2E2HK

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2hK00
4OIPA 1SMYA 1Y1VC 5IP9K 4Y52C 1I3QK 3HOZK 1WCMC 4G7OA 1IW7A 5C3EK 2JA8K 2NVQK 1XPPA 3PO2K 3S16K 3S2DC 1Y1WC 2E2JC 4Q5SA 3GTLK 4Y52K 4G7HA 3K7AC 5C44K 3I4MK 4X6AK 4A3DK 5TMFA 4C3IK 4NOIA 3H0GC 4LK1A 2E2JK 2R92C 3S2DK 4KN4A 3S17K 2O5JA 4A3EC 4Y7NC 2E2HC 3K7AK 3RZDK 3HKZD 3HKZL 2PA8D 3HOXC 3GTOC 4A3BC 2WB1D 4GZYA 4C3HK 3FKIK 5FJ8K 4YFNA 5IYDC 1ZYRA 4A3MK 4BY1C 3H0GK 2R92K 3S15C 5IYCK 3S1QC 4OIRA 3WODA 3HOWC 4A3EK 4Y7NK 3S2HK 2CW0A 3GTOK 4JK1A 1I50C 3CQZC 3H3VL 5IYDK 1BDFA 4BY1K 4A3CC 4MEYA 3GTMK 3S1QK 4XSZA 3HOWK 1TWGC 5C4JC 2JA7C 2A6EA 1Y1VK 1TWCC 2VUMC 2PMZL 2PMZD 4A3GC 4MEXA 4BBRC 3S1NC 5C4XC 1WCMK 2NVXC 1K83C 3GTKC 5M5WK 3GTQC 1TWFC 5IP7C 2R93C 1TWGK 2NVTC 2JA7K 1Y1WK 1TWCK 2VUMK 5TMCA 4A3GK 2YU9C 4BBRK 3S1NK 5C4XK 1I6VA 2NVXK 1K83K 5FLMC 3GTKK 2A68A 4Q4ZA 3M3YC 4A93C 1HQMA 3GTQK 1TWFK 3HOVC 3GTPC 4LLGA 2NVTK 4MQ9A 4AYBD 2BE5A 4AYBL 2E2HK 2JA5C 4ZH4A 4A3FC 5FLMK 3HOXK 4A3BK 5M5XK 3HOVK 3H3VD 3GTMC 3GTPK 3S15K 3S1MC 4A3KC 1TWHC 2JA6C 1SFOC 3DXJA 1R9TC 2JA5K 4OINA 4LJZA 2R7ZC 3HOUC 4A3FK 3GTJC 2A6HA 1YNJA 1I50K 3CQZK 4YFKA 2Y0SL 4A3JC 1TWAC 2O5IA 4KN7A 4OIOA 4C3JK 3M4OC 4QIWL 4QIWD 2E2IC 3S1MK 4A3CK 1TWHK 5IP9C 2B63C 2JA6K 1SFOK 4BXXC 5M3FK 5C4JK 1I3QC 4KMUA 3HOYC 4A3LC 3GTJK 3PO2C 1TWAK 4C2MK 3S14C 3M4OK 4A3IC 3S16C 4YG2A 5D4DA 4XLPA 5IP7K 2B63K 3GTLC 4BXXK 2A69A 2R93K 5C44C 4XLNA 3HOYK 3I4MC 4A3LK 3S1RC 2YU9K 4OIQA 4X6AC 2PPBA 4A3DC 4LK0A 3S14K 3M3YK 4A3IK 4A93K 3EQLA 1YNNA 3RZOC 4YFXA 3S17C 3PO3C 4BBSC 3RZDC 4BY7C 3S1RK 2WAQD 2WAQL 1I6HC 3FKIC 4A3MC 4XSXA 5M3MK 2NVYC 4QJVB 5IYBC 4G7ZA 2Y0SD 5IYCC 3RZOK 3S2HC 3GTGC 3PO3K 3I4NC 4BBSK 4A3KK 4BY7K 2PA8L 5M5YK 1R9TK 4QJVA 2WB1L 1I6HK 2R7ZK 3HOZC 3HOUK 2NVYK 5IYBK 5C3EC 4A3JK 2JA8C 2NVQC 3I4NK 3GTGK 2E2IK
chains in the Genus database with same CATH superfamily
1SMYA 1Y1VC 3GTLA 4Y52C 1USOA 4C3IC 3FHZA 1ISEA 4KMHA 3SZYA 3MMLB 3T02A 4LK1A 2R92C 3S17K 2O5JA 4A3EC 2E2HC 3K7AK 1XZPA 3GTOA 3HOXC 4C3HK 3FKIK 3OPFA 4YFNA 1F7VA 1JQWA 3S15C 4KC6A 2ZUFA 3WODA 3S2HK 4Y7NK 3LPXA 1I50C 1DD5A 4C3JC 1BDFA 4BY1K 4MEYA 4GTCA 2JA7A 1TWGC 1Y1WA 1Y1VK 3S1NC 2NVXA 3AQPA 3IPJA 3GTQA 1XZQB 1TWFC 2NVTC 3OEPA 1TWCK 4GT9A 1F93A 1K83K 1O26A 2V6TA 4A93C 3HOVC 1IS1A 3GTPA 1VLOA 1INNA 2JA5A 3V4GA 2E2HK 4FZBA 4ZH4A 3T01A 4A3FC 3HOXK 1XXCA 5M5XK 1WSVA 3AD8C 3S15K 2JA6A 1WIHA 1SFOC 4LJZA 2R7ZC 3GTJC 3LAPA 4YFKA 1I50K 2RH6A 4C3JK 1XXAA 3S1MK 2R93A 2GSUA 5IP9C 2V6UA 5M3FK 3M4OK 4YG2A 4WILA 3GEEA 4GTDA 4PABA 5C44C 3HOYK 4A3LK 3I4MC 1WOSA 4OIQA 4X6AC 2PPBA 4A93K 4YFXA 1VH2A 4BBSC 1BS2A 3S1RK 1IE0A 4PAAA 1EH1A 4G7ZA 2Y0SD 5EGHA 5IYCC 3RZOK 3PO3K 4BY7K 3GEHA 5M5YK 1I3QA 1I6HK 2R7ZK 1B4AA 3L4KA 1WOOA 3GTMC 3TFHA 3GTGK 5IP9K 3A8IA 2JH3A 4G7OA 1WCMC 3VA7A 4KB4A 2NVQK 3AQOA 1F7UA 3K7AC 5C44K 3I4MK 4X6AK 4J3NA 4C3HC 4WJ4A 5HL8A 2R92A 1O28A 1J6WA 2E2JK 3S2DK 4KN4A 4Y7NC 1O2AA 1DCHA 1J6VA 4C45A 1O2BA 4BY1C 3H0GK 5IYCK 4GTFA 3CQZC 3H3VL 2V6SA 4A3CC 3ADAC 4KB2A 5JVOA 2CFAB 3GTMK 1TWGA 3S1QK 3HOWK 2A6EA 1TWCC 1JVIA 1WCMK 1K83C 1TWFA 3GIRA 2VUMK 4A3GK 5C4XK 1XZQA 1I6VA 3GTKK 2A68A 4Q4ZA 3M3YC 1IBAA 3QX3A 2W7VA 4LLGA 4MQ9A 4G0WA 1V5VA 2BE5A 1EK8A 5FLMK 3T00A 1IQ0A 4DDQA 1WOPA 1VJEA 3JSTA 3S1MC 2EBBA 1SFOA 1G51A 3DXJA 4P5BA 4GTLA 1ZVUA 4O2DA 1BJTA 3GTJA 3HOUC 3CQZK 5IOQA 4KN7A 3M4OC 3N0BA 3G4CA 2E2IC 3L4JA 2D6FC 4A3CK 1TWHK 3HOYC 2YU9A 1WQHA 4A3LC 4KARA 4KM8A 4KAWX 3SZZA 1TWAK 3OREA 3S16C 3CAGA 2B63K 3GTLC 1GE9A 4LR2A 3S1RC 4A3DC 3S14K 3M3YK 3EQLA 3RZOC 3PO3C 1R9TA 4BY7C 4XCHA 1I6HC 4A3MC 4QJVB 3GEIA 2XCRB 3GTGC 4KMDA 2PA8L 2WB1L 4GTAA 1EQRA 3HOUK 2NVYK 3NUHA 4GFQA 3S0XA 2NVQC 3I4NK 2E2IK 3FOEA 1O29A 1IW7A 5C3EK 5JFEA 2JA8K 1PJ6A 1XPPA 3PO2K 3S16K 3S2DC 1Y1WC 2E2JC 4Q5SA 3GTLK 4GTBA 4G7HA 3AD9C 3FKIA 1L0WA 4A3DK 1USMA 4NOIA 3H0GC 3HKZD 3HKZL 4A3BC 1JOEA 1WSRA 5FJ8K 1O24A 1ZYRA 4A3MK 5IOSA 1O25A 3S1QC 4OIRA 3HOWC 1Y1VA 3BP8C 2CW0A 3GTOK 4JK1A 5IYDK 3TFJA 4P9SA 4XSZA 1EI6A 1TWCA 2VUMC 4A3GC 4KASA 4MEXA 2GAGC 5C4XC 2CFAA 1K83A 4C2MC 3GTKC 1C0AA 5M5WK 4KM9A 2FQOA 2R93C 3BUEA 2JA7K 1Y1WK 3N0CA 2E2HA 1VGXA 5TJ3A 1O2FB 4BBRK 2NVXK 1J6XA 5FLMC 1DCOA 1HQMA 3GTQK 5IORA 4AYBD 4AYBL 3Q3QA 2Y3PA 1B4BA 1ZBSA 4KMAA 1I50A 4A3BK 3H3VD 3GTPK 2FQTA 5E68A 5IOTA 4A3KC 1TWHC 3A8KA 2JA5K 2GSOA 1TWAC 2O5IA 4OIOA 4QIWL 4QIWD 2B63C 2JA6K 4WJ3M 1I3QC 3AH5A 4C2MK 3S14C 1WORA 4BXXK 5D4DA 4XLPA 2R93K 1AB4A 4BKWA 3G4AA 4LK0A 4A3IK 4G0UA 3RZDC 3TFIA 2WAQD 2WAQL 2R7ZA 3BP3A 2NVYC 3GTGA 3I4NC 5EGEA 4A3KK 2ZFZA 4QJVA 1RU0A 5L46A 4BLBA 5IYBK 5C3EC 2JA8C 2XCQA 2GSNA 1WQGA 1O27A 4OIPA 3PO2C 1DCPA 5CJ9A 1I3QK 3HOZK 2GAHC 4LOWA 2P8TA 1YCLA 3HXAA 4Y52K 5TMFA 4GTEA 1XZPB 2ZUEA 4C3IK 3H0GA 1KQ4A 1YX2A 1X31C 3RZDK 2PA8D 1IL2A 3GTOC 2WB1D 4GZYA 1XXBA 4ILDA 5IYDC 2R92K 3GTMA 4G0VA 4A3EK 1J98A 4M1XA 1WCMA 3LAJA 4FM9A 3AD7C 1UV7A 5C4JC 2JA7C 2VUMA 2PMZL 2PMZD 1ZQ1C 4BBRC 2NVXC 3GTKA 3GTQC 5IP7C 1TWGK 5TMCA 2YU9C 3GDZA 3S1NK 2RGRA 1TWFK 3GTPC 2NVTK 1ZXOA 1HI9A 1F9NA 2JA5C 2XCOA 3CQZA 5CHPA 3HOVK 2P5MA 1BGWA 1TWHA 2JA6C 1R9TC 4OINA 3GSIA 4A3FK 2A6HA 1YNJA 1TWAA 2Y0SL 4A3JC 4BXXC 2B63A 1SFOK 5C4JK 3FOFA 4KMUA 3GTJK 4LQYA 4A3IC 5IP7K 2A69A 1PJ5A 4XLNA 1WQFA 4RMFA 2YU9K 4KATA 4P5AA 1PJ7A 2PHCB 1VRQC 1YNNA 3N3YA 4KDDA 3S17C 3A8JA 3FKIC 2NVYA 4BLAA 4XSXA 5M3MK 5IYBC 4AH6A 2KWAA 2E2IA 3S2HC 3ERED 4BBSK 3TTGA 1R9TK 3HOZC 1EFWA 4A3JK
chains in the Genus database with same CATH topology
4OIPA 1SMYA 1Y1VC 5IP9K 4Y52C 1I3QK 3HOZK 1WCMC 4G7OA 1IW7A 5C3EK 2JA8K 2NVQK 1XPPA 3PO2K 3S16K 3S2DC 1Y1WC 2E2JC 4Q5SA 3GTLK 4Y52K 4G7HA 3K7AC 5C44K 3I4MK 4X6AK 4A3DK 5TMFA 4C3IK 4NOIA 3H0GC 4LK1A 2E2JK 2R92C 3S2DK 4KN4A 3S17K 2O5JA 4A3EC 4Y7NC 2E2HC 3K7AK 3RZDK 3HKZD 3HKZL 2PA8D 3HOXC 3GTOC 4A3BC 2WB1D 4GZYA 4C3HK 3FKIK 5FJ8K 4YFNA 5IYDC 1ZYRA 4A3MK 4BY1C 3H0GK 2R92K 3S15C 5IYCK 3S1QC 4OIRA 3WODA 3HOWC 4A3EK 4Y7NK 3S2HK 2CW0A 3GTOK 4JK1A 1I50C 3CQZC 3H3VL 5IYDK 1BDFA 4BY1K 4A3CC 4MEYA 3GTMK 3S1QK 4XSZA 3HOWK 1TWGC 5C4JC 2JA7C 2A6EA 1Y1VK 1TWCC 2VUMC 2PMZL 2PMZD 4A3GC 4MEXA 4BBRC 3S1NC 5C4XC 1WCMK 2NVXC 1K83C 3GTKC 5M5WK 3GTQC 1TWFC 5IP7C 2R93C 1TWGK 2NVTC 2JA7K 1Y1WK 1TWCK 2VUMK 5TMCA 4A3GK 2YU9C 4BBRK 3S1NK 5C4XK 1I6VA 2NVXK 1K83K 5FLMC 3GTKK 2A68A 4Q4ZA 3M3YC 4A93C 1HQMA 3GTQK 1TWFK 3HOVC 3GTPC 4LLGA 2NVTK 4MQ9A 4AYBD 2BE5A 4AYBL 2E2HK 2JA5C 4ZH4A 4A3FC 5FLMK 3HOXK 4A3BK 5M5XK 3HOVK 3H3VD 3GTMC 3GTPK 3S15K 3S1MC 4A3KC 1TWHC 2JA6C 1SFOC 3DXJA 1R9TC 2JA5K 4OINA 4LJZA 2R7ZC 3HOUC 4A3FK 3GTJC 2A6HA 1YNJA 1I50K 3CQZK 4YFKA 2Y0SL 4A3JC 1TWAC 2O5IA 4KN7A 4OIOA 4C3JK 3M4OC 4QIWL 4QIWD 2E2IC 3S1MK 4A3CK 1TWHK 5IP9C 2B63C 2JA6K 1SFOK 4BXXC 5M3FK 5C4JK 1I3QC 4KMUA 3HOYC 4A3LC 3GTJK 3PO2C 1TWAK 4C2MK 3S14C 3M4OK 4A3IC 3S16C 4YG2A 5D4DA 4XLPA 5IP7K 2B63K 3GTLC 4BXXK 2A69A 2R93K 5C44C 4XLNA 3HOYK 3I4MC 4A3LK 3S1RC 2YU9K 4OIQA 4X6AC 2PPBA 4A3DC 4LK0A 3S14K 3M3YK 4A3IK 4A93K 3EQLA 1YNNA 3RZOC 4YFXA 3S17C 3PO3C 4BBSC 3RZDC 4BY7C 3S1RK 2WAQD 2WAQL 1I6HC 3FKIC 4A3MC 4XSXA 5M3MK 2NVYC 4QJVB 5IYBC 4G7ZA 2Y0SD 5IYCC 3RZOK 3S2HC 3GTGC 3PO3K 3I4NC 4BBSK 4A3KK 4BY7K 2PA8L 5M5YK 1R9TK 4QJVA 2WB1L 1I6HK 2R7ZK 3HOZC 3HOUK 2NVYK 5IYBK 5C3EC 4A3JK 2JA8C 2NVQC 3I4NK 3GTGK 2E2IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIP A;  1SMY A;  1Y1V C;  5IP9 K;  4Y52 C;  1I3Q K;  3HOZ K;  1WCM C;  4G7O A;  1IW7 A;  5C3E K;  2JA8 K;  2NVQ K;  1XPP A;  3PO2 K;  3S16 K;  3S2D C;  1Y1W C;  2E2J C;  4Q5S A;  3GTL K;  4Y52 K;  4G7H A;  3K7A C;  5C44 K;  3I4M K;  4X6A K;  4A3D K;  5TMF A;  4C3I K;  4NOI A;  3H0G C;  4LK1 A;  2E2J K;  2R92 C;  3S2D K;  4KN4 A;  3S17 K;  2O5J A;  4A3E C;  4Y7N C;  2E2H C;  3K7A K;  3RZD K;  3HKZ D;  3HKZ L;  2PA8 D;  3HOX C;  3GTO C;  4A3B C;  2WB1 D;  4GZY A;  4C3H K;  3FKI K;  5FJ8 K;  4YFN A;  5IYD C;  1ZYR A;  4A3M K;  4BY1 C;  3H0G K;  2R92 K;  3S15 C;  5IYC K;  3S1Q C;  4OIR A;  3WOD A;  3HOW C;  4A3E K;  4Y7N K;  3S2H K;  2CW0 A;  3GTO K;  4JK1 A;  1I50 C;  3CQZ C;  3H3V L;  5IYD K;  1BDF A;  4BY1 K;  4A3C C;  4MEY A;  3GTM K;  3S1Q K;  4XSZ A;  3HOW K;  1TWG C;  5C4J C;  2JA7 C;  2A6E A;  1Y1V K;  1TWC C;  2VUM C;  2PMZ L;  2PMZ D;  4A3G C;  4MEX A;  4BBR C;  3S1N C;  5C4X C;  1WCM K;  2NVX C;  1K83 C;  3GTK C;  5M5W K;  3GTQ C;  1TWF C;  5IP7 C;  2R93 C;  1TWG K;  2NVT C;  2JA7 K;  1Y1W K;  1TWC K;  2VUM K;  5TMC A;  4A3G K;  2YU9 C;  4BBR K;  3S1N K;  5C4X K;  1I6V A;  2NVX K;  1K83 K;  5FLM C;  3GTK K;  2A68 A;  4Q4Z A;  3M3Y C;  4A93 C;  1HQM A;  3GTQ K;  1TWF K;  3HOV C;  3GTP C;  4LLG A;  2NVT K;  4MQ9 A;  4AYB D;  2BE5 A;  4AYB L;  2E2H K;  2JA5 C;  4ZH4 A;  4A3F C;  5FLM K;  3HOX K;  4A3B K;  5M5X K;  3HOV K;  3H3V D;  3GTM C;  3GTP K;  3S15 K;  3S1M C;  4A3K C;  1TWH C;  2JA6 C;  1SFO C;  3DXJ A;  1R9T C;  2JA5 K;  4OIN A;  4LJZ A;  2R7Z C;  3HOU C;  4A3F K;  3GTJ C;  2A6H A;  1YNJ A;  1I50 K;  3CQZ K;  4YFK A;  2Y0S L;  4A3J C;  1TWA C;  2O5I A;  4KN7 A;  4OIO A;  4C3J K;  3M4O C;  4QIW L;  4QIW D;  2E2I C;  3S1M K;  4A3C K;  1TWH K;  5IP9 C;  2B63 C;  2JA6 K;  1SFO K;  4BXX C;  5M3F K;  5C4J K;  1I3Q C;  4KMU A;  3HOY C;  4A3L C;  3GTJ K;  3PO2 C;  1TWA K;  4C2M K;  3S14 C;  3M4O K;  4A3I C;  3S16 C;  4YG2 A;  5D4D A;  4XLP A;  5IP7 K;  2B63 K;  3GTL C;  4BXX K;  2A69 A;  2R93 K;  5C44 C;  4XLN A;  3HOY K;  3I4M C;  4A3L K;  3S1R C;  2YU9 K;  4OIQ A;  4X6A C;  2PPB A;  4A3D C;  4LK0 A;  3S14 K;  3M3Y K;  4A3I K;  4A93 K;  3EQL A;  1YNN A;  3RZO C;  4YFX A;  3S17 C;  3PO3 C;  4BBS C;  3RZD C;  4BY7 C;  3S1R K;  2WAQ D;  2WAQ L;  1I6H C;  3FKI C;  4A3M C;  4XSX A;  5M3M K;  2NVY C;  4QJV B;  5IYB C;  4G7Z A;  2Y0S D;  5IYC C;  3RZO K;  3S2H C;  3GTG C;  3PO3 K;  3I4N C;  4BBS K;  4A3K K;  4BY7 K;  2PA8 L;  5M5Y K;  1R9T K;  4QJV A;  2WB1 L;  1I6H K;  2R7Z K;  3HOZ C;  3HOU K;  2NVY K;  5IYB K;  5C3E C;  4A3J K;  2JA8 C;  2NVQ C;  3I4N K;  3GTG K;  2E2I K; 
#chains in the Genus database with same CATH topology
 1SMY A;  1Y1V C;  3GTL A;  4Y52 C;  1USO A;  4C3I C;  3FHZ A;  1ISE A;  4KMH A;  3SZY A;  3MML B;  3T02 A;  4LK1 A;  2R92 C;  3S17 K;  2O5J A;  4A3E C;  2E2H C;  3K7A K;  1XZP A;  3GTO A;  3HOX C;  4C3H K;  3FKI K;  3OPF A;  4YFN A;  1F7V A;  1JQW A;  3S15 C;  4KC6 A;  2ZUF A;  3WOD A;  3S2H K;  4Y7N K;  3LPX A;  1I50 C;  1DD5 A;  4C3J C;  1BDF A;  4BY1 K;  4MEY A;  4GTC A;  2JA7 A;  1TWG C;  1Y1W A;  1Y1V K;  3S1N C;  2NVX A;  3AQP A;  3IPJ A;  3GTQ A;  1XZQ B;  1TWF C;  2NVT C;  3OEP A;  1TWC K;  4GT9 A;  1F93 A;  1K83 K;  1O26 A;  2V6T A;  4A93 C;  3HOV C;  1IS1 A;  3GTP A;  1VLO A;  1INN A;  2JA5 A;  3V4G A;  2E2H K;  4FZB A;  4ZH4 A;  3T01 A;  4A3F C;  3HOX K;  1XXC A;  5M5X K;  1WSV A;  3AD8 C;  3S15 K;  2JA6 A;  1WIH A;  1SFO C;  4LJZ A;  2R7Z C;  3GTJ C;  3LAP A;  4YFK A;  1I50 K;  2RH6 A;  4C3J K;  1XXA A;  3S1M K;  2R93 A;  2GSU A;  5IP9 C;  2V6U A;  5M3F K;  3M4O K;  4YG2 A;  4WIL A;  3GEE A;  4GTD A;  4PAB A;  5C44 C;  3HOY K;  4A3L K;  3I4M C;  1WOS A;  4OIQ A;  4X6A C;  2PPB A;  4A93 K;  4YFX A;  1VH2 A;  4BBS C;  1BS2 A;  3S1R K;  1IE0 A;  4PAA A;  1EH1 A;  4G7Z A;  2Y0S D;  5EGH A;  5IYC C;  3RZO K;  3PO3 K;  4BY7 K;  3GEH A;  5M5Y K;  1I3Q A;  1I6H K;  2R7Z K;  1B4A A;  3L4K A;  1WOO A;  3GTM C;  3TFH A;  3GTG K;  5IP9 K;  3A8I A;  2JH3 A;  4G7O A;  1WCM C;  3VA7 A;  4KB4 A;  2NVQ K;  3AQO A;  1F7U A;  3K7A C;  5C44 K;  3I4M K;  4X6A K;  4J3N A;  4C3H C;  4WJ4 A;  5HL8 A;  2R92 A;  1O28 A;  1J6W A;  2E2J K;  3S2D K;  4KN4 A;  4Y7N C;  1O2A A;  1DCH A;  1J6V A;  4C45 A;  1O2B A;  4BY1 C;  3H0G K;  5IYC K;  4GTF A;  3CQZ C;  3H3V L;  2V6S A;  4A3C C;  3ADA C;  4KB2 A;  5JVO A;  2CFA B;  3GTM K;  1TWG A;  3S1Q K;  3HOW K;  2A6E A;  1TWC C;  1JVI A;  1WCM K;  1K83 C;  1TWF A;  3GIR A;  2VUM K;  4A3G K;  5C4X K;  1XZQ A;  1I6V A;  3GTK K;  2A68 A;  4Q4Z A;  3M3Y C;  1IBA A;  3QX3 A;  2W7V A;  4LLG A;  4MQ9 A;  4G0W A;  1V5V A;  2BE5 A;  1EK8 A;  5FLM K;  3T00 A;  1IQ0 A;  4DDQ A;  1WOP A;  1VJE A;  3JST A;  3S1M C;  2EBB A;  1SFO A;  1G51 A;  3DXJ A;  4P5B A;  4GTL A;  1ZVU A;  4O2D A;  1BJT A;  3GTJ A;  3HOU C;  3CQZ K;  5IOQ A;  4KN7 A;  3M4O C;  3N0B A;  3G4C A;  2E2I C;  3L4J A;  2D6F C;  4A3C K;  1TWH K;  3HOY C;  2YU9 A;  1WQH A;  4A3L C;  4KAR A;  4KM8 A;  4KAW X;  3SZZ A;  1TWA K;  3ORE A;  3S16 C;  3CAG A;  2B63 K;  3GTL C;  1GE9 A;  4LR2 A;  3S1R C;  4A3D C;  3S14 K;  3M3Y K;  3EQL A;  3RZO C;  3PO3 C;  1R9T A;  4BY7 C;  4XCH A;  1I6H C;  4A3M C;  4QJV B;  3GEI A;  2XCR B;  3GTG C;  4KMD A;  2PA8 L;  2WB1 L;  4GTA A;  1EQR A;  3HOU K;  2NVY K;  3NUH A;  4GFQ A;  3S0X A;  2NVQ C;  3I4N K;  2E2I K;  3FOE A;  1O29 A;  1IW7 A;  5C3E K;  5JFE A;  2JA8 K;  1PJ6 A;  1XPP A;  3PO2 K;  3S16 K;  3S2D C;  1Y1W C;  2E2J C;  4Q5S A;  3GTL K;  4GTB A;  4G7H A;  3AD9 C;  3FKI A;  1L0W A;  4A3D K;  1USM A;  4NOI A;  3H0G C;  3HKZ D;  3HKZ L;  4A3B C;  1JOE A;  1WSR A;  5FJ8 K;  1O24 A;  1ZYR A;  4A3M K;  5IOS A;  1O25 A;  3S1Q C;  4OIR A;  3HOW C;  1Y1V A;  3BP8 C;  2CW0 A;  3GTO K;  4JK1 A;  5IYD K;  3TFJ A;  4P9S A;  4XSZ A;  1EI6 A;  1TWC A;  2VUM C;  4A3G C;  4KAS A;  4MEX A;  2GAG C;  5C4X C;  2CFA A;  1K83 A;  4C2M C;  3GTK C;  1C0A A;  5M5W K;  4KM9 A;  2FQO A;  2R93 C;  3BUE A;  2JA7 K;  1Y1W K;  3N0C A;  2E2H A;  1VGX A;  5TJ3 A;  1O2F B;  4BBR K;  2NVX K;  1J6X A;  5FLM C;  1DCO A;  1HQM A;  3GTQ K;  5IOR A;  4AYB D;  4AYB L;  3Q3Q A;  2Y3P A;  1B4B A;  1ZBS A;  4KMA A;  1I50 A;  4A3B K;  3H3V D;  3GTP K;  2FQT A;  5E68 A;  5IOT A;  4A3K C;  1TWH C;  3A8K A;  2JA5 K;  2GSO A;  1TWA C;  2O5I A;  4OIO A;  4QIW L;  4QIW D;  2B63 C;  2JA6 K;  4WJ3 M;  1I3Q C;  3AH5 A;  4C2M K;  3S14 C;  1WOR A;  4BXX K;  5D4D A;  4XLP A;  2R93 K;  1AB4 A;  4BKW A;  3G4A A;  4LK0 A;  4A3I K;  4G0U A;  3RZD C;  3TFI A;  2WAQ D;  2WAQ L;  2R7Z A;  3BP3 A;  2NVY C;  3GTG A;  3I4N C;  5EGE A;  4A3K K;  2ZFZ A;  4QJV A;  1RU0 A;  5L46 A;  4BLB A;  5IYB K;  5C3E C;  2JA8 C;  2XCQ A;  2GSN A;  1WQG A;  1O27 A;  4OIP A;  3PO2 C;  1DCP A;  5CJ9 A;  1I3Q K;  3HOZ K;  2GAH C;  4LOW A;  2P8T A;  1YCL A;  3HXA A;  4Y52 K;  5TMF A;  4GTE A;  1XZP B;  2ZUE A;  4C3I K;  3H0G A;  1KQ4 A;  1YX2 A;  1X31 C;  3RZD K;  2PA8 D;  1IL2 A;  3GTO C;  2WB1 D;  4GZY A;  1XXB A;  4ILD A;  5IYD C;  2R92 K;  3GTM A;  4G0V A;  4A3E K;  1J98 A;  4M1X A;  1WCM A;  3LAJ A;  4FM9 A;  3AD7 C;  1UV7 A;  5C4J C;  2JA7 C;  2VUM A;  2PMZ L;  2PMZ D;  1ZQ1 C;  4BBR C;  2NVX C;  3GTK A;  3GTQ C;  5IP7 C;  1TWG K;  5TMC A;  2YU9 C;  3GDZ A;  3S1N K;  2RGR A;  1TWF K;  3GTP C;  2NVT K;  1ZXO A;  1HI9 A;  1F9N A;  2JA5 C;  2XCO A;  3CQZ A;  5CHP A;  3HOV K;  2P5M A;  1BGW A;  1TWH A;  2JA6 C;  1R9T C;  4OIN A;  3GSI A;  4A3F K;  2A6H A;  1YNJ A;  1TWA A;  2Y0S L;  4A3J C;  4BXX C;  2B63 A;  1SFO K;  5C4J K;  3FOF A;  4KMU A;  3GTJ K;  4LQY A;  4A3I C;  5IP7 K;  2A69 A;  1PJ5 A;  4XLN A;  1WQF A;  4RMF A;  2YU9 K;  4KAT A;  4P5A A;  1PJ7 A;  2PHC B;  1VRQ C;  1YNN A;  3N3Y A;  4KDD A;  3S17 C;  3A8J A;  3FKI C;  2NVY A;  4BLA A;  4XSX A;  5M3M K;  5IYB C;  4AH6 A;  2KWA A;  2E2I A;  3S2H C;  3ERE D;  4BBS K;  3TTG A;  1R9T K;  3HOZ C;  1EFW A;  4A3J K; 
#chains in the Genus database with same CATH homology
 4OIP A;  1SMY A;  1Y1V C;  5IP9 K;  4Y52 C;  1I3Q K;  3HOZ K;  1WCM C;  4G7O A;  1IW7 A;  5C3E K;  2JA8 K;  2NVQ K;  1XPP A;  3PO2 K;  3S16 K;  3S2D C;  1Y1W C;  2E2J C;  4Q5S A;  3GTL K;  4Y52 K;  4G7H A;  3K7A C;  5C44 K;  3I4M K;  4X6A K;  4A3D K;  5TMF A;  4C3I K;  4NOI A;  3H0G C;  4LK1 A;  2E2J K;  2R92 C;  3S2D K;  4KN4 A;  3S17 K;  2O5J A;  4A3E C;  4Y7N C;  2E2H C;  3K7A K;  3RZD K;  3HKZ D;  3HKZ L;  2PA8 D;  3HOX C;  3GTO C;  4A3B C;  2WB1 D;  4GZY A;  4C3H K;  3FKI K;  5FJ8 K;  4YFN A;  5IYD C;  1ZYR A;  4A3M K;  4BY1 C;  3H0G K;  2R92 K;  3S15 C;  5IYC K;  3S1Q C;  4OIR A;  3WOD A;  3HOW C;  4A3E K;  4Y7N K;  3S2H K;  2CW0 A;  3GTO K;  4JK1 A;  1I50 C;  3CQZ C;  3H3V L;  5IYD K;  1BDF A;  4BY1 K;  4A3C C;  4MEY A;  3GTM K;  3S1Q K;  4XSZ A;  3HOW K;  1TWG C;  5C4J C;  2JA7 C;  2A6E A;  1Y1V K;  1TWC C;  2VUM C;  2PMZ L;  2PMZ D;  4A3G C;  4MEX A;  4BBR C;  3S1N C;  5C4X C;  1WCM K;  2NVX C;  1K83 C;  3GTK C;  5M5W K;  3GTQ C;  1TWF C;  5IP7 C;  2R93 C;  1TWG K;  2NVT C;  2JA7 K;  1Y1W K;  1TWC K;  2VUM K;  5TMC A;  4A3G K;  2YU9 C;  4BBR K;  3S1N K;  5C4X K;  1I6V A;  2NVX K;  1K83 K;  5FLM C;  3GTK K;  2A68 A;  4Q4Z A;  3M3Y C;  4A93 C;  1HQM A;  3GTQ K;  1TWF K;  3HOV C;  3GTP C;  4LLG A;  2NVT K;  4MQ9 A;  4AYB D;  2BE5 A;  4AYB L;  2E2H K;  2JA5 C;  4ZH4 A;  4A3F C;  5FLM K;  3HOX K;  4A3B K;  5M5X K;  3HOV K;  3H3V D;  3GTM C;  3GTP K;  3S15 K;  3S1M C;  4A3K C;  1TWH C;  2JA6 C;  1SFO C;  3DXJ A;  1R9T C;  2JA5 K;  4OIN A;  4LJZ A;  2R7Z C;  3HOU C;  4A3F K;  3GTJ C;  2A6H A;  1YNJ A;  1I50 K;  3CQZ K;  4YFK A;  2Y0S L;  4A3J C;  1TWA C;  2O5I A;  4KN7 A;  4OIO A;  4C3J K;  3M4O C;  4QIW L;  4QIW D;  2E2I C;  3S1M K;  4A3C K;  1TWH K;  5IP9 C;  2B63 C;  2JA6 K;  1SFO K;  4BXX C;  5M3F K;  5C4J K;  1I3Q C;  4KMU A;  3HOY C;  4A3L C;  3GTJ K;  3PO2 C;  1TWA K;  4C2M K;  3S14 C;  3M4O K;  4A3I C;  3S16 C;  4YG2 A;  5D4D A;  4XLP A;  5IP7 K;  2B63 K;  3GTL C;  4BXX K;  2A69 A;  2R93 K;  5C44 C;  4XLN A;  3HOY K;  3I4M C;  4A3L K;  3S1R C;  2YU9 K;  4OIQ A;  4X6A C;  2PPB A;  4A3D C;  4LK0 A;  3S14 K;  3M3Y K;  4A3I K;  4A93 K;  3EQL A;  1YNN A;  3RZO C;  4YFX A;  3S17 C;  3PO3 C;  4BBS C;  3RZD C;  4BY7 C;  3S1R K;  2WAQ D;  2WAQ L;  1I6H C;  3FKI C;  4A3M C;  4XSX A;  5M3M K;  2NVY C;  4QJV B;  5IYB C;  4G7Z A;  2Y0S D;  5IYC C;  3RZO K;  3S2H C;  3GTG C;  3PO3 K;  3I4N C;  4BBS K;  4A3K K;  4BY7 K;  2PA8 L;  5M5Y K;  1R9T K;  4QJV A;  2WB1 L;  1I6H K;  2R7Z K;  3HOZ C;  3HOU K;  2NVY K;  5IYB K;  5C3E C;  4A3J K;  2JA8 C;  2NVQ C;  3I4N K;  3GTG K;  2E2I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...