3LAPA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-canavanine.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
149
Chain Sequence
b'ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator/dna
total genus 46
structure length 149
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lapA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lapA02
2KIMA 3KE2A 3GF2A 4MQVA 1KU3A 3ABUA 1FNNA 5E8GA 3VOEA 2H6CA 2XGXA 5FFZA 1J75A 1EH1A 4HA8A 3WG9A 4YFKF 3OV8A 3HTSB 4Q4ZF 2COMA 4WF2A 4WXDA 4KA4A 5F64A 2NRAC 1FWZA 1MDMB 1PDNC 2HFHA 1STZA 1ZYRF 1G3WA 2XROA 3J81K 2G7HA 1FX7A 5JI6A 1UB9A 3OEPA 1ZGAA 2PQ8A 2LF8A 1WSUA 3H3ZA 3P9CA 4BNCA 2JTVA 3QP5A 1IN6A 1FSHA 1YO5C 1FC3A 1ZAOA 2VN2A 2XAGA 1KYZA 3DF8A 4L5IA 1XMKA 4MTDA 1IN7A 2Q0OA 3FF5A 2EFNA 4BXUA 2E7XA 3VB2A 2VC0A 3O3KA 3V8JA 4E70A 3WTTC 3H92A 2DTRA 1OYYA 1NHAA 4LK0F 5HS9A 1EH6A 4LK1F 3RIRA 3V7CA 1T0FA 1PUEE 1U5TC 3R0AA 1IS1A 5FB2A 1ZG3A 3GZ5A 4AIKA 4Z2YA 4UVAA 2C6YA 2K86A 1W7PB 4UUVA 1ZVUA 5JFRA 5HDGA 1OKRA 3GLXA 1HSJA 1HBXG 5KVRA 4M71A 1ZARA 3DXJF 4S05A 2QZ8A 1BIBA 2FE3A 2BYVE 2CGPA 4IRHA 5D5XB 5D8LB 3MFKA 1IN4A 2HTJA 1GE9A 2YX4A 2W25A 3L7WA 1LNWA 2BEOA 3DPTA 2HDCA 3RTRA 1JGSA 1K78B 2QENA 2RC4A 3F72A 5F1RA 2CFXA 4LLNA 2JSCA 2OAZA 4YFXF 2EB7A 3PQJA 2KJBA 4U0VA 3RYPA 3RDIA 5F6FA 2R7FA 1ZH5A 2EFWA 1R5GA 5J8FA 5ICEA 5L3CA 2PJPA 1RUNA 2DPUA 4QLCU 1IN8A 5HDKA 1IF1A 3L00A 5LHGA 3LPXA 2ESNA 2ACJA 4ZYEA 3R60A 2XIGA 2OZ6A 5CJ9A 4I98B 2O03A 2M8EA 4I02A 3COAC 5LGTA 3CO6C 1USTA 2WTEA 3WTSC 1Z6RA 4HAMA 3JTHA 3HUGA 6PAXA 1K7AA 1B4AA 3MQ0A 4RB1A 1TTYA 1RUOA 3KCCA 4RB3C 2RGVA 4CICA 4IHTA 4PGGA 2E7WA 1ZRCA 2HKXA 3WE3A 2A5YB 3RYRA 4LG0B 2ZFZA 2UXXA 4B8XA 1FPQA 5ICGA 3KLOA 2XAJA 1SFUA 2GA2A 2EV5A 4ENNA 1BI3A 2CWEA 3KEOA 4IHSA 1EK8A 2AXLA 2XV4S 3HSFA 2LKPA 3V4GA 3BROA 2DLLA 2GWRA 4MGRA 1RI7A 1LQ1A 1S8NA 2KWAA 2J5OA 4PCQA 4YG2F 1OYIA 2FMYA 1J59A 1ZLJA 1P4XA 2IPQX 3HRSA 3CUQA 3GXOA 3WTUC 3TGNA 1L0OC 1FT9A 2Z9OA 2L02A 4P9UA 4PZJA 4CHUA 2NNYA 2LDUA 3K1PA 2KJCA 3RKXA 4DDQA 2QQAA 3GYHX 3W6JB 5JR3A 2UZKA 3WU0A 3JTGA 4M73A 2RV8A 2EA4A 1IXCA 2FOKA 4HLYA 5FD5A 1B9MA 5CLSA 2HS5A 4RB0A 3SHFA 1BC8C 2DK5A 5DCMB 1U6GA 2J5PA 1AOYA 3U2RA 4R8HA 2XCRB 3ZQ7A 2ZNZA 3SQNA 1YYVA 2VODA 2FMLA 1ON2A 2RQPA 3F22A 5H20A 3K1NA 1BIAA 4L18B 2YR2A 1G3TA 3TO7A 3ZMTA 2XAQA 3N4MA 2OD5A 4EQQA 2R7DA 1YW8A 3RKWA 4I0BA 2F2EA 1HW1A 4MTEA 3J80K 1XSVA 3GFMA 1YFHA 2LSOA 5BQTA 1SD6A 4KYWA 1XSDA 2VE8A 1ZLKA 4KUMA 1L3LA 2HQNA 2A07F 1YS7A 1KA8A 2FXAA 3B02A 2CSOA 1FSEA 2K27A 3K9TA 1R58A 3F8BA 3L2CA 5JVTA 4IXAA 1YIOA 4EJWA 2X4HA 2MBFA 3E3VA 5HS8A 4CZZA 1AB4A 4LLLA 4XLPF 2V1XA 3VEPA 3SZPA 1LEBA 1S7AA 4P5OA 1P6RA 1R36A 3BPXA 3T8RA 4OIOF 1W7PA 5DD4A 4RGSA 4OU0A 4EJVA 1S6LA 3KFWX 3TDZC 2YU3A 2HZTA 3WODF 4P9FA 4RGXA 1I27A 1W5SA 3IHUA 2BE5F 4FT8A 3M8EA 4KN4X 2XRNA 4AD9A 1B1BA 2WC2A 4U7BA 3I59B 1QGPA 3IWFA 3LAPA 1SMYF 3QP6A 5HDNA 4G0UA 2K4JA 4RGRA 2QQBA 5FGMA 2FNPA 3T8TA 4A0YA 1FY7A 3WGIA 4UV8A 3ZMUA 1F9NA 2PFBA 3ABTA 1U5TA 1K78A 1ULYA 2JPBA 5AIPA 1MJBA 1FZPB 3I54A 4UNOA 3F6VA 1B4BA 4ZYHA 1V3FA 3VFZA 1SD7A 2Q2EA 1D8JA 3HHHA 1ZG1A 2K02A 1G4DA 2XCOA 2O61A 2HOEA 2JPCA 4AIJA 4M6XA 3MZYA 3IKVA 2IA1A 1T98A 4F7ZA 2D1VA 2AS5F 3TKYA 4EM2A 1R1TA 3R6SA 1E17A 2BBYA 1P2FA 4HQMA 4BYYA 4KIBA 1FOKA 5HS7A 2DFIA 1A04A 4XBFA 1I1SA 2XVCA 4Y13A 4A6DA 1ZN2A 1T39A 2R3SA 3RPQA 5K5QA 3CDHA 3O2PE 3IC7A 3CUQB 3LFKA 2M5WA 1TW3A 1YQAA 1T2KA 4WWCA 4IPAA 1XD7A 4LB6B 3PQKA 4FHTA 4O6JA 4LG0A 1KQ9A 2Q8KA 2FBHA 4QWQA 1O7FA 3SFZA 1G3SA 1YTYA 4HF2A 3KP3A 4ENJA 2NYXA 2STWA 3W6KB 1TLHB 3ZMDA 3FX3A 2ETHA 4EGYA 4GO1A 4ZYDA 4L9TA 4YIIA 2L54A 3HYIA 4NHJA 2ZBKA 1XXCA 4M6YA 4L9VA 4OOIA 3I71A 3D5LA 1T38A 4WCGA 1O57A 3LQRA 1KU2A 1REPC 4NQWA 1ONVA 4UXNA 2VBZA 1LVAA 2IA0A 4ESFA 4HDVA 4L9NA 1V4RA 3F8NA 2X0LA 3G3ZA 3GUDA 3BUEA 2D45A 2P6TA 4BH9A 3M9AA 2JT1A 4YFNF 2GXGA 4KIFA 3HHGA 4XSXF 1KU7A 1HSTA 1JE8A 1DPUA 4EJUA 1Z1DA 5CVJA 4GYGA 2KIFA 1WI9A 1IUYA 5DCMA 3FMQA 1GHCA 2OZUA 2VONA 1P4AA 4A6EA 2G7UA 2VC1A 2DQRA 1TNSA 3F6OA 3QU6A 2HKOA 4ASNA 1CF7A 1HXDA 2MC3A 4ENMA 5BPDA 5D4RA 2DPDA 1TW2A 2V9VA 4L5JA 1TQMA 1WQ2A 3GVAA 4NB5A 3CLOA 4ZZDA 1Z9CA 1Q1HA 3FXQA 3IWZA 1R1UA 2RDPA 3NEUA 4Q47A 4EJOA 5TJJA 1W7PD 4O5VA 4M9XA 2ZO4A 2PBIA 2ZMEB 4BHBA 3FOEA 2F5EA 3F8MA 5D8KB 1XSXA 4WX9A 4ON0A 4PDKA 1KYWA 4AVPA 2GA1A 3DV8A 1U5TB 5H6RA 3LA3A 4P55A 4EMSA 2L4AA 2QWWA 1AWCA 3KP7A 3ZN0A 4G8XA 3R4KA 2P5LC 2F5CA 4IRIA 1R23A 2GZWA 3ML6A 3BJOA 1J2XA 1ZREA 2M87A 3I59A 2DAOA 5DEQA 5LRSA 3F3XA 5JVOA 4HW0A 4EM0B 2A61A 4OINF 3J80Z 4HX8A 3IRQA 4P96A 2LNBA 1DP7P 1JXSA 4BQAA 1QNTA 4IF4A 3REOA 1JHHA 2Z33A 4RS8A 3KP5A 1RNLA 4GGGA 4EV0A 2V1UA 2XCQA 4TV7A 3KP4A 1H0MA 4KB4A 3BY6A 1GVJA 1MJ9A 1DUXC 3I5UA 1FYKA 4HX7A 1OR7A 2ZNYA 1FBQA 3FMSA 1I1GA 2V79A 2XAHA 4RAZA 3JW4A 3BJ6A 1YG2A 4HX4A 5AONA 3FM3A 1SFEA 2M45A 3CUOA 1ZHFA 4I0AA 3FXRA 1W4MA 3D0SA 2CO5A 3WTVC 5IT9Z 2Y0MA 4LGWA 3BJAA 3E6DA 2DI3A 2EFPA 3K0LA 4GXOA 1LEAA 2VBWA 1WRJA 4EGZA 4KICA 3O6BB 4YIFA 1USSA 2O6GE 4G6QA 2QVOA 1O3QA 2FU4A 1IRFA 2QQ9A 4IJAA 3V8KA 3C3WA 2PN6A 5CVRA 3GFIA 5HLIA 3WGHA 5J6XA 2G9WA 4U0WA 2P5VA 5H6QA 3HOSA 3I4PA 5DYMA 3AAFA 1HW2A 1G3YA 1U8RA 4KB2A 4BHPA 2B0LA 3I64A 3WTYC 2FBIA 2L4MA 4GYIA 1XN7A 5L3GA 4LMYA 2YPRA 4K2EA 5E20A 3BPVA 1H9TA 1R00A 1D5VA 5LBQA 3BOQA 2EFQA 3BDDA 2PMUA 4HF1A 3GZ6A 5KK1A 1CF7B 4BHCA 2ADUA 1D8KA 2FNAA 2XKOA 4G0VA 3I0TA 1O3SA 4A12A 2EFOA 1OPCA 3PFIA 3KZYA 5CVVA 4KIGA 3ERED 4MNUA 3JAMK 4KFCA 1QO0D 3OREA 4Q5SF 4CO8A 5D5WB 1EH8A 1T6SA 3RI4A 3BP8A 3KZZA 4KDPA 3LQQA 2EV0A 2Z3YA 4UV9A 3P9IA 2VT2A 4EVIA 5E1ZB 2GAUA 3QPTA 3FMRA 4CDGA 1LDDA 4J3NA 1U3EM 2D1HA 4EM1A 1TQPA 1K6OA 5K5OA 3MCZA 2GIVA 4MEYF 2FSWA 3F8FA 3QU3A 2NNNA 4N0BA 3EYYA 3F8CA 1U78A 3ZMSA 3MAJA 4MQ9F 2QLZA 1BN5A 1BGWA 1UCRA 1Y0UA 4HOBA 2MD5A 3LSTA 2VBYA 4UVBA 5FLXZ 2ZFWA 1OYWA 2GXBA 1IN5A 5IT9K 2P7VB 2KIUA 1Z91A 2RNJA 5DV5A 2FBKA 1F1ZA 2ZMEA 4DQ2A 1O7LA 1H9GA 1QZYA 4D0PA 4ZH4F 3GEZA 4OMYA 2IVMA 5EEHA 4OIQF 1FLIA 2OU2A 3EDPA 2HYFA 3WTXC 3HIFA 1SFXA 1IZ1A 1TQIA 2VE9A 2QM3A 3TO6A 2PHCB 2Y75A 3WGGA 2A6EF 5ILSA 1YW7A 2CQKA 5HLHA 4KAWX 3V7RA 2MH2A 3E5XA 4KDDA 4KN7X 3T1BA 1I6XA 3E5UA 1BI1A 4U0YA 2VT3A 1ZRDA 2MLKA 1XDSA 3IL2A 5ICFA 1I5ZA 4EJTA 3T0YA 2H6BA 1BM9A 3QPHA 3WE2A 3E6CC 5LHIA 2W57A 2P5MA 3K1MA 3DQVC 4ENKA 2ZJ2A 3WTZA 4ESJA 1W5TA 5ILVA 4A0XA 1HQCA 3NUHA 4CGZA 5J8CA 3EETA 2ISZA 3ELKA 3QX3A 2EV6A 4XRFA 2FF4A 5AIQA 4G94A 5L3BA 2HEOA 2HTSA 3JSPA 3OPFA 4R1HA 1B6AA 3HRMA 3SXYA 1HKSA 5L3EA 4WXCA 3IKTA 2M30A 2LF7A 2BGCA 2DT5A 3GFLA 2BV6A 2FRHA 4H0EA 2W84A 3E97A 2FA5A 3FWEA 2MA3A 4OMZA 1FYMA 1SMTA 1B59A 3FHZA 3ROUA 4L0ZB 2A69F 2VBXA 4ETSA 1XMAA 1XGNA 3ZMZA 1WQFA 1SD4A 4DNCA 2IP2A 5FLXK 3BZ6A 2ELHA 3TOAA 4JBAA 2IJLA 3S2WA 1GXPA 4R79A 2HYGD 3KEQA 3DKWA 1OMIA 2IRFG 1G6NA 2QUFA 2YSRA 2L01A 5ERIA 4U88A 1KQ8A 2DO7A 2P5KA 1O3TA 2PLYA 4KMFA 1KQ0A 3HSRA 2HWVA 4MHGA 1QBJA 3L09A 1MKMA 2QYOA 3FOFA 5LGUA 1UHMA 4M72A 3KETA 1IRGA 1IAWA 4G7ZF 5DDGA 4S04A 3B73A 3TQNA 5LLQA 4UHTA 1Z05A 4U7DA 1WQHA 1XCVA 2JRTA 4LD5A 2FEZA 2Y48A 1LJ9A 3VA7A 4LB5A 2UWMA 4CXFA 3R61A 5LHHA 5E1XA 2EJRA 4M9SA 2XUBA 2EWNA 2D2WA 3K2ZA 2HQRA 2MH9A 1IXRC 3ZP5A 2ISYA 2ZXJA 5JHUA 1R5HA 2Y3PA 3NQOA 1E2XA 3FM5A 3GO5A 3I53A 1XXAA 1LDKB 2XKPA 5D5UB 2K4BA 2RN7A 1S29A 2OA4A 2V1DA 5LEJA 1LB2A 3IRRA 1RIOH 1EV7A 1TBXA 5CVIA 1UHWA 3BWGA 2L3DA 5D5VB 5CVUA 1VTNC 3MMLB 4HV6A 2RVCA 3MEXA 1XGMA 3JAMZ 3Q9VA 1J0RA 1XXBA 1MD0A 1WQGA 3L4JA 3RJPA 2TDXA 3C1DA 3HRTA 2STTA 1O3RA 1R1VA 1Z7UA 2CYYA 4XSZF 1F5TA 3WTWC 2OQRA 4KC6A 5L3DA 2CW0F 1RZ4A 5CYVA 3DPLC 3HSEA 3KP6A 1B9NA 1WKMA 5E1WA 1ODDA 4G7OF 2XHKA 1BJAA 2ESHA 5LGNA 1R7JA 3H3UA 2OQGA 2WWYA 5LEKA 1TNTA 4FX4A 3KP2A 3Q9SA 4KMUX 2M1BA 4GFQA 4LJZF 1S3JA 5DD8A 1FBSA 4WK8F 3HRUA 4I01A 4FX0A 3LWFA 4BAYA 3NRVA 1P92A 5A2QZ 4M74A 2QBYB 4Y17A 4HZFA 1U2WA 4JQFA 3FZVA 3F23A 3CJNA 1BBYA 3I58A 2DW4A 3GWZA 3Q5FA 2W85A 1XDUA 4G0WA 2KKOA 3RKYA 3V8LA 3ULQB 2P4WA 4G9YA 4HBLA 1DPRA 1SAXA 1PP7U 5IT3A 2XAFA 1QQIA 2EA2A 2FQ3A 3CO7C 3EUHA 4ZYGA 2HR3A 1IXSB 3G73A 2V6CA 4HDUA 2JZYA 3EYIA 2RKHA 3U9GA 5FFXA 1UFMA 2EK5A 1ZG5A 1BC7C 5DCFA 5HOOA 3VODA 2Z99A 4L0YB 3P7NA 3R0JA 3F21A 3J7AO 1FBUA 3QOPA 4AIHA 2H94A 1HKTA 2PEXA 4B09A 2RGRA 3E6MA 1PP8F 3M7GA 1KGSA 2KRFA 4MEXF 1D3YA 1WWXA 1BJTA 3TO9A 1MDMA 5FO5A 3MZHA 5ED4A 3DEUA 2IT0A 5K5RA 2W24A 2PG4A 1MZBA 2VOPA 1YLFA 1Z6TA 2F5DA 2WV0A 4UVCA 2VOOA 1EH7A 4IRGA 4A5NA 1P4WA 2DU9A 5LRRA 2Z5UA 2CG4A 1C0WA 3T5XA 2IA2A 1BI0A 1IW7F 1CGPA 3QAHA 5BMZA 5HVQC 3TDUC 3CTAA 3EQLF 3MWMA 2O0YA 2H09A 1KU9A 3LA7A 1J9IA 4FM9A 2P7CB 4O3MA 4AWXB 1FP2A 3E5QA 2XASA 4RGUA 1MJAA 4I2OA 3SZTA 3LA2A 3M1EA 4XLNF 4HLXA 1K79A 3DFGA 5E18F 3ZMVA 3TOBA 4RAYA 5E8IA 3ISPA 2IW5A 3LAJA 1FP1D 2E1CA 2K7LA 2ZKZA 3U1DA 2DBBA 5K1YA 5A2QK 5E17F 1DDNA 1GXQA 1FYLA 3HTUA 2P6SA 2GQQA 2O8XA 4A5MA 3JSOA 2H27A 3J81Z 4L9JA 1S7OA 2O3FA 3CAGA 3ECOA 3GFJA 1HKQA 3GX4X 3L4KA 4G7HF 3GW2A 4I09A 5HLGA 1BOAA 4KT5C 4G6DA 4A2UA 3E6BA 2PMHA 3FXUA 5ILUA 2F5FA 1J5YA 3L9FA 2OBPA 3ECHA 3QRFF 1YW9A 2PI0A 2HGCA 5D4SA 4HF0A 4IVNA 1LDJA 5BPIA 3K69A 1QPMA 2ZCWA 4HV5A 5D6EA 3CUQC 1X3UA 1YS6A 2UXNA 2E1NA 1MGTA 1ZGJA 4PGHA 4WXHA 1WIHA 5L3FA 2P8TA 3OOPA 4I7HA 1BI2A 1R22A 3P9KA 4OIRF 5BS6A 2NS0A 3V7SA 2NAZA 3DP7A 4Q48A 2YX7A 1JHFA 1DD5A 1J7KA 3WU1B 3RPUA 4Y15A 4HQEA 2MLGA 1XB4A 1F4KA 2DK8A 1QZZA 4ESBA 5DUKA 3M8FA 5EEGA 3N97A 1XCBA 4HYEA 2DQLA 4M9ZA 4OIPF 4JK1X 4LFUA 5DUIA 4ZZLA 4RB2C 5ICCA 2VXZA 3KLNA 3C18A 2A6HF 1ON1A 4GCVA 5D6FA 4KNYA 5BOXA 2A68F 3ZPLA 5TRDA 2A3SA 1HW5A 1ZRFA 4N9IA 4A0ZA 3HOTA 1SD5A 3ZN1A 3C7JA 4N9HA 5FD6A 1ISEA 1XGOA 2QBYA 1XGSA 4CYDA 4LLGF
chains in the Genus database with same CATH superfamily
2W1OA 2KIMA 4B44A 3KE2A 3GF2A 4BQQA 4MQVA 1O26A 1KU3A 3ABUA 1FNNA 5E8GA 3VOEA 2H6CA 2XGXA 2Y9ZA 2JVHA 5FFZA 4ABZA 2I8DA 1J75A 1EH1A 4HA8A 3WG9A 4YFKF 3OV8A 3H3VD 3HTSB 4Q4ZF 3S16C 2COMA 4IZZA 2FUG2 3DXJA 1WVRA 1TWHC 3VPRA 4WF2A 1TWAA 2OV7A 3OYCA 1ETOA 1YX2A 4XCHA 3HKZN 1VQ6I 4WXDA 1TWCJ 1VI0A 2L9SA 5IPAA 4KA4A 5F64A 2NRAC 3ADAC 1FWZA 2ECBA 1O2BA 2MSYA 4E7ZA 1MDMB 1APLC 4N4OB 1PDNC 2HFHA 1YX3A 4QIWD 1STZA 5FKNA 1ZYRF 2CQXA 2OJED 1G3WA 2XROA 4M3FA 3J81K 3PO3C 2G7HA 2X1DA 2DA4A 1TZLA 1VQ7I 4IHWA 2W7VA 1FX7A 1SFOC 4PJNA 4PJ0C 1X1PA 1WPKA 4BY1K 3AL0B 5JI6A 1UB9A 4S0HB 3OEPA 1UHSA 1ZGAA 1YNJA 3J7AY 1K83K 2PQ8A 2LF8A 3QOEA 2KIQA 2VUMC 1T95A 4U87A 1WSUA 3LSIA 4C9YA 3H3ZA 4KM8A 3P9CA 1IV6A 5B3SH 2JTVA 4BNCA 2OCEA 4A3IK 1I50K 4BY7J 3QP5A 3GTPC 1IN6A 1FSHA 1YO5C 1UELB 1CQTA 5DM7F 2YU9C 1TWGA 1FC3A 1ZAOA 1QPIA 5IP6A 2VN2A 2XAGA 1KYZA 3OS0A 2V6TA 3DF8A 3GIRA 2L7MP 4L5IA 2QKMB 1XMKA 2DMNA 4MTDA 1IN7A 4UB8C 2LKXA 2Q0OA 4OWRB 5J40A 3FF5A 2EFNA 3Q3SA 3RQIA 4BXUA 2R92J 4RLFA 5IYDK 2KDOA 3HL2A 2E7XA 3VB2A 1R4NB 2VKDA 2EZHA 2VC0A 1X4PA 3S93A 3O3KA 2VQCA 3BR3A 3K2AA 3V8JA 4BKXA 4E70A 3RZDJ 3I4MJ 4C2MK 3AG1H 1WJCA 4BBRC 3WTTC 3BR2A 2AHQA 3H92A 1X2NA 2DTRA 1OYYA 1NHAA 4LK0F 3FKIJ 2R7XA 2L0KA 3JRAA 5HS9A 2B9SA 1ETYA 1EH6A 4LK1F 2DFHA 4BGDA 3RIRA 2JA5K 3V7CA 1T0FA 4MFEA 1PUEE 3S1RK 5JLXA 1GV5A 1U5TC 2JA6C 1K4TA 3HXAA 2O5IA 3GTJK 3ZOBA 3R0AA 5J4YA 2CFAB 1IS1A 5FB2A 1ZG3A 4BXXK 5GPAA 2D6FC 3GZ5A 4AIKA 4Z2YA 4UVAA 2C6YA 2K86A 1W7PB 2B63A 1X3ZB 1JKQC 4UUVA 3V42A 2HDDA 1K83A 1S72I 1ZVUA 5JFRA 5HDGA 1OKRA 3GLXA 1R49A 3BCAA 1HSJA 2R7ZA 2V7FA 4X1EA 3OYJA 2WBMA 1HBXG 3A2KA 1I50A 1L0WA 5KVRA 4M71A 1ZARA 3DXJF 1S7EA 4KMDA 2KHMA 4S05A 3JRFA 3AD8C 3S1MJ 4KARA 1W1WE 2NVXJ 1QU3A 2QZ8A 4LG3A 1BIBA 2FE3A 2BYVE 3QQAA 2CGPA 4IRHA 5D5XB 5D8LB 3MFKA 1FJLA 1IN4A 4BEHA 2HTJA 2M4KA 1O2AA 1GE9A 4E7LA 3M1CA 2YX4A 2W25A 1BL0A 2E2IJ 1O25A 1USMA 1ETQA 1AKHB 2H8WA 5IOSA 1QHHD 3L7WA 1LNWA 1VQOI 3GTOC 1HDPA 2OC6A 2BEOA 3DPTA 2DMUA 2HDCA 3RTRA 4Y3OA 3JRBA 3QYFA 3PO2J 1JGSA 1K78B 2QENA 2RC4A 3CDIA 3F72A 5F1RA 4A3MK 2BXYA 4XLHA 5F0CA 2LRDA 2JA5A 2CFXA 4LLNA 5FLMC 3PUFA 4ITVA 2TRTA 3MZ8A 4BBSC 2JSCA 2OAZA 4YFXF 3E0JB 2EB7A 4GFBA 3PQJA 2R7RA 2CUZA 2KJBA 1JKRC 2V6SA 3GTJA 4U0VA 3RYPA 3OYMA 2M4GA 3RDIA 5F6FA 3LNQA 5EGOA 2R5ZA 2XF7A 1F36A 4E7SA 2FQTA 2R7FA 1ZH5A 3N0CA 5F0FA 2EFWA 1R5GA 3A4CA 5KCMA 5J8FA 5ICEA 5L3CA 2COBA 2PJPA 1TWFC 5IOQA 1RUNA 1T56A 2CW7A 4QLCU 1IN8A 4Y7NJ 3G1MA 2DPUA 3S17C 3DCFA 2GIZA 5HDKA 1IF1A 3L00A 3S0XA 5LHGA 2NS8A 3LPXA 4A93C 3ZQHA 2ESNA 2ACJA 4X6AJ 4ZYEA 3R60A 2XIGA 4M6VA 4LQYA 2OZ6A 3H0GC 5CJ9A 5EZHA 4I98B 1NG6A 2O03A 2M8EA 1VQMI 4I02A 3COAC 5LGTA 4C3JJ 4NC7A 3CO6C 4CZCA 3BLYA 4BE0A 5M5YJ 4XLEA 1V5EA 1USTA 5J1UA 2WTEA 3WTSC 1Z6RA 5F27A 3TFHA 4HAMA 3JTHA 3RPUD 3HUGA 2OUMA 4E4HA 6PAXA 1Y1WA 1XG1A 5FRMA 5FRNA 3TBIA 3LOCA 2DCEA 3GTKK 1K7AA 4A3GK 1B4AA 2DA7A 3MQ0A 4RB1A 1TTYA 4BDZA 1HDDC 1RUOA 1W0UA 1QA6A 3KCCA 4PSWA 1SEUA 4RB3C 2RGVA 3SFIA 2X6XA 4CICA 2XF6A 4IHTA 3HOUC 3QYEA 3FISA 4PGGA 2E7WA 3SJMA 4KMUA 2RAEA 3JRDA 3H3VK 1ZRCA 2XDVA 2HKXA 3GBGA 3WE3A 2A5YB 3GTLK 3GDZA 1Y1VK 3RYRA 4LG0B 2IS4A 2HXOA 2ZFZA 2UXXA 1QRYA 1WCMC 4PJMA 4B8XA 1FPQA 5ICGA 3FXKA 3KLOA 2XAJA 1SFUA 3HGGA 2GA2A 2EV5A 2KRCA 1WSRA 3CMEI 4ENNA 1BI3A 2CWEA 3KEOA 4IHSA 2L9NA 2AXLA 2XV4S 3HSFA 2VPLA 1EK8A 2LKPA 3V4GA 3BROA 2E5NA 3S1NC 4WILA 2DLLA 4M3DA 2GWRA 3RZOC 1JKPC 4KT6A 4MGRA 3I9V2 3TFJA 1RI7A 1GT0C 1LQ1A 3BP3A 1S8NA 4XRMA 2KWAA 2J5OA 4PCQA 4YG2F 3PIOF 1OYIA 2FMYA 1J59A 4A3KK 1ZLJA 5JHFA 1P4XA 1R5ID 4A3JK 2EIKH 5L46A 2IPQX 4D7MA 4B4CA 3HRSA 3CUQA 2HYJA 3GXOA 3WTUC 3ABLH 3AG2H 4A3DC 3TGNA 2HNHA 1MH3A 1D0ZA 1MNDA 1L0OC 1FT9A 2Z9OA 1B8IB 2L02A 4P9UA 3AQOA 2IS6A 3EUKL 4PZJA 3OOUA 4C2TA 1RESA 2I5UA 3CCSI 2GLOA 1PJ5A 2JA7K 2O5RA 4CHUA 2NNYA 2X85A 2O5JA 4GTAA 4XLPA 3GTGJ 2R93J 2LDUA 3GTLA 5M3MK 3K1PA 2KJCA 1Y1VA 1DCPA 3CCJI 4NOIA 3RKXA 1X3WB 4DDQA 3SEQA 2QQAA 4OIOA 3GYHX 1NK2P 5M5YK 3N3YA 2NVQC 3S16K 3W6JB 5JR3A 5FJ8K 1UG0A 2UZKA 2M7BA 1TWHK 4XKBA 3WU0A 1R9TJ 1W36C 3JTGA 2HQAA 2RREA 2X51A 4M73A 1OCPA 5J47A 1JUPA 2RV8A 3WODA 1G8XA 1IXCA 2EA4A 1XZPB 2FOKA 4HLYA 5FD5A 1B9MA 1U0JA 2VI6A 2HS5A 5CLSA 4RB0A 3SHFA 1MSFC 1YCLA 2BE5A 1BC8C 1EQRA 2DK5A 3IAM2 5DCMB 5GP9A 1U6GA 2J5PA 4CCOA 3PO3K 2K9SA 1AOYA 3U2RA 1SFOK 4R8HA 2XCRB 3ZQ7A 2E2HA 2DFFA 2JK3A 2DT7B 2ZNZA 3GTMC 3SQNA 1YYVA 2O8KA 1DP3A 1SMYA 4C3IJ 4XRSG 2VODA 2FMLA 4BDYA 2VKVA 3TW6A 2VUMK 1ON2A 2I10A 2GOMA 2RQPA 3F22A 5H20A 3K1NA 2VB6A 4UY8I 3GTPK 2DODA 4ZDPA 1BIAA 2UV1A 3BR6A 2YR2A 1G3TA 3TO7A 2E60A 4L18B 3ZMTA 2K5CA 2K3FA 2XAQA 2OD5A 2LR8A 4XN0A 5HLTA 3N4MA 4EQQA 2R7DA 2EPFA 4E7JA 1YW8A 3RKWA 4I0BA 4XR6A 2F2EA 3H3VL 1HW1A 4MTEA 3J80K 2BW3B 1XSVA 3IV5A 4KMHA 2HZDA 3GFMA 1YFHA 2R7OA 1C0AA 2LSOA 5BQTA 2QSFX 1SD6A 4XOPA 4P5BA 5IYBK 4KYWA 1XSDA 3T02A 4HSRA 4H4KC 2F4OB 2VE8A 1I3QK 1ZLKA 1F93A 4KUMA 2IGKA 2QSHX 1L3LA 1TWHA 2HQNA 4GZYA 2A07F 1LE8B 3HOVC 1YS7A 1KA8A 4QIWL 2FXAA 3B02A 1SFKA 3BTLA 1MMAA 2CSOA 2CV0A 1FSEA 2K27A 1WJAA 3K9TA 1BW6A 1K4SA 3K7AC 1R58A 3F8BA 3L2CA 5JVTA 4IXAA 1YIOA 4CH7A 1IDYA 2BHYA 4AYBN 4EJWA 2X4HA 4E6KG 2R7TA 2MBFA 2JA6K 3E3VA 1SFOA 5HS8A 4HSTA 5GTIC 2AQFA 4CZZA 1AB4A 5TGTA 4LLLA 4XLPF 2V1XA 2IAIA 3VEPA 1I3AA 3HOWC 2VUMA 3CF2A 3SZPA 2AO9A 3PJRA 1LEBA 1S7AA 2CFAA 2EILH 4P5OA 1TWAJ 1P6RA 1R36A 3JCUC 3GTPA 3BPXA 5IYCK 3T8RA 4OIOF 1W7PA 4GRIA 5DD4A 4RGSA 4XKWA 1X1AA 2YU9A 4OU0A 4EJVA 2A6HA 1S6LA 3KFWX 3BQZA 2B7EA 4NUBA 2YU3A 3TDZC 2KZGA 2HZTA 4RM3A 3WODF 4P9SA 4P9FA 3CCEI 4RGXA 1JJ6C 1I6HJ 1I27A 1W5SA 3IHUA 2BE5F 1OR7C 4FT8A 5EGOB 3M8EA 4KN4X 2R5ZB 2XRNA 4AD9A 1MMSA 1B1BA 2WC2A 5C4JJ 3KYDB 4U7BA 1XZQA 4FQGA 4AH6A 2DYRH 4XLAA 4AVZA 3QYBA 1HCRA 1VQ4I 3I59B 2ID3A 3OIPA 3LSGA 1QGPA 3IWFA 3GTOK 3LAPA 5M5WJ 3DKXA 3CJQB 2NVYC 1HA8A 1SMYF 3QP6A 5HDNA 3A01B 3S2HC 1AKHA 4G0UA 4JOMA 2K4JA 2CH0A 1TWGJ 4RGRA 4ZTJA 3DWLE 5B1BH 2NOGA 4B3AA 1RRJA 2QQBA 5FGMA 4OAZA 2FNPA 1TC3C 3T8TA 4A0YA 5FLMK 1FY7A 3WGIA 2VL8A 2HU9A 4UV8A 3ZMUA 3HG9A 1F9NA 4BBSK 2PFBA 3ABTA 1U5TA 1K78A 1AU7A 1ULYA 2JPBA 2JA6A 5AIPA 1MJBA 2KLOA 1ZK8A 1FZPB 3HUGB 1ACIA 2R92C 4WJ3M 3I54A 4UNOA 3F6VA 1B4BA 4CA0A 3HBLA 4ZYHA 3TL4X 2R7WA 2VQLA 1JKOC 1VQ8I 1V3FA 4A3BK 5LFAA 3I4MC 2JUCA 3VFZA 1IJWC 1SD7A 2Q2EA 1Q1VA 4PFPA 3S17K 1AHDP 1D8JA 3HHHA 2E1MC 4CCNA 4A93K 1ZG1A 1PJRA 2K40A 5JVGF 1RR8C 2K02A 1G4DA 3S2DJ 3DTIA 2XCOA 2AXTC 5HNHA 3F0CA 1T8IA 1BR4A 2M3AA 3H0GK 3L2VA 2O61A 2BXZA 4Y52C 2R7VA 2E5ZA 2HOEA 2P0WA 2JPCA 3LSPA 4AIJA 1UJ8A 2P81A 3CJTB 2EBBA 4M6XA 2HPIA 3MZYA 1POGA 3JRCA 1NTCA 1WH5A 2EQRA 3IKVA 3FBNB 3M4OC 2IA1A 1T98A 4F7ZA 2CJJA 2D1VA 3N05A 1K83J 1X58A 1B72B 2AS5F 3TKYA 4EM2A 2PJRB 1R1TA 4LOCA 3R6SA 2Z16A 1E17A 3GTOA 4IQ4A 2BBYA 4A3IJ 2Y69H 1I50J 5FKKA 2YS9A 1RKTA 1UG2A 2LOOA 2F4IA 1P2FA 2E34A 4AIDA 4HQMA 4BYYA 4KIBA 1FOKA 5HS7A 4B48A 2DFIA 1A04A 4XBFA 4KITB 3BZKA 3RCOA 1I1SA 4DIQA 2XVCA 1P9QC 1XMXA 3HPGA 3Q3QA 4Y13A 2FJ1A 1WJ5A 2HXIA 1R4MB 1ZN2A 4A6DA 2R3SA 1T39A 1G51A 3G4AA 3ABMH 3RPQA 3MD2A 4JK1A 5K5QA 3CDHA 4KMAA 2XGDA 3O2PE 2F4MB 3IC7A 2VXDA 3BTIA 3VDXA 3CUQB 3LFKA 5IYDJ 2V1NA 2M5WA 1XPXA 1TW3A 2K9MA 1YQAA 1JTYA 1T2KA 4WWCA 4IPAA 4RDUA 1XD7A 1LPQA 4LB6B 3PQKA 4C2MJ 2L7KA 4FHTA 2LY1A 4O6JA 3L2QA 4P1WA 4LG0A 1KQ9A 3RSNA 1TWFA 2Q8KA 4F3QA 3MKWB 2FBHA 1MBFA 4QWQA 5CQEA 4DZJA 1O7FA 3SFZA 1G3SA 1YTYA 4HF2A 1M1EB 3KP3A 3S1NK 1JT6A 4ENJA 2NYXA 1ETXA 2JA5J 1ZTRA 2STWA 3W6KB 1TLHB 2X1EA 3FX3A 3ZMDA 2ETHA 1YHQI 3S1RJ 2JH3A 1UV7A 4EGYA 3H0GA 2NXNB 3HPHA 3GTJJ 2WY8Q 1ZR4A 4BXXJ 1IO2A 4C30A 2V4JC 4GO1A 4ZYDA 4EATA 4QPQA 3S14C 4BJTA 4L9TA 4YIIA 2L54A 4KM9A 5EGHA 2JQ7A 3HYIA 4NHJA 2ZBKA 3Q0VA 1H88C 3A8KA 1XXCA 4XLFA 1WJDA 1G59A 2BY1A 2ICWG 4M6YA 3SZGA 4XN3A 4LOWA 3BP8C 4L9VA 4OOIA 4A3LJ 1N77A 3MVPA 2LMDA 2PMZN 3TP0A 3I71A 3D5LA 1E3HA 2PMZA 3HKZA 2W82A 1T38A 4WCGA 4QJVB 4RLQA 1RKWA 1O57A 3S2DK 3LQRA 1KU2A 4QSHA 1B8IA 5TMFA 2HPMA 1REPC 2MG4A 4NQWA 1ONVA 4II3A 2VBZA 1LVAA 4UXNA 2VLAA 2IA0A 4ESFA 4HDVA 4L9NA 1V4RA 3FXLA 1WCMA 4B43A 3F8NA 4MLOA 2X0LA 2B63K 1Y1WJ 4A3FC 3G3ZA 3GUDA 3BUEA 1DU0A 2XF5A 3RQ4A 2R7ZK 2D45A 2M8GX 3SZZA 2P6TA 3JREA 4A3MJ 1FTZA 1P7IA 4BH9A 1Y6IA 2MGQA 3M9AA 5TISC 2JT1A 4YFNF 2GXGA 4KIFA 2XB0X 3HHGA 4YFXA 4Z6YA 4HRIA 3O8HA 4XSXF 5E3MA 3CCVI 3ASOH 4PUSA 1KU7A 1HSTA 4UB6C 1XZPA 1JE8A 3G1OA 1DPUA 4EJUA 1Z1DA 5CVJA 2R0QC 3IUOA 3I4NK 4GYGA 2KIFA 5IOTA 2QEXI 1WI9A 3QWLA 4N4NB 1IUYA 2ZSHB 3SZYA 5DCMA 3GTMK 3S1QK 3FDYA 3FMQA 1GHCA 2OZUA 1Y39A 2VONA 1P4AA 3SDBA 4A6EA 2G7UA 2MC4A 5B66C 2DYSH 2VC1A 4HPQA 2DQRA 4I76A 4IL6C 4OINA 1TNSA 3F6OA 3KX2A 3N0BA 3QU6A 2HKOA 4XONA 4ASNA 1CF7A 2ZMEC 4JYKA 1HXDA 2PMZL 3HKZL 2MC3A 4XLCA 5F08A 4ENMA 3PIPF 3MKZA 5BPDA 3SEZA 2MFZA 3RZOK 2CU7A 5D4RA 4BLAA 5E3LA 2DPDA 1TW2A 2V9VA 4L5JA 1TQMA 1WQ2A 3OS2A 1OCTC 3GVAA 1N78A 1WH7A 4NB5A 2K85A 3CLOA 2BW3A 4ZZDA 1Z9CA 1Q1HA 3A03A 3FXQA 4CUGA 2R5YB 1IBAA 2KL4A 3GTKJ 4A3GJ 3IWZA 3TEDA 4KASA 1R1UA 2RDPA 3NEUA 2GM4A 2WB1N 4F93B 4BKWA 3J7ZI 2WB1A 4CCKA 3K7AK 3OYAA 1A6QA 5EEAA 4A3LK 1J6WA 1LE8A 1Y0NA 3OL3A 4OAYA 1XC5A 1XZQB 4Q47A 4EJOA 5TJJA 3GTGC 3GTLJ 1W7PD 3KIOA 1TT5B 1IL2A 1HC8A 1Y1VJ 4O5VA 1OJLA 4M9XA 2ZO4A 2V9KA 2RNGA 2ZC2A 2PBIA 2Q1ZB 3GTMA 4AUXA 4C3HK 2EIJH 3HOWK 2M7AA 2VJ5A 2ZMEB 3GZNB 4BHBA 3HOZC 2NOJB 1IGNA 2GAGC 3FOEA 2F5EA 3BC8A 3F8MA 2BOLA 3IH3A 5D8KB 3HOYC 2CRGA 1Y1WK 1XSXA 4WX9A 4ON0A 4PDKA 3BG3A 1KYWA 4AVPA 2GA1A 3BCBA 3DV8A 1U5TB 5H6RA 3ZQLA 3I55I 3LA3A 4P55A 1FOWA 2EZKA 4EMSA 2L4AA 2QWWA 5IP9C 1AWCA 1OCCH 4YG2A 3KP7A 1O29A 1BW5A 3ZN0A 2FOWA 4A3KJ 1NK3P 4G8XA 5FROA 3CC2I 4A3JJ 1Z3XA 1MBEA 3R4KA 1MNEA 2P5LC 4CCLA 2F5CA 4C3IC 4IRIA 1R23A 4XL9A 4B47A 1Z0XA 2Q2EB 4IO9F 3AD7C 2GZWA 3ML6A 3BJOA 1J2XA 2K9LA 2NVYK 2ID6A 2KZVA 1ZREA 1AA7A 3ZQCA 1D0XA 2M87A 2W00A 3S2HK 3I59A 2DAOA 5DEQA 3ASNH 4FTHA 5LRSA 4HG2A 3M3YC 2WB1L 3F3XA 3DBHB 1MBGA 5JVOA 1JQWA 4HW0A 4EM0B 2X6OA 2A61A 1PYVA 4OINF 2JA7J 3J80Z 2HVRA 1ZKGA 3A01A 4HX8A 3IRQA 1G2HA 4LIUA 2E19A 4P5AA 4P96A 2LNBA 3LFUA 1DP7P 4Y4RA 5M3MJ 1JXSA 4BQAA 1QNTA 4IF4A 1WHUA 4IOCF 3CESA 3REOA 1JHHA 4FISA 3BT9A 4RS8A 2Z33A 4ZTFA 3KP5A 5IOYA 2GSUA 2KP6A 3S16J 3G1LA 1UZCA 1BA5A 1RNLA 3LSKA 5FJ8J 4GGGA 1TWHJ 2ZXWH 4EV0A 2V1UA 3C2BA 2XCQA 3ZR8X 2IGNA 3NWSA 4J19A 4ZDLA 2WV1A 4TV7A 2JA8C 3OYLA 1JVIA 2BZTA 3KP4A 1H0MA 1R71A 1JI8A 2IS2A 5C44C 3OSGA 4KB4A 3BY6A 1GVJA 1JTXA 1Y8RB 1MJ9A 1DUXC 3I5UA 1EI6A 1FYKA 4HX7A 4MIMA 1OR7A 3PO3J 1V54H 4Y52K 2ZNYA 3ONQA 1SFOJ 1FBQA 5DTDA 3FMSA 2WA0A 1I1GA 3M4OK 2M34A 5F04A 2V79A 2XAHA 2UUZA 4RAZA 3JW4A 3BJ6A 3OSFA 2VUMJ 1YG2A 1R6RA 4HX4A 2NVYA 3DU5A 3HOXC 5AONA 1Z67A 3GTPJ 2V9PA 1KZHA 2TCTA 3FM3A 2E2JC 3DEWA 1GV2A 1B72A 1SFEA 2PJRA 2CQQA 3GEIA 2GOXB 2M45A 3CUOA 4M3GA 4AC0A 4NC8A 1YJ9I 1ZHFA 3RKQA 4I0AA 1OCZH 3K4MA 2R7SA 1Z21A 3WHCA 3S15C 3FXRA 1W4MA 3DU6A 4J01A 1QHGA 3D0SA 2VKHA 2CO5A 4DJAA 2NVTK 2IXSA 1NG7A 2L9RA 2DOEA 3X2QH 3WTVC 1ITYA 4ZYAA 5IT9Z 1VQKI 2Y0MA 5IYBJ 2KFDA 4LGWA 2R92A 3BJAA 1IV8A 3E6DA 1I3QJ 2DI3A 1LVKA 2E2HK 2EFPA 2OPTA 4A3EK 3CMAI 3ERMA 3K0LA 4GXOA 1LEAA 4DZPA 1DGWY 2VBWA 3OYBA 1WRJA 4XQFA 4EGZA 4KICA 3O6BB 4YIFA 3S3NA 1USSA 1WJBA 2F48A 3K6GA 3TW7A 3FXJA 2O6GE 2E35A 4CYCB 3Q0WA 5D4DA 4XNFA 5EJCA 4G6QA 2QVOA 9ANTA 2QF7A 5K7FA 3J7YJ 1O3QA 2FU4A 3A1YA 3OIOA 4NQWB 2JA6J 1J6VA 4BE2A 2L7FP 2DT6A 3CCMI 4MEYA 1IRFA 1KONA 2QQ8A 2H8RA 1EF4A 4LR2A 2QQ9A 3KZIC 3S14K 3HKZD 2PMZD 4IJAA 3CQZC 3V8KA 4G12A 3C3WA 4GTCA 2PN6A 4HNVA 5CVRA 3GFIA 2R4GA 5HLIA 3WGHA 4MQ9A 3ZCOA 2E1OA 5IYCJ 3IPJA 5F1JA 1YX5A 2G9WA 5J6XA 1A5JA 4U0WA 2P5VA 4E7HA 5H6QA 1I39A 2Y0SN 3HOSA 2JWTA 3I4PA 3OYKA 5DYMA 2Y0SA 4FE7A 3AAFA 3CC4I 1HW2A 4KNYA 2PA8L 1G3YA 1U8RA 4QPOA 4KB2A 4BHPA 1KQ4A 1X2MA 1SC7A 2B0LA 3PFYA 1HLVA 3I64A 1RC9A 4IEJA 3PNVA 3A0HC 3WTYC 2FBIA 2L4MA 1FMVA 3OYDA 4GYIA 4BY1C 1XN7A 3ZQIA 5L3GA 3BQYA 4LMYA 1UAAA 1ETKA 2YPRA 2W48A 4K2EA 2M0MA 5E20A 3OYGA 4QJVA 3BPVA 1H9TA 1R00A 3GTOJ 5LBQA 1D5VA 1PJ6A 3BOQA 1ZGWA 4GTEA 2EFQA 2M2EA 2PMUA 3BDDA 4HF1A 2ZJQF 4A3FK 3GZ6A 5KK1A 1CF7B 1FMWA 3GTQC 4ILDA 2XAUA 1F7VA 1IUFA 4BHCA 2WAQN 2ADUA 1D8KA 2CMPA 2X9DA 2WAQA 2FNAA 2XKOA 4G0VA 3I0TA 1GDTA 4OIQA 2YU9K 3QPSA 1O3SA 1A6IA 2ZB9A 5FLMJ 4A12A 4BBSJ 2DOFA 4ZDOA 2EFOA 1OPCA 3PFIA 2BVMA 4EEFG 3KZYA 4BQOA 3OYNA 2KISA 1DCOA 5CVVA 4KIGA 4XM3A 2N8GA 3A0BC 3ERED 4MNUA 2HOSA 3JAMK 3PL8A 2ZFUA 4KFCA 1J98A 1QO0D 3OREA 4Q5SF 4CO8A 5D5WB 2CFOA 5FKMA 5KAFC 1EH8A 3HJEA 4A3BJ 1T6SA 4A3CC 3C2HA 3RI4A 2K3PA 2V26A 5IP7K 3S17J 5B1AH 3BP8A 3KZZA 4KDPA 2A6EA 3LQQA 3F9KA 5C3EC 4BBRK 2EV0A 4A93J 1IDZA 2DA1A 4IHXA 1ZXOA 5C4XC 2JUGA 2Z3YA 4UV9A 2PPBA 3P9IA 2VT2A 4EVIA 3S1RC 5E1ZB 2GAUA 3H0GJ 3HB9A 1W36D 3JRHA 3QPTA 3FMRA 4CDGA 1EJ9A 1LDDA 1WGXA 4AYBA 4J3NA 2WB1D 1U3EM 2D1HA 4EM1A 1TQPA 2DJIA 4BQNA 5K5OA 5KNLA 3OYFA 3MCZA 1K6OA 2GIVA 1T08B 4JX4A 4MEYF 5GAGJ 3W2AA 4DYRA 3JRGA 2FSWA 3F8FA 4PK4A 3QU3A 2NNNA 1OQYA 2PX9A 4N0BA 3EYYA 4KATA 3W2VA 5TMCA 3F8CA 1U78A 3H9QA 3FK7A 2CQ7A 1Y56A 4M3EA 3ZMSA 3HM5A 2WAQL 1OCOH 5FKOA 3MAJA 4MQ9F 1TWCC 2W4SA 5M5XK 2QLZA 1BN5A 2BY0A 5KAIC 1BGWA 1UCRA 2R5YA 1Y0UA 4HOBA 2MD5A 1Z7LA 3LSTA 2VBYA 5J3LA 5CQGA 1X1DA 4RM2A 2ZXHA 3UNGC 4UVBA 5FLXZ 2ZFWA 2M0CA 3CZ6A 2V6UA 1OYWA 3CP2A 3JR9A 2GXBA 1IN5A 2JRMA 1ENHA 5IT9K 2P7VB 4KN4A 3HOZK 3U21A 3JSTA 2KIUA 1U8BA 3HOYK 1YJWI 1Z91A 2ZXIA 2A6TA 2RNJA 3K4LA 5E3OA 2IGOA 2WADA 5DV5A 2ZUEA 3S1NJ 4BY7C 1SVMA 2FBKA 1F1ZA 1MMDA 2ZMEA 5DM6F 4DQ2A 3RZOJ 1WORA 1O7LA 2F5VA 1YNNA 1H9GA 5H2FC 1QZYA 2E71A 4D0PA 5IP9K 4ZH4F 3GEZA 3A8JA 4OMYA 2IVMA 5EEHA 4OIQF 4DBQA 2DOAA 1PJ7A 1BR2A 4UUTA 1FLIA 4AYBL 3B6CA 2OU2A 3EDPA 2HYFA 3WTXC 4AU7A 3HIFA 2QA4I 3MKLA 1SFXA 1IZ1A 4MO7A 4GTFA 3H5RA 4A3DJ 1TQIA 2VE9A 1VGXA 2A5WA 3RZDC 2Z1DA 3K4BA 2VJJA 1TWFK 3HEFA 1EFWA 3M3YK 2QM3A 3TO6A 4IHVA 1WZ2A 2R7UA 2PHCB 2Y75A 3FKIC 3WGGA 2A6EF 5ILSA 1YW7A 2CQKA 5HLHA 4KAWX 3V7RA 2MH2A 3LMMA 3E5XA 3GTGA 3KPHA 2A69A 4KDDA 3S32A 4KN7X 3T1BA 2H1KA 4XKCA 3CCRI 1I6XA 3C2GA 3K10A 3E5UA 1XX5A 5B5EC 1BI1A 2B63J 2FQOA 1P7JA 3BG6A 4U0YA 4A69C 3EUHC 2VT3A 1MBJA 1ZRDA 3GTKC 3LSJA 1SANA 2R7ZJ 2MLKA 3K4JA 2JA8K 1XDSA 5J4VA 3IL2A 2X48A 3FXOA 2ZSIB 3PM1A 3DLLF 5ICFA 4YFNA 1I5ZA 3L2UA 4EJTA 5C44K 4L5EA 3T0YA 2H6BA 1BM9A 4NDLA 4XSXA 3S1MC 3HXLA 4HNUA 2NVXC 3QPHA 3WE2A 2LBFA 4NNJA 3HOUK 1JUSA 1VQNI 3I4NJ 4F55A 2LY9A 3CJRB 3E6CC 5LHIA 3GTMJ 1DCHA 2PA8D 2RQQA 2DDBA 2W57A 5E3NA 3S1QJ 2G0EA 3K1MA 2P5MA 2WAFA 4LIVA 2ZUFA 2E2IC 3SYTA 3TP3A 1H8AC 1VQ5I 5HL8A 3LL7A 1WCMK 3UR3C 3DQVC 5HNFA 3HOXK 2E1MB 4ENKA 4G7ZA 2ZJ2A 3BTJA 4E7KA 1GVDA 1VFCA 2D5VA 2QSGX 2E2JK 2BY2A 3PO2C 1LFBA 2EBIA 3G71I 1ETVA 3FXMA 3WTZA 4XIDA 5IORA 4ESJA 1W5TA 1WOPA 5ILVA 3S15K 4A0XA 2O9LA 1HQCA 3NUHA 4CGZA 3BR0A 2KMUA 3EETA 5J8CA 4PABA 5JFEA 2ISZA 3D5SC 4G6TB 3ELKA 3QX3A 2EV6A 3A02A 1PVEA 3AFHA 4XRFA 3BG5A 3BG7A 2FF4A 3I56I 5AIQA 1WJFA 4A3JC 4JP0A 3IP4B 4G94A 3CD6I 4WJ4A 5L3BA 2IS1A 2HEOA 2HTSA 3ESWB 3JSPA 1F7UA 3EPZA 3CC7I 3OPFA 4R1HA 1B6AA 1FIPA 3HRMA 2EH3A 3SXYA 1HKSA 2XGEA 5L3EA 1MSEC 2ECCA 3E7LA 4WXCA 2HVQA 5EZGA 3IKTA 2VJ4A 2M30A 2LF7A 3K7AJ 4BUPA 2BGCA 4Y7NC 4A3DK 3OL4A 2DT5A 3GFLA 2BV6A 2O7OA 2Y31A 3VSLA 3TFIA 2FRHA 4F91B 4H0EA 4X6AC 2W84A 3E97A 2FA5A 3FWEA 2MA3A 4OMZA 4CYCA 1LFUP 2LC2A 2Y0SD 3MKYB 4C3JC 1FYMA 1SMTA 1B59A 3FHZA 4C3HJ 3ROUA 4L0ZB 2A69F 2VBXA 3CQZK 3HOWJ 5E79C 1N75A 4ETSA 1IRXA 1XMAA 1XS9A 1XGNA 3ZMZA 1MNMC 1WQFA 1ZQ1C 1SD4A 4DNCA 2IP2A 2ZJRF 5FLXK 3BZ6A 1JT0A 2ELHA 3TOAA 2OF7A 2DDAA 2NVQK 3GMEA 2FD5A 4JBAA 1GUUA 5FKLA 4Y33A 2IJLA 1H89C 2QKLB 5EYRA 3OS1A 3S2WA 1GXPA 4PSXA 2BVLA 1DU6A 4R79A 2HYGD 3KEQA 1MMGA 3E1SA 3GSIA 2CUFA 4KJZA 1YE9A 3DKWA 2DMPA 1OMIA 4DGWB 2IRFG 1G6NA 1ZQ3P 2WAQD 4YEJA 5GTHC 2QUFA 5BNGA 2YSRA 3W2WA 2L01A 3G4SI 5ERIA 4U88A 1KQ8A 2DO7A 2P5KA 1O3TA 2PLYA 4KMFA 1KQ0A 3HSRA 2HWVA 2IBDA 4MHGA 3MMYB 2NVYJ 1QBJA 3L09A 2ME6A 1MKMA 2QYOA 3FOFA 1OLTA 2CQNA 5LGUA 5GAHJ 1O28A 1X1BA 3DEEA 1UHMA 3S2HJ 3GTQK 4RMFA 3ABKH 3DBRB 4M72A 2DJNA 5IY5H 3KETA 4YELA 1IRGA 1HOMA 1SVOA 3HC7A 4G7ZF 1PUFB 1IAWA 5DDGA 4S04A 3B73A 3MN2A 4C45A 2LK2A 1BR1A 3VSKA 5M3FK 3NARA 3FK6A 3TQNA 4IOAF 5LLQA 2BY3A 4UHTA 1Z05A 4D7NA 4U7DA 1WQHA 5IYBC 1VQPI 3OY9A 1XCVA 1I3QC 2JRTA 3CQZA 1WJEA 3I3LA 4LD5A 2FEZA 4F92B 4GT9A 4XSZA 4BACA 2QGUA 2Y48A 3S8PA 3AG3H 4A3CK 2NS7A 1LJ9A 3QODA 5E68A 2CW0A 4AYBD 1VJEA 3VA7A 1RETA 2XPWA 4JX6A 3WHBA 3HOVK 5DS9A 1BDFA 4LB5A 5C3EK 2UWMA 5C4XK 2DN0A 3LSMA 4CXFA 1BOBA 4II2A 3R61A 1O27A 5LHHA 5IOZA 4E7IA 4G7OA 2VPRA 2X6YA 3ZQQA 1NH3A 3DKYA 5E1XA 2EJRA 1V5GA 3DTKA 4M9SA 4Y52J 1WSVA 3H9GA 2XUBA 3M4OJ 2EWNA 2XGCA 2D2WA 2R93C 3GEEA 4M1XA 1RPWA 3K2ZA 4X0GA 4ANJA 4BL0B 2HQRA 2MH9A 1IXRC 3ZP5A 3FHNA 5GPCA 2ISYA 1A35A 4V2GA 5GADJ 5IYCC 3LSHA 1IG7A 3GTQA 4LJZA 2CUJA 2ZXJA 5JHUA 1RU0A 1QVUA 3CMMA 1R5HA 1U9NA 2DTZA 3PSIA 4RMNA 1R9TC 2Y3PA 1F43A 2DA3A 1TWCK 1FTTA 3NQOA 1E2XA 3FM5A 3GO5A 1O2FB 3I53A 1XXAA 1LDKB 2XKPA 4ZJZA 5D5UB 1X31C 2K4BA 2RN7A 1S29A 2NVTJ 4YIRX 2LLKA 2OA4A 4PJJA 2NVUB 2V1DA 5LEJA 3CCUI 3H9JA 2E2HJ 3ZRGA 4A3EJ 1LB2A 3IRRA 1RIOH 2BHZA 2GXAA 2MW8A 5GAEJ 3VYTB 1EV7A 1N25A 1TBXA 5CVIA 1VZ0A 1UHWA 1WI3A 2MYSA 4UUSB 3BWGA 3GLLA 2WAEA 2A05A 4O2DA 2L3DA 5D5VB 5CVUA 1VTNC 2GSNA 3MMLB 4BY7K 1X19A 2L5QA 2R7QA 4HV6A 2LG4A 2XB5A 4D5CA 1TT0A 2RVCA 5K7ZA 1IQ0A 4FCYA 3MEXA 1XGMA 3JAMZ 3UKGA 3G2BA 3Q9VA 4BXFA 1J0RA 1DGRM 3VYRB 1XXBA 3S14J 3K70C 1MD0A 1WQGA 3L4JA 3B6AA 4XOTA 3RJPA 2TDXA 4A3BC 2R92K 3FIWA 3C1DA 3HRTA 1YRNB 2STTA 2FX0A 1O3RA 1R1VA 4RA2A 1Z7UA 3I4MK 2CYYA 3RZDK 4XSZF 1D0YA 1E0EA 1F5TA 5FLVA 3BR5A 2JN6A 2OQRA 3CDLA 3WTWC 4KC6A 1K61A 1VF9A 5L3DA 1TWCA 2LBFB 2CW0F 1RZ4A 5CYVA 3FKIK 3DPLC 3K4CA 4D5FA 2LY2A 3HSEA 3KP6A 1FOXA 1B9NA 3QPLA 2EIMH 1WKMA 5E1WA 1ODDA 1BS2A 4G7OF 3T01A 2XHKA 1BJAA 2ESHA 5LGNA 1USOA 3NWTA 2JMWA 2XPUA 4XRSA 1ERDA 1R7JA 4A3FJ 1S5LC 3H3UA 3DPUA 2OQGA 2WWYA 2EZLA 5LEKA 1E3PA 1TNTA 4FX4A 1A31A 2JJ7A 3KP2A 3Q9SA 4KMUX 4W1UA 1TWAC 2XC7A 2M1BA 3CMYA 4GFQA 1JUMA 4MEXA 4I6ZA 2LTPA 2YU9J 2XSJC 3H5AA 4LJZF 5IP7C 3VYSB 1S3JA 2WY7Q 2LKSA 5DD8A 3S1MK 1FBSA 4WK8F 3HRUA 4CSWA 2NVXK 4I01A 4FX0A 3LWFA 4BAYA 2DA5A 1I6HC 3NRVA 2HOTA 1P92A 5A2QZ 5C4JC 3Q0UA 4M74A 1A36A 2QBYB 4Q5SA 4Y17A 4W97A 4ZC3A 4BS9A 4HZFA 4FASD 2DFEA 2E2IK 2Y9YA 1U2WA 4JQFA 3FZVA 3F23A 1YI2I 3BZCA 3CJNA 1BBYA 3OR2C 3K70D 3I58A 2EINH 5IP7J 1K6YA 4GDFA 4FE4A 2DW4A 1MMNA 4BBRJ 3GWZA 3PO2K 3Q5FA 3GCMA 2LVSA 2W85A 1TWGC 2ZJPF 2DXIA 3FKIA 1XDUA 2LREA 2KKOA 4G0WA 3RKYA 1IW7A 2CUEA 3V8LA 4BU2A 4PAAA 2GBYA 3ULQB 2P4WA 3EQLA 2LP0A 4G9YA 3ZXSA 4HBLA 3T00A 1DPRA 2VIXA 1SAXA 4FZBA 3NAUA 4IQJA 2VQHA 1PP7U 3PSFA 5IT3A 2XAFA 1QQIA 2JVGA 5K7HA 2EA2A 2HQ5A 1YIJI 3KYCB 2FQ3A 3CO7C 3EUHA 1IRZA 4ZYGA 2HR3A 3FKJA 2CW8A 4PFOA 3GTKA 1IXSB 3G73A 2V6CA 4HDUA 4BJ5C 3WG7H 3K4NA 2JZYA 3HZJA 2RKHA 3EYIA 3U9GA 5FFXA 5M5XJ 4QTRA 1UFMA 4Y7NK 2EK5A 3OR1C 4XLNA 1ZG5A 3G4CA 2KDZA 1BC7C 3G6EI 2NVXA 3OYIA 3IH4A 2VJIA 5DCFA 1T0FC 3S2DC 4XORA 2HDWA 5HOOA 4X6AK 3VODA 2K9NA 3AH5A 2Z99A 4L0YB 3P7NA 5EF6A 3K4KA 5EG0A 3R0JA 4C3JK 3DLAA 4YRVA 3BG9A 2B63C 3H36A 3F21A 2E2IA 3J7AO 1K83C 4QIWN 2Y2ZA 3HOZJ 3S3MA 1FBUA 1EA3A 3HOYJ 4XKVA 4A3IC 2R7ZC 4DOZA 3QOPA 4AIHA 1I50C 2QCOA 2H94A 4IX7A 1HKTA 1LKXA 2XSDC 2PEXA 1W5CC 4BE1A 1OISA 4B09A 2Y30A 2RGRA 1XPPA 3E6MA 1PP8F 2EZIA 3M7GA 3ZGKA 1KGSA 4ZH4A 1OFCX 2KRFA 1VH2A 1INNA 5IP9J 3AG4H 4MEXF 1D3YA 2LFBA 1J09A 1WWXA 3I4NC 1HF0A 1X1CA 1ZELA 3TO9A 1BJTA 1MDMA 2CS3A 5FO5A 1Y8QB 3MZHA 1I6VA 5ED4A 4G7HA 3DEUA 4XMYA 3S1QC 1WOSA 1VRQC 2IT0A 1V5VA 2F6CA 5K5RA 2W24A 5IYDC 4NC6A 2X6WA 3FBIB 1O4XA 2PG4A 1MZBA 3DTEA 1XTAA 1Z77A 4F52A 2VOPA 3H0DA 4DW6A 3U1KA 4C2MC 1E3OC 1YLFA 5KHDA 1Z6TA 2F5DA 2HOAA 4CCJA 2WV0A 4UVCA 2VOOA 1TWFJ 3W6VA 1EH7A 3M07A 3M3YJ 4IRGA 3KEYA 1ZBSA 4A5NA 4JX5A 4DBRA 2JA7A 1P4WA 2Y0SL 1D1BA 2DU9A 5LRRA 2JA5C 1QVTA 3CLQA 2Z5UA 2CG4A 1C0WA 3PNYA 3PUBA 2W7NA 1VLOA 5TJ3A 3T5XA 1PUFA 2RH6A 2IA2A 4NBQA 1YJNI 3GTJC 1BI0A 1IW7F 3OYHA 1CGPA 4BXXC 3QAHA 3GEHA 4HEA2 5BMZA 3TTGA 1D5YA 1D1CA 5HVQC 3TDUC 1D1AA 3CTAA 3EQLF 3MWMA 1IC8A 2FQ4A 2O0YA 5LD2C 2HVSA 1LUJB 3KYLA 2H09A 4BJ6C 1MW7A 3LSRA 4OIRA 4I99C 1KU9A 3CCYA 2JA8J 3LA7A 1J9IA 4FM9A 2E36A 1V5FA 4XICA 5C44J 2LD5A 2P7CB 4O3MA 4A3LC 4BEHB 4AWXB 2ELKA 1FP2A 3E5QA 2XASA 1YITI 2XRLA 4RGUA 1MJAA 4I2OA 3SZTA 4LITA 3LA2A 1WFXA 2CV1A 3HOUJ 1WOOA 3M1EA 1SVLA 2DMQA 4XLNF 4HLXA 3OMYA 1K79A 3DFGA 1ETWA 5E18F 2L9VA 3GTGK 3ZMVA 3TOBA 2R93K 4RAYA 5E8IA 2IGMA 3ISPA 1ZR2A 2OTLI 3O8GA 4C3HC 2IW5A 3LAJA 1FP1D 3TMOA 2E1CA 4OIPA 5CKTA 2DA2A 3L2RA 2K7LA 5CHPA 1WCMJ 2ZKZA 2HI3A 2V6EA 3DBLB 2KPMA 2IEKA 3M8JA 3HOXJ 3U1DA 1Y1WC 2DBBA 5K1YA 5A2QK 2OTJI 4BLBA 2E2JJ 3OYEA 5E17F 1DDNA 1GXQA 1FYLA 3HTUA 4GTBA 1R9TK 1Z3YA 4M3BA 3D5RC 2P6SA 1UMQA 4D1QA 2GQQA 2A68A 2O8XA 4A5MA 5HODA 4A3MC 3JSOA 2H27A 3J81Z 5F0HA 3S15J 2LH9A 1TL8A 4AM3A 3SDGA 4GTDA 4L9JA 3CP8A 1S7OA 1T33A 2AQEA 2O3FA 4DYQA 2DMTA 3CAGA 1I3QA 3ECOA 3GFJA 3HGYA 3H35A 1HKQA 4PJLA 3GX4X 4C3IK 3L4KA 1VQ9I 4G7HF 2VASA 1MBHA 3GW2A 4V2FA 3VYUB 4I09A 3H1CA 2CV2A 2JA2A 2XPVA 1JJ8C 1FEXA 5HLGA 1HI9A 4LLGA 3P5JA 4DYCA 4B3XA 3IH2A 1BOAA 4KT5C 3L1PA 4G6DA 2H1LA 4A2UA 3E6BA 3VWBA 1FOYA 2PMHA 3FXUA 4UUSA 1MBKA 5ILUA 2F5FA 4MFDA 1J5YA 3L9FA 2OBPA 3ECHA 3QRFF 4YFKA 1YW9A 1V55H 2R93A 4Q4ZA 2PI0A 3W3CA 1ORKA 1MH4A 2KT0A 2HGCA 3CQZJ 5D4SA 3OWTA 3WU2C 4HF0A 1JGGA 4GTLA 3S3OA 3AKZA 4IVNA 1LDJA 2K9QA 5BPIA 3K69A 1OCRH 1QPMA 2ZCWA 4HV5A 5D6EA 3CUQC 2NVQJ 1X3UA 2OCCH 4KN7A 1YS6A 2UXNA 4C2UA 1X4OA 2E1NA 1MGTA 1ZGJA 4PGHA 4WXHA 1WIHA 4A3GC 1R9TA 5L3FA 2P8TA 3OOPA 4I7HA 3OIQA 1BI2A 1R22A 3P9KA 1ZYRA 4V19K 4OIRF 4CCMA 1YRNA 5BS6A 2NS0A 3L2WA 3V7SA 5EGEA 1RR7A 2NAZA 3DP7A 4Q48A 2YX7A 1BJZA 1JHFA 3IAS2 5CPRB 2KQRA 1DD5A 1J7KA 2JSPA 2MD0A 3WU1B 2ME0A 3RPUA 4Y15A 5JLWA 2GSOA 4HQEA 4BY1J 2L2OA 3BR1A 1JOEA 2MLGA 1XB4A 3GTLC 1F4KA 1Y1VC 2DK8A 4HNTA 5J1YA 3BTCA 1QZZA 3A8IA 4KISA 1GLNA 4ESBA 2Z2SB 1FIAA 5DUKA 1U9OA 3D1NI 1O24A 2VQGA 3M8FA 5EEGA 3N97A 1S9HA 1XCBA 4HYEA 1W0TA 3GTQJ 2DQLA 2MABA 4M9ZA 4OIPF 3ZQFA 3AQPA 4JK1X 4B1RA 4LFUA 5J1RA 5DUIA 1TWAK 1QZEA 4IKFA 1J6XA 2ELJA 2KRHA 4ZZLA 4RB2C 1MIJA 5ICCA 4RBOA 2VKEA 1EKEA 2DA6A 2LYCA 2VXZA 2A6HF 1ON1A 3C18A 3KLNA 3PNTA 4GCVA 5D6FA 5M3FJ 5BOXA 2A68F 3ZPLA 1IE0A 5TRDA 3AD9C 2NVTC 2A3SA 3CF5F 1I6HK 3CCLI 1SAUA 1HW5A 1ZRFA 4N9IA 4A0ZA 3HDDA 2GAHC 3H5NA 3HOTA 4A3KC 2E2HC 1SD5A 5C4JK 3ZN1A 4A3EC 4D9JA 3C7JA 1YOVB 4XK4A 4N9HA 4RAFA 5FD6A 4A3CJ 1HQMA 2YUSA 2X1CA 5M5WK 1LFPA 1ISEA 4RAGA 4LK0A 3HOVJ 1XGOA 1DQUA 4J00A 2QBYA 5C3EJ 3AL0C 3CCQI 1TP4A 2L7ZA 5C4XJ 4LK1A 5EDNA 4FETA 3EUAA 1XGSA 4IHYA 1TWGK 1VNDA 4CYDA 3ZQGA 2M9HA 4LLGF 1VQLI 3JRIA 5EG0B 2JA7C
chains in the Genus database with same CATH topology
2KIMA 3KE2A 3GF2A 4MQVA 1O26A 1KU3A 3ABUA 1FNNA 5E8GA 3VOEA 2H6CA 2XGXA 5FFZA 1J75A 1EH1A 4HA8A 3WG9A 4YFKF 3OV8A 3HTSB 4Q4ZF 2COMA 4WF2A 1TWAA 4WXDA 4KA4A 5F64A 2NRAC 1FWZA 1O2BA 1MDMB 1PDNC 2HFHA 1STZA 1ZYRF 1G3WA 2XROA 3J81K 2G7HA 1FX7A 5JI6A 1UB9A 3OEPA 1ZGAA 2PQ8A 2LF8A 1WSUA 3H3ZA 4KM8A 3P9CA 4BNCA 2JTVA 3QP5A 1IN6A 1FSHA 1YO5C 1TWGA 1FC3A 1ZAOA 2VN2A 2XAGA 1KYZA 3DF8A 4L5IA 1XMKA 4MTDA 1IN7A 2Q0OA 3FF5A 2EFNA 4BXUA 2E7XA 3VB2A 2VC0A 3O3KA 3V8JA 4E70A 3WTTC 3H92A 2DTRA 1OYYA 1NHAA 4LK0F 5HS9A 1EH6A 4LK1F 3RIRA 3V7CA 1T0FA 1PUEE 1U5TC 3R0AA 2CFAB 1IS1A 5FB2A 1ZG3A 3GZ5A 4AIKA 4Z2YA 4UVAA 2C6YA 2K86A 1W7PB 2B63A 4UUVA 1K83A 1ZVUA 5JFRA 5HDGA 1OKRA 3GLXA 1HSJA 2R7ZA 1HBXG 1I50A 5KVRA 4M71A 1ZARA 3DXJF 4KMDA 4S05A 4KARA 2QZ8A 1BIBA 2FE3A 2BYVE 2CGPA 4IRHA 5D5XB 5D8LB 3MFKA 1IN4A 2HTJA 1O2AA 1GE9A 2YX4A 2W25A 1O25A 5IOSA 3L7WA 1LNWA 2BEOA 3DPTA 2HDCA 3RTRA 1JGSA 1K78B 2QENA 2RC4A 3F72A 5F1RA 2JA5A 2CFXA 4LLNA 2JSCA 2OAZA 4YFXF 2EB7A 3PQJA 2KJBA 3GTJA 4U0VA 3RYPA 3RDIA 5F6FA 2R7FA 1ZH5A 3N0CA 2EFWA 1R5GA 5J8FA 5ICEA 5L3CA 2PJPA 5IOQA 1RUNA 2DPUA 4QLCU 1IN8A 3S0XA 5HDKA 1IF1A 3L00A 5LHGA 3LPXA 2ESNA 2ACJA 4ZYEA 3R60A 2XIGA 4LQYA 2OZ6A 5CJ9A 4I98B 2O03A 2M8EA 4I02A 3COAC 5LGTA 3CO6C 1USTA 2WTEA 3WTSC 1Z6RA 4HAMA 3JTHA 3HUGA 6PAXA 1Y1WA 1K7AA 1B4AA 3MQ0A 4RB1A 1TTYA 1RUOA 3KCCA 4RB3C 2RGVA 4CICA 4IHTA 4PGGA 2E7WA 1ZRCA 2HKXA 3WE3A 2A5YB 3RYRA 4LG0B 2ZFZA 2UXXA 4B8XA 1FPQA 5ICGA 3KLOA 2XAJA 1SFUA 2GA2A 2EV5A 4ENNA 1BI3A 2CWEA 3KEOA 4IHSA 1EK8A 2AXLA 2XV4S 3HSFA 2LKPA 3V4GA 3BROA 2DLLA 2GWRA 4MGRA 1RI7A 1LQ1A 1S8NA 2KWAA 2J5OA 4PCQA 4YG2F 1OYIA 2FMYA 1J59A 1ZLJA 1P4XA 2IPQX 3HRSA 3CUQA 3GXOA 3WTUC 3TGNA 1L0OC 1FT9A 2Z9OA 2L02A 4P9UA 3AQOA 4PZJA 4CHUA 2NNYA 4GTAA 3GTLA 2LDUA 3K1PA 2KJCA 1Y1VA 3RKXA 4DDQA 2QQAA 3GYHX 3N3YA 3W6JB 5JR3A 2UZKA 3WU0A 3JTGA 4M73A 2RV8A 2EA4A 1IXCA 2FOKA 4HLYA 5FD5A 1B9MA 5CLSA 2HS5A 4RB0A 3SHFA 1BC8C 2DK5A 5DCMB 1U6GA 2J5PA 1AOYA 3U2RA 4R8HA 2XCRB 3ZQ7A 2E2HA 2ZNZA 3SQNA 1YYVA 2VODA 2FMLA 1ON2A 2RQPA 3F22A 5H20A 3K1NA 1BIAA 4L18B 2YR2A 1G3TA 3TO7A 3ZMTA 2XAQA 3N4MA 2OD5A 4EQQA 2R7DA 1YW8A 3RKWA 4I0BA 2F2EA 1HW1A 4MTEA 3J80K 1XSVA 4KMHA 3GFMA 1YFHA 2LSOA 5BQTA 1SD6A 4P5BA 4KYWA 1XSDA 2VE8A 1ZLKA 4KUMA 1L3LA 1TWHA 2HQNA 2A07F 1YS7A 1KA8A 2FXAA 3B02A 2CSOA 1FSEA 2K27A 3K9TA 1R58A 3F8BA 3L2CA 5JVTA 4IXAA 1YIOA 4EJWA 2X4HA 2MBFA 3E3VA 1SFOA 5HS8A 4CZZA 1AB4A 4LLLA 4XLPF 2V1XA 3VEPA 2VUMA 3SZPA 1LEBA 1S7AA 2CFAA 4P5OA 1P6RA 1R36A 3GTPA 3BPXA 3T8RA 4OIOF 1W7PA 5DD4A 4RGSA 2YU9A 4OU0A 4EJVA 1S6LA 3KFWX 3TDZC 2YU3A 2HZTA 3WODF 4P9FA 4RGXA 1I27A 1W5SA 3IHUA 2BE5F 4FT8A 3M8EA 4KN4X 2XRNA 4AD9A 1B1BA 2WC2A 4U7BA 3I59B 1QGPA 3IWFA 3LAPA 1SMYF 3QP6A 5HDNA 4G0UA 2K4JA 4RGRA 2QQBA 5FGMA 2FNPA 3T8TA 4A0YA 1FY7A 3WGIA 4UV8A 3ZMUA 1F9NA 2PFBA 3ABTA 1U5TA 1K78A 2JA6A 1ULYA 2JPBA 5AIPA 1MJBA 1FZPB 3I54A 4UNOA 3F6VA 1B4BA 4ZYHA 1V3FA 3VFZA 1SD7A 2Q2EA 1D8JA 3HHHA 1ZG1A 2K02A 1G4DA 2XCOA 2O61A 2HOEA 2JPCA 4AIJA 4M6XA 3MZYA 3IKVA 2IA1A 1T98A 4F7ZA 2D1VA 2AS5F 3TKYA 4EM2A 1R1TA 3GTOA 3R6SA 1E17A 2BBYA 1P2FA 4HQMA 4BYYA 4KIBA 1FOKA 5HS7A 2DFIA 1A04A 4XBFA 1I1SA 2XVCA 3Q3QA 4Y13A 4A6DA 1ZN2A 1T39A 2R3SA 3G4AA 3RPQA 5K5QA 3CDHA 4KMAA 3O2PE 3IC7A 3CUQB 3LFKA 2M5WA 1TW3A 1YQAA 1T2KA 4WWCA 4IPAA 1XD7A 4LB6B 3PQKA 4FHTA 4O6JA 4LG0A 1KQ9A 1TWFA 2Q8KA 2FBHA 4QWQA 1O7FA 3SFZA 1G3SA 1YTYA 4HF2A 3KP3A 4ENJA 2NYXA 2STWA 3W6KB 1TLHB 3ZMDA 3FX3A 2ETHA 2JH3A 4EGYA 3H0GA 4GO1A 4ZYDA 4L9TA 4YIIA 2L54A 4KM9A 5EGHA 3HYIA 4NHJA 2ZBKA 1XXCA 4M6YA 4L9VA 4OOIA 3I71A 3D5LA 1T38A 4WCGA 1O57A 3LQRA 1KU2A 1REPC 4NQWA 1ONVA 4UXNA 2VBZA 1LVAA 2IA0A 4ESFA 4HDVA 4L9NA 1V4RA 1WCMA 3F8NA 2X0LA 3G3ZA 3GUDA 3BUEA 2D45A 2P6TA 4BH9A 3M9AA 2JT1A 4YFNF 2GXGA 4KIFA 3HHGA 4XSXF 1KU7A 1HSTA 1JE8A 1DPUA 4EJUA 1Z1DA 5CVJA 4GYGA 2KIFA 5IOTA 1WI9A 1IUYA 5DCMA 3FMQA 1GHCA 2OZUA 2VONA 1P4AA 4A6EA 2G7UA 2VC1A 2DQRA 1TNSA 3F6OA 3N0BA 3QU6A 2HKOA 4ASNA 1CF7A 1HXDA 2MC3A 4ENMA 5BPDA 5D4RA 4BLAA 2DPDA 1TW2A 2V9VA 4L5JA 1TQMA 1WQ2A 3GVAA 4NB5A 3CLOA 4ZZDA 1Z9CA 1Q1HA 3FXQA 3IWZA 4KASA 1R1UA 2RDPA 3NEUA 4BKWA 4Q47A 4EJOA 5TJJA 1W7PD 4O5VA 4M9XA 2ZO4A 2PBIA 3GTMA 2ZMEB 4BHBA 3FOEA 2F5EA 3F8MA 5D8KB 1XSXA 4WX9A 4ON0A 4PDKA 1KYWA 4AVPA 2GA1A 3DV8A 1U5TB 5H6RA 3LA3A 4P55A 4EMSA 2L4AA 2QWWA 1AWCA 3KP7A 1O29A 3ZN0A 4G8XA 3R4KA 2P5LC 2F5CA 4C3IC 4IRIA 1R23A 2GZWA 3ML6A 3BJOA 1J2XA 1ZREA 2M87A 3I59A 2DAOA 5DEQA 5LRSA 3F3XA 5JVOA 4HW0A 4EM0B 2A61A 4OINF 3J80Z 4HX8A 3IRQA 4P5AA 4P96A 2LNBA 1DP7P 1JXSA 4BQAA 1QNTA 4IF4A 3REOA 1JHHA 2Z33A 4RS8A 3KP5A 2GSUA 1RNLA 4GGGA 4EV0A 2V1UA 2XCQA 4TV7A 3KP4A 1H0MA 4KB4A 3BY6A 1GVJA 1MJ9A 1DUXC 3I5UA 1FYKA 4HX7A 1OR7A 2ZNYA 1FBQA 3FMSA 1I1GA 2V79A 2XAHA 4RAZA 3JW4A 3BJ6A 1YG2A 4HX4A 2NVYA 5AONA 3FM3A 1SFEA 2M45A 3CUOA 1ZHFA 4I0AA 3FXRA 1W4MA 3D0SA 2CO5A 3WTVC 5IT9Z 2Y0MA 4LGWA 2R92A 3BJAA 3E6DA 2DI3A 2EFPA 3K0LA 4GXOA 1LEAA 2VBWA 1WRJA 4EGZA 4KICA 3O6BB 4YIFA 1USSA 2O6GE 4G6QA 2QVOA 1O3QA 2FU4A 1IRFA 4LR2A 2QQ9A 4IJAA 3V8KA 3C3WA 4GTCA 2PN6A 5CVRA 3GFIA 5HLIA 3WGHA 5J6XA 2G9WA 4U0WA 2P5VA 5H6QA 3HOSA 3I4PA 5DYMA 3AAFA 1HW2A 1G3YA 1U8RA 4KB2A 4BHPA 1KQ4A 2B0LA 3I64A 3WTYC 2FBIA 2L4MA 4GYIA 1XN7A 5L3GA 4LMYA 2YPRA 4K2EA 5E20A 3BPVA 1H9TA 1R00A 1D5VA 5LBQA 4GTEA 3BOQA 2EFQA 3BDDA 2PMUA 4HF1A 3GZ6A 5KK1A 1CF7B 4ILDA 4BHCA 2ADUA 1D8KA 2FNAA 2XKOA 4G0VA 3I0TA 1O3SA 4A12A 2EFOA 1OPCA 3PFIA 3KZYA 5CVVA 4KIGA 3ERED 4MNUA 3JAMK 4KFCA 1QO0D 3OREA 4Q5SF 4CO8A 5D5WB 1EH8A 1T6SA 3RI4A 3BP8A 3KZZA 4KDPA 3LQQA 2EV0A 1ZXOA 2Z3YA 4UV9A 3P9IA 2VT2A 4EVIA 5E1ZB 2GAUA 3QPTA 3FMRA 4CDGA 1LDDA 4J3NA 1U3EM 2D1HA 4EM1A 1TQPA 1K6OA 5K5OA 3MCZA 2GIVA 4MEYF 2FSWA 3F8FA 3QU3A 2NNNA 4N0BA 3EYYA 4KATA 3F8CA 1U78A 3ZMSA 3MAJA 4MQ9F 2QLZA 1BN5A 1BGWA 1UCRA 1Y0UA 4HOBA 2MD5A 3LSTA 2VBYA 4UVBA 5FLXZ 2ZFWA 1OYWA 2GXBA 1IN5A 5IT9K 2P7VB 2KIUA 1Z91A 2RNJA 5DV5A 2FBKA 1F1ZA 2ZMEA 4DQ2A 1O7LA 1H9GA 1QZYA 4D0PA 4ZH4F 3GEZA 4OMYA 2IVMA 5EEHA 4OIQF 1FLIA 2OU2A 3EDPA 2HYFA 3WTXC 3HIFA 1SFXA 1IZ1A 4GTFA 1TQIA 2VE9A 2QM3A 3TO6A 2PHCB 2Y75A 3WGGA 2A6EF 5ILSA 1YW7A 2CQKA 5HLHA 4KAWX 3V7RA 2MH2A 3E5XA 3GTGA 4KDDA 4KN7X 3T1BA 1I6XA 3E5UA 1BI1A 4U0YA 2VT3A 1ZRDA 2MLKA 1XDSA 3IL2A 5ICFA 1I5ZA 4EJTA 3T0YA 2H6BA 1BM9A 3QPHA 3WE2A 3E6CC 5LHIA 2W57A 2P5MA 3K1MA 3DQVC 4ENKA 2ZJ2A 3WTZA 5IORA 4ESJA 1W5TA 5ILVA 4A0XA 1HQCA 3NUHA 4CGZA 5J8CA 3EETA 5JFEA 2ISZA 3ELKA 3QX3A 2EV6A 4XRFA 2FF4A 5AIQA 4G94A 5L3BA 2HEOA 2HTSA 3JSPA 3OPFA 4R1HA 1B6AA 3HRMA 3SXYA 1HKSA 5L3EA 4WXCA 3IKTA 2M30A 2LF7A 2BGCA 2DT5A 3GFLA 2BV6A 2FRHA 4H0EA 2W84A 3E97A 2FA5A 3FWEA 2MA3A 4OMZA 4C3JC 1FYMA 1SMTA 1B59A 3FHZA 3ROUA 4L0ZB 2A69F 2VBXA 4ETSA 1XMAA 1XGNA 3ZMZA 1WQFA 1SD4A 4DNCA 2IP2A 5FLXK 3BZ6A 2ELHA 3TOAA 4JBAA 2IJLA 3S2WA 1GXPA 4R79A 2HYGD 3KEQA 3DKWA 1OMIA 2IRFG 1G6NA 2QUFA 2YSRA 2L01A 5ERIA 4U88A 1KQ8A 2DO7A 2P5KA 1O3TA 2PLYA 4KMFA 1KQ0A 3HSRA 2HWVA 4MHGA 1QBJA 3L09A 1MKMA 2QYOA 3FOFA 5LGUA 1O28A 1UHMA 4M72A 3KETA 1IRGA 1IAWA 4G7ZF 5DDGA 4S04A 3B73A 3TQNA 5LLQA 4UHTA 1Z05A 4U7DA 1WQHA 1XCVA 2JRTA 3CQZA 4LD5A 2FEZA 4GT9A 2Y48A 1LJ9A 3VA7A 4LB5A 2UWMA 4CXFA 3R61A 1O27A 5LHHA 5E1XA 2EJRA 4M9SA 2XUBA 2EWNA 2D2WA 4M1XA 3K2ZA 2HQRA 2MH9A 1IXRC 3ZP5A 2ISYA 3GTQA 2ZXJA 5JHUA 1R5HA 2Y3PA 3NQOA 1E2XA 3FM5A 3GO5A 3I53A 1XXAA 1LDKB 2XKPA 5D5UB 2K4BA 2RN7A 1S29A 2OA4A 2V1DA 5LEJA 1LB2A 3IRRA 1RIOH 1EV7A 1TBXA 5CVIA 1UHWA 3BWGA 2L3DA 5D5VB 5CVUA 1VTNC 2GSNA 3MMLB 4HV6A 2RVCA 3MEXA 1XGMA 3JAMZ 3Q9VA 1J0RA 1XXBA 1MD0A 1WQGA 3L4JA 3RJPA 2TDXA 3C1DA 3HRTA 2STTA 1O3RA 1R1VA 1Z7UA 2CYYA 4XSZF 1F5TA 3WTWC 2OQRA 4KC6A 5L3DA 1TWCA 2CW0F 1RZ4A 5CYVA 3DPLC 3HSEA 3KP6A 1B9NA 1WKMA 5E1WA 1ODDA 4G7OF 2XHKA 1BJAA 2ESHA 5LGNA 1R7JA 3H3UA 2OQGA 2WWYA 5LEKA 1TNTA 4FX4A 3KP2A 3Q9SA 4KMUX 2M1BA 4GFQA 4LJZF 1S3JA 5DD8A 1FBSA 4WK8F 3HRUA 4I01A 4FX0A 3LWFA 4BAYA 3NRVA 1P92A 5A2QZ 4M74A 2QBYB 4Y17A 4HZFA 1U2WA 4JQFA 3FZVA 3F23A 3CJNA 1BBYA 3I58A 2DW4A 3GWZA 3Q5FA 2W85A 3FKIA 1XDUA 4G0WA 2KKOA 3RKYA 3V8LA 3ULQB 2P4WA 4G9YA 4HBLA 1DPRA 4FZBA 1SAXA 1PP7U 5IT3A 2XAFA 1QQIA 2EA2A 2FQ3A 3CO7C 3EUHA 4ZYGA 2HR3A 3GTKA 1IXSB 3G73A 2V6CA 4HDUA 2JZYA 3EYIA 2RKHA 3U9GA 5FFXA 1UFMA 2EK5A 1ZG5A 3G4CA 1BC7C 2NVXA 5DCFA 5HOOA 3VODA 3AH5A 2Z99A 4L0YB 3P7NA 3R0JA