3LAPA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-canavanine.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
149
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator/dna
molecule keywords Arginine repressor
total genus 46
structure length 149
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lapA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lapA02
4Q47A 5HLHA 1YW8A 1FC3A 3VODA 2FF4A 2MH2A 1S7OA 3SZTA 4A0XA 1TQMA 2YSRA 4KN7X 1ZARA 2ACJA 2OZ6A 2FBIA 2VE9A 4CYDA 2STTA 4L9NA 2XV4S 5KK1A 5HVQC 4HAMA 4UHTA 3IKTA 1IN6A 2KIUA 2QENA 3EETA 3KE2A 3V8KA 2HFHA 3CAGA 4GFQA 2V79A 3ZMZA 4PGHA 3F8BA 1Y0UA 3QP5A 1TW2A 3LQQA 4Y13A 4ZZLA 1GHCA 4P96A 1IF1A 4EV0A 3F23A 2L54A 4LD5A 3O6BB 1J0RA 2EFNA 1XGOA 3F6OA 5LEKA 5IT9K 4Y15A 2EJRA 3U2RA 4LFUA 2XCOA 2PMUA 1S29A 2XRNA 5LRSA 4B8XA 5LEJA 3VOEA 4HA8A 1IN4A 1EH6A 4WX9A 2AS5F 2P6TA 2A6EF 1R58A 2DBBA 1WQGA 4IPAA 3BP8A 4ENJA 1MDMA 3VEPA 3LWFA 3GYHX 2XAGA 3MZYA 2QLZA 1O7FA 4RAYA 4L9JA 2XAFA 2IT0A 1TQIA 2O0YA 5FD6A 1J7KA 2MLGA 2XAHA 1S6LA 3ZQ7A 4TV7A 2BYVE 3DFGA 2G7UA 4UNOA 4IRGA 4Q5SF 1EH7A 3REOA 1F1ZA 1GXQA 1QZYA 2PLYA 1LDKB 1W4MA 1KQ0A 3DPLC 3N4MA 4HQEA 1G3WA 1X3UA 2M1BA 3GFLA 4MNUA 1Z1DA 4R1HA 1FBSA 1R00A 2MLKA 5BPIA 4E70A 4R79A 4S05A 2VOPA 1XN7A 2M30A 2P5VA 4ZYHA 5D8KB 1ZG3A 2RV8A 1HKSA 4HOBA 1B59A 2ELHA 2FOKA 2P8TA 2QM3A 3IRRA 4M9SA 4Z2YA 2HTJA 4A12A 1MJ9A 2W25A 1G3TA 2C6YA 1W7PA 3CUOA 4OIQF 1IXRC 1P4AA 3IHUA 2QVOA 4OMYA 1Z05A 1O3TA 4U0VA 1IXSB 4PZJA 5K1YA 4ETSA 4DNCA 3BROA 1FX7A 3DV8A 5LLQA 5HOOA 3ABTA 5AONA 3NRVA 2EV5A 3L4KA 1U2WA 3DF8A 2MD5A 2K4JA 2YX4A 5AIQA 3G3ZA 2ADUA 1TTYA 1HSTA 2RNJA 1Z7UA 1WKMA 2P5KA 2R7FA 3T1BA 1XD7A 4BH9A 4LLGF 3QRFF 2E1NA 2RVCA 3OEPA 4UVAA 4NB5A 3FM3A 2A6HF 2H6CA 2XAQA 3PQKA 2MH9A 2WC2A 2GWRA 4A6EA 3I71A 2FBKA 4P9FA 2HDCA 4AIHA 2M45A 4DQ2A 4BYYA 1DPUA 3KP2A 3NQOA 3BJ6A 2KIMA 1W5SA 2RQPA 4EQQA 2RN7A 2JT1A 3KP3A 4EJOA 1T39A 1QQIA 2WV0A 3KLNA 3EYIA 3K1NA 3MMLB 2IP2A 2ZXJA 1L0OC 4LB5A 1G3YA 2HR3A 4N9IA 1XMAA 2HS5A 4YIIA 3LAPA 1WI9A 1LQ1A 3ECOA 4HYEA 3C18A 5EEGA 1ZAOA 4IJAA 2JPCA 3TQNA 4K2EA 1R5HA 3VFZA 4GYGA 4RGUA 4MGRA 3J80Z 4YIFA 1AB4A 3FOEA 1MGTA 4GO1A 2CW0F 2EK5A 3E6CC 2YX7A 1P2FA 2DTRA 2VBZA 2VT2A 4KUMA 5LGNA 2FNPA 1IRFA 1EK8A 3MCZA 4MTEA 5CVJA 5CVRA 3KP7A 4ZYGA 2PI0A 3F72A 2D1VA 4CZZA 5EEHA 1FWZA 2DQLA 4M71A 2XIGA 2P7VB 4KAWX 2V6CA 4WXHA 2UWMA 3FOFA 1LB2A 5HDKA 1YS6A 3HSEA 2XVCA 3S2WA 1WQFA 5IT9Z 4ZYDA 5A2QZ 2FNAA 1PP8F 5FLXZ 2XAJA 4FT8A 1S8NA 4M6XA 1XXCA 2G7HA 4FX4A 3HRSA 1O3QA 2HEOA 3E97A 4MHGA 1FBUA 2ESNA 3K0LA 3K9TA 3GUDA 5DD4A 1Z6TA 3I0TA 2VC0A 2IRFG 4LG0B 4KC6A 5DUIA 1MD0A 2F5DA 3QAHA 2W85A 2YPRA 3L2CA 4HBLA 1WRJA 1ZVUA 5E17F 3ZMDA 5ILVA 1XXAA 2VXZA 4L18B 2ZMEB 5K5OA 4MEXF 2NNYA 4OIPF 1EH1A 1L3LA 2A3SA 4KFCA 3RPUA 2E1CA 1QO0D 1KQ8A 4CICA 1U78A 4U0WA 3Q9SA 3TGNA 5DEQA 1KU7A 2R7DA 2K7LA 4XSZF 1SD4A 2PHCB 1YO5C 2OZUA 2STWA 3JSPA 1U6GA 2VODA 4FM9A 3HOSA 1FSEA 1HSJA 3HYIA 3BUEA 4CO8A 1G3SA 1YTYA 2AXLA 4OU0A 2O3FA 3FMQA 2EV6A 4KDPA 2RC4A 2OBPA 1FBQA 1D3YA 3U9GA 2DW4A 1B4AA 2RGRA 3BPXA 5LGUA 1J2XA 3DPTA 5BS6A 4XLPF 3VA7A 2V1XA 1PP7U 2VOOA 3DEUA 3GWZA 5H6RA 3V4GA 5CVUA 2ISZA 3EUHA 3FWEA 1PDNC 5KVRA 3HRUA 5F64A 3TO6A 1AWCA 3K1MA 4GXOA 4EJWA 2O8XA 4L5IA 3KETA 2PN6A 4I7HA 4I98B 6PAXA 4MQ9F 1B6AA 3G73A 1LJ9A 2UXNA 2RDPA 2ZBKA 3RKWA 4U0YA 4ESJA 2K02A 3HHGA 1O7LA 1YG2A 3RKYA 3I53A 2L01A 3WGHA 1RI7A 4LJZF 3GZ5A 3FMRA 1XCBA 4L0ZB 4R8HA 3R6SA 3P9IA 4KIFA 4XBFA 4RS8A 1MZBA 2XKPA 1FP2A 1IW7F 4H0EA 2J5PA 2JRTA 4G94A 2A5YB 2OAZA 2FXAA 1FOKA 4Q4ZF 1SD6A 2HYFA 3E6DA 2QQAA 1B1BA 3KEOA 3F8CA 1ZH5A 3O2PE 2GZWA 4KICA 4M9XA 2PEXA 1HXDA 4O6JA 5LBQA 4HLYA 1ZRCA 3L4JA 5L3BA 2PJPA 4EM2A 1KA8A 2Y75A 5E20A 1FLIA 1K7AA 5DV5A 5CVVA 2HZTA 2ESHA 4UUVA 2Z99A 3CDHA 1EV7A 4BQAA 3GXOA 2EFOA 5JI6A 3GFMA 3Q9VA 1IZ1A 5DD8A 3U1DA 1MJAA 5HDNA 1R5GA 3EQLF 3GEZA 1ONVA 2IA0A 2RGVA 4P9UA 3KLOA 2CFXA 4G6DA 3CLOA 3F21A 3ML6A 2H09A 4I09A 1S3JA 3FHZA 2GA2A 4G0WA 1R22A 3BOQA 1B4BA 5E18F 3ZN1A 1FT9A 2XKOA 4UV9A 2GQQA 2QZ8A 2YU3A 2F5CA 3EYYA 3DQVC 1TLHB 2ZO4A 1ZG1A 3HIFA 5FLXK 1CGPA 3L09A 1YQAA 3H92A 1KYZA 5J8FA 5L3EA 3WU0A 2IA1A 4A2UA 1QBJA 3F6VA 2FBHA 1IUYA 2ZMEA 3KP4A 1S7AA 5FD5A 5HS7A 1OYIA 4M72A 1REPC 2QQ9A 1Q1HA 3HOTA 2DQRA 3WTWC 1ZG5A 2MBFA 1SD7A 2VN2A 3ZPLA 3GZ6A 4L9VA 1A04A 3I64A 2Y48A 2FE3A 2KRFA 3NUHA 3WTTC 3KZZA 1O3SA 2LF7A 1RUOA 1GE9A 1BIBA 4LG0A 2XGXA 3QOPA 4RGSA 4A5NA 1I1GA 3MWMA 3IL2A 3KP6A 1I27A 5CJ9A 2LNBA 2CG4A 3HRMA 4KDDA 1GXPA 3R60A 4AIKA 1U3EM 1UB9A 4CXFA 2CYYA 3W6KB 1T38A 5LHGA 2ETHA 4Q48A 1DD5A 4WF2A 3OV8A 1YS7A 5E1ZB 4IF4A 4U7DA 5DCFA 3M7GA 3RJPA 3OREA 5BPDA 2Q2EA 4HX4A 1ZGAA 1UHWA 2HYGD 2IJLA 3WTSC 2HQNA 3F8NA 2FEZA 1LEAA 4RB1A 1OPCA 3EDPA 4EGYA 3KFWX 3E3VA 2ZCWA 2DFIA 4KA4A 3ISPA 4LLNA 3RI4A 2COMA 5D4RA 4KMUX 3PFIA 1R36A 4OMZA 2WTEA 2V1DA 1FYKA 4PCQA 4LB6B 4A5MA 3R61A 1XDSA 1BN5A 1U5TA 5LRRA 3OPFA 1H9GA 1R1UA 2HOEA 1E17A 1JXSA 1O57A 2OU2A 3CUQA 1DPRA 4I01A 4M9ZA 5BQTA 3M8FA 1Z91A 3BZ6A 3DP7A 4Y17A 4G8XA 2P4WA 3M8EA 5LHIA 3QX3A 5ICCA 4L9TA 2PFBA 4G7ZF 3VB2A 2Y0MA 1ODDA 1YW7A 3ZMVA 1F9NA 2O6GE 1OMIA 5DDGA 3TDUC 5D8LB 1Z6RA 3DXJF 4ESBA 1ZN2A 1LVAA 2H94A 2DPDA 5DYMA 2D1HA 3J80K 1W7PB 2X0LA 3WTVC 3C3WA 4LLLA 2BV6A 3RKXA 4AD9A 3K2ZA 2EFPA 3P7NA 2CWEA 4EJTA 4WXDA 2V1UA 3I59A 5JVOA 1XMKA 1HKTA 1BC7C 4IHTA 4BHBA 3O3KA 2M87A 2WWYA 2DK5A 1FP1D 1SFEA 1T0FA 1UHMA 4BAYA 1U8RA 1FYMA 1LNWA 4BNCA 1WSUA 1HW1A 1YFHA 1R1VA 2K4BA 3FXRA 2P5MA 5FFZA 2B0LA 1DDNA 2XUBA 1V3FA 1BI3A 1UFMA 2OD5A 1ULYA 1R1TA 3FX3A 3ZMUA 3IWFA 3RTRA 4BHPA 3HTUA 1YLFA 1T6SA 4ASNA 1AOYA 2ZFZA 2P6SA 3I59B 3FF5A 3T8RA 1B9NA 3F3XA 4EM1A 1IN5A 3B73A 1ZLJA 2NNNA 5L3DA 5E1WA 3QPTA 4KMFA 5E8GA 2LSOA 2JPBA 2EFWA 3IC7A 2BBYA 4KB2A 2QBYA 3JAMZ 5HDGA 4WK8F 3WTZA 5ICEA 1RIOH 3P9CA 2O61A 3LSTA 2DAOA 4L0YB 2VBXA 3HHHA 1I1SA 1W7PD 3ULQB 2PBIA 2OA4A 5K5QA 4ESFA 2BEOA 4ON0A 1I6XA 3LQRA 5AIPA 5CLSA 1XGSA 2DT5A 4EGZA 4FX0A 1RUNA 1FSHA 2MC3A 4G7HF 3ERED 1YW9A 5J6XA 4HF0A 3N97A 4RB3C 4ENMA 2CGPA 1P4WA 3E6BA 1WQ2A 1O3RA 2RKHA 1TNTA 2LKPA 2JTVA 3LA3A 4MQVA 3WTUC 4HV6A 2W84A 2O03A 1Z9CA 1QGPA 1J75A 1D8KA 2FSWA 1P6RA 3V8JA 1W5TA 4WXCA 4A0YA 4HQMA 3R0AA 3GFIA 3AAFA 1V4RA 5BOXA 1HW5A 2L3DA 2K86A 5F1RA 1TNSA 3TO9A 3KP5A 5F6FA 2P5LC 2FQ3A 1GVJA 3SXYA 5JHUA 3OOPA 4AVPA 5BMZA 1R23A 2A69F 5ICFA 5ERIA 4ENNA 2JZYA 2Y3PA 3MAJA 1FPQA 2V9VA 2QWWA 1FNNA 1BC8C 2EV0A 3ELKA 4IRHA 1F4KA 4CHUA 1TQPA 1BI2A 2IW5A 3GX4X 4ZYEA 4G9YA 4O5VA 4XSXF 1K6OA 2HWVA 3F8FA 5D5XB 3D5LA 3V7RA 5FGMA 4EJUA 4G7OF 1USSA 2D2WA 2H27A 3HTSB 1WWXA 3QP6A 5DCMB 4KB4A 2VBYA 2OQRA 4OIOF 3E5QA 1ON1A 3MQ0A 3KZYA 2CO5A 1P92A 5HLGA 1USTA 5JVTA 2L4AA 2NRAC 2KKOA 4I02A 2ZFWA 2IVMA 2YR2A 4NQWA 4XLNF 2ZKZA 3WGIA 3RYRA 3T8TA 4YFXF 2QYOA 3GO5A 2Z33A 3ZN0A 2DLLA 4LMYA 2GIVA 1J5YA 2GXBA 2P7CB 4P55A 1XGNA 3WU1B 4RB2C 2L02A 3BDDA 5FFXA 2FRHA 3T0YA 4N9HA 5LHHA 2Z5UA 4KIBA 2IPQX 4AWXB 2EA2A 2VC1A 5ICGA 4A6DA 3BJOA 4ZH4F 2DO7A 3PQJA 1BGWA 1R7JA 3WG9A 4YFNF 3BPVA 3RPQA 3V7CA 2FMLA 2FA5A 1H9TA 3J81Z 3BY6A 1HBXG 3I5UA 2XCRB 4M74A 3GF2A 3QPHA 5JR3A 4IVNA 2EFQA 1U5TC 1LEBA 1FY7A 3CJNA 4OOIA 4UVCA 4P5OA 1XSXA 4PDKA 1OKRA 3V8LA 4WCGA 1I5ZA 3GLXA 1PUEE 2QBYB 2HTSA 1ZHFA 4RGXA 5ILUA 1BJTA 5ED4A 2HQRA 2J5OA 1OR7A 4XRFA 4KT5C 1D8JA 1RNLA 4RB0A 5LGTA 4G0VA 1ISEA 3V7SA 4OINF 1C0WA 5E1XA 5E8IA 4IXAA 1HKQA 1E2XA 4HDVA 4B09A 2HKOA 1XXBA 1YIOA 4HF2A 3ECHA 2VONA 5FB2A 1SMTA 3HUGA 1BI1A 3E5XA 3E5UA 5FO5A 3R0JA 2ZNZA 1SFUA 2DU9A 3ZMSA 3F8MA 3L7WA 2DI3A 2X4HA 3T5XA 4NHJA 5CYVA 1U5TB 4WWCA 1HQCA 2Q0OA 3FZVA 3GFJA 2HGCA 2E7WA 3P9KA 3SQNA 1T2KA 3I54A 2UZKA 4JQFA 3H3UA 1CF7A 3FM5A 2FU4A 1SD5A 4LK0F 2F5FA 1XDUA 3DKWA 3MFKA 2NS0A 4KYWA 1YYVA 3RIRA 4G0UA 1H0MA 3GW2A 1XSDA 2G9WA 2VT3A 3TOBA 2EA4A 5DCMA 1BI0A 1STZA 5D6FA 1ZGJA 2L4MA 1SAXA 3L00A 5D4SA 1T98A 3BJAA 2LF8A 2PQ8A 3LA2A 3WTYC 4EJVA 3J81K 4UVBA 2NAZA 2E7XA 4U7BA 5L3FA 3GVAA 3TOAA 3COAC 2ZJ2A 1IS1A 3C1DA 2CQKA 1KU9A 2BGCA 4KN4X 3LA7A 5D6EA 2FMYA 1ZREA 4IRIA 2TDXA 5D5UB 5TRDA 1UCRA 4KNYA 4I0AA 4HV5A 3WE3A 5D5VB 2DK8A 1IAWA 1BBYA 3WE2A 1XB4A 5ILSA 4HDUA 4FHTA 1JE8A 2BE5F 4BHCA 1OYYA 3NEUA 2KJBA 3MZHA 4HF1A 1JHHA 2KIFA 2A68F 1WQHA 4UXNA 4RAZA 2W24A 2PMHA 1F5TA 3KCCA 4LK1F 1ZYRF 5IT3A 3MEXA 3CO7C 3SFZA 1J9IA 4KIGA 2DPUA 1RZ4A 3IWZA 4MTDA 1BM9A 4J3NA 1G4DA 1NHAA 1ON2A 2Z3YA 4OIRF 2QQBA 3JAMK 4D0PA 2XASA 1DP7P 1ZRDA 2HKXA 4JK1X 4JBAA 5H6QA 3K1PA 4F7ZA 5J8CA 1DUXC 1XSVA 3TO7A 1JGSA 3LFKA 3IKVA 2JSCA 4GCVA 4YG2F 5DUKA 3M9AA 5HS8A 1MDMB 4N0BA 4HZFA 1CF7B 3QU6A 2EB7A 1KGSA 3CTAA 4M6YA 4PGGA 5JFRA 3D0SA 2A07F 2D45A 2W57A 4UV8A 2ZNYA 3HSFA 2M8EA 2GAUA 3ROUA 1MKMA 2KJCA 1QPMA 1KQ9A 1MJBA 4U88A 1J59A 1SFXA 5TJJA 1HW2A 4I2OA 3CUQB 2Q8KA 1XCVA 3RYPA 3WODF 4YFKF 1JHFA 2Z9OA 1BJAA 3LPXA 3I4PA 3E6MA 3FXUA 4HW0A 4MEYF 4GYIA 3ZP5A 3BWGA 1IN8A 4DDQA 2MA3A 3CUQC 5L3CA 4L5JA 2PG4A 3JTGA 2XROA 1ZLKA 4A0ZA 2ISYA 1B9MA 4O3MA 2OQGA 3HSRA 1LDDA 5CVIA 2NYXA 3JTHA 3Q5FA 1FZPB 4G6QA 1QZZA 3FMSA 3CO6C 2QUFA 2F5EA 3H3ZA 2XHKA 5D5WB 4S04A 3TKYA 5A2QK 1KYWA 2EWNA 2H6BA 3ABUA 3IRQA 1K78A 2IA2A 3QU3A 3ZMTA 2R3SA 1BIAA 5H20A 4ENKA 1LDJA 4HLXA 1K78B 4QWQA 1FYLA 1D5VA 4ZZDA 2VBWA 3KEQA 3R4KA 4EMSA 2K27A 2LDUA 1P4XA 4HX8A 3HRTA 2GA1A 3F22A 2F2EA 4QLCU 4RGRA 3M1EA 3I58A 4BXUA 3JW4A 4M73A 4CGZA 1EH8A 4I0BA 4IHSA 2XCQA 1IRGA 1KU3A 1K79A 4LGWA 2UXXA 1G6NA 3K69A 3TDZC 2CSOA 3SZPA 2A61A 2KWAA 5K5RA 1ZRFA 1WIHA 3J7AO 5HLIA 4CDGA 2M5WA 4HX7A 2VE8A 4AIJA 3C7JA 1SMYF 5L3GA 1KU2A 4EVIA 1IXCA 5HS9A 3L9FA 3JSOA 3RDIA 1TBXA 4EM0B 2GXGA 3SHFA 3W6JB 1BOAA 1TW3A 3LAJA 1IN7A 1QNTA 3WTXC 1OYWA 4GGGA 1XGMA 3B02A 1VTNC 3FXQA 3WGGA
chains in the Genus database with same CATH superfamily
4Q47A 2JUGA 5HLHA 1YW8A 3HOZC 2HVSA 3OS1A 1FC3A 3VODA 2FF4A 1JKRC 2MH2A 4XRSG 1S7OA 3SZTA 1WHUA 3GTLJ 4A0XA 3OYLA 3ZQQA 1TQMA 2YSRA 4KN7X 1ZARA 2ACJA 3TFHA 2OZ6A 5IYBC 2K3FA 3LSGA 1K83K 2FBIA 2VE9A 3Q3SA 4CYDA 4M3EA 1QHGA 3VSLA 2STTA 3FDYA 4L9NA 1A6IA 4YRVA 2GOMA 2XV4S 5KK1A 5HVQC 1J09A 4XM3A 4HAMA 5IYCC 4UHTA 5IP7K 1JJ8C 2KL4A 3IKTA 1IN6A 2O9LA 3RKQA 2KIUA 2QENA 3A03A 3EETA 3KE2A 3V8KA 2HFHA 3CAGA 2MG4A 4CZCA 1SFKA 5TJ3A 3TP0A 1F7VA 2NOGA 4GFQA 3GEIA 5FKMA 2V79A 1D1BA 3HEFA 1LKXA 3ZMZA 4CH7A 3D1NI 2DMQA 2CUZA 1ERDA 4KATA 1Y1WK 4Y7NK 4PGHA 2ZUFA 3AD8C 2JA8C 4D7MA 3F8BA 4BQQA 3CCQI 1Y0UA 3QP5A 1TW2A 3LQQA 4Y13A 1Y0NA 4ZZLA 1GHCA 2KP6A 4P96A 1IF1A 1TWCA 4DIQA 2F48A 1BDFA 2OJED 4EV0A 3F23A 2AXTC 3K7AC 2L54A 4LD5A 2H1KA 3VSKA 4N4OB 2NVTK 2VQLA 1QZEA 3O6BB 1J0RA 1QVTA 2EFNA 1XGOA 5K7ZA 5L46A 2R7QA 3F6OA 2ELKA 4RMFA 2HQ5A 1ETOA 5LEKA 4DBRA 3S17J 3I4MJ 1DCHA 1TZLA 5IT9K 1E0EA 4Y15A 2EJRA 1DU6A 3U2RA 1JUMA 1IBAA 4LFUA 1R9TJ 2XCOA 1JQWA 3JSTA 5FLMC 2PMUA 4XRMA 1S29A 4BE0A 2XRNA 5LRSA 4ZC3A 4B8XA 2IS1A 5LEJA 3H9QA 3DXJA 4QJVA 3VOEA 2MYSA 1O28A 4HA8A 1IN4A 3G71I 1BW5A 1EH6A 2WB1A 3N3YA 4WX9A 2AS5F 3TBIA 3JREA 1VNDA 2P6TA 2E2IK 2A6EF 1R58A 4YEJA 3GTLC 5IORA 2DBBA 1Z77A 1WQGA 4IPAA 3BP8A 4NC6A 2Z16A 4HEA2 3EUHC 5FRNA 4ENJA 3CMEI 2NS7A 1MDMA 4W97A 3VEPA 2Y0SN 2JA7A 3B6CA 3KX2A 1E3HA 2KZGA 3W2VA 1BR2A 2UV1A 3LWFA 4BBRC 3GYHX 2CV1A 1F43A 2XAGA 1OCCH 3MZYA 2QLZA 1O7FA 3HKZN 4IOAF 2QKLB 3EUAA 2GIZA 4L9JA 4RAYA 2XAFA 2IT0A 2VKEA 1TQIA 1JKPC 1UAAA 2DMTA 2R7UA 2O0YA 4GTEA 3RZOC 4JYKA 2ID3A 3PM1A 5FD6A 3J7ZI 3T00A 1J7KA 2MLGA 1B72B 3HOYC 2XAHA 5M5XK 1S6LA 3ZQ7A 4BXXJ 2EILH 4TV7A 2BYVE 2DFFA 3DFGA 2G7UA 2R5YB 4AYBL 4UNOA 2IBDA 4IRGA 3DCFA 4XLPA 5IYDK 4Q5SF 4FETA 3RQ4A 1LPQA 2JH3A 1EH7A 4PAAA 1IV8A 3L2QA 2R7ZJ 3ZQIA 2CW8A 3REOA 1F1ZA 1GXQA 1MMNA 1QZYA 2PLYA 3CDIA 2LKXA 1WOOA 4F55A 4BXXC 1LDKB 1W4MA 1KQ0A 3DPLC 4DBQA 3N4MA 3KEYA 4HQEA 2JA8J 2R5YA 1G3WA 1X3UA 2B63K 2M1BA 5GPAA 3GFLA 4MNUA 1Z1DA 1IG7A 4R1HA 3JRFA 2JA6A 1FBSA 3AKZA 2BY0A 3G6EI 4HNUA 3QODA 4HRIA 1R00A 5EGHA 2MLKA 5BPIA 4E70A 4X6AK 2BVMA 4R79A 4S05A 1HDPA 1S72I 2VOPA 2VXDA 1XN7A 2M30A 4CYCA 1ZR2A 3BR1A 4MFEA 2HOAA 2P5VA 4ZYHA 1RPWA 1Y8QB 5FKKA 5D8KB 2B7EA 5BNGA 1ZG3A 2RV8A 3F9KA 1HKSA 4HOBA 1B59A 2ELHA 2R7ZA 2FOKA 4E4HA 1V5FA 2P8TA 4PABA 2QM3A 2YUSA 3IRRA 4M9SA 4Z2YA 2HTJA 1R9TA 4A12A 1T95A 1MJ9A 5JLXA 4IHYA 2EBBA 2W25A 4Y7NC 1G3TA 3SZGA 2C6YA 2XPUA 1VFCA 1W7PA 3CUOA 4V2FA 3OWTA 2EINH 3ASOH 1IXRC 4OIQF 2R93J 1P4AA 3G4AA 3IHUA 2QVOA 4OMYA 1Z05A 1O3TA 4ZH4A 3PO3K 2MGQA 1OQYA 1YHQI 4U0VA 5HNFA 1IXSB 1QVUA 4PZJA 5K1YA 3S17C 2JMWA 3K7AJ 4ETSA 4G6TB 3DEWA 1VQ5I 4DNCA 4FISA 3H0GC 3BROA 4YG2A 1X2NA 5C4JK 5FKOA 2ID6A 1MBGA 4AUXA 1FX7A 3DV8A 5LLQA 5HOOA 3OS2A 3S2DJ 3ABTA 5AONA 3NRVA 3A4CA 2EV5A 2Y0SA 1SMYA 1U2WA 2CQ7A 3DF8A 2MD5A 3L4KA 2K4JA 2YX4A 5AIQA 3G3ZA 1RESA 2ADUA 1TTYA 1HSTA 3CF5F 1A6QA 2RNJA 4AU7A 1Z7UA 1WKMA 4XOTA 3BG3A 3S32A 2P5KA 2R7FA 2LK2A 3T1BA 1WFXA 1XD7A 4PJJA 4BH9A 1POGA 4LLGF 3QRFF 2E1NA 1ETYA 2RVCA 3S93A 3QOEA 3OEPA 4XSXA 1R49A 4XLNA 1P7JA 3GTOK 1MSFC 1N78A 2YU9A 4UVAA 4NB5A 1D1CA 3FM3A 1WJFA 1YIJI 3S15J 1T08B 2K9MA 3NARA 3OIPA 3S2HC 1UMQA 3GTGA 1X19A 2A6HF 4XLAA 4NOIA 2H6CA 2XAQA 2W7VA 4BUPA 4E7KA 3FKIJ 5E68A 3PQKA 3ZOBA 2MH9A 4ZTJA 1FOXA 2WC2A 1DCPA 2GWRA 4PJLA 4A6EA 1TWCJ 2HI3A 3I71A 2A69A 2FBKA 1N77A 4P9FA 2HDCA 4AIHA 2M45A 1I3QA 2JJ7A 2HPMA 4DQ2A 4A3EC 4BYYA 4F3QA 1DPUA 3KP2A 3NQOA 1MSEC 4G7OA 3BJ6A 4XMYA 2M2EA 1OJLA 2KIMA 4DJAA 1W5SA 2RQPA 3EQLA 1I39A 4XKWA 4EQQA 2RN7A 2R5ZA 1XMXA 4NUBA 2JT1A 3T02A 3KP3A 1TWFA 3PSIA 2BZTA 1VI0A 4EJOA 4A3KK 1T39A 1QQIA 2WV0A 1MNEA 2R7SA 2AO9A 3KLNA 1PUFA 3IH3A 3EYIA 2L7FP 4CCJA 2VJ5A 3K1NA 3M4OC 4DGWB 3MMLB 2V6SA 2IP2A 4YIRX 2ZXJA 4DOZA 3CC2I 2CV0A 1HLVA 3SYTA 1L0OC 1W36C 2DA4A 1B8IA 4LB5A 1G3YA 2HR3A 4N9IA 1XMAA 2WB1L 1ETWA 2Y31A 2HS5A 4IZZA 2Y0SL 4YIIA 3LAPA 1WI9A 1LQ1A 3CQZA 3ECOA 4HYEA 3C18A 2RH6A 5EEGA 2EZKA 1ZAOA 4B47A 1U9NA 2Y2ZA 1PUFB 4IJAA 1VLOA 2JPCA 5EG0A 3GSIA 5B1BH 3TQNA 4K2EA 1R5HA 1VF9A 4BGDA 4GDFA 3VFZA 4GYGA 4RGUA 3OYEA 2LRDA 4MGRA 3J80Z 4Y52K 1GDTA 2DFEA 4YIFA 1AB4A 3FOEA 1MGTA 4RM2A 3I4NK 4LIUA 4BY7J 2OV7A 4GO1A 2CW0F 2EK5A 3E6CC 2IXSA 2YX7A 1WCMA 3HOXJ 3G2BA 4C9YA 1P2FA 2DTRA 2VBZA 2VT2A 4KUMA 5LGNA 2ZJRF 4J01A 2L9NA 3OSGA 2FNPA 1IRFA 2P81A 1WSVA 1EK8A 4L5EA 5E3LA 3GTJJ 2RREA 3MCZA 4MTEA 1Y39A 1NK2P 5CVJA 3I56I 5CVRA 3KP7A 4BS9A 2X1CA 3GCMA 1EF4A 2JA7K 4ZYGA 3F72A 1YI2I 2PI0A 2D1VA 5J4YA 1SVOA 3PIOF 3GTQC 2L7KA 4CZZA 3BG7A 5EEHA 2RNGA 1FWZA 2ELJA 4XKCA 2DQLA 4M71A 1C0AA 2XIGA 1GVDA 3HJEA 2P7VB 2E2IA 4KAWX 4GTAA 2V6CA 4WXHA 2UWMA 3FOFA 2GSNA 1LB2A 5HDKA 1YS6A 2E35A 3HSEA 4BEHA 5GTHC 2XVCA 3S2WA 3WODA 4YFKA 3I4MC 4RMNA 1WQFA 5IT9Z 4ZYDA 5A2QZ 2VUMC 2FNAA 1PP8F 3VYTB 5FLXZ 2XAJA 4FT8A 1S8NA 4KJZA 4M6XA 1I6VA 1XXCA 2G7HA 4FX4A 3HRSA 1O3QA 2HEOA 3E97A 4MHGA 4OAZA 1FBUA 4BXFA 2ESNA 3K0LA 3QPLA 1E3OC 3K9TA 4G7HA 1WJDA 3GUDA 5DD4A 1Z6TA 3I0TA 2VC0A 2IRFG 4LG0B 4KC6A 3H5RA 1MD0A 2F5DA 5DUIA 2KLOA 4CCNA 3QAHA 3DPUA 2W85A 2YPRA 3G1MA 4HBLA 1WRJA 2DMNA 3L2CA 2E2JJ 1INNA 1ZVUA 2JWTA 4KM9A 3S14K 2BW3B 2DT7B 2TCTA 4HSTA 4F93B 3NWSA 1B72A 5E17F 3ZMDA 5ILVA 3H0GA 1XXAA 2VXZA 3GLLA 4M1XA 4L18B 2ZMEB 5K5OA 4MEXF 2HXIA 2NNYA 4OIPF 2HVRA 3S1RK 1EH1A 1L3LA 1W0UA 4CUGA 4A69C 2A3SA 2XGCA 2M0MA 2PMZL 2NVUB 4KFCA 3RPUA 2E1CA 4P5BA 1QO0D 1KQ8A 4CICA 1U78A 3OYJA 4U0WA 3Q9SA 3TGNA 1WCMK 1OISA 4OINA 5DEQA 1KU7A 1WGXA 1WJ5A 2R7DA 3M4OJ 1DP3A 4GTBA 2JK3A 2K7LA 4XSZF 3H3VK 1SD4A 5M3FK 1V5GA 1ZBSA 4ANJA 3S2DK 2PHCB 1R4NB 3HOVJ 2ZMEC 1YO5C 2OPTA 2OZUA 2STWA 1WZ2A 2YU9C 3CCJI 3GTMC 5HODA 3JSPA 4A3FJ 1YRNB 1U6GA 4A3CC 2VODA 4FM9A 3HOSA 5EGOA 3SDBA 3HOWJ 1FSEA 3S1NJ 3GTMA 1HI9A 3OY9A 1HSJA 1SFOC 1JKQC 3KZIC 4A3DC 4GT9A 3HYIA 3BUEA 1LFPA 2R4GA 4CO8A 2HXOA 2LH9A 3Q3QA 2WAFA 2LKSA 4LITA 2E2HC 3H3VL 1G3SA 2X1DA 1YTYA 2AXLA 4ZYAA 4QIWL 5EDNA 4OU0A 2O3FA 3FMQA 3BCAA 2EV6A 4HSRA 1IJWC 4KDPA 2K9QA 5C44K 2M0CA 3FBNB 4JK1A 2RC4A 4A3FK 1X1CA 2X1EA 2OBPA 4BKXA 3MKWB 1FBQA 3LSKA 1D3YA 3U9GA 3HXAA 2ICWG 4LK1A 2DW4A 1BS2A 1PJ5A 1B4AA 3S1NK 2RGRA 2Y0SD 2NVYK 3BPXA 5LGUA 3CCYA 1J2XA 4BY1C 3DPTA 1Z21A 2EIMH 3LSHA 2QF7A 1ZGWA 2XPWA 4C3IK 3A0BC 5BS6A 1UG0A 3W2WA 4XLPF 1TWAK 3VA7A 3DTEA 5M3FJ 5EZGA 3AQOA 2V1XA 1PP7U 5GAGJ 2VOOA 4A3DJ 3EPZA 1IL2A 2A05A 4XIDA 4CCOA 3GDZA 5DM7F 1ETQA 2NVQK 3DEUA 3GWZA 3WHBA 5H6RA 3VYSB 3CD6I 3V4GA 4B48A 3AD7C 3K4MA 3TP3A 1AU7A 1LE8B 5CVUA 4J19A 2L2OA 3EUHA 2ISZA 3S14J 2DFHA 3FWEA 1PDNC 5CPRB 2E1MB 5KVRA 1TWCK 1ACIA 1ZTRA 3AG3H 3HRUA 5F64A 3TO6A 1AWCA 2Z1DA 3K1MA 2Q1ZB 2M34A 1IC8A 1O25A 4GXOA 3VYRB 2VUMJ 3HOYJ 4EJWA 3FXJA 2O8XA 4UB8C 2ME6A 4L5IA 3KETA 2PN6A 2O7OA 4Y33A 3GTKC 4HNTA 2VJ4A 1Y1WA 2WAEA 4I7HA 3SJMA 1WOSA 4BQOA 2HNHA 4I98B 5M5WJ 4D5CA 4FASD 6PAXA 4MQ9F 4A3EJ 4KITB 3PSFA 2Z2SB 1B6AA 1PVEA 4G7ZA 3RQIA 3G73A 5C4JJ 1MNMC 1LJ9A 2UXNA 2RDPA 2ZBKA 3MKLA 3RKWA 4U0YA 4ESJA 5TGTA 1Y8RB 2K9LA 1I3QK 2VQHA 4JOMA 4D9JA 1VQNI 3H36A 2K02A 2DDAA 3HHGA 1O7LA 2CS3A 4A3IK 3HOVC 1YG2A 2WB1N 3HOUK 3FKIC 2E19A 1LFUP 3RKYA 3I53A 2L01A 3WGHA 1RI7A 3L2WA 3HKZD 4LJZF 1U0JA 3GEHA 3GZ5A 3FMRA 3K6GA 2X6WA 1GUUA 1XCBA 2BW3A 3S2HJ 2GM4A 4L0ZB 4R8HA 1YE9A 5IP9K 3M3YK 3A01A 3R6SA 1FIAA 3B6AA 1UELB 2LFBA 1A31A 1X31C 3A8JA 3P9IA 4C3IJ 4KIFA 4AH6A 4XBFA 3L2RA 2W4SA 3D5SC 4RS8A 1MZBA 3DEEA 4RBOA 2XKPA 4II2A 1FP2A 1R9TK 1IW7F 3VWBA 4MEYA 4UUTA 2J5PA 4H0EA 5C4JC 2JRTA 2NVTJ 2QKMB 4G94A 3QPSA 3IV5A 2A5YB 2XGEA 2OAZA 2FXAA 3S17K 1FOKA 2DA2A 1U9OA 1O2FB 4Q4ZF 1SD6A 2HDWA 2HYFA 2VKVA 3E6DA 4KISA 2QQAA 3PO3C 1B1BA 3KEOA 3F8CA 1ZH5A 3S1RC 4RLQA 3O2PE 3UKGA 3CC4I 2GZWA 1MMGA 4KICA 4M9XA 5F1JA 2PEXA 4Y52J 1HXDA 4O6JA 5LBQA 4BLBA 3BR5A 3BTIA 1HQMA 3CJRB 4QTRA 4KMAA 2JA6K 4HLYA 2JVGA 1P7IA 4RAFA 3ZQCA 1ZRCA 3L4JA 1VQ9I 3HBLA 5L3BA 2LYCA 1Y1WJ 3NAUA 2R0QC 3VPRA 2PJPA 2Q2EB 4EM2A 5IP9J 1KA8A 2Y75A 5E20A 4A3KJ 1FLIA 1K7AA 3FKJA 2W82A 3HC7A 4LG3A 5CVVA 5DV5A 2HZTA 2MD0A 2ESHA 4UUVA 2Z99A 3CDHA 5EG0B 4KMDA 3X2QH 4RLFA 1EV7A 2OUMA 2CJJA 4BQAA 3GXOA 2EFOA 5JI6A 3GFMA 3Q9VA 1IZ1A 1BR1A 5DD8A 5TMFA 3U1DA 4ZTFA 1MJAA 2IS4A 4O2DA 1S5LC 5HDNA 1R5GA 4E7SA 1CQTA 4QPQA 3EQLF 3GEZA 3J7YJ 1MNDA 1ONVA 5C3EK 2IA0A 2RGVA 4P9UA 3KLOA 2CFXA 4XLEA 3CMYA 4G6DA 3CLOA 3F21A 2XF5A 3ML6A 2H09A 4I09A 1S3JA 1VQLI 3FHZA 1F93A 3S16C 2CQNA 3OYBA 2W48A 5FJ8K 2GA2A 3JRIA 4G0WA 3GTKA 1R22A 4J00A 3BOQA 3BTJA 2BHYA 1B4BA 3GBGA 2B63A 5E18F 1XS9A 3ZN1A 1FT9A 2VQCA 2XKOA 5E79C 3DLAA 1KZHA 3M1CA 4UV9A 2GQQA 2QZ8A 3I9V2 2XC7A 3BR6A 5FRMA 2YU3A 2F5CA 2W00A 3CQZJ 3HPGA 3CMMA 3EYYA 1TLHB 2KT0A 2HPIA 3DQVC 2ZO4A 1ZG1A 2H8WA 3HIFA 4OIRA 5FLXK 4C3HK 1YNNA 1CGPA 3CZ6A 3L09A 3JRDA 1YQAA 1HA8A 3H92A 1KYZA 5J8FA 5L3EA 3WU0A 2IA1A 4A2UA 1QBJA 1T33A 3F6VA 3GZNB 1WOPA 2FBHA 2VKDA 3BTCA 4Y52C 2X85A 2KIQA 1A36A 3WG7H 1IUYA 2ZMEA 4LLGA 3KP4A 2GBYA 1S7AA 2DT6A 1Y1VK 1R4MB 2E2IC 5FD5A 5HS7A 2DDBA 4CCKA 3CJQB 2DYSH 1OYIA 4M72A 1REPC 1YX5A 3K4JA 2QQ9A 1Q1HA 1ZQ3P 4FE7A 3HOTA 2DN0A 2DQRA 1D1AA 1ITYA 3WTWC 1BOBA 2B9SA 2DJIA 3GIRA 3BG9A 4YFNA 2XSJC 1ZG5A 2MBFA 5FLVA 3GTJC 5C44J 1UJ8A 3KYLA 3HKZL 1O24A 3BP3A 1SD7A 2VN2A 3ZPLA 3SZZA 1HC8A 1P9QC 3A0HC 4BBSC 1JOEA 3BR2A 3GZ6A 5DS9A 4L9VA 4BKWA 4A3LK 1W1WE 3OYKA 3HOZJ 3AG4H 1A04A 1N25A 2LTPA 2FE3A 2Y48A 3I64A 3K4BA 2ZJPF 2KRFA 1HDDC 3NUHA 1YOVB 2CFAB 4A3LC 4Z6YA 3WTTC 3OIQA 3KZZA 2BY2A 4XN0A 3DU5A 5GPCA 2NVTC 1HCRA 1O3SA 1ZXOA 2LF7A 2CUFA 2VIXA 4BJTA 5IOZA 2JQ7A 1RUOA 2BHZA 1R71A 3H0GJ 1LE8A 1BIBA 1V5EA 1GE9A 4LG0A 2XGXA 3QOPA 2GOXB 4RGSA 4A5NA 4KARA 1I1GA 5JFEA 3MWMA 3FXMA 2HU9A 5EZHA 3IL2A 2JA2A 3SDGA 3KP6A 3AG2H 1I27A 5CJ9A 2LNBA 2CG4A 4PFOA 4XICA 1G59A 2DMUA 5F27A 3HRMA 1Y1WC 4KDDA 3K4KA 3R60A 1GXPA 4BDYA 4AIKA 3PFYA 4C3HJ 1U3EM 1Y1VC 3BG6A 4FQGA 4KM8A 1NTCA 1UB9A 1JUSA 1QA6A 1GV2A 1WH7A 3HM5A 4GRIA 4CXFA 2R7WA 5CHPA 2CYYA 3W6KB 2MABA 4C2UA 5FJ8J 1T38A 5LHGA 2ETHA 2ZC2A 1G2HA 4Q48A 1YJNI 3G1OA 5M3MJ 3HOYK 3M3YC 1MMAA 3DLLF 2FQOA 1DD5A 1EA3A 3H9JA 3OV8A 4M6VA 4WF2A 1J6WA 3HDDA 2JVHA 4KMHA 4C30A 4XQFA 4Q4ZA 4C3HC 4BU2A 1O4XA 1RRJA 1YS7A 4NNJA 4BBRK 2A6TA 5E1ZB 4IF4A 4U7DA 4RA2A 3JRGA 1MIJA 1Z67A 2O8KA 2K9SA 4NDLA 5DCFA 2E2IJ 1JT6A 3M7GA 4E7JA 2V7FA 1TP4A 3RJPA 3OREA 5BPDA 2Q2EA 2TRTA 2LY9A 4HX4A 2MW8A 1ZGAA 1UHWA 2HYGD 1B8IB 4LOCA 1I50J 2E2HA 2QSHX 3ABKH 2IJLA 3OSFA 1VRQC 1IDZA 4E6KG 3QQAA 3E0JB 3A8KA 3WTSC 2HQNA 3F8NA 2FEZA 1X1BA 1GLNA 2DCEA 3H5AA 5IYBJ 2D6FC 1LEAA 4RB1A 3OYAA 5C3EC 1OPCA 1YX3A 3EDPA 4ZDPA 4EGYA 3KFWX 3E3VA 2ZCWA 4CCMA 2HOSA 2DFIA 4LK0A 2HZDA 4KA4A 2RAEA 3ISPA 1EKEA 4LLNA 2LY1A 3RI4A 2COMA 5LD2C 1ZKGA 1O2BA 5D4RA 4KMUX 2X6OA 3PFIA 5KNLA 1D5YA 4IL6C 1R36A 3IAM2 5IOTA 4I99C 3S3NA 5M3MK 2JA6J 4OMZA 3MN2A 4OAYA 2A6EA 2WTEA 2V1DA 3GTPK 5J4VA 1FYKA 4PCQA 1KQ4A 4MFDA 4LB6B 4A5MA 5EF6A 3GTJK 2CUEA 2WAQL 4XRSA 3R61A 1JVIA 1IW7A 1XDSA 1BN5A 3A01B 1U5TA 5LRRA 2R5ZB 4Q5SA 3AH5A 3OPFA 1UV7A 3JRBA 2JSPA 2K9NA 5J1UA 2FX0A 1H9GA 1R1UA 2ECCA 2HOEA 3FK6A 1IV6A 2HYJA 1E17A 3CC7I 3I4NJ 5IP7J 1JXSA 4ZDLA 1O57A 2OU2A 3CUQA 3CCSI 3PO3J 1DPRA 4I01A 2GLOA 2VQGA 4M9ZA 4A3GC 5BQTA 1UHSA 2QGUA 2ZXHA 3M8FA 1Z91A 2QEXI 3ADAC 2B63C 3BZ6A 3DP7A 2L7ZA 1NG6A 1WJAA 4NQWB 4Y17A 1WCMJ 1ZR4A 3OYNA 3CCLI 4G8XA 4BE2A 2X9DA 2P4WA 3M8EA 5LHIA 2MC4A 3QX3A 2R93C 1ZK8A 3HB9A 2D5VA 3N0CA 5ICCA 3M8JA 4L9TA 4GFBA 2F4IA 2PFBA 1XZPA 4G7ZF 1WPKA 3VB2A 3HOUJ 2Y0MA 3DTKA 3IPJA 1ODDA 3DBRB 3HXLA 1YW7A 3ZMVA 1MBHA 1F9NA 2O6GE 1OMIA 1IQ0A 2V6EA 3OL3A 4XORA 2CFAA 2KHMA 5DDGA 3TDUC 5D8LB 1DCOA 1Z6RA 2CQXA 3ZRGA 3CQZK 3DXJF 4ESBA 1K61A 3SZYA 1ZN2A 4E7LA 1LVAA 2H94A 5F0HA 2LBFA 2DPDA 3S16K 5DYMA 2D1HA 2L0KA 1UG2A 1W7PB 3J80K 4KN7A 3BZKA 2X0LA 4A3IC 4F52A 1F7UA 3WTVC 4F92B 3LSMA 3C3WA 4LLLA 2BV6A 3RKXA 4AD9A 3K2ZA 2EFPA 3P7NA 2O5JA 2DOFA 2CWEA 3OOUA 2XB0X 3ABLH 4EJTA 1O29A 4WXDA 4PJMA 2E34A 1X4OA 2V1UA 4XK4A 3I59A 5JVOA 3RZDK 1ZYRA 4A3BJ 1XC5A 2Y69H 2M4KA 3GTLK 2BY1A 1RR7A 2LLKA 1R6RA 3QYFA 2KZVA 1XMKA 1HKTA 1BC7C 2IAIA 2W7NA 5CQEA 4IHTA 4BHBA 3S0XA 2VB6A 2M87A 3N05A 2DK5A 1FOWA 1FP1D 3O3KA 2WWYA 3GTKK 1SFEA 1T0FA 1UHMA 4BAYA 3KYCB 1U8RA 1FYMA 4LOWA 1LNWA 3CLQA 3DU6A 2KFDA 3DWLE 4BNCA 2WV1A 1WSUA 4XSZA 1HW1A 1YFHA 1R1VA 2K4BA 2P0WA 4B43A 3FXRA 1SC7A 3TEDA 2OF7A 2BY3A 4BDZA 2P5MA 4IHXA 3OYCA 2VPLA 3FHNA 3L2VA 5FFZA 1Z0XA 2B0LA 1DDNA 2XUBA 3OS0A 1V3FA 1BI3A 1UFMA 2OD5A 1ULYA 3GTOJ 2NS8A 4GZYA 1JJ6C 1R1TA 3FX3A 3ONQA 3IWFA 3RTRA 3ZMUA 4BHPA 2BOLA 2JA5C 3HTUA 1YLFA 1T6SA 4ASNA 1AOYA 2GAHC 3BG5A 2ZFZA 1X1PA 1WSRA 5EEAA 2P6SA 4FE4A 1TT0A 3I59B 4YELA 3E7LA 3FF5A 3T8RA 4QIWD 4C3IC 4RAGA 3LL7A 4U87A 5B1AH 3T01A 1B9NA 3K4CA 5FKNA 2R7RA 3F3XA 4EM1A 1IN5A 2DTZA 3B73A 2BXZA 1ZLJA 2NNNA 4DYRA 3FISA 5L3DA 2R7TA 5JLWA 2PX9A 5J1RA 3MKZA 5E1WA 3QPTA 1HF0A 2M3AA 2LP0A 3BP8C 2JA7C 4KMFA 5E8GA 4IHWA 5DTDA 2LSOA 1JTYA 4LIVA 1V54H 2JPBA 2EFWA 3IC7A 1ZELA 2BBYA 5IP9C 2E60A 5C4XC 4KB2A 4UUSB 2QBYA 1EJ9A 3JAMZ 1T56A 2E1MC 2CH0A 5HDGA 4WK8F 2KQRA 3WTZA 1X1AA 5ICEA 1RIOH 3P9CA 2O61A 1VQ7I 3JRHA 2CUJA 3LSTA 2XDVA 2AQEA 3G1LA 3I4NC 2DAOA 5EJCA 4L0YB 1SFOA 1K83J 4OIPA 2AQFA 1SANA 2VBXA 3HHHA 4MEXA 1J6VA 4OIOA 1I1SA 1JUPA 3GMEA 5C4XJ 2YU9K 1W7PD 4A3MJ 3ULQB 2PBIA 2HVQA 2OA4A 2EZIA 3S2DC 5K5QA 4ESFA 1OCZH 3S1RJ 2BEOA 4ON0A 1I6XA 3LQRA 1TWHK 5AIPA 5CLSA 1XGSA 2ZJQF 2DT5A 1K4TA 2IGMA 2WADA 3JR9A 4EGZA 1DGWY 4II3A 3HKZA 4FX0A 1VQ8I 3ASNH 4JX6A 4M3FA 3K70D 1RUNA 2MC3A 1FSHA 4G7HF 3ERED 1YW9A 2CW0A 2QA4I 1W36D 2XRLA 3HUGB 5J6XA 3M4OK 4HF0A 1BA5A 1MW7A 3N97A 1ENHA 2EBIA 4RB3C 4ENMA 2L9VA 4B4CA 4A3KC 2CGPA 1P4WA 3E6BA 1WQ2A 1O3RA 2RKHA 1TNTA 5J40A 2LD5A 4AYBD 4GTCA 3BQZA 3SFIA 3ESWB 1ETVA 3OYHA 2WB1D 2HQAA 2LKPA 2JTVA 4XONA 3C2BA 1VGXA 4HPQA 1ETKA 2ME0A 2LR8A 3LA3A 2NVQC 3ZR8X 4MQVA 4CA0A 3WTUC 4HV6A 1O27A 2W84A 2O03A 3DBLB 1Z9CA 3FXOA 4A3EK 5M5XJ 1MBKA 1QGPA 1MBEA 1V55H 3PNYA 4IQ4A 1J75A 1D8KA 2PA8D 2FSWA 1P6RA 1AA7A 3H5NA 4IQJA 1FTTA 3V8JA 1I50A 1X1DA 1W5TA 4WXCA 4A0YA 3RCOA 5IOQA 4HQMA 3D5RC 5IY5H 3R0AA 5FLMJ 3OR2C 3GFIA 3AAFA 1V4RA 1K83A 5BOXA 1HW5A 4X0GA 3K70C 2L3DA 3S1MK 2K86A 5F1RA 1W0TA 4AM3A 4BBRJ 4A3FC 3I4MK 1TNSA 2YS9A 3CCRI 3TO9A 4IX7A 3KP5A 2XSDC 1TWHA 3DBHB 3HOWC 5F6FA 2P5LC 2FQ3A 4LR2A 1GVJA 3SXYA 2JN6A 3O8HA 5JHUA 3OOPA 2E2HK 4AVPA 5BMZA 1R23A 2PMZD 2A69F 5ICFA 3PNTA 4A3DK 2DJNA 5ERIA 4A3MC 3W2AA 4WJ4A 3OYDA 4ENNA 2ZSIB 3FKIA 2JZYA 1Z7LA 4I76A 3MAJA 2Y3PA 1FPQA 3PUFA 5GTIC 2ECBA 2JRMA 2V9VA 2QWWA 1FNNA 1BC8C 4IHVA 2EV0A 1OLTA 2OC6A 3ELKA 4OWRB 4AYBA 1X3ZB 1MMSA 3GTGJ 4IRHA 1F4KA 4CHUA 3W3CA 5LFAA 1TQPA 3MKYB 1BI2A 2IW5A 5FLMK 3GX4X 4ZYEA 2YU9J 1LUJB 5C4XK 1R5ID 5B5EC 3HZJA 4JX4A 5EGOB 4G9YA 2DA6A 3H0GK 4O5VA 4XSXF 1WCMC 2JUCA 1K6OA 2HWVA 3HL2A 3ZQHA 4XLCA 2EPFA 1XPXA 1YCLA 2IS6A 3F8FA 5EYRA 5D5XB 3ZQGA 3H35A 4BE1A 2OCEA 3D5LA 4QIWN 2IGOA 4DZPA 3QYBA 3V7RA 3M3YJ 5FGMA 4EJUA 4G7OF 2HOTA 3LMMA 1USSA 2D2WA 4E7ZA 1N75A 2BXYA 2H27A 1MBFA 3HTSB 1WWXA 2DXIA 3QP6A 1J98A 5DCMB 4KB4A 2VBYA 1FTZA 1VQMI 1FJLA 2OQRA 5F04A 1NH3A 4OIOF 5M5YJ 2JA5K 2QSFX 3E5QA 3RPUD 5DM6F 1GV5A 1ON1A 3MQ0A 4QSHA 5IPAA 1QHHD 4F91B 1XZPB 2CU7A 2E36A 3KZYA 3LSIA 2CO5A 3MZ8A 3VDXA 4IO9F 1H8AC 1P92A 1X3WB 4MLOA 2ZXWH 1USTA 3AFHA 5HLGA 5JVTA 2L4AA 3GTPA 4X6AC 2LVSA 2M4GA 2XPVA 4D7NA 2NRAC 1VZ0A 2KKOA 4I02A 2F6CA 2ZFWA 4LJZA 3RSNA 4GTLA 2IVMA 4OIQA 2VJIA 5TISC 1A35A 2YR2A 4FTHA 1J6XA 4NQWA 3ZGKA 4B44A 2R7ZC 4XLNF 2ZKZA 3WGIA 4KMUA 3DKYA 3RYRA 3OYIA 1WH5A 2VUMK 3T8TA 4YFXF 2QYOA 1LVKA 2IEKA 2X6XA 3BCBA 3GO5A 2VLAA 1L0WA 2Z33A 2VKHA 3ZN0A 1RKTA 2Y9ZA 4PFPA 2O5IA 2DLLA 4C2MJ 3A8IA 4LMYA 1GT0C 2GIVA 2KISA 4MQ9A 1AKHB 4CCLA 1YITI 3GTLA 1J5YA 2M8GX 2GXBA 2NOJB 3O8GA 3CCUI 2V1NA 2XAUA 4P55A 2P7CB 1XGNA 4A3JK 4IKFA 3WU1B 4RB2C 3GTQK 1JTXA 2KDZA 3A1YA 3H3VD 4YFXA 2L02A 1D0ZA 1A5JA 2NVXJ 3BDDA 3S16J 5FFXA 2FRHA 1OCTC 3T0YA 4A93C 4N9HA 2WY7Q 1DU0A 4C2TA 5LHHA 2Z5UA 2I5UA 4KIBA 1OCRH 3OIOA 1TWGJ 2XB5A 2IPQX 4AWXB 3A2KA 3G4CA 3HGGA 5J1YA 4C3JJ 5IOSA 1Y56A 3TL4X 2EA2A 2VC1A 3TMOA 2E2JC 5ICGA 4A3BK 2EZHA 2GAGC 4A6DA 3BJOA 4H4KC 4ZH4F 2DO7A 3MVPA 1XTAA 1IDYA 2NVYJ 3PQJA 1BGWA 3FK7A 3SEQA 1R7JA 3WG9A 2W1OA 2V6UA 4C2MC 2DYRH 4KN4A 4YFNF 2X51A 3BPVA 3OR1C 3TTGA 2KDOA 2BE5A 3RPQA 2FD5A 3V7CA 2FMLA 2FA5A 2R93K 4WJ3M 1MH4A 1VH2A 4BEHB 1H9TA 3J81Z 4PJ0C 3BY6A 1SFOJ 4KT6A 1HBXG 3I5UA 2XCRB 4M74A 1TWFK 3GF2A 3QPHA 2EIKH 1BW6A 5JR3A 1XPPA 1KONA 3GTGC 4AYBN 2X48A 2OTJI 4IVNA 2WAQD 2EFQA 1U5TC 3CCMI 1UZCA 1LEBA 3SEZA 2IS2A 1FY7A 2FQ4A 4XR6A 4A3GK 2QCOA 2LMDA 3CJNA 3IUOA 4OOIA 4UVCA 4A3GJ 1PJ7A 1USOA 2LG4A 4P5OA 4BLAA 1XSXA 3BR0A 1D0XA 3G4SI 4PDKA 1OKRA 3V8LA 2VPRA 4WCGA 1MBJA 1I5ZA 3TFJA 3GLXA 3CJTB 3GEEA 3VYUB 1PUEE 4NC7A 4UUSA 2QBYB 4BBSJ 2HTSA 1ZHFA 2LY2A 4BBSK 2L5QA 4RGXA 5ILUA 1TC3C 5K7FA 1BJTA 5CKTA 1LFBA 5ED4A 2HQRA 2J5OA 1OR7A 2UUZA 3ABMH 4XRFA 2XGDA 4KT5C 3S15C 1QRYA 4RM3A 1D8JA 1RNLA 4RB0A 5LGTA 1RR8C 3CESA 3FXKA 3GTOA 4A93J 4G0VA 3J7AY 3W6VA 1ISEA 1FEXA 3U21A 1AHDP 3V7SA 4DYQA 4OINF 1C0WA 1W5CC 5E1XA 1X58A 2EIJH 4ILDA 5E8IA 4IXAA 3BTLA 1HKQA 1BL0A 4C45A 1E2XA 4AC0A 3LSRA 3S2HK 2VASA 2M9HA 4HDVA 4B09A 2HKOA 1XXBA 1YIOA 3HGYA 2DA7A 5IYCK 4BXXK 4HF2A 3ECHA 2V9KA 4B1RA 2LREA 2VONA 4S0HB 5E3OA 1QPIA 1TWFC 5FB2A 4XN3A 1I6HK 1SMTA 5GAEJ 3HUGA 1BI1A 3E5XA 9ANTA 3E5UA 5HL8A 1JKOC 1VQPI 1YRNA 1VJEA 1BR4A 1YX2A 5FO5A 4EATA 3R0JA 4UY8I 4FZBA 2V6TA 2ZNZA 4CSWA 2MSYA 5IYDC 1SFUA 2DU9A 3ZMSA 3F8MA 3L7WA 4AVZA 2DI3A 3JRCA 4C3JC 4C2MK 3K2AA 2X4HA 3T5XA 1FOYA 2E5ZA 2PJRB 4NHJA 5CYVA 4C3JK 3QWLA 3KYDB 1E3PA 3RZOK 4RDUA 1U5TB 2BVLA 5E3MA 4WWCA 4A3BC 5CQGA 2E2JK 2PPBA 3Q0VA 1HQCA 2Q0OA 3U1KA 1U8BA 3FZVA 1S9HA 1IRXA 3GFJA 2I10A 2HGCA 1WJCA 5J3LA 2E7WA 2X6YA 3P9KA 3SQNA 5KHDA 3AL0C 1MH3A 2OTLI 2O5RA 3WU2C 1EFWA 3I54A 1SAUA 1T2KA 5K7HA 2UZKA 1RETA 4JQFA 3KIOA 3H3UA 4A93K 1CF7A 3FM5A 3K10A 2FU4A 2NVXC 1SD5A 1VQ4I 4LK0F 3HOXK 2XF6A 1ORKA 1K4SA 2EZLA 2F5FA 5C3EJ 1XDUA 2CRGA 3DKWA 3MFKA 2NS0A 1WJEA 4KYWA 1YYVA 4UB6C 3RIRA 4G0UA 1H0MA 4BY7C 3GW2A 2WY8Q 1PYVA 1XSDA 5KAIC 1VQOI 3GTQA 1X2MA 2G9WA 4B3XA 2VT3A 3TOBA 3PO2K 2CW7A 2EA4A 5DCMA 1BI0A 3TW6A 3LOCA 1STZA 3DKXA 5D6FA 1ZGJA 2LBFB 1IGNA 2L4MA 1SAXA 2EH3A 3L00A 1SVMA 5D4SA 1T98A 3OYGA 3K4LA 3S1QJ 1PJRA 3BJAA 2LF8A 2KMUA 3K4NA 3PO2C 4BJ6C 2PQ8A 3LA2A 4AIDA 4WILA 2H8RA 5B66C 3WTYC 1V5VA 3MMYB 3DTIA 4EJVA 4BY7K 3J81K 1H89C 4UVBA 3BC8A 3WHCA 2NAZA 2E5NA 2A5WA 2E7XA 4U7BA 5L3FA 3I55I 2JA8K 3TW7A 2H1LA 3GVAA 3PL8A 3TOAA 3ZXSA 3COAC 2ZJ2A 2R7VA 1IS1A 3C1DA 2CQKA 2JA5A 1KU9A 3QYEA 2BGCA 4KN4X 1JT0A 3LA7A 4PUSA 4G12A 5D6EA 1YNJA 2FMYA 4XL9A 1ZREA 4IRIA 2FJ1A 5FKLA 5IP7C 3CF2A 2TDXA 5D5UB 5IYDJ 2ZXIA 5TRDA 4IEJA 2FUG2 1UCRA 4KNYA 1RU0A 4I0AA 3V42A 4HV5A 3L1PA 4ZDOA 2R92A 2GSOA 2VJJA 3WE3A 5D5VB 3PO2J 2R7XA 2DK8A 1IAWA 5IYBK 1BBYA 1Y1VJ 3WE2A 4DW6A 1XB4A 5ILSA 4HDUA 3FKIK 2LOOA 4FHTA 3UNGC 5J47A 1JE8A 2E2HJ 2BE5F 4BHCA 1OYYA 3JRAA 3NEUA 3E1SA 2KRCA 2KJBA 3MZHA 4HF1A 1JGGA 1JHHA 2KIFA 4A3IJ 2A68F 1WQHA 4UXNA 4E7HA 3KPHA 5GAHJ 4RAZA 1I6HC 2W24A 4NBQA 1FMVA 2PMHA 3FBIB 1F5TA 3S1MJ 4NC8A 1QU3A 1G8XA 1WJBA 3KCCA 3FIWA 4LK1F 1ZYRF 3BZCA 5IT3A 3MEXA 3FXLA 4Y4RA 3CO7C 2R92J 3SFZA 1ETXA 1J9IA 1Z3XA 4KIGA 2DPUA 1TWCC 2IGNA 3CCVI 1RZ4A 1RC9A 1IUFA 3IWZA 1I50K 4MTDA 2IGKA 5KAFC 1BM9A 4J3NA 1G4DA 1NHAA 3Q0UA 4JX5A 1ON2A 5M5YK 1XX5A 2JA5J 2Z3YA 4LQYA 3S15K 4MO7A 4OIRF 2QQBA 4KASA 3JAMK 2WBMA 4D0PA 3OYMA 3S8PA 4V2GA 4D5FA 2XASA 5KCMA 1DP7P 3K7AK 1ZRDA 3C2HA 1F36A 2HKXA 3LFUA 4JK1X 4JBAA 3Q0WA 5H6QA 1AKHA 3K1PA 1I6HJ 3H1CA 1G51A 4F7ZA 5J8CA 1TWAC 4PK4A 2ZSHB 2KPMA 2JA6C 1DUXC 1XSVA 4P9SA 2K40A 2F4MB 4BY1K 1TWAA 3CMAI 2R92C 5FROA 3UR3C 1JGSA 3LFKA 3TO7A 2NVYC 3IKVA 2JSCA 4GCVA 4YG2F 2DODA 1YJWI 5DUKA 3F0CA 3M9AA 5HS8A 1MDMB 4N0BA 3BT9A 4GTDA 4HZFA 4A3LJ 1CF7B 1VQKI 2L9RA 3C2GA 1Y1VA 3QU6A 2GSUA 2EB7A 1KGSA 3CTAA 2K85A 4M6YA 5C44C 4PGGA 3EUKL 3IH4A 3GTGK 5EGEA 4V19K 4M3DA 5H2FC 5JFRA 3S1QK 4XLHA 1ZQ1C 5TMCA 1OCPA 3D0SA 2A07F 3BLYA 1Z3YA 4ITVA 2PMZN 1K83C 1R9TC 2XF7A 4X6AJ 2NVXA 1S7EA 2RQQA 4BY1J 1SFOK 2D45A 2W57A 4UV8A 2ZNYA 3HSFA 3HOZK 3GTMK 4A3CK 2WAQA 2M8EA 2GAUA 3HPHA 1X4PA 3ROUA 1MKMA 1TT5B 4Y7NJ 2KJCA 1QPMA 1SEUA 1XZQA 2DOAA 2F5VA 2NXNB 1KQ9A 5GADJ 1MJBA 4U88A 1DGRM 1J59A 3AQPA 1SFXA 2M7AA 3JCUC 2V9PA 5JHFA 3ZQFA 3S3MA 5TJJA 5IP6A 4JP0A 3HOUC 4BL0B 1HW2A 4I2OA 3HOVK 3CUQB 2Q8KA 2QSGX 2PA8L 4QJVB 2CFOA 1XCVA 1WI3A 1I3QC 3RYPA 3AG1H 4M3BA 1TWGK 1TWFJ 3S3OA 1D0YA 3WODF 4YFKF 3GTPJ 3S1MC 1JHFA 1HOMA 2Z9OA 1BJAA 4DZJA 1WVRA 3RZOJ 4A3JC 5JVGF 2R92K 3LPXA 3I4PA 4BJ5C 3E6MA 2B63J 3MD2A 3CP8A 3FXUA 3GTQJ 4HW0A 4XCHA 3IH2A 4MEYF 1XG1A 4GYIA 2L7MP 2GXAA 3GTKJ 3ZP5A 3BWGA 1IN8A 1I3QJ 4DDQA 2K3PA 3S14C 4MIMA 2E71A 2MA3A 2L9SA 1YJ9I 3CUQC 2R7ZK 5E3NA 1FMWA 5L3CA 5GP9A 4L5JA 3CP2A 2KRHA 3IP4B 2NVQJ 2PG4A 1Y6IA 1EQRA 1NG7A 2ZFUA 3NWTA 3JTGA 1K6YA 4XOPA 2XROA 1ZLKA 1XZQB 2DOEA 3BR3A 4A0ZA 2HDDA 2ISYA 1I50C 2EQRA 2DA5A 1B9MA 1TWAJ 4O3MA 2COBA 1BJZA 2OQGA 3HSRA 1LDDA 2MFZA 5CVIA 1PJ6A 4CYCB 2NYXA 3JTHA 3OMYA 3Q5FA 1FZPB 2QQ8A 1O2AA 2N8GA 4G6QA 4HG2A 1QZZA 2V4JC 2E1OA 3FMSA 5F0FA 3LSPA 3CO6C 2QUFA 3RZDJ 2F5EA 3GTMJ 4XNFA 4A3CJ 1TWHC 3H3ZA 2XHKA 5D5WB 4S04A 3TKYA 5IYCJ 5A2QK 1WORA 1KYWA 3S1NC 2EWNA 2DA1A 2H6BA 3ABUA 3IRQA 4GTFA 1K78A 2VI6A 4ZJZA 4HNVA 2IA2A 5F08A 1OFCX 4Y3OA 4X1EA 1MMDA 2G0EA 5B3SH 3QU3A 2ZB9A 1FIPA 3OYFA 1IRZA 1NK3P 4QPOA 2DMPA 3N0BA 3ZMTA 2R3SA 1BIAA 4N4NB 1I3AA 5H20A 4ENKA 1LDJA 3OL4A 2ZUEA 1TWHJ 2M7BA 4HLXA 4PSXA 4D1QA 2Y9YA 2WA0A 1T8IA 1K78B 4QWQA 3AL0B 2VL8A 4FCYA 1FYLA 1D5VA 3CQZC 4ZZDA 4EEFG 2VBWA 3KEQA 3R4KA 2CQQA 4EMSA 3LSJA 2K27A 2R93A 2LDUA 1P4XA 3PNVA 4HX8A 3HRTA 2A68A 1Q1VA 2GA1A 3F22A 2F2EA 4A3MK 2PJRA 4QLCU 2FQTA 1RKWA 1APLC 4RGRA 5F0CA 5IOYA 3M1EA 3PIPF 1IO2A 4B3AA 3I58A 2Y30A 4BXUA 4DYCA 3A02A 3S1QC 1O26A 4XLFA 3JW4A 2CMPA 4M73A 4CGZA 1EH8A 4I0BA 5HNHA 3HOWK 4IHSA 3CDLA 2A6HA 2XCQA 3TFIA 1H88C 1IRGA 1KU3A 1OR7C 1K79A 2V26A 3I3LA 4E7IA 4LGWA 3BQYA 2UXXA 2F4OB 1G6NA 3K69A 1USMA 3M07A 4IOCF 3TDZC 3PJRA 2PMZA 2CSOA 3SZPA 3LNQA 3AD9C 2A61A 3CCEI 2KWAA 5K5RA 1VQ6I 4XKBA 1IE0A 4XKVA 1ZRFA 2DA3A 3ZQLA 1WIHA 3J7AO 2K5CA 5HLIA 4PJNA 4CDGA 2M5WA 2LC2A 1TL8A 4HX7A 4A3JJ 2VE8A 1EI6A 1T0FC 4AIJA 4I6ZA 2R7OA 3C7JA 1SMYF 5L3GA 4M3GA 1KU2A 3GTPC 1SVLA 3PUBA 2VUMA 2OCCH 4EVIA 4P5AA 5D4DA 3L2UA 3H0DA 4P1WA 3P5JA 4ABZA 1IXCA 5HLTA 5HS9A 3L9FA 4BACA 3JSOA 3RDIA 1TBXA 3IAS2 4W1UA 1DQUA 4EM0B 3GTJA 2NVYA 2CV2A 3HOXC 2GXGA 3RZDC 4BQNA 3ERMA 3SHFA 3W6JB 1BOAA 5M5WK 1TWGC 1TW3A 3LAJA 1M1EB 3ZCOA 4PSWA 1IN7A 2AHQA 1TWGA 1QNTA 2WAQN 3WTXC 1JI8A 1OYWA 2FOWA 2I8DA 4GGGA 2JA7J 2NVXK 3GTOC 1OCOH 1XGMA 3B02A 1VTNC 3H9GA 3HG9A 3FXQA 3WGGA
chains in the Genus database with same CATH topology
4Q47A 5HLHA 1YW8A 1FC3A 3VODA 2FF4A 2MH2A 1S7OA 3SZTA 4A0XA 1TQMA 2YSRA 4KN7X 1ZARA 2ACJA 2OZ6A 2FBIA 2VE9A 4CYDA 2STTA 4L9NA 2XV4S 5KK1A 5HVQC 4HAMA 4UHTA 3IKTA 1IN6A 2KIUA 2QENA 3EETA 3KE2A 3V8KA 2HFHA 3CAGA 5TJ3A 4GFQA 2V79A 4KATA 3ZMZA 4PGHA 3F8BA 1Y0UA 3QP5A 1TW2A 3LQQA 4Y13A 4ZZLA 1GHCA 4P96A 1IF1A 1TWCA 4EV0A 3F23A 2L54A 4LD5A 3O6BB 1J0RA 2EFNA 1XGOA 3F6OA 5LEKA 5IT9K 4Y15A 2EJRA 3U2RA 4LFUA 2XCOA 2PMUA 1S29A 2XRNA 5LRSA 4B8XA 5LEJA 3VOEA 1O28A 4HA8A 1IN4A 1EH6A 3N3YA 4WX9A 2AS5F 2P6TA 2A6EF 1R58A 5IORA 2DBBA 1WQGA 4IPAA 3BP8A 4ENJA 1MDMA 3VEPA 2JA7A 3LWFA 3GYHX 2XAGA 3MZYA 2QLZA 1O7FA 4RAYA 4L9JA 2XAFA 2IT0A 1TQIA 2O0YA 4GTEA 5FD6A 1J7KA 2MLGA 2XAHA 1S6LA 3ZQ7A 4TV7A 2BYVE 3DFGA 2G7UA 4UNOA 4IRGA 4Q5SF 2JH3A 1EH7A 3REOA 1F1ZA 1GXQA 1QZYA 2PLYA 1LDKB 1W4MA 1KQ0A 3DPLC 3N4MA 4HQEA 1G3WA 1X3UA 2M1BA 3GFLA 4MNUA 1Z1DA 4R1HA 2JA6A 1FBSA 1R00A 5EGHA 2MLKA 5BPIA 4E70A 4R79A 4S05A 2VOPA 1XN7A 2M30A 2P5VA 4ZYHA 5D8KB 1ZG3A 2RV8A 1HKSA 4HOBA 1B59A 2ELHA 2R7ZA 2FOKA 2P8TA 2QM3A 3IRRA 4M9SA 4Z2YA 2HTJA 1R9TA 4A12A 1MJ9A 2W25A 1G3TA 2C6YA 1W7PA 3CUOA 4OIQF 1IXRC 1P4AA 3G4AA 3IHUA 2QVOA 4OMYA 1Z05A 1O3TA 4U0VA 1IXSB 4PZJA 5K1YA 4ETSA 4DNCA 3BROA 1FX7A 3DV8A 5LLQA 5HOOA 3ABTA 5AONA 3NRVA 2EV5A 3L4KA 1U2WA 3DF8A 2MD5A 2K4JA 2YX4A 5AIQA 3G3ZA 2ADUA 1TTYA 1HSTA 2RNJA 1Z7UA 1WKMA 2P5KA 2R7FA 3T1BA 1XD7A 4BH9A 4LLGF 3QRFF 2E1NA 2RVCA 3OEPA 2YU9A 4UVAA 4NB5A 3FM3A 3GTGA 2A6HF 2H6CA 2XAQA 3PQKA 2MH9A 2WC2A 2GWRA 4A6EA 3I71A 2FBKA 4P9FA 2HDCA 4AIHA 2M45A 1I3QA 4DQ2A 4BYYA 1DPUA 3KP2A 3NQOA 3BJ6A 2KIMA 1W5SA 2RQPA 4EQQA 2RN7A 2JT1A 3KP3A 1TWFA 4EJOA 1T39A 1QQIA 2WV0A 3KLNA 3EYIA 3K1NA 3MMLB 2IP2A 2ZXJA 1L0OC 4LB5A 1G3YA 2HR3A 4N9IA 1XMAA 2HS5A 4YIIA 3LAPA 1WI9A 1LQ1A 3CQZA 3ECOA 4HYEA 3C18A 2RH6A 5EEGA 1ZAOA 4IJAA 2JPCA 3TQNA 4K2EA 1R5HA 3VFZA 4GYGA 4RGUA 4MGRA 3J80Z 4YIFA 1AB4A 3FOEA 1MGTA 4GO1A 2CW0F 2EK5A 3E6CC 1WCMA 2YX7A 1P2FA 2DTRA 2VBZA 2VT2A 4KUMA 5LGNA 2FNPA 1IRFA 1EK8A 3MCZA 4MTEA 5CVJA 5CVRA 3KP7A 4ZYGA 2PI0A 3F72A 2D1VA 4CZZA 5EEHA 1FWZA 2DQLA 4M71A 2XIGA 2E2IA 2P7VB 4KAWX 4GTAA 2V6CA 4WXHA 2UWMA 3FOFA 2GSNA 1LB2A 5HDKA 1YS6A 3HSEA 2XVCA 3S2WA 1WQFA 5IT9Z 4ZYDA 5A2QZ 2FNAA 1PP8F 5FLXZ 2XAJA 4FT8A 1S8NA 4M6XA 1XXCA 2G7HA 4FX4A 3HRSA 1O3QA 2HEOA 3E97A 4MHGA 1FBUA 2ESNA 3K0LA 3K9TA 3GUDA 5DD4A 1Z6TA 3I0TA 2VC0A 2IRFG 4LG0B 4KC6A 5DUIA 1MD0A 2F5DA 3QAHA 2W85A 2YPRA 3L2CA 4HBLA 1WRJA 1ZVUA 4KM9A 5E17F 3ZMDA 5ILVA 3H0GA 1XXAA 2VXZA 4M1XA 4L18B 2ZMEB 5K5OA 4MEXF 2NNYA 4OIPF 1EH1A 1L3LA 2A3SA 4KFCA 3RPUA 2E1CA 4P5BA 1QO0D 1KQ8A 4CICA 1U78A 4U0WA 3Q9SA 3TGNA 5DEQA 1KU7A 2R7DA 4GTBA 2K7LA 4XSZF 1SD4A 1ZBSA 2PHCB 1YO5C 2OZUA 2STWA 3JSPA 1U6GA 2VODA 4FM9A 3HOSA 1FSEA 3GTMA 1HSJA 4GT9A 3HYIA 3BUEA 4CO8A 3Q3QA 1G3SA 1YTYA 2AXLA 4OU0A 2O3FA 3FMQA 2EV6A 4KDPA 2RC4A 2OBPA 1FBQA 1D3YA 3U9GA 2DW4A 1B4AA 2RGRA 3BPXA 5LGUA 1J2XA 3DPTA 5BS6A 4XLPF 3VA7A 3AQOA 2V1XA 1PP7U 2VOOA 3DEUA 3GWZA 5H6RA 3V4GA 5CVUA 2ISZA 3EUHA 3FWEA 1PDNC 5KVRA 3HRUA 5F64A 3TO6A 1AWCA 3K1MA 1O25A 4GXOA 4EJWA 2O8XA 4L5IA 3KETA 2PN6A 1Y1WA 4I7HA 4I98B 6PAXA 4MQ9F 1B6AA 3G73A 1LJ9A 2UXNA 2RDPA 2ZBKA 3RKWA 4U0YA 4ESJA 2K02A 3HHGA 1O7LA 1YG2A 3RKYA 3I53A 2L01A 3WGHA 1RI7A 4LJZF 3GZ5A 3FMRA 1XCBA 4L0ZB 4R8HA 3R6SA 3P9IA 4KIFA 4XBFA 4RS8A 1MZBA 2XKPA 1FP2A 1IW7F 4H0EA 2J5PA 2JRTA 4G94A 2A5YB 2OAZA 2FXAA 1FOKA 4Q4ZF 1SD6A 2HYFA 3E6DA 2QQAA 1B1BA 3KEOA 3F8CA 1ZH5A 3O2PE 2GZWA 4KICA 4M9XA 2PEXA 1HXDA 4O6JA 5LBQA 4BLBA 4KMAA 4HLYA 1ZRCA 3L4JA 5L3BA 2PJPA 4EM2A 1KA8A 2Y75A 5E20A 1FLIA 1K7AA 5DV5A 5CVVA 2HZTA 2ESHA 4UUVA 2Z99A 3CDHA 4KMDA 1EV7A 4BQAA 3GXOA 2EFOA 5JI6A 3GFMA 3Q9VA 1IZ1A 5DD8A 3U1DA 1MJAA 5HDNA 1R5GA 3EQLF 3GEZA 1ONVA 2IA0A 2RGVA 4P9UA 3KLOA 2CFXA 4G6DA 3CLOA 3F21A 3ML6A 2H09A 4I09A 1S3JA 3FHZA 2GA2A 4G0WA 3GTKA 1R22A 3BOQA 1B4BA 2B63A 5E18F 3ZN1A 1FT9A 2XKOA 4UV9A 2GQQA 2QZ8A 2YU3A 2F5CA 3EYYA 3DQVC 1TLHB 2ZO4A 1ZG1A 3HIFA 5FLXK 1CGPA 3L09A 1YQAA 3H92A 1KYZA 5J8FA 5L3EA 3WU0A 2IA1A 4A2UA 1QBJA 3F6VA 2FBHA 1IUYA 2ZMEA 3KP4A 1S7AA 5FD5A 5HS7A 1OYIA 4M72A 1REPC 2QQ9A 1Q1HA 3HOTA 2DQRA 3WTWC 1ZG5A 2MBFA 1O24A 1SD7A 2VN2A 3ZPLA 3GZ6A 4L9VA 4BKWA 1A04A 3I64A 2Y48A 2FE3A 2KRFA 3NUHA 2CFAB 3WTTC 3KZZA 1ZXOA 1O3SA 2LF7A 1RUOA 1GE9A 1BIBA 4LG0A 2XGXA 3QOPA 4KARA 4RGSA 4A5NA 1I1GA 5JFEA 3MWMA 3IL2A 3KP6A 1I27A 5CJ9A 2LNBA 2CG4A 3HRMA 4KDDA 1GXPA 3R60A 4AIKA 1U3EM 4KM8A 1UB9A 4CXFA 5CHPA 2CYYA 3W6KB 1T38A 5LHGA 2ETHA 4Q48A 1DD5A 4WF2A 3OV8A 4KMHA 4C3HC 1YS7A 5E1ZB 4IF4A 4U7DA 5DCFA 3M7GA 3RJPA 3OREA 5BPDA 2Q2EA 4HX4A 1ZGAA 1UHWA 2HYGD 2E2HA 2IJLA 3WTSC 2HQNA 3F8NA 2FEZA 1LEAA 4RB1A 1OPCA 3EDPA 4EGYA 3KFWX 3E3VA 2ZCWA 2DFIA 4KA4A 3ISPA 4LLNA 3RI4A 2COMA 1O2BA 5D4RA 4KMUX 3PFIA 1R36A 5IOTA 4OMZA 2WTEA 2V1DA 1FYKA 4PCQA 1KQ4A 4LB6B 4A5MA 3R61A 1XDSA 1BN5A 1U5TA 5LRRA 3AH5A 3OPFA 1H9GA 1R1UA 2HOEA 1E17A 1JXSA 1O57A 2OU2A 3CUQA 1DPRA 4I01A 4M9ZA 5BQTA 3M8FA 1Z91A 3BZ6A 3DP7A 4Y17A 4G8XA 2P4WA 3M8EA 5LHIA 3QX3A 3N0CA 5ICCA 4L9TA 2PFBA 4G7ZF 3VB2A 2Y0MA 1ODDA 1YW7A 3ZMVA 1F9NA 2O6GE 1OMIA 2CFAA 5DDGA 3TDUC 5D8LB 1Z6RA 3DXJF 4ESBA 1ZN2A 1LVAA 2H94A 2DPDA 5DYMA 2D1HA 3J80K 1W7PB 2X0LA 3WTVC 3C3WA 4LLLA 2BV6A 3RKXA 4AD9A 3K2ZA 2EFPA 3P7NA 2CWEA 4EJTA 1O29A 4WXDA 2V1UA 3I59A 5JVOA 1XMKA 1HKTA 1BC7C 4IHTA 4BHBA 3S0XA 3O3KA 2M87A 2WWYA 2DK5A 1FP1D 1SFEA 1T0FA 1UHMA 4BAYA 1U8RA 1FYMA 1LNWA 4BNCA 1WSUA 1HW1A 1YFHA 1R1VA 2K4BA 3FXRA 2P5MA 5FFZA 2B0LA 1DDNA 2XUBA 1V3FA 1BI3A 1UFMA 2OD5A 1ULYA 1R1TA 3FX3A 3ZMUA 3IWFA 3RTRA 4BHPA 3HTUA 1YLFA 1T6SA 4ASNA 1AOYA 2ZFZA 2P6SA 3I59B 3FF5A 3T8RA 4C3IC 1B9NA 3F3XA 4EM1A 1IN5A 3B73A 1ZLJA 2NNNA 5L3DA 5E1WA 3QPTA 4KMFA 5E8GA 2LSOA 2JPBA 2EFWA 3IC7A 2BBYA 4KB2A 2QBYA 3JAMZ 5HDGA 4WK8F 3WTZA 5ICEA 1RIOH 3P9CA 2O61A 3LSTA 2DAOA 4L0YB 1SFOA 2VBXA 3HHHA 1I1SA 1W7PD 3ULQB 2PBIA 2OA4A 5K5QA 4ESFA 2BEOA 4ON0A 1I6XA 3LQRA 5AIPA 5CLSA 1XGSA 2DT5A 4EGZA 4FX0A 1RUNA 1FSHA 2MC3A 4G7HF 3ERED 1YW9A 5J6XA 4HF0A 3N97A 4RB3C 4ENMA 2CGPA 1P4WA 3E6BA 1WQ2A 1O3RA 2RKHA 1TNTA 4GTCA 2LKPA 2JTVA 3LA3A 4MQVA 3WTUC 4HV6A 1O27A 2W84A 2O03A 1Z9CA 1QGPA 1J75A 1D8KA 2FSWA 1P6RA 3V8JA 1I50A 1W5TA 4WXCA 4A0YA 5IOQA 4HQMA 3R0AA 3GFIA 3AAFA 1V4RA 1K83A 5BOXA 1HW5A 2L3DA 2K86A 5F1RA 1TNSA 3TO9A 3KP5A 1TWHA 5F6FA 2P5LC 2FQ3A 4LR2A 1GVJA 3SXYA 5JHUA 3OOPA 4AVPA 5BMZA 1R23A 2A69F 5ICFA 5ERIA 4ENNA 3FKIA 2JZYA 2Y3PA 3MAJA 1FPQA 2V9VA 2QWWA 1FNNA 1BC8C 2EV0A 3ELKA 4IRHA 1F4KA 4CHUA 1TQPA 1BI2A 2IW5A 3GX4X 4ZYEA 4G9YA 4O5VA 4XSXF 1K6OA 2HWVA 3F8FA 5D5XB 3D5LA 3V7RA 5FGMA 4EJUA 4G7OF 1USSA 2D2WA 2H27A 3HTSB 1WWXA 3QP6A 5DCMB 4KB4A 2VBYA 2OQRA 4OIOF 3E5QA 1ON1A 3MQ0A 3KZYA 2CO5A 1P92A 5HLGA 1USTA 5JVTA 2L4AA 3GTPA 2NRAC 2KKOA 4I02A 2ZFWA 4GTLA 2IVMA 2YR2A 4NQWA 4XLNF 2ZKZA 3WGIA 3RYRA 3T8TA 4YFXF 2QYOA 3GO5A 2Z33A 3ZN0A 2DLLA 4LMYA 2GIVA 3GTLA 1J5YA 2GXBA 2P7CB 4P55A 1XGNA 3WU1B 4RB2C 2L02A 3BDDA 5FFXA 2FRHA 3T0YA 4N9HA 5LHHA 2Z5UA 4KIBA 2IPQX 4AWXB 3G4CA 5IOSA 2EA2A 2VC1A 5ICGA 4A6DA 3BJOA 4ZH4F 2DO7A 3PQJA 1BGWA 1R7JA 3WG9A 4C2MC 4YFNF 3BPVA 3RPQA 3V7CA 2FMLA 2FA5A 1H9TA 3J81Z 3BY6A 1HBXG 3I5UA 2XCRB 4M74A 3GF2A 3QPHA 5JR3A 4IVNA 2EFQA 1U5TC 1LEBA 1FY7A 3CJNA 4OOIA 4UVCA 4P5OA 4BLAA 1XSXA 4PDKA 1OKRA 3V8LA 4WCGA 1I5ZA 3GLXA 1PUEE 2QBYB 2HTSA 1ZHFA 4RGXA 5ILUA 1BJTA 5ED4A 2HQRA 2J5OA 1OR7A 4XRFA 4KT5C 1D8JA 1RNLA 4RB0A 5LGTA 3GTOA 4G0VA 1ISEA 3V7SA 4OINF 1C0WA 5E1XA 4ILDA 5E8IA 4IXAA 1HKQA 1E2XA 4HDVA 4B09A 2HKOA 1XXBA 1YIOA 4HF2A 3ECHA 2VONA 5FB2A 1SMTA 3HUGA 1BI1A 3E5XA 3E5UA 5FO5A 3R0JA 4FZBA 2ZNZA 1SFUA 2DU9A 3ZMSA 3F8MA 3L7WA 2DI3A 4C3JC 2X4HA 3T5XA 4NHJA 5CYVA 1U5TB 4WWCA 1HQCA 2Q0OA 3FZVA 3GFJA 2HGCA 2E7WA 3P9KA 3SQNA 1T2KA 3I54A 2UZKA 4JQFA 3H3UA 1CF7A 3FM5A 2FU4A 1SD5A 4LK0F 2F5FA 1XDUA 3DKWA 3MFKA 2NS0A 4KYWA 1YYVA 3RIRA 4G0UA 1H0MA 3GW2A 1XSDA 3GTQA 2G9WA 2VT3A 3TOBA 2EA4A 5DCMA 1BI0A 1STZA 5D6FA 1ZGJA 2L4MA 1SAXA 3L00A 5D4SA 1T98A 3BJAA 2LF8A 2PQ8A 3LA2A 3WTYC 4EJVA 3J81K 4UVBA 2NAZA 2E7XA 4U7BA 5L3FA 3GVAA 3TOAA 3COAC 2ZJ2A 1IS1A 3C1DA 2CQKA 2JA5A 1KU9A 2BGCA 4KN4X 3LA7A 5D6EA 2FMYA 1ZREA 4IRIA 2TDXA 5D5UB 5TRDA 1UCRA 4KNYA 4I0AA 4HV5A 2R92A 2GSOA 3WE3A 5D5VB 2DK8A 1IAWA 1BBYA 3WE2A 1XB4A 5ILSA 4HDUA 4FHTA 1JE8A 2BE5F 4BHCA 1OYYA 3NEUA 2KJBA 3MZHA 4HF1A 1JHHA 2KIFA