA 2EZIA 4P55A 1SD6A 1CF7B 3PL8A 2Y0SN 4LG3A 1LQ1A 1D3YA 3L2RA 2WB1D 4BH9A 3SYTA 2PX9A 4RAGA 2DTZA 1IBAA 2DMUA 3LA7A 2WAFA 1JUMA 3VOEA 1GXPA 4M71A 2GM4A 5GAHJ 1Z3YA 3K1NA 2WY8Q 2L3DA 2LKSA 3RKYA 3S1RJ 2R7VA 1WSRA 2B7EA 2ZJRF 4ZDLA 1XG1A 5IYBK 5EF6A 4UV8A 4Y52K 1DP7P 4UY8I 5FGMA 1K78A 4ZZLA 3GTGA 3T1BA 2LR8A 5HL8A 4HG2A 4GGGA 1UHSA 4WXCA 3CO7C 4L0YB 4XLNA 2H8RA 3BROA 1ETOA 1WJBA 2WY7Q 2HR3A 3OOUA 1JKRC 4A3BJ 3S2DK 5L3CA 2K02A 3PO3J 3H1CA 3O3KA 3L2CA 4KYWA 2FBIA 2COMA 2NOGA 1MBHA 3TO9A 5A2QZ 1HDDC 5LEKA 3PQKA 2JQ7A 3ZN0A 2R7ZC 1ONVA 2YU3A 4U0YA 2VUMA 5J40A 3VSKA 2EV0A 1R36A 2DPDA 1R9TA 1XCBA 4IZZA 4QIWN 1S72I 3BZKA 4M3FA 2KISA 3K69A 3CCMI 4I6ZA 4R1HA 5LHGA 4KIFA 1DU0A 5KNLA 1W0UA 3FK6A 4HSRA 3DEWA 2QQ9A 3CMEI 1VQNI 1HQCA 1LPQA 2DU9A 3HL2A 4DZPA 1IL2A 1QVTA 4XLPF 2FU4A 4OINA 1EH6A 4D7NA 2FA5A 3TP0A 1P92A 3FWEA 3M4OK 3FIWA 3DFGA 3OYJA 2DA1A 4A3IJ 2K9LA 5BOXA 2XF6A 1IG7A 1XZPB 4XORA 2LVSA 3KX2A 4MGRA 3D5RC 3VYUB 3IH3A 1TC3C 4A3JK 2VPLA 1SVLA 1EFWA 4KMHA 2LK2A 2BYVE 3SQNA 2CFAB 2HTJA 4KMAA 1GE9A 3E6CC 4P1WA 3CO6C 5K7ZA 5M3MJ 4CH7A 1XMXA 3VEPA 4WCGA 4OAZA 3JRHA 2LKXA 1I1SA 2XSDC 4IPAA 2CQXA 1M1EB 4C45A 2A6TA 2IAIA 2XV4S 2RGVA 3OY9A 3KE2A 3I0TA 4DYQA 4IL6C 4LITA 1KONA 3MMLB 1ZGAA 4GXOA 3SZPA 3HOTA 3HXLA 2M7BA 5IP7C 1S6LA 3S1QJ 4RB2C 4A3DK 2E7WA 3HOWC 2V26A 2IGNA 2XGXA 3VB2A 3IH2A 1KYWA 2JA8C 1JE8A 3V8LA 4UUVA 1ODDA 4HBLA 2DTRA 4R79A 2XAJA 1TWAC 4F91B 2VC0A 3CJTB 3C3WA 1Z3XA 3FF5A 5JI6A 4BY1J 4XMYA 4CCLA 3S1NC 3ZMUA 1R1TA 1Z67A 2XASA 2H6BA 1HOMA 4OIQF 2KIQA 3E5XA 1FP1D 3EQLA 4O6JA 4B4CA 1JJ8C 4A3EC 3Q5FA 3WE3A 5ILUA 4M6VA 3S2HK 1YRNA 4RA2A 3RPQA 4HNVA 4ESJA 1YG2A 2E2HK 4AU7A 3RZDC 3ELKA 4PFPA 5JHUA 2GA2A 1OQYA 2NNYA 5CLSA 4A5NA 3BP8A 3A0HC 3MZHA 4RMFA 3ABUA 1OCZH 3CZ6A 5E20A 2H8WA 2VC1A 4F3QA 2STTA 4BHPA 2GSUA 1W1WE 3TKYA 1PUFB 1I50A 1YJWI 2Q8KA 2KKOA 4HX7A 4LB5A 1I3QA 2RNGA 3DQVC 4TV7A 3S2HJ 1DD5A 3HOSA 1EJ9A 4GTCA 4HAMA 3SZGA 5J4YA 2V7FA 3B02A 3M8JA 5FD5A 1J09A 3RQ4A 4M3EA 5B1BH 3RI4A 5JR3A 4P5BA 2JA7A 3GSIA 3LAJA 4KMDA 1BIBA 1G3YA 3HOUK 1T08B 4GTDA 3ZXSA 2ELHA 5ED4A 1EI6A 3PO2C 2Z99A 5KHDA 2LF7A 2M0CA 1KU7A 1TNTA 1K6YA 1T95A 3DBHB 4JBAA 4ZYEA 1S5LC 2DDAA 3W2WA 1W36C 5J8CA 5IP9K 5FLXK 3VWBA 2DT6A 1N78A 3O6BB 2BY2A 1ERDA 4MQ9A 2H1KA 2ME6A 2P7CB 2K7LA 2GAUA 2L5QA 4YELA 4HSTA 3VFZA 1U2WA 1WCMC 2IA2A 3JW4A 1MDMB 2VPRA 1IQ0A 3F23A 3K7AJ 1LVAA 3K4JA 3M9AA 2E2IC 3BY6A 3DBRB 1WJ5A 2STWA 5E17F 4XQFA 4PDKA 5IP9J 2OTJI 2R7SA 4ENJA 3ONQA 1JJ6C 1MBFA 2EZLA 3CF5F 3H0GK 4O2DA 4HOBA 5J1UA 3S3OA 3REOA 2FD5A 1RI7A 1VQOI 1F7VA 2DOAA 3HHHA 2R7QA 2NVYA 2FUG2 3TP3A 1NTCA 1U5TC 4HNUA 4Y4RA 5C3EK 3FXKA 2R7OA 1QU3A 2HPMA 1ETVA 5F64A 3GTLJ 1XGMA 3WHBA 2P6TA 3F8CA 5HS7A 3GTPJ 5LEJA 2R92C 4BXFA 1MBJA 4KB4A 1R5HA 3ABMH 2L02A 3AL0C 4S0HB 1AWCA 5E3MA 3I4MK 5EEGA 2HYJA 1W5CC 5JHFA 2HS5A 2LH9A 2K5CA 1JI8A 1VQPI 3HOZC 4FHTA 4E7ZA 4G7HA 4BHBA 2HOTA 4YFNA 1I6HK 2NVXA 4ZH4F 4RB1A 2EFNA 2JA6A 1BC7C 5TISC 3CC2I 3ZR8X 2XAGA 3I71A 4PCQA 2CU7A 1A35A 3E97A 3H5AA 2P5LC 3RIRA 3K4KA 2YUSA 3IAM2 4HF0A 2K85A 4GYGA 5DDGA 3E5QA 4E4HA 1UHWA 2VXZA 3OYBA 2BE5A 2R0QC 3AQPA 2F4OB 2CW0F 1BR4A 2M1BA 2TCTA 4JK1X 5E79C 1ZELA 5F0CA 4XLFA 5D5VB 1ZGJA 2FXAA 2Y2ZA 1ZG5A 4G6DA 1QGPA 2JPCA 3OS0A 5LD2C 3EQLF 3A02A 5CVIA 1UV7A 5C4XC 4U88A 1SFOC 5D6FA 1YW7A 2EH3A 3H3UA 1XDSA 2A69A 2GQQA 3S17J 3QOPA 1TLHB 3I53A 2L9RA 1BOAA 2PN6A 3GTJK 1Y0UA 3B6AA 2NS0A 2RV8A 3IKVA 3A03A 3VDXA 2WWYA 3G4AA 2R7WA 4O3MA 1V3FA 2WAQN 5CPRB 1X19A 1XSDA 2NOJB 4A3GK 2WA0A 2P4WA 3V7SA 4YFKA 2F5EA 2O5IA 2NVQK 1VFCA 3LSMA 3H92A 4I0BA 1SMYA 3HUGA 4UUSB 4KASA 4M3GA 1MMSA 3CUOA 3L00A 2MA3A 4AYBA 5BMZA 4AYBL 1QA6A 2L0KA 3TW7A 2IRFG 1MJAA 4N4NB 1S3JA 2K4BA 1P7JA 3EUHC 2OF7A 3M1CA 2A5YB 2CUFA 2VKEA 4I99C 2CUZA 2IXSA 2ZXWH 1WSUA 5FLMC 2GXAA 1GV2A 2E71A 1SANA 1POGA 5IOQA 2CQQA 2J5OA 1FEXA 3PNTA 5ILVA 1VGXA 1Y1VK 4L9VA 1B8IB 1PP7U 2QYOA 3FOEA 1BI0A 1EK8A 2ZFZA 4YG2A 1B4BA 1DCPA 3Q3QA 2QSHX 2R7ZJ 2D45A 3LSIA 4UV9A 3TBIA 2ME0A 4AYBD 2W57A 2KJBA 3K10A 3M3YJ 3CMAI 4MQ9F 4BXXC 4A3KC 3VPRA 3GF2A 3M1EA 2ISZA 1RNLA 2QBYA 4PJMA 3WTWC 1KQ0A 2E2JK 4EMSA 2V9KA 3HEFA 4KN7X 2HQAA 4IOAF 4XBFA 4A0YA 1C0AA 1A36A 2VE9A 5F0HA 2X51A 4MFEA 5M5WK 1U5TB 3A01A 4ITVA 2HDWA 3BG3A 4WK8F 2V1DA 1BW6A 1FSHA 2ZKZA 1TP4A 3ABTA 3M7GA 1JTYA 1BC8C 3BUEA 3HOWK 3CUQA 2R7TA 1F5TA 3AL0B 2OJED 4EJOA 4KMUX 1DPRA 1MMAA 1ZRDA 1BJZA 3C2BA 3HRUA 3SXYA 3V42A 4IHVA 2E7XA 1IN7A 3KYDB 1Q1HA 4MO7A 2X85A 3ZQ7A 3MMYB 1XN7A 4BBRJ 2NVTC 3JRDA 5DUKA 2ZSIB 4A93K 2P8TA 2QLZA 4MEXF 1YI2I 2HZTA 5IP7J 1DGWY 4XONA 2X0LA 3QPTA 3HOWJ 3BR1A 3PIPF 4DDQA 4G7HF 2JA8J 4YFNF 3BLYA 2H1LA 3RYPA 1T0FC 1TWAJ 2L4AA 5ILSA 3AQOA 5TMFA 4L9NA 2ZJPF 1HKSA 3PNVA 4B3AA 2E5ZA 3EUAA 2H27A 3S1NJ 1WJFA 4GDFA 3BCBA 4M72A 1W4MA 2RQQA 2QEXI 1ON2A 1ZG3A 5IYDK 3LSGA 2MD5A 4A3EJ 1SVOA 4AIJA 1IW7A 3BTIA 1ITYA 3I55I 3RZDJ 2VT3A 1SVMA 2CQKA 1L0WA 1HDPA 2W25A 3CCRI 4C2MK 1X1PA 2M9HA 3GTOA 1IN4A 1R22A 1W0TA 3EYYA 5J6XA 5JVOA 2ZNZA 3GTKK 1ORKA 2PMHA 2A69F 2L2OA 3QODA 3CESA 4E6KG 3L1PA 1HW1A 1XSVA 2CQ7A 4Y15A 3OYMA 1PP8F 5C44K 1IZ1A 1SAUA 3HGYA 4G8XA 2KIFA 1JUPA 3JREA 4GTEA 2O8XA 2BW3B 4WJ4A 3MZ8A 1ISEA 3LQRA 4DQ2A 5FLVA 1O2FB 4KIGA 2CQNA 4BY7J 2E36A 3OSFA 3HOXC 4YFKF 2Z2SB 2MBFA 1Z6RA 3HM5A 3BZCA 2J5PA 3IH4A 1WCMK 2FQOA 1LNWA 3RCOA 2LP0A 3GTGC 3PO2J 1KA8A 3P9CA 2E2IK 4C2UA 3D5LA 3S93A 3JCUC 3N0BA 3H35A 4ETSA 1D1CA 2ZNYA 5J1RA 3TW6A 3QWLA 2HPIA 3BP3A 5EYRA 4MEYF 5LHIA 3FBNB 1Z05A 2LOOA 4CHUA 2R5ZA 1VQ8I 1Z7LA 1U8RA 1JQWA 3GIRA 2VUMC 3WODA 1A5JA 4JX4A 4LIUA 5K1YA 3QU3A 1WCMJ 3J7YJ 3KETA 3AFHA 1R9TC 3S1QC 3PIOF 3MAJA 2CV1A 4YG2F 2PHCB 2COBA 2DBBA 2LMDA 4M1XA 3CQZA 2W7VA 2OUMA 4S04A 3HPGA 5AIPA 2GBYA 5GTIC 5HLTA 1R5GA 3NQOA 1FMWA 2CUJA 4D1QA 3FISA 1EA3A 2HZDA 4JP0A 1TWGK 3UNGC 2IGKA 5E68A 1X3ZB 3N97A 2JA2A 3HOZK 1D5YA 4V2FA 3WU2C 3J80Z 2H6CA 1L0OC 2A5WA 4H0EA 1N77A 3S2WA 4ZYDA 2JJ7A 1HW5A 2XPWA 2DOEA 1FMVA 1LJ9A 3MEXA 2M87A 3LFKA 4A5MA 2D6FC 2XB5A 2LKPA 3K4CA 3N05A 4C3HK 1RR8C 2R92J 2Q1ZB 2RN7A 5DCFA 1JKQC 4X1EA 2FE3A 2HYGD 3GBGA 3I59A 4AM3A 3KP4A 5HLIA 1UJ8A 1O24A 3PFYA 1MSFC 1XXCA 2BXZA 3U9GA 1H0MA 1WJDA 2Q2EA 1UFMA 2R7DA 2KIMA 2JPBA 4U87A 3CD6I 3CCYA 4XK4A 1D1AA 3OIOA 1D0XA 1HLVA 1RKTA 4A3MC 1SFOK 2OZUA 1WHUA 5FJ8J 1ZARA 2XAFA 3GTMA 3D0SA 2LRDA 3DEUA 4C3JK 4IEJA 2ZCWA 5ICFA 4A3CC 1QNTA 2HQ5A 1AB4A 5B3SH 5M5YK 4NC6A 5HLGA 2MGQA 2QZ8A 2QENA 1TWCK 1UZCA 2EV6A 1MBGA 2MLKA 1C0WA 1B9NA 1O57A 2OD5A 2F6CA 5DV5A 4OIRF 4XOTA 1ZRCA 1K83A 3W3CA 3W2AA 3F8NA 2UV1A 3LAPA 3K9TA 3BZ6A 5C4XJ 3SZYA 5EGOA 3J81K 5TJ3A 3BP8C 5DEQA 4GFQA 1SMTA 3HHGA 5A2QK 2ZC2A 3DTKA 2OQGA 4G0VA 4D9JA 3WGGA 4IHXA 4XRSG 3OV8A 3E3VA 2G0EA 3FMQA 4XN3A 2VOOA 1I3QC 4G12A 1ZHFA 4NBQA 3OREA 1IDZA 4GT9A 1ZR4A 4FE7A 1U0JA 4DYCA 4A3FC 4XRMA 5D5UB 3OR1C 5CVUA 5KAFC 1K78B 1O2AA 2JA7C 4DW6A 1O3RA 2JA5A 2DJNA 4NQWA 5EDNA 2O61A 3R6SA 2X1DA 1QQIA 1V5EA 4OIOA 2M8EA 2XAQA 4FE4A 2Y9ZA 1WFXA 2F5CA 1KU2A 2ID6A 4C2TA 5FLMJ 1WH5A 2V1NA 5D4RA 1WJCA 3E7LA 2P5VA 2R93A 5KK1A 1E3OC 1XPXA 2BEOA 4BDZA 2B63J 2QUFA 3S14C 3H9JA 4KN4X 4EJVA 4G0WA 1LKXA 1PJ5A 3WU0A 2P5KA 2E1NA 3GZNB 4P9UA 4BXXJ 4A3KJ 3AH5A 2GXGA 4RAFA 5D4SA 3H36A 3H0DA 1BM9A 2FBKA 3WODF 5ICCA 4BXUA 4L5JA 2YR2A 2OU2A 4BEHA 5HNHA 4OIQA 2JT1A 3ESWB 3GFLA 2R5YA 3TEDA 3S3NA 4KFCA 1IE0A 4HRIA 3IV5A 1S29A 3DPTA 4ENNA 5DD4A 4R8HA 2YS9A 1K4TA 1TWFC 1T38A 2NVYC 3TTGA 3BR5A 4WWCA 3GTQA 3JRBA 4F52A 1R49A 1SD4A 4GO1A 4A3LC 4I76A 4AVZA 2OCEA 3ZQFA 3JAMZ 5EEHA 1YHQI 2PJPA 3LWFA 2YU9A 1P2FA 3OYGA 1QBJA 1XGNA 3QAHA 4DYRA 1SFUA 1XX5A 2VASA 1Y1WJ 2MLGA 3A0BC 2XCQA 4JQFA 4RB0A 4P9SA 2PLYA 2EFQA 3IUOA 2NVTJ 4O5VA 3G73A 4N9HA 5FKOA 3P5JA 2OV7A 2E35A 2NVXC 1OCPA 2PMUA 4A3BK 3C2HA 2JA6C 1LE8B 3PO3K 2A07F 3S32A 1RRJA 2ID3A 2L4MA 1J6XA 1USOA 4FZBA 1X31C 1VTNC 1I3AA 1TNSA 2ECBA 3DWLE 3KYCB 4EV0A 5ICGA 3OOPA 3MD2A 1G3TA 4KM8A 2XRLA 4PABA 3HKZA 2QKMB 3U21A 5LFAA 4EGZA 2QA4I 3S3MA 3HKZL 5HDGA 5LLQA 2LY9A 1S7EA 1J75A 3H3VK 5GAGJ 1YFHA 1B4AA 1R6RA 3AG3H 2W84A 1LFPA 1OKRA 1PVEA 3ISPA 4PJNA 1IUFA 1XTAA 3FM5A 5DTDA 2ESHA 1O7LA 4XLAA 1N25A 2FNAA 3T5XA 1IRFA 2HOSA 2Y0SL 4BKWA 3LFUA 4A3IK 5K7FA 3H5RA 4I01A 1FOKA 3M3YC 1USTA 2AQEA 2HOEA 4EQQA 4A69C 3HKZD 5EEAA 1QRYA 5ICEA 1OYIA 1TT5B 2UXNA 5L3GA 4ZTFA 3H3VD 1GLNA 2W00A 4G7ZF 5M3MK 1TZLA 3CCJI 5FO5A 3GO5A 2KPMA 4V19K
chains in the Genus database with same CATH topology
4E70A 3FOFA 4L18B 3B73A 4LGWA 2CG4A 2CYYA 5K5QA 2O3FA 1J0RA 1ZRFA 1YTYA 2XRNA 2HKXA 4OIOF 3SFZA 4IF4A 5L3FA 2Z9OA 3HTSB 5FFXA 5HLHA 4Y13A 1IN6A 4OMZA 2HDCA 1OYWA 1KU9A 3QX3A 1B6AA 5D5XB 2IVMA 1MGTA 2D1HA 4HLXA 4GCVA 2HKOA 4LG0B 3HSFA 4ESBA 3CJNA 3U1DA 5AIQA 1D8JA 3V7CA 1KQ8A 4FX4A 2E2HA 3CUQC 1QZYA 1BN5A 4K2EA 2FOKA 4EM1A 1BJTA 1Z7UA 4N9IA 2PG4A 4P5AA 1HSJA 2YSRA 1CGPA 4U0VA 1LEAA 3JSOA 4A12A 4ZYGA 3I64A 2DQRA 4OOIA 4ON0A 1U3EM 1V4RA 4HF2A 4AIKA 4GYIA 3QP5A 1XB4A 1IN5A 2EA4A 3M8FA 3IWZA 1R1UA 1X3UA 1IRGA 3F8FA 1XMKA 5H6RA 1G3SA 1YW8A 1F1ZA 3SZTA 1B59A 3GVAA 2EA2A 1XCVA 4HZFA 2DQLA 1YS7A 3JSPA 2RVCA 2X4HA 3H0GA 2CFAA 1XD7A 3L7WA 1KYZA 2L01A 1R58A 2XCRB 2KWAA 3PFIA 5CVVA 2K27A 1Z9CA 3WG9A 1B9MA 1ZLKA 3IL2A 1L3LA 2WV0A 4AD9A 3R61A 2PBIA 4GTBA 5H6QA 3KFWX 2QBYB 3WTYC 2PQ8A 1EH1A 1OR7A 1BI3A 2V79A 4KDPA 2DAOA 1UB9A 5IORA 4OIPF 5CHPA 1TQPA 3CUQB 4KUMA 4LLLA 2ZXJA 3HRMA 2A6HF 2AXLA 2C6YA 1GXQA 3GTJA 1UCRA 4GTLA 1LDDA 2Y3PA 1WQGA 1FY7A 4CO8A 2NRAC 4AIHA 2A6EF 4MTEA 1IAWA 4YIFA 1IN8A 5CVJA 3K1MA 3OEPA 1PDNC 1I5ZA 2KIUA 5D6EA 2Z33A 2BV6A 1F4KA 1MDMA 5E1WA 2EB7A 3G3ZA 4CGZA 4AVPA 3FHZA 4G94A 2LF8A 2JZYA 3F3XA 1Y1VA 5HS8A 1REPC 3GX4X 1FC3A 1TWHA 1O27A 4G0UA 1G6NA 3FMSA 3ZP5A 1NHAA 5IT3A 5E18F 3HYIA 2ZBKA 2M5WA 3FM3A 3TO7A 1T2KA 5E8GA 1P4XA 3J80K 2WC2A 2ETHA 1QPMA 3DP7A 1IXSB 4HYEA 1E17A 1IF1A 3DPLC 2VODA 4D0PA 1WQFA 4U7BA 2R7FA 5DCMA 2FBHA 2M30A 2EFOA 4RB3C 1YS6A 1ZVUA 3TOBA 2HYFA 3WGHA 1ZREA 2QWWA 4GTAA 2GWRA 3E6MA 1T98A 1YQAA 1SFEA 4EVIA 5JVTA 4KM9A 4CICA 5JFRA 4OMYA 3N3YA 5FB2A 4HW0A 2CO5A 3RKXA 3ZMZA 1OYYA 3GTKA 3KLOA 2DFIA 5IOTA 2G9WA 3MCZA 2XROA 2VN2A 1O25A 1FYKA 1W5SA 3RYRA 3FZVA 2XAHA 4UVCA 1FT9A 2V6CA 1KQ4A 2H09A 2EWNA 3WE2A 2LNBA 1Z6TA 2E2IA 3WGIA 1MD0A 4M6YA 3DV8A 1ZXOA 1T39A 2CGPA 3E5UA 3KP7A 1IS1A 3QU6A 2XIGA 4XRFA 3H3ZA 1DDNA 5D8LB 4XSXF 4S05A 2G7UA 4WX9A 4A2UA 1YLFA 1TWGA 2OBPA 3I54A 4FX0A 2DPUA 4RGUA 3KEOA 2EFPA 5BQTA 1G4DA 3E6BA 3R4KA 1JXSA 2IJLA 3CDHA 3OPFA 1ULYA 1IXRC 5F1RA 2O0YA 1E2XA 1XGSA 3I5UA 4ENMA 2GSOA 2PEXA 1DPUA 3C1DA 3WTXC 1IUYA 4P96A 1XXBA 2DI3A 2P5MA 1ON1A 4L9TA 2YX7A 4EGYA 4QWQA 3WTUC 1PUEE 2P7VB 1SFOA 2F5DA 4CZZA 4UVBA 1XGOA 2MH2A 1FLIA 1BGWA 1XXAA 3T8TA 1TWCA 1MZBA 1MKMA 2XUBA 4WXDA 1O3TA 3U2RA 4I09A 4EM0B 2A68F 1UHMA 2FNPA 1R23A 1ZH5A 3ZMVA 3ZMDA 3F8BA 5E8IA 3COAC 5LBQA 2HQRA 1WQ2A 1BBYA 2JSCA 1WRJA 2AS5F 4UXNA 2R3SA 3GWZA 1WWXA 5IOSA 2OAZA 4KIBA 4A0XA 3Q9VA 3W6KB 4IRHA 1RIOH 4UHTA 3T0YA 3V8KA 1XSXA 3EDPA 5L3EA 3KZZA 1EH7A 4LMYA 4OU0A 2A61A 4HA8A 3WTSC 1WQHA 3F6VA 4LK0F 5TJJA 2EFWA 4ZYHA 4L5IA 2ZMEA 3FKIA 2D1VA 1YYVA 2DT5A 3I58A 2GSNA 4BYYA 2MC3A 1BIAA 2EK5A 4I02A 4ASNA 1ZN2A 2HTSA 2QQAA 4WXHA 3N0CA 5TRDA 1S7AA 4Y17A 2K4JA 1USSA 4HLYA 3MZYA 2F5FA 4KA4A 2OZ6A 2W85A 2LDUA 3P9KA 2VOPA 4RS8A 4KDDA 4LFUA 1WIHA 2RKHA 3DKWA 3FX3A 3ZN1A 1GVJA 4N0BA 4KNYA 3GYHX 3E6DA 2ISYA 1Z1DA 3KZYA 3CAGA 3NEUA 4M9ZA 1XDUA 1SFXA 4EM2A 2HFHA 3ECOA 1LDJA 3G4CA 2W24A 2XVCA 3MQ0A 1P6RA 4XSZF 4IHTA 3WTZA 4G7OF 5IT9Z 4ILDA 4RAZA 4MQVA 5FFZA 3JTHA 5DUIA 3J81Z 3S0XA 1W7PA 5DYMA 2IA0A 5JFEA 2DO7A 2QVOA 3WTVC 1I27A 1FZPB 5KVRA 1TBXA 4NB5A 1HKTA 5ERIA 5FD6A 3GZ6A 3VA7A 1ZLJA 3WU1B 4HV6A 4IHSA 1O7FA 3FXRA 2G7HA 2V1UA 1W7PD 2P6SA 1FYLA 1D5VA 2FF4A 3EETA 3ERED 4GTFA 4HV5A 4RGXA 4I7HA 2PFBA 5BPDA 4I0AA 4CDGA 3GXOA 5J8FA 1U78A 3GFIA 1T6SA 1JHFA 1CF7A 5E1ZB 4KT5C 1EV7A 3GUDA 3P7NA 3R60A 2RNJA 3FXQA 2A3SA 3LPXA 1FP2A 3NRVA 1K79A 4G9YA 2VBZA 1SD5A 2WTEA 4LLGF 4HX8A 3Q9SA 1K7AA 2GZWA 2BBYA 4IRIA 3K2ZA 3O2PE 1LB2A 1WI9A 2RDPA 1ZBSA 1KU3A 3LA2A 5AONA 3BJAA 4BAYA 2VE8A 3C7JA 1SD7A 3HIFA 1KQ9A 3ZMTA 2UWMA 4C2MC 3SHFA 1SAXA 3EYIA 4EJWA 1U6GA 3BOQA 1QZZA 2FQ3A 4LQYA 2PI0A 2XKOA 3GTLA 3GTPA 4NHJA 5LHHA 4PZJA 2FMLA 4FT8A 4XLNF 1STZA 4FM9A 3V4GA 5LGNA 1YO5C 1EH8A 5E1XA 3ZMSA 3AAFA 1TQIA 2IW5A 4HDUA 5EGHA 3RKWA 3L4KA 3BWGA 3BJ6A 2NAZA 1RZ4A 5BS6A 2NYXA 5F6FA 3ROUA 5BPIA 3DXJF 2IA1A 1TWFA 4LG0A 1MJBA 2B0LA 2ZJ2A 3DF8A 4PGGA 3L4JA 4I98B 4OINF 4BLBA 4LLNA 2HQNA 3MFKA 2RH6A 3L9FA 2UZKA 4DNCA 1J59A 1MJ9A 2CFXA 3GFJA 2HGCA 4UNOA 2O6GE 2VBXA 3KP2A 1S7OA 2VBWA 5HVQC 4J3NA 3KP5A 1FBUA 4A6DA 4B09A 4HX4A 3V8JA 2YPRA 5CJ9A 1HW2A 3IRRA 2H94A 4C3HC 1J2XA 1B1BA 1OMIA 4Z2YA 3HSEA 3TO6A 5LRRA 2DLLA 1LEBA 5DCMB 2KRFA 4MNUA 3KP3A 4Q48A 1HSTA 2F2EA 3KCCA 4LB6B 4AWXB 3IKTA 5D5WB 1W5TA 5HS9A 2IT0A 2IP2A 4C3JC 2R7ZA 3GZ5A 2OA4A 5HDNA 5D8KB 2MH9A 4LJZF 2ACJA 2FSWA 3M8EA 1AOYA 2RC4A 3K1PA 3P9IA 4KB2A 3IRQA 2VT2A 3ULQB 5K5RA 5EGEA 3FMRA 3GLXA 4EJUA 2ZO4A 4Q47A 5FLXZ 2GXBA 2CWEA 3K0LA 3R0AA 5K5OA 2QM3A 4M6XA 4HQEA 3TDZC 2BGCA 4M74A 4RAYA 2ADUA 3LSTA 3GW2A 3F21A 4LK1F 1J5YA 2Q0OA 1RUNA 1FPQA 1TWAA 1HKQA 4F7ZA 1J9IA 1BI2A 4QLCU 3JTGA 2HEOA 2L54A 3R0JA 4IXAA 3QPHA 3PQJA 4LD5A 2V1XA 3MWMA 1R00A 1FYMA 4HDVA 1WKMA 3FXUA 6PAXA 3GEZA 4C3IC 4WF2A 1O3SA 4BNCA 1TW2A 4RGSA 5L3DA 1LDKB 1JGSA 1ZYRF 3RJPA 3KP6A 3F6OA 1GHCA 2ZFWA 3QP6A 1O2BA 1I6XA 1S8NA 2O03A 4L0ZB 2IPQX 3CLOA 3I59B 2UXXA 2D2WA 2RGRA 4EJTA 3KEQA 5HOOA 1O26A 4ESFA 1BI1A 1Z91A 2QQBA 2YX4A 2Y0MA 2Y75A 3CTAA 4B8XA 2BE5F 4MHGA 3RDIA 2HWVA 3QRFF 3F8MA 2FMYA 5LRSA 1I1GA 3TQNA 3F22A 1WCMA 1R1VA 4IRGA 4KMFA 1FBSA 2DW4A 2LSOA 4M73A 1P4AA 3RPUA 3I4PA 2Z5UA 3F72A 2CSOA 1U5TA 1D8KA 1SMYF 3ECHA 3C18A 3ZPLA 1FNNA 1K6OA 1YIOA 3IHUA 2EV5A 4YFXF 4IVNA 2R92A 1TW3A 2JH3A 3HSRA 3TOAA 1QO0D 4M9SA 2FRHA 4P5OA 4RGRA 4CYDA 4Q5SF 2VBYA 3V7RA 2OQRA 4PGHA 3JAMK 3L09A 4HQMA 2V9VA 3TDUC 4ENKA 2ZMEB 3HTUA 2JRTA 2DK5A 3LQQA 2M45A 4ZZDA 4UVAA 4A0ZA 2GA1A 1R7JA 3RTRA 2Y48A 1A04A 3J7AO 4BLAA 4L9JA 2XKPA 3GFMA 3IWFA 4MTDA 2Z3YA 1F9NA 3T8RA 5DD8A 4BHCA 1O28A 4HF1A 1BJAA 1JHHA 1IXCA 4U0WA 3N4MA 3LA3A 1HBXG 5LGTA 3EUHA 1FX7A 3W6JB 2GIVA 1HXDA 5H20A 2EJRA 5IT9K 3WTTC 4KATA 2K86A 1KGSA 2DK8A 2ESNA 1FSEA 2B63A 1IW7F 1FWZA 2KJCA 1ZAOA 2RQPA 2XHKA 1ZG1A 3NUHA 1G3WA 4LR2A 1RUOA 4CXFA 4G6QA 1J7KA 2TDXA 4U7DA 2FEZA 2E1CA 3HRTA 1DUXC 3BPVA 1H9GA 4KARA 4KAWX 1H9TA 5L3BA 1YW9A 5HDKA 3BPXA 1Y1WA 1W7PB 4KICA 3KLNA 4IJAA 2XCOA 3IC7A 4Q4ZF 2JTVA 1FBQA 1P4WA 4A6EA 1T0FA 1O29A 1O3QA 3TGNA 4KC6A 1OPCA 3HRSA 1XMAA 5CYVA 1TTYA 1TQMA 4BQAA 4M9XA 2NNNA 3BJOA 4P9FA 4YIIA 5LGUA 3VODA 2VONA 4I2OA 3BDDA 3ML6A 5CVRA 4P55A 1SD6A 1CF7B 1LQ1A 1D3YA 4BH9A 3LA7A 3VOEA 1GXPA 4M71A 3K1NA 2L3DA 3RKYA 4UV8A 1DP7P 5FGMA 1K78A 4ZZLA 3GTGA 3T1BA 4GGGA 4WXCA 3CO7C 4L0YB 3BROA 2HR3A 5L3CA 2K02A 3O3KA 3L2CA 4KYWA 2FBIA 2COMA 3TO9A 5A2QZ 5LEKA 3PQKA 2VUMA 3ZN0A 1ONVA 2YU3A 4U0YA 2EV0A 1R36A 2DPDA 1R9TA 1XCBA 3K69A 4R1HA 5LHGA 4KIFA 2QQ9A 1HQCA 2DU9A 4XLPF 2FU4A 1EH6A 2FA5A 1P92A 3FWEA 3DFGA 5BOXA 4MGRA 4KMHA 2BYVE 3SQNA 2CFAB 2HTJA 4KMAA 1GE9A 3E6CC 3CO6C 3VEPA 4WCGA 1I1SA 4IPAA 2XV4S 2RGVA 3KE2A 3I0TA 3MMLB 1ZGAA 3HOTA 3SZPA 4GXOA 1S6LA 4RB2C 2E7WA 2XGXA 3VB2A 1KYWA 1JE8A 3V8LA 4UUVA 1ODDA 4HBLA 2DTRA 4R79A 2XAJA 2VC0A 3FF5A 3C3WA 5JI6A 3ZMUA 1R1TA 2XASA 2H6BA 4OIQF 3E5XA 1FP1D 4O6JA 3Q5FA 3WE3A 5ILUA 3RPQA 4ESJA 1YG2A 3ELKA 5JHUA 2GA2A 2NNYA 5CLSA 4A5NA 3BP8A 3MZHA 3ABUA 5E20A 2GSUA 2STTA 2VC1A 4BHPA 3TKYA 1I50A 2Q8KA 2KKOA 4HX7A 4LB5A 1I3QA 3DQVC 4TV7A 1DD5A 3HOSA 4GTCA 4HAMA 3B02A 5FD5A 3RI4A 4P5BA 2JA7A 5JR3A 3LAJA 4KMDA 1BIBA 1G3YA 4GTDA 2ELHA 5ED4A 2Z99A 2LF7A 1KU7A 1TNTA 4ZYEA 4JBAA 5J8CA 5FLXK 3O6BB 2P7CB 2K7LA 2GAUA 3VFZA 1U2WA 2IA2A 3JW4A 1MDMB 3F23A 1LVAA 3M9AA 3BY6A 2STWA 5E17F 4PDKA 4ENJA 4HOBA 3REOA 1RI7A 3HHHA 2NVYA 1U5TC 5F64A 1XGMA 2P6TA 3F8CA 5HS7A 5LEJA 4KB4A 1R5HA 2L02A 1AWCA 5EEGA 2HS5A 4FHTA 4BHBA 2NVXA 4ZH4F 4RB1A 2EFNA 2JA6A 1BC7C 2XAGA 3I71A 4PCQA 3E97A 2P5LC 3RIRA 4HF0A 5DDGA 4GYGA 3E5QA 1UHWA 2VXZA 3AQPA 2CW0F 2M1BA 4JK1X 5D5VB 1ZGJA 2FXAA 1ZG5A 4G6DA 1QGPA 2JPCA 3EQLF 5CVIA 4U88A 5D6FA 1YW7A 3H3UA 1XDSA 2GQQA 3QOPA 1TLHB 3I53A 1BOAA 2PN6A 1Y0UA 2NS0A 2RV8A 3IKVA 3G4AA 2WWYA 4O3MA 1V3FA 1XSDA 2P4WA 3V7SA 2F5EA 3H92A 4I0BA 3HUGA 4KASA 3CUOA 3L00A 2MA3A 5BMZA 2IRFG 1MJAA 1S3JA 2K4BA 2A5YB 1WSUA 5IOQA 2J5OA 5ILVA 4L9VA 1PP7U 2QYOA 3FOEA 1BI0A 1EK8A 2ZFZA 1B4BA 3Q3QA 2D45A 4UV9A 2W57A 2KJBA 4MQ9F 3GF2A 3M1EA 2ISZA 1RNLA 2QBYA 3WTWC 1KQ0A 4EMSA 4KN7X 4XBFA 4A0YA 2VE9A 1U5TB 4WK8F 2V1DA 1FSHA 2ZKZA 3ABTA 3M7GA 1BC8C 3BUEA 3CUQA 1F5TA 4EJOA 4KMUX 1DPRA 1ZRDA 3SXYA 3HRUA 2E7XA 1IN7A 1Q1HA 3ZQ7A 1XN7A 5DUKA 2P8TA 2QLZA 4MEXF 2HZTA 2X0LA 3QPTA 4DDQA 4G7HF 4YFNF 3RYPA