2E2HK

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2hK00
2Y0SD 5C4XK 3I4MC 2R93K 1TWHC 4Y7NC 5IYCK 4OIRA 4QIWL 4KN4A 4C3IK 3HOYC 2NVQC 4ZH4A 4G7ZA 5M3MK 3RZDK 2JA7C 4G7OA 1WCMK 4A3DK 4A3BC 4A3MC 3PO2C 3RZOC 5IP7C 4A3GK 1R9TC 3GTLK 1TWCK 5C4XC 2E2IK 1I6VA 4OIOA 3HOWK 2R93C 4Y52K 5D4DA 5IYCC 3S2DK 4Q5SA 4C2MK 1I3QK 3RZDC 5C3EK 1WCMC 4A3DC 4QJVA 4BBSK 4A3GC 1YNJA 2A68A 3GTLC 1TWCC 2E2IC 4G7HA 3HOWC 3S15K 4Y52C 5FJ8K 2BE5A 1TWFK 2CW0A 4XSXA 3GTPK 3S2DC 2NVTK 4LLGA 4BBRK 1I3QC 4KN7A 5C3EC 4AYBD 4XLNA 3GTMK 3S2HK 3HOUK 3WODA 4BBSC 4C3JK 3S15C 1I50K 2NVYK 2WAQL 3H3VD 1TWFC 3RZOK 3GTPC 2A6EA 3HOVK 4C3HK 2NVTC 4BBRC 5M5XK 2Y0SL 1SMYA 3GTMC 3S2HC 4A3MK 3M4OK 3HOUC 2A6HA 4OIPA 2O5JA 2O5IA 3GTQK 5FLMK 2R7ZK 4A93K 3S17K 1I50C 2NVYC 2PA8D 3HKZD 4NOIA 3HOVC 4LK1A 3M3YK 3S1RK 5IYBK 5C4JK 3CQZK 4OIQA 2JA6K 2WB1D 2NVXK 3M4OC 4MEYA 3S1QK 5IYDK 3GTKK 4YFKA 4LK0A 5FLMC 2R7ZC 3GTQC 3PO3K 4A3CK 4A93C 2PMZD 3S17C 4OINA 5TMFA 1Y1VK 4A3FK 3S1RC 3M3YC 2YU9K 2E2JK 4YG2A 5IYBC 5C4JC 3CQZC 2VUMK 2JA6C 2PPBA 3S1NK 4X6AK 3GTGK 2NVXC 5C44K 3DXJA 5IYDC 3S1QC 1HQMA 4A3EK 3GTKC 2JA5K 3PO3C 1I6HK 2B63K 3S16K 4A3LK 4BXXK 4A3CC 4BY7K 4AYBL 2JA8K 2R92K 4Q4ZA 4JK1A 4XLPA 4A3FC 1Y1VC 2E2HK 5M5YK 2E2JC 2YU9C 3I4NK 2VUMC 4A3IK 4KMUA 3H0GK 3S1NC 4X6AC 3GTGC 1K83K 5C44C 3HOZK 4QIWD 3H3VL 4A3EC 2JA5C 1I6HC 2B63C 3K7AK 4A3JK 4BY1K 3S16C 4BXXC 4BY7C 4A3LC 2JA8C 2R92C 1IW7A 4A3KK 2E2HC 3I4NC 5IP9K 5M5WK 4A3IC 3H0GC 3S1MK 1YNNA 4LJZA 1K83C 1TWGK 3GTOK 2PA8L 3GTJK 3HKZL 3HOZC 3FKIK 4YFNA 5M3FK 3K7AC 4A3JC 4BY1C 3S14K 4MQ9A 2WB1L 3HOXK 4YFXA 4XSZA 1TWAK 4A3KC 5IP9C 3S1MC 2PMZL 1TWGC 1SFOK 3GTOC 3GTJC 4QJVB 3FKIC 1Y1WK 4MEXA 5TMCA 4GZYA 3I4MK 3S14C 1TWHK 3EQLA 4Y7NK 3HOXC 3HOYK 1TWAC 1XPPA 2NVQK 1BDFA 2WAQD 2JA7K 1SFOC 1ZYRA 4A3BK 2A69A 3PO2K 1Y1WC 5IP7K 1R9TK
chains in the Genus database with same CATH superfamily
2B63A 4OIRA 1WSRA 4KN4A 5IORA 2JA7C 3NUHA 4A3DK 1XZQA 4A3MC 4A3BC 1R9TC 1I6VA 4ILDA 4OIOA 1WSVA 3HOWK 4Y52K 5EGEA 2RGRA 3S2DK 4C2MK 4GTBA 4GTDA 1WCMC 3VA7A 4LR2A 4QJVA 1F7VA 1BJTA 1TWGA 3FOEA 2E2IC 2V6SA 5FJ8K 2P8TA 1TWFK 4XSXA 3MMLB 2NVTK 4LLGA 4BBRK 2XCOA 1XXAA 4KMDA 3AQOA 4BBSC 4G0VA 4DDQA 3SZZA 3GTPC 2A6EA 4KC6A 2A6HA 3N0CA 1YX2A 4OIPA 2O5IA 5FLMK 4A93K 3S17K 2NVYC 2PA8D 3GIRA 3HKZD 2R93A 2PHCB 3M3YK 3CQZK 2GSUA 2NVXK 2NVYA 1VLOA 3GTKK 4BKWA 4A3CK 1G51A 3GTLA 4OINA 2RH6A 4LQYA 4A3FK 3S1RC 5IYBC 2VUMK 1J6WA 3GTGK 5C44K 1O29A 2GAGC 3A8IA 1IBAA 5CJ9A 1I6HK 3T01A 2B63K 4Q4ZA 4JK1A 1WOOA 3I4NK 3S1NC 1RU0A 4X6AC 4A3EC 3S16C 4A3JK 4BY7C 4BY1K 4A3LC 1XXCA 2JA8C 1IW7A 4J3NA 2EBBA 5IP9K 3H0GC 3L4KA 3AD9C 1TWGK 2PA8L 3HKZL 3FKIK 1JOEA 5M3FK 3K7AC 3GTQA 2R7ZA 4YFXA 1PJ6A 1TWAK 2V6UA 3GTOC 5TMCA 3I4MK 3T02A 3S14C 4Y7NK 3AD7C 4PAAA 2KWAA 1Y1VA 4G0UA 3PO2K 1WOPA 5C4XK 1JVIA 2R93K 2JA5A 4LOWA 5IOQA 5IYCK 3HOYC 3GEHA 4C3IK 2NVQC 3LAPA 4G7ZA 2R92A 5M3MK 5IOSA 3RZDK 1O2BA 1WQFA 4GFQA 3GTLK 1EH1A 1VGXA 4Q5SA 5C3EK 4FM9A 2VUMA 4A3GC 1YNJA 1IE0A 1TWCC 3S15K 2CW0A 3BP3A 1I3QC 2XCRB 1DCPA 4KN7A 1IQ0A 4XLNA 3S2HK 1ZVUA 3HOUK 4C3JK 1Y1WA 1O25A 1ZQ1C 1B4BA 3AH5A 4KATA 4C3HK 3HOVK 5M5XK 2Y3PA 1SMYA 3GTMC 4C45A 3M4OK 2JA7A 3GTQK 4KARA 2R7ZK 1XZPB 1I50C 1R9TA 3GTMA 4NOIA 1XZPA 3GEIA 1O26A 4OIQA 2WB1D 3A8KA 1WCMA 1EFWA 1F93A 2E2IA 5TMFA 1Y1VK 1JQWA 2ZFZA 1V5VA 4YG2A 5C4JC 4GTAA 2E2JK 2JA6C 5IYDC 3S1QC 1HQMA 2JA5K 3PO3C 4BLAA 2JA6A 2R92K 4XLPA 1XXBA 2YU9C 5M5YK 3GTPA 3T00A 3OREA 3HOZK 1USMA 4BXXC 3L4JA 4KMHA 2E2HC 4A3IC 1YNNA 4LJZA 1K83C 3IPJA 4KAWX 3TFJA 4GT9A 4MQ9A 2WB1L 4A3KC 3JSTA 1F9NA 3S1MC 1PJ5A 5CHPA 3GTJC 1Y1WK 4MEXA 4GZYA 3EQLA 3HOXC 3S0XA 3TFIA 1O2AA 2JA7K 1VJEA 5E68A 1SFOC 4A3BK 4A3MK 1R9TK 1O27A 1DD5A 4XCHA 1TWHC 1WQGA 4ZH4A 3BP8C 4G7OA 1WCMK 3FHZA 3RZOC 3H0GA 5IP7C 2E2IK 3ADAC 3LAJA 4A3DC 3Q3QA 1WIHA 3BUEA 5JFEA 4BBSK 3GTOA 1YCLA 4G7HA 3HOWC 5TJ3A 4Y52C 2BE5A 1GE9A 3GTPK 3S2DC 4C2MC 4AH6A 3WODA 2GSOA 5EGHA 1IS1A 1J6XA 2NVYK 3H3VD 1TWFC 4GTLA 2NVTC 4BBRC 1C0AA 4GTEA 4WILA 3OPFA 4PABA 4LK1A 3N0BA 3S1RK 5IYBK 3G4AA 4MEYA 1J98A 4YFKA 4LK0A 5FLMC 4A93C 3S17C 3TFHA 1TWCA 4P9SA 3M3YC 3CQZC 3S1NK 4X6AK 1I3QA 2NVXC 4P5AA 4A3EK 3GTKC 3S16K 4A3LK 4A3CC 4BY7K 3CAGA 2JA8K 1DCOA 1EI6A 4A3FC 3GTKA 3N3YA 4KM8A 2VUMC 4KMUA 3H0GK 3GTGC 5C44C 1EK8A 4QIWD 3H3VL 5JVOA 5HL8A 1I6HC 2B63C 3K7AK 5IOTA 1ISEA 3FOFA 3GTGA 1I50A 3I4NC 5M5WK 1O24A 3GDZA 3GTOK 1XZQB 2XCQA 1O28A 2JH3A 4A3JC 4BY1C 4KM9A 3S14K 4XSZA 1X31C 5IP9C 3G4CA 3AD8C 4KMAA 1TWGC 1AB4A 1VH2A 2ZUEA 4QJVB 3FKIC 1WOSA 3HOYK 2GAHC 1TWAC 3QX3A 4BLBA 3FKIA 2NVQK 1BDFA 2WAQD 2YU9A 3GSIA 2Y0SD 1TWAA 3I4MC 3OEPA 1WQHA 3SZYA 4Y7NC 4QIWL 1BGWA 2E2HA 4GTCA 3PO2C 4A3GK 3GEEA 1K83A 1TWCK 4WJ3M 5C4XC 2R93C 1BS2A 5D4DA 5IYCC 4P5BA 4C3IC 1I3QK 1J6VA 4FZBA 4M1XA 3RZDC 1O2FB 2A68A 3GTLC 3HXAA 3GTJA 2V6TA 4O2DA 3TTGA 5C3EC 4AYBD 3GTMK 1SFOA 3S15C 1I50K 2WAQL 1PJ7A 1KQ4A 2FQOA 1TWHA 2Y0SL 3S2HC 3HOUC 2O5JA 3V4GA 4C3JC 3HOVC 4C3HC 1F7UA 5C4JK 4G0WA 2JA6K 5L46A 3M4OC 2D6FC 3S1QK 5IYDK 1ZBSA 3GTQC 3PO3K 2R7ZC 2PMZD 2ZUFA 3ERED 2YU9K 2FQTA 2PPBA 3DXJA 1ZXOA 4GTFA 4KB2A 2CFAB 3LPXA 4BXXK 4AYBL 1Y1VC 1EQRA 2CFAA 1TWFA 2E2JC 2E2HK 4A3IK 3AQPA 1INNA 1K83K 2W7VA 1VRQC 2JA5C 1L0WA 1B4AA 4KDDA 2R92C 1UV7A 4A3KK 2P5MA 3S1MK 4KB4A 1USOA 3HOZC 3GTJK 4KASA 4YFNA 1IL2A 4WJ4A 1DCHA 4RMFA 3HOXK 1WORA 2PMZL 1SFOK 1HI9A 3CQZA 3A8JA 2NVXA 1TWHK 1XPPA 2GSNA 1ZYRA 2A69A 3RZOK 1Y1WC 5IP7K
chains in the Genus database with same CATH topology
2Y0SD 5C4XK 3I4MC 2R93K 1TWHC 4Y7NC 5IYCK 4OIRA 4QIWL 4KN4A 4C3IK 3HOYC 2NVQC 4ZH4A 4G7ZA 5M3MK 3RZDK 2JA7C 4G7OA 1WCMK 4A3DK 4A3BC 4A3MC 3PO2C 3RZOC 5IP7C 4A3GK 1R9TC 3GTLK 1TWCK 5C4XC 2E2IK 1I6VA 4OIOA 3HOWK 2R93C 4Y52K 5D4DA 5IYCC 3S2DK 4Q5SA 4C2MK 1I3QK 3RZDC 5C3EK 1WCMC 4A3DC 4QJVA 4BBSK 4A3GC 1YNJA 2A68A 3GTLC 1TWCC 2E2IC 4G7HA 3HOWC 3S15K 4Y52C 5FJ8K 2BE5A 1TWFK 2CW0A 4XSXA 3GTPK 3S2DC 2NVTK 4LLGA 4BBRK 1I3QC 4KN7A 5C3EC 4AYBD 4XLNA 3GTMK 3S2HK 3HOUK 3WODA 4BBSC 4C3JK 3S15C 1I50K 2NVYK 2WAQL 3H3VD 1TWFC 3RZOK 3GTPC 2A6EA 3HOVK 4C3HK 2NVTC 4BBRC 5M5XK 2Y0SL 1SMYA 3GTMC 3S2HC 4A3MK 3M4OK 3HOUC 2A6HA 4OIPA 2O5JA 2O5IA 3GTQK 5FLMK 2R7ZK 4A93K 3S17K 1I50C 2NVYC 2PA8D 3HKZD 4NOIA 3HOVC 4LK1A 3M3YK 3S1RK 5IYBK 5C4JK 3CQZK 4OIQA 2JA6K 2WB1D 2NVXK 3M4OC 4MEYA 3S1QK 5IYDK 3GTKK 4YFKA 4LK0A 5FLMC 2R7ZC 3GTQC 3PO3K 4A3CK 4A93C 2PMZD 3S17C 4OINA 5TMFA 1Y1VK 4A3FK 3S1RC 3M3YC 2YU9K 2E2JK 4YG2A 5IYBC 5C4JC 3CQZC 2VUMK 2JA6C 2PPBA 3S1NK 4X6AK 3GTGK 2NVXC 5C44K 3DXJA 5IYDC 3S1QC 1HQMA 4A3EK 3GTKC 2JA5K 3PO3C 1I6HK 2B63K 3S16K 4A3LK 4BXXK 4A3CC 4BY7K 4AYBL 2JA8K 2R92K 4Q4ZA 4JK1A 4XLPA 4A3FC 1Y1VC 2E2HK 5M5YK 2E2JC 2YU9C 3I4NK 2VUMC 4A3IK 4KMUA 3H0GK 3S1NC 4X6AC 3GTGC 1K83K 5C44C 3HOZK 4QIWD 3H3VL 4A3EC 2JA5C 1I6HC 2B63C 3K7AK 4A3JK 4BY1K 3S16C 4BXXC 4BY7C 4A3LC 2JA8C 2R92C 1IW7A 4A3KK 2E2HC 3I4NC 5IP9K 5M5WK 4A3IC 3H0GC 3S1MK 1YNNA 4LJZA 1K83C 1TWGK 3GTOK 2PA8L 3GTJK 3HKZL 3HOZC 3FKIK 4YFNA 5M3FK 3K7AC 4A3JC 4BY1C 3S14K 4MQ9A 2WB1L 3HOXK 4YFXA 4XSZA 1TWAK 4A3KC 5IP9C 3S1MC 2PMZL 1TWGC 1SFOK 3GTOC 3GTJC 4QJVB 3FKIC 1Y1WK 4MEXA 5TMCA 4GZYA 3I4MK 3S14C 1TWHK 3EQLA 4Y7NK 3HOXC 3HOYK 1TWAC 1XPPA 2NVQK 1BDFA 2WAQD 2JA7K 1SFOC 1ZYRA 4A3BK 2A69A 3PO2K 1Y1WC 5IP7K 1R9TK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S D;  5C4X K;  3I4M C;  2R93 K;  1TWH C;  4Y7N C;  5IYC K;  4OIR A;  4QIW L;  4KN4 A;  4C3I K;  3HOY C;  2NVQ C;  4ZH4 A;  4G7Z A;  5M3M K;  3RZD K;  2JA7 C;  4G7O A;  1WCM K;  4A3D K;  4A3B C;  4A3M C;  3PO2 C;  3RZO C;  5IP7 C;  4A3G K;  1R9T C;  3GTL K;  1TWC K;  5C4X C;  2E2I K;  1I6V A;  4OIO A;  3HOW K;  2R93 C;  4Y52 K;  5D4D A;  5IYC C;  3S2D K;  4Q5S A;  4C2M K;  1I3Q K;  3RZD C;  5C3E K;  1WCM C;  4A3D C;  4QJV A;  4BBS K;  4A3G C;  1YNJ A;  2A68 A;  3GTL C;  1TWC C;  2E2I C;  4G7H A;  3HOW C;  3S15 K;  4Y52 C;  5FJ8 K;  2BE5 A;  1TWF K;  2CW0 A;  4XSX A;  3GTP K;  3S2D C;  2NVT K;  4LLG A;  4BBR K;  1I3Q C;  4KN7 A;  5C3E C;  4AYB D;  4XLN A;  3GTM K;  3S2H K;  3HOU K;  3WOD A;  4BBS C;  4C3J K;  3S15 C;  1I50 K;  2NVY K;  2WAQ L;  3H3V D;  1TWF C;  3RZO K;  3GTP C;  2A6E A;  3HOV K;  4C3H K;  2NVT C;  4BBR C;  5M5X K;  2Y0S L;  1SMY A;  3GTM C;  3S2H C;  4A3M K;  3M4O K;  3HOU C;  2A6H A;  4OIP A;  2O5J A;  2O5I A;  3GTQ K;  5FLM K;  2R7Z K;  4A93 K;  3S17 K;  1I50 C;  2NVY C;  2PA8 D;  3HKZ D;  4NOI A;  3HOV C;  4LK1 A;  3M3Y K;  3S1R K;  5IYB K;  5C4J K;  3CQZ K;  4OIQ A;  2JA6 K;  2WB1 D;  2NVX K;  3M4O C;  4MEY A;  3S1Q K;  5IYD K;  3GTK K;  4YFK A;  4LK0 A;  5FLM C;  2R7Z C;  3GTQ C;  3PO3 K;  4A3C K;  4A93 C;  2PMZ D;  3S17 C;  4OIN A;  5TMF A;  1Y1V K;  4A3F K;  3S1R C;  3M3Y C;  2YU9 K;  2E2J K;  4YG2 A;  5IYB C;  5C4J C;  3CQZ C;  2VUM K;  2JA6 C;  2PPB A;  3S1N K;  4X6A K;  3GTG K;  2NVX C;  5C44 K;  3DXJ A;  5IYD C;  3S1Q C;  1HQM A;  4A3E K;  3GTK C;  2JA5 K;  3PO3 C;  1I6H K;  2B63 K;  3S16 K;  4A3L K;  4BXX K;  4A3C C;  4BY7 K;  4AYB L;  2JA8 K;  2R92 K;  4Q4Z A;  4JK1 A;  4XLP A;  4A3F C;  1Y1V C;  2E2H K;  5M5Y K;  2E2J C;  2YU9 C;  3I4N K;  2VUM C;  4A3I K;  4KMU A;  3H0G K;  3S1N C;  4X6A C;  3GTG C;  1K83 K;  5C44 C;  3HOZ K;  4QIW D;  3H3V L;  4A3E C;  2JA5 C;  1I6H C;  2B63 C;  3K7A K;  4A3J K;  4BY1 K;  3S16 C;  4BXX C;  4BY7 C;  4A3L C;  2JA8 C;  2R92 C;  1IW7 A;  4A3K K;  2E2H C;  3I4N C;  5IP9 K;  5M5W K;  4A3I C;  3H0G C;  3S1M K;  1YNN A;  4LJZ A;  1K83 C;  1TWG K;  3GTO K;  2PA8 L;  3GTJ K;  3HKZ L;  3HOZ C;  3FKI K;  4YFN A;  5M3F K;  3K7A C;  4A3J C;  4BY1 C;  3S14 K;  4MQ9 A;  2WB1 L;  3HOX K;  4YFX A;  4XSZ A;  1TWA K;  4A3K C;  5IP9 C;  3S1M C;  2PMZ L;  1TWG C;  1SFO K;  3GTO C;  3GTJ C;  4QJV B;  3FKI C;  1Y1W K;  4MEX A;  5TMC A;  4GZY A;  3I4M K;  3S14 C;  1TWH K;  3EQL A;  4Y7N K;  3HOX C;  3HOY K;  1TWA C;  1XPP A;  2NVQ K;  1BDF A;  2WAQ D;  2JA7 K;  1SFO C;  1ZYR A;  4A3B K;  2A69 A;  3PO2 K;  1Y1W C;  5IP7 K;  1R9T K; 
#chains in the Genus database with same CATH topology
 2B63 A;  4OIR A;  1WSR A;  4KN4 A;  5IOR A;  2JA7 C;  3NUH A;  4A3D K;  1XZQ A;  4A3M C;  4A3B C;  1R9T C;  1I6V A;  4ILD A;  4OIO A;  1WSV A;  3HOW K;  4Y52 K;  5EGE A;  2RGR A;  3S2D K;  4C2M K;  4GTB A;  4GTD A;  1WCM C;  3VA7 A;  4LR2 A;  4QJV A;  1F7V A;  1BJT A;  1TWG A;  3FOE A;  2E2I C;  2V6S A;  5FJ8 K;  2P8T A;  1TWF K;  4XSX A;  3MML B;  2NVT K;  4LLG A;  4BBR K;  2XCO A;  1XXA A;  4KMD A;  3AQO A;  4BBS C;  4G0V A;  4DDQ A;  3SZZ A;  3GTP C;  2A6E A;  4KC6 A;  2A6H A;  3N0C A;  1YX2 A;  4OIP A;  2O5I A;  5FLM K;  4A93 K;  3S17 K;  2NVY C;  2PA8 D;  3GIR A;  3HKZ D;  2R93 A;  2PHC B;  3M3Y K;  3CQZ K;  2GSU A;  2NVX K;  2NVY A;  1VLO A;  3GTK K;  4BKW A;  4A3C K;  1G51 A;  3GTL A;  4OIN A;  2RH6 A;  4LQY A;  4A3F K;  3S1R C;  5IYB C;  2VUM K;  1J6W A;  3GTG K;  5C44 K;  1O29 A;  2GAG C;  3A8I A;  1IBA A;  5CJ9 A;  1I6H K;  3T01 A;  2B63 K;  4Q4Z A;  4JK1 A;  1WOO A;  3I4N K;  3S1N C;  1RU0 A;  4X6A C;  4A3E C;  3S16 C;  4A3J K;  4BY7 C;  4BY1 K;  4A3L C;  1XXC A;  2JA8 C;  1IW7 A;  4J3N A;  2EBB A;  5IP9 K;  3H0G C;  3L4K A;  3AD9 C;  1TWG K;  2PA8 L;  3HKZ L;  3FKI K;  1JOE A;  5M3F K;  3K7A C;  3GTQ A;  2R7Z A;  4YFX A;  1PJ6 A;  1TWA K;  2V6U A;  3GTO C;  5TMC A;  3I4M K;  3T02 A;  3S14 C;  4Y7N K;  3AD7 C;  4PAA A;  2KWA A;  1Y1V A;  4G0U A;  3PO2 K;  1WOP A;  5C4X K;  1JVI A;  2R93 K;  2JA5 A;  4LOW A;  5IOQ A;  5IYC K;  3HOY C;  3GEH A;  4C3I K;  2NVQ C;  3LAP A;  4G7Z A;  2R92 A;  5M3M K;  5IOS A;  3RZD K;  1O2B A;  1WQF A;  4GFQ A;  3GTL K;  1EH1 A;  1VGX A;  4Q5S A;  5C3E K;  4FM9 A;  2VUM A;  4A3G C;  1YNJ A;  1IE0 A;  1TWC C;  3S15 K;  2CW0 A;  3BP3 A;  1I3Q C;  2XCR B;  1DCP A;  4KN7 A;  1IQ0 A;  4XLN A;  3S2H K;  1ZVU A;  3HOU K;  4C3J K;  1Y1W A;  1O25 A;  1ZQ1 C;  1B4B A;  3AH5 A;  4KAT A;  4C3H K;  3HOV K;  5M5X K;  2Y3P A;  1SMY A;  3GTM C;  4C45 A;  3M4O K;  2JA7 A;  3GTQ K;  4KAR A;  2R7Z K;  1XZP B;  1I50 C;  1R9T A;  3GTM A;  4NOI A;  1XZP A;  3GEI A;  1O26 A;  4OIQ A;  2WB1 D;  3A8K A;  1WCM A;  1EFW A;  1F93 A;  2E2I A;  5TMF A;  1Y1V K;  1JQW A;  2ZFZ A;  1V5V A;  4YG2 A;  5C4J C;  4GTA A;  2E2J K;  2JA6 C;  5IYD C;  3S1Q C;  1HQM A;  2JA5 K;  3PO3 C;  4BLA A;  2JA6 A;  2R92 K;  4XLP A;  1XXB A;  2YU9 C;  5M5Y K;  3GTP A;  3T00 A;  3ORE A;  3HOZ K;  1USM A;  4BXX C;  3L4J A;  4KMH A;  2E2H C;  4A3I C;  1YNN A;  4LJZ A;  1K83 C;  3IPJ A;  4KAW X;  3TFJ A;  4GT9 A;  4MQ9 A;  2WB1 L;  4A3K C;  3JST A;  1F9N A;  3S1M C;  1PJ5 A;  5CHP A;  3GTJ C;  1Y1W K;  4MEX A;  4GZY A;  3EQL A;  3HOX C;  3S0X A;  3TFI A;  1O2A A;  2JA7 K;  1VJE A;  5E68 A;  1SFO C;  4A3B K;  4A3M K;  1R9T K;  1O27 A;  1DD5 A;  4XCH A;  1TWH C;  1WQG A;  4ZH4 A;  3BP8 C;  4G7O A;  1WCM K;  3FHZ A;  3RZO C;  3H0G A;  5IP7 C;  2E2I K;  3ADA C;  3LAJ A;  4A3D C;  3Q3Q A;  1WIH A;  3BUE A;  5JFE A;  4BBS K;  3GTO A;  1YCL A;  4G7H A;  3HOW C;  5TJ3 A;  4Y52 C;  2BE5 A;  1GE9 A;  3GTP K;  3S2D C;  4C2M C;  4AH6 A;  3WOD A;  2GSO A;  5EGH A;  1IS1 A;  1J6X A;  2NVY K;  3H3V D;  1TWF C;  4GTL A;  2NVT C;  4BBR C;  1C0A A;  4GTE A;  4WIL A;  3OPF A;  4PAB A;  4LK1 A;  3N0B A;  3S1R K;  5IYB K;  3G4A A;  4MEY A;  1J98 A;  4YFK A;  4LK0 A;  5FLM C;  4A93 C;  3S17 C;  3TFH A;  1TWC A;  4P9S A;  3M3Y C;  3CQZ C;  3S1N K;  4X6A K;  1I3Q A;  2NVX C;  4P5A A;  4A3E K;  3GTK C;  3S16 K;  4A3L K;  4A3C C;  4BY7 K;  3CAG A;  2JA8 K;  1DCO A;  1EI6 A;  4A3F C;  3GTK A;  3N3Y A;  4KM8 A;  2VUM C;  4KMU A;  3H0G K;  3GTG C;  5C44 C;  1EK8 A;  4QIW D;  3H3V L;  5JVO A;  5HL8 A;  1I6H C;  2B63 C;  3K7A K;  5IOT A;  1ISE A;  3FOF A;  3GTG A;  1I50 A;  3I4N C;  5M5W K;  1O24 A;  3GDZ A;  3GTO K;  1XZQ B;  2XCQ A;  1O28 A;  2JH3 A;  4A3J C;  4BY1 C;  4KM9 A;  3S14 K;  4XSZ A;  1X31 C;  5IP9 C;  3G4C A;  3AD8 C;  4KMA A;  1TWG C;  1AB4 A;  1VH2 A;  2ZUE A;  4QJV B;  3FKI C;  1WOS A;  3HOY K;  2GAH C;  1TWA C;  3QX3 A;  4BLB A;  3FKI A;  2NVQ K;  1BDF A;  2WAQ D;  2YU9 A;  3GSI A;  2Y0S D;  1TWA A;  3I4M C;  3OEP A;  1WQH A;  3SZY A;  4Y7N C;  4QIW L;  1BGW A;  2E2H A;  4GTC A;  3PO2 C;  4A3G K;  3GEE A;  1K83 A;  1TWC K;  4WJ3 M;  5C4X C;  2R93 C;  1BS2 A;  5D4D A;  5IYC C;  4P5B A;  4C3I C;  1I3Q K;  1J6V A;  4FZB A;  4M1X A;  3RZD C;  1O2F B;  2A68 A;  3GTL C;  3HXA A;  3GTJ A;  2V6T A;  4O2D A;  3TTG A;  5C3E C;  4AYB D;  3GTM K;  1SFO A;  3S15 C;  1I50 K;  2WAQ L;  1PJ7 A;  1KQ4 A;  2FQO A;  1TWH A;  2Y0S L;  3S2H C;  3HOU C;  2O5J A;  3V4G A;  4C3J C;  3HOV C;  4C3H C;  1F7U A;  5C4J K;  4G0W A;  2JA6 K;  5L46 A;  3M4O C;  2D6F C;  3S1Q K;  5IYD K;  1ZBS A;  3GTQ C;  3PO3 K;  2R7Z C;  2PMZ D;  2ZUF A;  3ERE D;  2YU9 K;  2FQT A;  2PPB A;  3DXJ A;  1ZXO A;  4GTF A;  4KB2 A;  2CFA B;  3LPX A;  4BXX K;  4AYB L;  1Y1V C;  1EQR A;  2CFA A;  1TWF A;  2E2J C;  2E2H K;  4A3I K;  3AQP A;  1INN A;  1K83 K;  2W7V A;  1VRQ C;  2JA5 C;  1L0W A;  1B4A A;  4KDD A;  2R92 C;  1UV7 A;  4A3K K;  2P5M A;  3S1M K;  4KB4 A;  1USO A;  3HOZ C;  3GTJ K;  4KAS A;  4YFN A;  1IL2 A;  4WJ4 A;  1DCH A;  4RMF A;  3HOX K;  1WOR A;  2PMZ L;  1SFO K;  1HI9 A;  3CQZ A;  3A8J A;  2NVX A;  1TWH K;  1XPP A;  2GSN A;  1ZYR A;  2A69 A;  3RZO K;  1Y1W C;  5IP7 K; 
#chains in the Genus database with same CATH homology
 2Y0S D;  5C4X K;  3I4M C;  2R93 K;  1TWH C;  4Y7N C;  5IYC K;  4OIR A;  4QIW L;  4KN4 A;  4C3I K;  3HOY C;  2NVQ C;  4ZH4 A;  4G7Z A;  5M3M K;  3RZD K;  2JA7 C;  4G7O A;  1WCM K;  4A3D K;  4A3B C;  4A3M C;  3PO2 C;  3RZO C;  5IP7 C;  4A3G K;  1R9T C;  3GTL K;  1TWC K;  5C4X C;  2E2I K;  1I6V A;  4OIO A;  3HOW K;  2R93 C;  4Y52 K;  5D4D A;  5IYC C;  3S2D K;  4Q5S A;  4C2M K;  1I3Q K;  3RZD C;  5C3E K;  1WCM C;  4A3D C;  4QJV A;  4BBS K;  4A3G C;  1YNJ A;  2A68 A;  3GTL C;  1TWC C;  2E2I C;  4G7H A;  3HOW C;  3S15 K;  4Y52 C;  5FJ8 K;  2BE5 A;  1TWF K;  2CW0 A;  4XSX A;  3GTP K;  3S2D C;  2NVT K;  4LLG A;  4BBR K;  1I3Q C;  4KN7 A;  5C3E C;  4AYB D;  4XLN A;  3GTM K;  3S2H K;  3HOU K;  3WOD A;  4BBS C;  4C3J K;  3S15 C;  1I50 K;  2NVY K;  2WAQ L;  3H3V D;  1TWF C;  3RZO K;  3GTP C;  2A6E A;  3HOV K;  4C3H K;  2NVT C;  4BBR C;  5M5X K;  2Y0S L;  1SMY A;  3GTM C;  3S2H C;  4A3M K;  3M4O K;  3HOU C;  2A6H A;  4OIP A;  2O5J A;  2O5I A;  3GTQ K;  5FLM K;  2R7Z K;  4A93 K;  3S17 K;  1I50 C;  2NVY C;  2PA8 D;  3HKZ D;  4NOI A;  3HOV C;  4LK1 A;  3M3Y K;  3S1R K;  5IYB K;  5C4J K;  3CQZ K;  4OIQ A;  2JA6 K;  2WB1 D;  2NVX K;  3M4O C;  4MEY A;  3S1Q K;  5IYD K;  3GTK K;  4YFK A;  4LK0 A;  5FLM C;  2R7Z C;  3GTQ C;  3PO3 K;  4A3C K;  4A93 C;  2PMZ D;  3S17 C;  4OIN A;  5TMF A;  1Y1V K;  4A3F K;  3S1R C;  3M3Y C;  2YU9 K;  2E2J K;  4YG2 A;  5IYB C;  5C4J C;  3CQZ C;  2VUM K;  2JA6 C;  2PPB A;  3S1N K;  4X6A K;  3GTG K;  2NVX C;  5C44 K;  3DXJ A;  5IYD C;  3S1Q C;  1HQM A;  4A3E K;  3GTK C;  2JA5 K;  3PO3 C;  1I6H K;  2B63 K;  3S16 K;  4A3L K;  4BXX K;  4A3C C;  4BY7 K;  4AYB L;  2JA8 K;  2R92 K;  4Q4Z A;  4JK1 A;  4XLP A;  4A3F C;  1Y1V C;  2E2H K;  5M5Y K;  2E2J C;  2YU9 C;  3I4N K;  2VUM C;  4A3I K;  4KMU A;  3H0G K;  3S1N C;  4X6A C;  3GTG C;  1K83 K;  5C44 C;  3HOZ K;  4QIW D;  3H3V L;  4A3E C;  2JA5 C;  1I6H C;  2B63 C;  3K7A K;  4A3J K;  4BY1 K;  3S16 C;  4BXX C;  4BY7 C;  4A3L C;  2JA8 C;  2R92 C;  1IW7 A;  4A3K K;  2E2H C;  3I4N C;  5IP9 K;  5M5W K;  4A3I C;  3H0G C;  3S1M K;  1YNN A;  4LJZ A;  1K83 C;  1TWG K;  3GTO K;  2PA8 L;  3GTJ K;  3HKZ L;  3HOZ C;  3FKI K;  4YFN A;  5M3F K;  3K7A C;  4A3J C;  4BY1 C;  3S14 K;  4MQ9 A;  2WB1 L;  3HOX K;  4YFX A;  4XSZ A;  1TWA K;  4A3K C;  5IP9 C;  3S1M C;  2PMZ L;  1TWG C;  1SFO K;  3GTO C;  3GTJ C;  4QJV B;  3FKI C;  1Y1W K;  4MEX A;  5TMC A;  4GZY A;  3I4M K;  3S14 C;  1TWH K;  3EQL A;  4Y7N K;  3HOX C;  3HOY K;  1TWA C;  1XPP A;  2NVQ K;  1BDF A;  2WAQ D;  2JA7 K;  1SFO C;  1ZYR A;  4A3B K;  2A69 A;  3PO2 K;  1Y1W C;  5IP7 K;  1R9T K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...