2E2HK

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2hK00
2CW0A 4YG2A 1Y1VC 4BXXK 4G7HA 4A3BK 4LLGA 1K83C 4C2MK 1R9TC 5D4DA 5C4JK 4A3JC 2PA8D 4MEXA 3RZDC 3GTQK 4C3JK 4Y7NC 2O5JA 1XPPA 2E2HC 4Q4ZA 2JA7C 3HOUC 3S16K 3S1NC 4GZYA 1TWHC 1TWAK 1TWGK 4BBRK 4X6AK 4A3IK 5C3EC 5C4XK 2WB1D 4Y52C 4OIPA 4A93C 4YFKA 4YFXA 5M3MK 5C44C 2PPBA 4XSZA 1TWCK 3GTOK 3CQZC 3GTLK 3H3VD 3K7AC 2PMZD 4BY7K 3S2HK 3EQLA 1IW7A 2NVYK 3HKZL 3GTMK 4G7OA 4ZH4A 3GTJK 1I3QK 1SFOC 3GTGC 1I6HK 4A3DC 5IP9K 4BBSC 5IYBC 4C3HK 4BY1K 4A3LK 3H0GC 3RZOC 2R7ZK 3GTKK 3S1MK 1TWFC 3I4MK 1YNNA 3S2DK 3FKIK 3S1QC 2JA8K 2NVTK 3HKZD 3M4OC 2R93K 4LJZA 3HOXC 2YU9C 1R9TK 4A3CC 4A3JK 2JA5K 2Y0SD 5TMFA 3M3YC 4JK1A 3PO2C 1I50C 1I6VA 4MQ9A 4A3GK 1TWGC 4BBRC 2BE5A 5FLMC 3HOWC 4QIWD 2VUMK 4A3KK 5C4XC 2B63K 3DXJA 4A3FC 3S15C 2O5IA 3GTPC 3S14K 4A3EK 3GTLC 4OIQA 4Q5SA 2A69A 3PO3K 2A6EA 5IP7K 4BXXC 4KMUA 5IYCK 5M3FK 4LK0A 3HOZC 2A68A 2JA6C 5IYDC 2E2JC 2R92K 3HOVK 3RZDK 5IYBK 1Y1VK 2NVXK 3WODA 4KN7A 4A3MK 2JA7K 3HOUK 1K83K 1TWHK 5FJ8K 5C4JC 4OIRA 3M4OK 2R93C 4G7ZA 2WAQD 5M5XK 1WCMK 4Y7NK 2E2IK 4A3CK 4QJVA 4KN4A 5C44K 3S16C 4LK1A 1TWAC 2NVQC 4XLPA 5C3EK 3S1RC 4A3GC 4C3IK 2Y0SL 4QJVB 1HQMA 4A3DK 1TWCC 4YFNA 4A3FK 3GTOC 3S15K 5M5YK 3I4NC 3S1QK 4QIWL 4BY7C 3S14C 1Y1WK 3S2HC 4XLNA 3HOYC 3S1NK 3S17K 4BY1C 4A3EC 4A3LC 3H0GK 3GTMC 3RZOK 4A3BC 3S1MC 5IP7C 4MEYA 1I3QC 1SFOK 3S2DC 2JA8C 5TMCA 1I6HC 5IP9C 4BBSK 4OINA 3GTQC 2YU9K 5IYDK 2E2HK 2R92C 3HOVC 3M3YK 1YNJA 3FKIC 4X6AC 2NVTC 2NVXC 4A3IC 3H3VL 1I50K 1ZYRA 2PMZL 4A3MC 4A93K 3HOXK 4Y52K 4OIOA 4AYBL 5FLMK 3HOWK 1SMYA 1BDFA 2A6HA 4A3KC 2JA5C 3PO2K 3CQZK 1WCMC 3K7AK 2E2IC 4NOIA 2WAQL 2NVYC 3I4MC 2NVQK 4XSXA 2VUMC 2PA8L 5M5WK 3GTJC 3S1RK 2B63C 3GTGK 3PO3C 5IYCC 3GTPK 3HOZK 3I4NK 2WB1L 2JA6K 2E2JK 2R7ZC 1Y1WC 3GTKC 3HOYK 1TWFK 3S17C 4AYBD
chains in the Genus database with same CATH superfamily
4YG2A 1O2AA 4WILA 4KC6A 1R9TC 5C4JK 4A3JC 4MEXA 4Y7NC 2O5JA 1XPPA 4GTDA 1TWHC 4X6AK 5C3EC 4OIPA 4GTBA 4YFXA 1ZBSA 2Y3PA 3G4CA 1F9NA 1IW7A 1HI9A 3GTMK 1USOA 1EFWA 4KMAA 5JFEA 4ZH4A 3GTGC 2W7VA 1I6HK 4GT9A 1TWAA 4C3HK 4PAAA 4KASA 3GTGA 3RZOC 2R7ZK 3I4MK 2JA8K 1O27A 1EK8A 4PABA 4LJZA 1O2FB 3ADAC 5TMFA 3JSTA 1I50C 5FLMC 4QIWD 1B4BA 1BGWA 1VLOA 2B63K 3S15C 5EGHA 2O5IA 3GTPC 1DCHA 4GTCA 1WSVA 4A3EK 3V4GA 1R9TA 2CFAB 2A6EA 3PO3K 3TFHA 3GDZA 3GTKA 1I50A 1Y1VK 3WODA 2JA7K 4LR2A 1XXCA 4OIRA 2WAQD 5M5XK 1WCMK 2E2IK 1WCMA 2E2IA 1G51A 4WJ3M 1EI6A 1TWAC 1XZQA 3S1RC 4A3GC 1HQMA 4M1XA 3GTOC 3S15K 1VRQC 4BY7C 3S2HC 4BY1C 4A3EC 4GTAA 4A3BC 3AD9C 4MEYA 1SFOK 2JA8C 5IP9C 2GAGC 3MMLB 4WJ4A 5IYDK 3HOVC 1I50K 4G0UA 4AYBL 5FLMK 1Y1VA 3PO2K 1WCMC 3K7AK 2E2IC 1WOSA 1WOOA 2NVYC 3SZZA 4G0VA 3PO3C 1AB4A 2VUMA 2E2JK 1Y1WC 4LQYA 3GTKC 3LPXA 2ZUFA 2JA5A 4A3BK 2JH3A 1K83C 3AQOA 4C2MK 2NVXA 5JVOA 3FKIA 3GTQK 4C3JK 1F7VA 1TWAK 4Y52C 4A93C 4YFKA 5C44C 4XSZA 1TWCK 2GSNA 3H3VD 3GTLK 3FOEA 3K7AC 2PMZD 2ZFZA 5IOTA 2NVYK 3HKZL 3FOFA 4A3DC 5IP9K 3TFIA 4BBSC 4A3LK 3H0GC 2XCOA 2NVTK 3HKZD 1WQHA 4GTEA 3AH5A 2YU9C 3CQZA 2JA5K 1WIHA 2EBBA 4JK1A 3TTGA 4MQ9A 1TWGC 4C3IC 3HOWC 1TWHA 1L0WA 1JOEA 3DXJA 4A3FC 1PJ7A 4BLBA 2RGRA 3GTLA 3L4JA 2A69A 4KMUA 5M3FK 1IBAA 4LK0A 2R7ZA 2A68A 2JA6C 2R92K 3RZDK 4C3JC 4O2DA 4KB2A 3IPJA 4KB4A 4J3NA 2P5MA 1TWFA 4Y7NK 4QJVA 3NUHA 2FQOA 1XZQB 1ZQ1C 5C3EK 1SFOA 1O26A 1XZPB 5M5YK 4A3DK 3S14C 3GTQA 1BS2A 3S1NK 3HXAA 3N3YA 4A3LC 3H0GK 1I3QC 3GTMA 1I6HC 4BLAA 5E68A 1YCLA 4DDQA 2JA7A 2E2HA 4KMHA 2E2HK 1TWCA 2R92C 3CAGA 3M3YK 4A3IC 3GIRA 3HOXK 1BDFA 1IE0A 1USMA 4NOIA 1O28A 4KMDA 4XSXA 1IL2A 2PA8L 5M5WK 2B63C 1JVIA 3GTJA 1DD5A 3GTPK 3HOZK 3I4NK 3Q3QA 3I4MC 2CW0A 3S0XA 4BXXK 5D4DA 3T00A 2ZUEA 1BJTA 4ILDA 1DCPA 2E2HC 2JA7C 3S16K 4GZYA 1WORA 4BBRK 1B4AA 2XCQA 4A3IK 5C4XK 5IOQA 3BP8C 4G0WA 1IS1A 1J6XA 3T01A 1I3QK 1WSRA 5IYBC 4BY1K 3A8IA 1TWFC 1YNNA 3FKIK 3M4OC 2R93K 2R93A 3TFJA 3HOXC 1R9TK 4A3CC 4A3JK 4XCHA 1VH2A 2Y0SD 3SZYA 1I6VA 4A3GK 4BBRC 5IORA 5C4XC 3N0BA 5CJ9A 3BP3A 2PHCB 5IOSA 3FHZA 4Q5SA 2KWAA 4BXXC 1XZPA 5IYCK 1IQ0A 5IYDC 2E2JC 3HOVK 1RU0A 5IYBK 4KAWX 2NVXK 4A3MK 3QX3A 2YU9A 1K83K 1TWHK 4C2MC 1O24A 2FQTA 3M4OK 2R93C 3N0CA 2V6UA 2V6SA 4A3CK 4GTLA 5CHPA 4XLPA 1GE9A 1WOPA 4QJVB 2V6TA 3AD8C 1O2BA 1TWCC 4YFNA 1YX2A 1Y1WK 3HOYC 3S17K 3RZOK 5TMCA 4BBSK 3GTQC 3G4AA 1DCOA 2NVTC 2NVXC 4P5BA 4A3MC 4A93K 4Y52K 4OIOA 2A6HA 2JA5C 3CQZK 4RMFA 4P9SA 3OPFA 4BKWA 2VUMC 3S1RK 3GTJC 2XCRB 5IYCC 1UV7A 3ERED 3A8KA 3HOYK 1EH1A 3S17C 3S1QK 1Y1VC 1VJEA 4G7HA 4KM8A 1PJ6A 4LLGA 3GEIA 1VGXA 2PA8D 3RZDC 1X31C 2R92A 4Q4ZA 3HOUC 3AD7C 2GAHC 1TWGK 2GSUA 1TWGA 2WB1D 1I3QA 1ISEA 3VA7A 3LAPA 2D6FC 5M3MK 3AQPA 2PPBA 3GTOK 3CQZC 4GFQA 4BY7K 1EQRA 1XXBA 4C45A 3S2HK 3EQLA 1V5VA 5EGEA 4G7OA 3GTJK 1SFOC 3H0GA 2CFAA 3GSIA 4KATA 3BUEA 4P5AA 3GTKK 3S1MK 3S1QC 3S2DK 1F93A 3L4KA 4KDDA 3PO2C 3M3YC 4FZBA 1JQWA 3A8JA 5L46A 2BE5A 3GEHA 4A3KK 2VUMK 3S14K 1ZXOA 3GTLC 4OIQA 3GTPA 5IP7K 3HOZC 3T02A 1PJ5A 2B63A 4KN7A 3HOUK 2P8TA 5FJ8K 5C4JC 1ZVUA 1INNA 4G7ZA 3OEPA 2GSOA 1O25A 4KN4A 5C44K 3S16C 4LK1A 4FM9A 2NVQC 3GEEA 4AH6A 1F7UA 4C3IK 2Y0SL 1O29A 5TJ3A 4A3FK 3I4NC 1WQFA 4QIWL 4XLNA 3GTMC 1WQGA 1J6WA 3S1MC 5IP7C 3S2DC 3OREA 4OINA 4KARA 2YU9K 3GTOA 2RH6A 1YNJA 3FKIC 4X6AC 1J98A 3H3VL 1ZYRA 2PMZL 1K83A 1XXAA 3HOWK 1SMYA 4A3KC 1J6VA 1Y1WA 4KM9A 2WAQL 4GTFA 2NVQK 4LOWA 3GTGK 5HL8A 3LAJA 1KQ4A 2NVYA 4C3HC 1C0AA 2WB1L 2JA6A 2JA6K 2R7ZC 3S1NC 1TWFK 4AYBD
chains in the Genus database with same CATH topology
2CW0A 4YG2A 1Y1VC 4BXXK 4G7HA 4A3BK 4LLGA 1K83C 4C2MK 1R9TC 5D4DA 5C4JK 4A3JC 2PA8D 4MEXA 3RZDC 3GTQK 4C3JK 4Y7NC 2O5JA 1XPPA 2E2HC 4Q4ZA 2JA7C 3HOUC 3S16K 3S1NC 4GZYA 1TWHC 1TWAK 1TWGK 4BBRK 4X6AK 4A3IK 5C3EC 5C4XK 2WB1D 4Y52C 4OIPA 4A93C 4YFKA 4YFXA 5M3MK 5C44C 2PPBA 4XSZA 1TWCK 3GTOK 3CQZC 3GTLK 3H3VD 3K7AC 2PMZD 4BY7K 3S2HK 3EQLA 1IW7A 2NVYK 3HKZL 3GTMK 4G7OA 4ZH4A 3GTJK 1I3QK 1SFOC 3GTGC 1I6HK 4A3DC 5IP9K 4BBSC 5IYBC 4C3HK 4BY1K 4A3LK 3H0GC 3RZOC 2R7ZK 3GTKK 3S1MK 1TWFC 3I4MK 1YNNA 3S2DK 3FKIK 3S1QC 2JA8K 2NVTK 3HKZD 3M4OC 2R93K 4LJZA 3HOXC 2YU9C 1R9TK 4A3CC 4A3JK 2JA5K 2Y0SD 5TMFA 3M3YC 4JK1A 3PO2C 1I50C 1I6VA 4MQ9A 4A3GK 1TWGC 4BBRC 2BE5A 5FLMC 3HOWC 4QIWD 2VUMK 4A3KK 5C4XC 2B63K 3DXJA 4A3FC 3S15C 2O5IA 3GTPC 3S14K 4A3EK 3GTLC 4OIQA 4Q5SA 2A69A 3PO3K 2A6EA 5IP7K 4BXXC 4KMUA 5IYCK 5M3FK 4LK0A 3HOZC 2A68A 2JA6C 5IYDC 2E2JC 2R92K 3HOVK 3RZDK 5IYBK 1Y1VK 2NVXK 3WODA 4KN7A 4A3MK 2JA7K 3HOUK 1K83K 1TWHK 5FJ8K 5C4JC 4OIRA 3M4OK 2R93C 4G7ZA 2WAQD 5M5XK 1WCMK 4Y7NK 2E2IK 4A3CK 4QJVA 4KN4A 5C44K 3S16C 4LK1A 1TWAC 2NVQC 4XLPA 5C3EK 3S1RC 4A3GC 4C3IK 2Y0SL 4QJVB 1HQMA 4A3DK 1TWCC 4YFNA 4A3FK 3GTOC 3S15K 5M5YK 3I4NC 3S1QK 4QIWL 4BY7C 3S14C 1Y1WK 3S2HC 4XLNA 3HOYC 3S1NK 3S17K 4BY1C 4A3EC 4A3LC 3H0GK 3GTMC 3RZOK 4A3BC 3S1MC 5IP7C 4MEYA 1I3QC 1SFOK 3S2DC 2JA8C 5TMCA 1I6HC 5IP9C 4BBSK 4OINA 3GTQC 2YU9K 5IYDK 2E2HK 2R92C 3HOVC 3M3YK 1YNJA 3FKIC 4X6AC 2NVTC 2NVXC 4A3IC 3H3VL 1I50K 1ZYRA 2PMZL 4A3MC 4A93K 3HOXK 4Y52K 4OIOA 4AYBL 5FLMK 3HOWK 1SMYA 1BDFA 2A6HA 4A3KC 2JA5C 3PO2K 3CQZK 1WCMC 3K7AK 2E2IC 4NOIA 2WAQL 2NVYC 3I4MC 2NVQK 4XSXA 2VUMC 2PA8L 5M5WK 3GTJC 3S1RK 2B63C 3GTGK 3PO3C 5IYCC 3GTPK 3HOZK 3I4NK 2WB1L 2JA6K 2E2JK 2R7ZC 1Y1WC 3GTKC 3HOYK 1TWFK 3S17C 4AYBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW0 A;  4YG2 A;  1Y1V C;  4BXX K;  4G7H A;  4A3B K;  4LLG A;  1K83 C;  4C2M K;  1R9T C;  5D4D A;  5C4J K;  4A3J C;  2PA8 D;  4MEX A;  3RZD C;  3GTQ K;  4C3J K;  4Y7N C;  2O5J A;  1XPP A;  2E2H C;  4Q4Z A;  2JA7 C;  3HOU C;  3S16 K;  3S1N C;  4GZY A;  1TWH C;  1TWA K;  1TWG K;  4BBR K;  4X6A K;  4A3I K;  5C3E C;  5C4X K;  2WB1 D;  4Y52 C;  4OIP A;  4A93 C;  4YFK A;  4YFX A;  5M3M K;  5C44 C;  2PPB A;  4XSZ A;  1TWC K;  3GTO K;  3CQZ C;  3GTL K;  3H3V D;  3K7A C;  2PMZ D;  4BY7 K;  3S2H K;  3EQL A;  1IW7 A;  2NVY K;  3HKZ L;  3GTM K;  4G7O A;  4ZH4 A;  3GTJ K;  1I3Q K;  1SFO C;  3GTG C;  1I6H K;  4A3D C;  5IP9 K;  4BBS C;  5IYB C;  4C3H K;  4BY1 K;  4A3L K;  3H0G C;  3RZO C;  2R7Z K;  3GTK K;  3S1M K;  1TWF C;  3I4M K;  1YNN A;  3S2D K;  3FKI K;  3S1Q C;  2JA8 K;  2NVT K;  3HKZ D;  3M4O C;  2R93 K;  4LJZ A;  3HOX C;  2YU9 C;  1R9T K;  4A3C C;  4A3J K;  2JA5 K;  2Y0S D;  5TMF A;  3M3Y C;  4JK1 A;  3PO2 C;  1I50 C;  1I6V A;  4MQ9 A;  4A3G K;  1TWG C;  4BBR C;  2BE5 A;  5FLM C;  3HOW C;  4QIW D;  2VUM K;  4A3K K;  5C4X C;  2B63 K;  3DXJ A;  4A3F C;  3S15 C;  2O5I A;  3GTP C;  3S14 K;  4A3E K;  3GTL C;  4OIQ A;  4Q5S A;  2A69 A;  3PO3 K;  2A6E A;  5IP7 K;  4BXX C;  4KMU A;  5IYC K;  5M3F K;  4LK0 A;  3HOZ C;  2A68 A;  2JA6 C;  5IYD C;  2E2J C;  2R92 K;  3HOV K;  3RZD K;  5IYB K;  1Y1V K;  2NVX K;  3WOD A;  4KN7 A;  4A3M K;  2JA7 K;  3HOU K;  1K83 K;  1TWH K;  5FJ8 K;  5C4J C;  4OIR A;  3M4O K;  2R93 C;  4G7Z A;  2WAQ D;  5M5X K;  1WCM K;  4Y7N K;  2E2I K;  4A3C K;  4QJV A;  4KN4 A;  5C44 K;  3S16 C;  4LK1 A;  1TWA C;  2NVQ C;  4XLP A;  5C3E K;  3S1R C;  4A3G C;  4C3I K;  2Y0S L;  4QJV B;  1HQM A;  4A3D K;  1TWC C;  4YFN A;  4A3F K;  3GTO C;  3S15 K;  5M5Y K;  3I4N C;  3S1Q K;  4QIW L;  4BY7 C;  3S14 C;  1Y1W K;  3S2H C;  4XLN A;  3HOY C;  3S1N K;  3S17 K;  4BY1 C;  4A3E C;  4A3L C;  3H0G K;  3GTM C;  3RZO K;  4A3B C;  3S1M C;  5IP7 C;  4MEY A;  1I3Q C;  1SFO K;  3S2D C;  2JA8 C;  5TMC A;  1I6H C;  5IP9 C;  4BBS K;  4OIN A;  3GTQ C;  2YU9 K;  5IYD K;  2E2H K;  2R92 C;  3HOV C;  3M3Y K;  1YNJ A;  3FKI C;  4X6A C;  2NVT C;  2NVX C;  4A3I C;  3H3V L;  1I50 K;  1ZYR A;  2PMZ L;  4A3M C;  4A93 K;  3HOX K;  4Y52 K;  4OIO A;  4AYB L;  5FLM K;  3HOW K;  1SMY A;  1BDF A;  2A6H A;  4A3K C;  2JA5 C;  3PO2 K;  3CQZ K;  1WCM C;  3K7A K;  2E2I C;  4NOI A;  2WAQ L;  2NVY C;  3I4M C;  2NVQ K;  4XSX A;  2VUM C;  2PA8 L;  5M5W K;  3GTJ C;  3S1R K;  2B63 C;  3GTG K;  3PO3 C;  5IYC C;  3GTP K;  3HOZ K;  3I4N K;  2WB1 L;  2JA6 K;  2E2J K;  2R7Z C;  1Y1W C;  3GTK C;  3HOY K;  1TWF K;  3S17 C;  4AYB D; 
#chains in the Genus database with same CATH topology
 4YG2 A;  1O2A A;  4WIL A;  4KC6 A;  1R9T C;  5C4J K;  4A3J C;  4MEX A;  4Y7N C;  2O5J A;  1XPP A;  4GTD A;  1TWH C;  4X6A K;  5C3E C;  4OIP A;  4GTB A;  4YFX A;  1ZBS A;  2Y3P A;  3G4C A;  1F9N A;  1IW7 A;  1HI9 A;  3GTM K;  1USO A;  1EFW A;  4KMA A;  5JFE A;  4ZH4 A;  3GTG C;  2W7V A;  1I6H K;  4GT9 A;  1TWA A;  4C3H K;  4PAA A;  4KAS A;  3GTG A;  3RZO C;  2R7Z K;  3I4M K;  2JA8 K;  1O27 A;  1EK8 A;  4PAB A;  4LJZ A;  1O2F B;  3ADA C;  5TMF A;  3JST A;  1I50 C;  5FLM C;  4QIW D;  1B4B A;  1BGW A;  1VLO A;  2B63 K;  3S15 C;  5EGH A;  2O5I A;  3GTP C;  1DCH A;  4GTC A;  1WSV A;  4A3E K;  3V4G A;  1R9T A;  2CFA B;  2A6E A;  3PO3 K;  3TFH A;  3GDZ A;  3GTK A;  1I50 A;  1Y1V K;  3WOD A;  2JA7 K;  4LR2 A;  1XXC A;  4OIR A;  2WAQ D;  5M5X K;  1WCM K;  2E2I K;  1WCM A;  2E2I A;  1G51 A;  4WJ3 M;  1EI6 A;  1TWA C;  1XZQ A;  3S1R C;  4A3G C;  1HQM A;  4M1X A;  3GTO C;  3S15 K;  1VRQ C;  4BY7 C;  3S2H C;  4BY1 C;  4A3E C;  4GTA A;  4A3B C;  3AD9 C;  4MEY A;  1SFO K;  2JA8 C;  5IP9 C;  2GAG C;  3MML B;  4WJ4 A;  5IYD K;  3HOV C;  1I50 K;  4G0U A;  4AYB L;  5FLM K;  1Y1V A;  3PO2 K;  1WCM C;  3K7A K;  2E2I C;  1WOS A;  1WOO A;  2NVY C;  3SZZ A;  4G0V A;  3PO3 C;  1AB4 A;  2VUM A;  2E2J K;  1Y1W C;  4LQY A;  3GTK C;  3LPX A;  2ZUF A;  2JA5 A;  4A3B K;  2JH3 A;  1K83 C;  3AQO A;  4C2M K;  2NVX A;  5JVO A;  3FKI A;  3GTQ K;  4C3J K;  1F7V A;  1TWA K;  4Y52 C;  4A93 C;  4YFK A;  5C44 C;  4XSZ A;  1TWC K;  2GSN A;  3H3V D;  3GTL K;  3FOE A;  3K7A C;  2PMZ D;  2ZFZ A;  5IOT A;  2NVY K;  3HKZ L;  3FOF A;  4A3D C;  5IP9 K;  3TFI A;  4BBS C;  4A3L K;  3H0G C;  2XCO A;  2NVT K;  3HKZ D;  1WQH A;  4GTE A;  3AH5 A;  2YU9 C;  3CQZ A;  2JA5 K;  1WIH A;  2EBB A;  4JK1 A;  3TTG A;  4MQ9 A;  1TWG C;  4C3I C;  3HOW C;  1TWH A;  1L0W A;  1JOE A;  3DXJ A;  4A3F C;  1PJ7 A;  4BLB A;  2RGR A;  3GTL A;  3L4J A;  2A69 A;  4KMU A;  5M3F K;  1IBA A;  4LK0 A;  2R7Z A;  2A68 A;  2JA6 C;  2R92 K;  3RZD K;  4C3J C;  4O2D A;  4KB2 A;  3IPJ A;  4KB4 A;  4J3N A;  2P5M A;  1TWF A;  4Y7N K;  4QJV A;  3NUH A;  2FQO A;  1XZQ B;  1ZQ1 C;  5C3E K;  1SFO A;  1O26 A;  1XZP B;  5M5Y K;  4A3D K;  3S14 C;  3GTQ A;  1BS2 A;  3S1N K;  3HXA A;  3N3Y A;  4A3L C;  3H0G K;  1I3Q C;  3GTM A;  1I6H C;  4BLA A;  5E68 A;  1YCL A;  4DDQ A;  2JA7 A;  2E2H A;  4KMH A;  2E2H K;  1TWC A;  2R92 C;  3CAG A;  3M3Y K;  4A3I C;  3GIR A;  3HOX K;  1BDF A;  1IE0 A;  1USM A;  4NOI A;  1O28 A;  4KMD A;  4XSX A;  1IL2 A;  2PA8 L;  5M5W K;  2B63 C;  1JVI A;  3GTJ A;  1DD5 A;  3GTP K;  3HOZ K;  3I4N K;  3Q3Q A;  3I4M C;  2CW0 A;  3S0X A;  4BXX K;  5D4D A;  3T00 A;  2ZUE A;  1BJT A;  4ILD A;  1DCP A;  2E2H C;  2JA7 C;  3S16 K;  4GZY A;  1WOR A;  4BBR K;  1B4A A;  2XCQ A;  4A3I K;  5C4X K;  5IOQ A;  3BP8 C;  4G0W A;  1IS1 A;  1J6X A;  3T01 A;  1I3Q K;  1WSR A;  5IYB C;  4BY1 K;  3A8I A;  1TWF C;  1YNN A;  3FKI K;  3M4O C;  2R93 K;  2R93 A;  3TFJ A;  3HOX C;  1R9T K;  4A3C C;  4A3J K;  4XCH A;  1VH2 A;  2Y0S D;  3SZY A;  1I6V A;  4A3G K;  4BBR C;  5IOR A;  5C4X C;  3N0B A;  5CJ9 A;  3BP3 A;  2PHC B;  5IOS A;  3FHZ A;  4Q5S A;  2KWA A;  4BXX C;  1XZP A;  5IYC K;  1IQ0 A;  5IYD C;  2E2J C;  3HOV K;  1RU0 A;  5IYB K;  4KAW X;  2NVX K;  4A3M K;  3QX3 A;  2YU9 A;  1K83 K;  1TWH K;  4C2M C;  1O24 A;  2FQT A;  3M4O K;  2R93 C;  3N0C A;  2V6U A;  2V6S A;  4A3C K;  4GTL A;  5CHP A;  4XLP A;  1GE9 A;  1WOP A;  4QJV B;  2V6T A;  3AD8 C;  1O2B A;  1TWC C;  4YFN A;  1YX2 A;  1Y1W K;  3HOY C;  3S17 K;  3RZO K;  5TMC A;  4BBS K;  3GTQ C;  3G4A A;  1DCO A;  2NVT C;  2NVX C;  4P5B A;  4A3M C;  4A93 K;  4Y52 K;  4OIO A;  2A6H A;  2JA5 C;  3CQZ K;  4RMF A;  4P9S A;  3OPF A;  4BKW A;  2VUM C;  3S1R K;  3GTJ C;  2XCR B;  5IYC C;  1UV7 A;  3ERE D;  3A8K A;  3HOY K;  1EH1 A;  3S17 C;  3S1Q K;  1Y1V C;  1VJE A;  4G7H A;  4KM8 A;  1PJ6 A;  4LLG A;  3GEI A;  1VGX A;  2PA8 D;  3RZD C;  1X31 C;  2R92 A;  4Q4Z A;  3HOU C;  3AD7 C;  2GAH C;  1TWG K;  2GSU A;  1TWG A;  2WB1 D;  1I3Q A;  1ISE A;  3VA7 A;  3LAP A;  2D6F C;  5M3M K;  3AQP A;  2PPB A;  3GTO K;  3CQZ C;  4GFQ A;  4BY7 K;  1EQR A;  1XXB A;  4C45 A;  3S2H K;  3EQL A;  1V5V A;  5EGE A;  4G7O A;  3GTJ K;  1SFO C;  3H0G A;  2CFA A;  3GSI A;  4KAT A;  3BUE A;  4P5A A;  3GTK K;  3S1M K;  3S1Q C;  3S2D K;  1F93 A;  3L4K A;  4KDD A;  3PO2 C;  3M3Y C;  4FZB A;  1JQW A;  3A8J A;  5L46 A;  2BE5 A;  3GEH A;  4A3K K;  2VUM K;  3S14 K;  1ZXO A;  3GTL C;  4OIQ A;  3GTP A;  5IP7 K;  3HOZ C;  3T02 A;  1PJ5 A;  2B63 A;  4KN7 A;  3HOU K;  2P8T A;  5FJ8 K;  5C4J C;  1ZVU A;  1INN A;  4G7Z A;  3OEP A;  2GSO A;  1O25 A;  4KN4 A;  5C44 K;  3S16 C;  4LK1 A;  4FM9 A;  2NVQ C;  3GEE A;  4AH6 A;  1F7U A;  4C3I K;  2Y0S L;  1O29 A;  5TJ3 A;  4A3F K;  3I4N C;  1WQF A;  4QIW L;  4XLN A;  3GTM C;  1WQG A;  1J6W A;  3S1M C;  5IP7 C;  3S2D C;  3ORE A;  4OIN A;  4KAR A;  2YU9 K;  3GTO A;  2RH6 A;  1YNJ A;  3FKI C;  4X6A C;  1J98 A;  3H3V L;  1ZYR A;  2PMZ L;  1K83 A;  1XXA A;  3HOW K;  1SMY A;  4A3K C;  1J6V A;  1Y1W A;  4KM9 A;  2WAQ L;  4GTF A;  2NVQ K;  4LOW A;  3GTG K;  5HL8 A;  3LAJ A;  1KQ4 A;  2NVY A;  4C3H C;  1C0A A;  2WB1 L;  2JA6 A;  2JA6 K;  2R7Z C;  3S1N C;  1TWF K;  4AYB D; 
#chains in the Genus database with same CATH homology
 2CW0 A;  4YG2 A;  1Y1V C;  4BXX K;  4G7H A;  4A3B K;  4LLG A;  1K83 C;  4C2M K;  1R9T C;  5D4D A;  5C4J K;  4A3J C;  2PA8 D;  4MEX A;  3RZD C;  3GTQ K;  4C3J K;  4Y7N C;  2O5J A;  1XPP A;  2E2H C;  4Q4Z A;  2JA7 C;  3HOU C;  3S16 K;  3S1N C;  4GZY A;  1TWH C;  1TWA K;  1TWG K;  4BBR K;  4X6A K;  4A3I K;  5C3E C;  5C4X K;  2WB1 D;  4Y52 C;  4OIP A;  4A93 C;  4YFK A;  4YFX A;  5M3M K;  5C44 C;  2PPB A;  4XSZ A;  1TWC K;  3GTO K;  3CQZ C;  3GTL K;  3H3V D;  3K7A C;  2PMZ D;  4BY7 K;  3S2H K;  3EQL A;  1IW7 A;  2NVY K;  3HKZ L;  3GTM K;  4G7O A;  4ZH4 A;  3GTJ K;  1I3Q K;  1SFO C;  3GTG C;  1I6H K;  4A3D C;  5IP9 K;  4BBS C;  5IYB C;  4C3H K;  4BY1 K;  4A3L K;  3H0G C;  3RZO C;  2R7Z K;  3GTK K;  3S1M K;  1TWF C;  3I4M K;  1YNN A;  3S2D K;  3FKI K;  3S1Q C;  2JA8 K;  2NVT K;  3HKZ D;  3M4O C;  2R93 K;  4LJZ A;  3HOX C;  2YU9 C;  1R9T K;  4A3C C;  4A3J K;  2JA5 K;  2Y0S D;  5TMF A;  3M3Y C;  4JK1 A;  3PO2 C;  1I50 C;  1I6V A;  4MQ9 A;  4A3G K;  1TWG C;  4BBR C;  2BE5 A;  5FLM C;  3HOW C;  4QIW D;  2VUM K;  4A3K K;  5C4X C;  2B63 K;  3DXJ A;  4A3F C;  3S15 C;  2O5I A;  3GTP C;  3S14 K;  4A3E K;  3GTL C;  4OIQ A;  4Q5S A;  2A69 A;  3PO3 K;  2A6E A;  5IP7 K;  4BXX C;  4KMU A;  5IYC K;  5M3F K;  4LK0 A;  3HOZ C;  2A68 A;  2JA6 C;  5IYD C;  2E2J C;  2R92 K;  3HOV K;  3RZD K;  5IYB K;  1Y1V K;  2NVX K;  3WOD A;  4KN7 A;  4A3M K;  2JA7 K;  3HOU K;  1K83 K;  1TWH K;  5FJ8 K;  5C4J C;  4OIR A;  3M4O K;  2R93 C;  4G7Z A;  2WAQ D;  5M5X K;  1WCM K;  4Y7N K;  2E2I K;  4A3C K;  4QJV A;  4KN4 A;  5C44 K;  3S16 C;  4LK1 A;  1TWA C;  2NVQ C;  4XLP A;  5C3E K;  3S1R C;  4A3G C;  4C3I K;  2Y0S L;  4QJV B;  1HQM A;  4A3D K;  1TWC C;  4YFN A;  4A3F K;  3GTO C;  3S15 K;  5M5Y K;  3I4N C;  3S1Q K;  4QIW L;  4BY7 C;  3S14 C;  1Y1W K;  3S2H C;  4XLN A;  3HOY C;  3S1N K;  3S17 K;  4BY1 C;  4A3E C;  4A3L C;  3H0G K;  3GTM C;  3RZO K;  4A3B C;  3S1M C;  5IP7 C;  4MEY A;  1I3Q C;  1SFO K;  3S2D C;  2JA8 C;  5TMC A;  1I6H C;  5IP9 C;  4BBS K;  4OIN A;  3GTQ C;  2YU9 K;  5IYD K;  2E2H K;  2R92 C;  3HOV C;  3M3Y K;  1YNJ A;  3FKI C;  4X6A C;  2NVT C;  2NVX C;  4A3I C;  3H3V L;  1I50 K;  1ZYR A;  2PMZ L;  4A3M C;  4A93 K;  3HOX K;  4Y52 K;  4OIO A;  4AYB L;  5FLM K;  3HOW K;  1SMY A;  1BDF A;  2A6H A;  4A3K C;  2JA5 C;  3PO2 K;  3CQZ K;  1WCM C;  3K7A K;  2E2I C;  4NOI A;  2WAQ L;  2NVY C;  3I4M C;  2NVQ K;  4XSX A;  2VUM C;  2PA8 L;  5M5W K;  3GTJ C;  3S1R K;  2B63 C;  3GTG K;  3PO3 C;  5IYC C;  3GTP K;  3HOZ K;  3I4N K;  2WB1 L;  2JA6 K;  2E2J K;  2R7Z C;  1Y1W C;  3GTK C;  3HOY K;  1TWF K;  3S17 C;  4AYB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...