2E2HK

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2hK00
3S14C 3S2DK 5M3MK 3H0GC 3S2HK 5C3EK 2JA5K 4AYBD 4XLPA 4C3IK 5FLMC 3S16K 4A3IK 4A3DC 2NVXC 3S1NC 4BBRC 1I6VA 3S1QK 3HKZD 4A3LK 1SFOC 1TWHK 3GTMK 4MQ9A 3H3VL 3S1RC 2R93C 1TWCC 4Q5SA 3S17C 5IYCK 2VUMC 4BBSK 1WCMK 4Q4ZA 4A3EK 3I4MC 2R92K 2B63K 4C3JK 3PO3C 4A3MK 5C4JC 3GTOC 3RZOC 3HOYC 4A93K 3S14K 4LK1A 3GTKC 1K83K 4BXXC 1Y1VC 4A3KC 3M4OC 1ZYRA 1YNNA 2YU9K 3I4NK 4QIWD 3HKZL 4OIPA 3DXJA 1SMYA 4Y7NC 2A68A 1SFOK 3HOWC 1I3QC 3S1RK 2BE5A 4BY7C 2R93K 4GZYA 3S15C 2O5IA 4A3CC 2R7ZK 1TWFC 5IP7C 5M5XK 3HOVC 3HOZK 5M3FK 2JA6C 4A93C 4MEXA 4KN7A 1Y1VK 2A69A 2NVYC 5C4XK 2PA8D 3HOXC 3FKIC 4QIWL 4YFNA 3M4OK 2O5JA 4JK1A 4Y7NK 3HOWK 3GTJC 1TWGK 1TWAC 3M3YK 1I50K 4X6AK 4Y52C 3H0GK 4AYBL 3PO2C 2E2HC 2NVQC 2A6EA 5FLMK 4A3DK 1TWFK 1Y1WC 3GTPC 2NVXK 3S1NK 4BBRK 2WAQD 5IYDC 2E2JC 3S1MC 5FJ8K 4A3GC 2Y0SD 1TWCK 2PA8L 1HQMA 4KMUA 4C2MK 4G7ZA 2VUMK 3GTGC 3S17K 5IP9C 3GTQC 4BY1C 3HOUC 3S2DC 3I4MK 3S2HC 5C3EC 3GTJK 3EQLA 3CQZC 3WODA 2CW0A 5C4JK 3GTOK 3HOYK 3RZOK 3PO3K 3GTKK 1XPPA 5M5YK 2PMZD 1R9TC 2PPBA 3GTLC 2E2HK 4QJVA 2NVQK 2JA8C 2NVTC 4A3KK 3S1QC 4LK0A 4BXXK 4A3LC 1TWHC 3GTMC 4MEYA 4A3FC 5IYDK 2JA7C 5D4DA 1I3QK 3K7AC 2Y0SL 4LJZA 4BBSC 4BY7K 5IYBC 4A3EC 4NOIA 2B63C 4A3JC 3S15K 4A3BC 5IP9K 3HOUK 4A3CK 1K83C 5IP7K 3RZDC 1I6HC 4X6AC 4XLNA 5C44C 3CQZK 3HOVK 2WB1D 4XSXA 5TMFA 2PMZL 4YFXA 2E2IC 2YU9C 4OIQA 2JA6K 3I4NC 1R9TK 3GTLK 2JA8K 2NVTK 4C3HK 2NVYK 4KN4A 4YFKA 3HOXK 3FKIK 4A3FK 4G7OA 5TMCA 2JA7K 1BDFA 3K7AK 1TWAK 2JA5C 4OINA 4OIRA 1YNJA 5IYBK 4A3IC 2R7ZC 3S16C 4Y52K 4G7HA 4A3BK 4A3JK 3PO2K 4ZH4A 3HOZC 2A6HA 3RZDK 2WAQL 1Y1WK 3GTPK 5C44K 1I6HK 2WB1L 3H3VD 4QJVB 4LLGA 5C4XC 5IYCC 2E2JK 2E2IK 3S1MK 4A3GK 3GTQK 1WCMC 4YG2A 2R92C 1IW7A 4XSZA 3GTGK 3M3YC 1TWGC 4A3MC 1I50C 4OIOA 5M5WK 4BY1K
chains in the Genus database with same CATH superfamily
1F93A 3S2DK 3H0GC 5C3EK 3N3YA 4A3IK 2NVXC 4BBRC 1I6VA 1YCLA 3H3VL 2R93C 3AQPA 1Y1WA 4G0WA 1WSVA 2VUMC 4KMAA 4A3EK 2R92K 2B63K 1EFWA 3RZOC 3GTGA 3GTQA 4BXXC 1BGWA 3GEHA 1YNNA 2YU9K 3HKZL 1C0AA 3GTLA 3HOWC 4GT9A 1F9NA 1O25A 2R93K 2R7ZK 1TWFC 1JVIA 2GSOA 2B63A 1VJEA 3HOZK 4KM8A 3GEIA 2ZFZA 2A69A 1WOSA 4C2MC 2NVYC 4YFNA 4GFQA 2YU9A 3HOWK 4LQYA 4GTDA 1WQGA 2E2HC 1DCPA 2A6EA 3LAJA 1TWFK 3GTPC 3S1NK 2R7ZA 3MMLB 4XCHA 2Y0SD 2PA8L 3OEPA 4C2MK 3S17K 1VGXA 5IP9C 4GTAA 5JVOA 3WODA 4C3IC 5CHPA 1EH1A 1XPPA 5M5YK 3OREA 2E2HK 2JA8C 2NVTC 4A3KK 4LK0A 4MEYA 4A3FC 1TWFA 3AH5A 4KMDA 5D4DA 1HI9A 4KAWX 5IOTA 3S15K 5IP9K 1IQ0A 1K83C 3T00A 4PAAA 5IP7K 5C44C 3HOVK 4XSXA 5TMFA 2JA8K 2NVTK 3T02A 4YFKA 2XCOA 3FKIK 4KDDA 4A3FK 4GTBA 2ZUEA 2ZUFA 2P8TA 1WSRA 5IOQA 3CAGA 1ISEA 5C44K 3H3VD 4KM9A 1WIHA 2E2JK 3S1MK 1WCMC 2GSUA 4A93C 4OIOA 4X6AC 3FKIA 2RH6A 5TJ3A 5HL8A 1ZXOA 4XLPA 3GTJA 4FZBA 3FOFA 4KASA 3HKZD 1SFOC 3GTMK 4BBSK 1AB4A 1WCMK 4Q4ZA 3I4MC 4C3JK 1XZPA 4P5AA 3PO3C 4A93K 3NUHA 2GSNA 3HOYC 3GTKC 3GDZA 5IOSA 4C45A 1SMYA 3DXJA 1R9TA 2EBBA 2A68A 1SFOK 1I3QC 4BY7C 1WQHA 3GTMA 2O5IA 3AD8C 1J6WA 1DCOA 1V5VA 3AD7C 5C4XK 2PA8D 3HOXC 4QIWL 2E2IA 4JK1A 1TWAC 1I50K 1SFOA 4WJ3M 3H0GK 3GSIA 3PO2C 2NVQC 1XZPB 2NVXK 4BBRK 5FJ8K 3AQOA 4P9SA 3FOEA 3N0BA 4G7ZA 2VUMK 3HOUC 1IS1A 3S2HC 2R92A 1USOA 3RZOK 1I50A 2XCQA 2NVQK 4QJVA 3H0GA 3S1QC 4BXXK 4A3LC 1TWHC 2XCRB 4PABA 2JA7C 2NVXA 4GTEA 4A3BC 4A3JC 2R93A 1J6XA 1O2FB 3HOUK 2VUMA 1O27A 1UV7A 1JQWA 1IBAA 4YFXA 1O28A 3I4NC 1O29A 2NVYK 3TFHA 2JA7K 4G0UA 2JA5C 4OINA 4OIRA 3S16C 5CJ9A 4A3BK 4A3JK 1WOOA 2D6FC 3GTPK 4QJVB 5IYCC 4YG2A 1G51A 1O2AA 3M3YC 1TWGC 2NVYA 5M5WK 2JA5K 4AYBD 4C3IK 5FLMC 3S16K 4A3DC 3SZYA 1DD5A 2E2HA 1VLOA 3GTPA 1YX2A 1TWCC 1X31C 5IYCK 3S0XA 3JSTA 1IE0A 1EI6A 5C4JC 3GTOC 4O2DA 1K83K 3A8KA 2RGRA 1Y1VC 2JA5A 1XZQA 4QIWD 4Y7NC 3GIRA 4GZYA 4A3CC 5M5XK 1O24A 5M3FK 3L4JA 2JA6C 1PJ5A 4MEXA 2GAGC 1K83A 1Y1VK 4C3HC 1INNA 2P5MA 2O5JA 3LPXA 4Y7NK 4KARA 4X6AK 4Y52C 4GTFA 4DDQA 3BP8C 4M1XA 4AYBL 1I50C 1Y1WC 4GTLA 2WAQD 3HXAA 5IYDC 4J3NA 4A3GC 4KC6A 3V4GA 1XZQB 1WOPA 1HQMA 4KMUA 3GTGC 3T01A 3GTQC 4BY1C 3S2DC 3I4MK 1WCMA 5C3EC 3PO3K 2CW0A 3HOYK 3GTKK 3GTLC 2Y3PA 2FQTA 5L46A 1B4BA 5IYDK 5EGHA 1I3QK 1XXAA 4LJZA 4BY7K 4A3EC 1PJ7A 4NOIA 2B63C 3L4KA 1O26A 4LOWA 2PMZL 1BS2A 2YU9C 3GTLK 4KMHA 3GTKA 4AH6A 3HOXK 3LAPA 1TWAK 1YNJA 1I3QA 2R7ZC 3PO2K 4ZH4A 3HOZC 2FQOA 2A6HA 3AD9C 2WAQL 1RU0A 2WB1L 4LLGA 4ILDA 3G4AA 1XXBA 2CFAA 4XSZA 4A3MC 4FM9A 3S14C 3TTGA 5M3MK 3S2HK 3IPJA 1KQ4A 1TWAA 1F7UA 3S1NC 3S1QK 4A3LK 1TWHK 4KB2A 1ZVUA 4MQ9A 3S1RC 1EQRA 4Q5SA 3S17C 4G0VA 4A3MK 4GTCA 3S14K 4LK1A 3GEEA 4A3KC 3M4OC 1ZYRA 3VA7A 3I4NK 2GAHC 4OIPA 1VH2A 1PJ6A 1TWHA 1USMA 3S1RK 2BE5A 1WORA 2CFAB 3S15C 2JA7A 4BLAA 1EK8A 5IP7C 1B4AA 1BJTA 3HOVC 1ZQ1C 4WILA 3N0CA 4KN7A 1J98A 3BP3A 3M4OK 3A8JA 3TFJA 3FKIC 2W7VA 4P5BA 3BUEA 1XXCA 2V6UA 4LR2A 3GTJC 1TWGK 2PHCB 3M3YK 4WJ4A 4RMFA 1DCHA 5IORA 3G4CA 3Q3QA 5FLMK 1WQFA 4A3DK 4BLBA 2KWAA 1L0WA 2E2JC 3S1MC 1TWCK 1GE9A 3OPFA 3TFIA 4KATA 1IL2A 3GTJK 3EQLA 3CQZC 5C4JK 3GTOK 2V6TA 1TWGA 2PMZD 1R9TC 2PPBA 2V6SA 3SZZA 3GTMC 4BKWA 3K7AC 2Y0SL 4BBSC 5IYBC 4C3JC 1F7VA 1TWCA 1ZBSA 3QX3A 4A3CK 3RZDC 1I6HC 4XLNA 3CQZK 2WB1D 4KB4A 5JFEA 2E2IC 4OIQA 2JA6K 3ERED 3GTOA 5E68A 1R9TK 4C3HK 4KN4A 1Y1VA 3A8IA 4G7OA 1VRQC 5TMCA 1JOEA 1BDFA 3K7AK 2JH3A 5IYBK 4A3IC 3ADAC 4Y52K 3FHZA 4G7HA 3RZDK 1Y1WK 1I6HK 5C4XC 3CQZA 2E2IK 1J6VA 4A3GK 2JA6A 1O2BA 2R92C 1IW7A 3GTGK 5EGEA 3GTQK 4BY1K
chains in the Genus database with same CATH topology
3S14C 3S2DK 5M3MK 3H0GC 3S2HK 5C3EK 2JA5K 4AYBD 4XLPA 4C3IK 5FLMC 3S16K 4A3IK 4A3DC 2NVXC 3S1NC 4BBRC 1I6VA 3S1QK 3HKZD 4A3LK 1SFOC 1TWHK 3GTMK 4MQ9A 3H3VL 3S1RC 2R93C 1TWCC 4Q5SA 3S17C 5IYCK 2VUMC 4BBSK 1WCMK 4Q4ZA 4A3EK 3I4MC 2R92K 2B63K 4C3JK 3PO3C 4A3MK 5C4JC 3GTOC 3RZOC 3HOYC 4A93K 3S14K 4LK1A 3GTKC 1K83K 4BXXC 1Y1VC 4A3KC 3M4OC 1ZYRA 1YNNA 2YU9K 3I4NK 4QIWD 3HKZL 4OIPA 3DXJA 1SMYA 4Y7NC 2A68A 1SFOK 3HOWC 1I3QC 3S1RK 2BE5A 4BY7C 2R93K 4GZYA 3S15C 2O5IA 4A3CC 2R7ZK 1TWFC 5IP7C 5M5XK 3HOVC 3HOZK 5M3FK 2JA6C 4A93C 4MEXA 4KN7A 1Y1VK 2A69A 2NVYC 5C4XK 2PA8D 3HOXC 3FKIC 4QIWL 4YFNA 3M4OK 2O5JA 4JK1A 4Y7NK 3HOWK 3GTJC 1TWGK 1TWAC 3M3YK 1I50K 4X6AK 4Y52C 3H0GK 4AYBL 3PO2C 2E2HC 2NVQC 2A6EA 5FLMK 4A3DK 1TWFK 1Y1WC 3GTPC 2NVXK 3S1NK 4BBRK 2WAQD 5IYDC 2E2JC 3S1MC 5FJ8K 4A3GC 2Y0SD 1TWCK 2PA8L 1HQMA 4KMUA 4C2MK 4G7ZA 2VUMK 3GTGC 3S17K 5IP9C 3GTQC 4BY1C 3HOUC 3S2DC 3I4MK 3S2HC 5C3EC 3GTJK 3EQLA 3CQZC 3WODA 2CW0A 5C4JK 3GTOK 3HOYK 3RZOK 3PO3K 3GTKK 1XPPA 5M5YK 2PMZD 1R9TC 2PPBA 3GTLC 2E2HK 4QJVA 2NVQK 2JA8C 2NVTC 4A3KK 3S1QC 4LK0A 4BXXK 4A3LC 1TWHC 3GTMC 4MEYA 4A3FC 5IYDK 2JA7C 5D4DA 1I3QK 3K7AC 2Y0SL 4LJZA 4BBSC 4BY7K 5IYBC 4A3EC 4NOIA 2B63C 4A3JC 3S15K 4A3BC 5IP9K 3HOUK 4A3CK 1K83C 5IP7K 3RZDC 1I6HC 4X6AC 4XLNA 5C44C 3CQZK 3HOVK 2WB1D 4XSXA 5TMFA 2PMZL 4YFXA 2E2IC 2YU9C 4OIQA 2JA6K 3I4NC 1R9TK 3GTLK 2JA8K 2NVTK 4C3HK 2NVYK 4KN4A 4YFKA 3HOXK 3FKIK 4A3FK 4G7OA 5TMCA 2JA7K 1BDFA 3K7AK 1TWAK 2JA5C 4OINA 4OIRA 1YNJA 5IYBK 4A3IC 2R7ZC 3S16C 4Y52K 4G7HA 4A3BK 4A3JK 3PO2K 4ZH4A 3HOZC 2A6HA 3RZDK 2WAQL 1Y1WK 3GTPK 5C44K 1I6HK 2WB1L 3H3VD 4QJVB 4LLGA 5C4XC 5IYCC 2E2JK 2E2IK 3S1MK 4A3GK 3GTQK 1WCMC 4YG2A 2R92C 1IW7A 4XSZA 3GTGK 3M3YC 1TWGC 4A3MC 1I50C 4OIOA 5M5WK 4BY1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 C;  3S2D K;  5M3M K;  3H0G C;  3S2H K;  5C3E K;  2JA5 K;  4AYB D;  4XLP A;  4C3I K;  5FLM C;  3S16 K;  4A3I K;  4A3D C;  2NVX C;  3S1N C;  4BBR C;  1I6V A;  3S1Q K;  3HKZ D;  4A3L K;  1SFO C;  1TWH K;  3GTM K;  4MQ9 A;  3H3V L;  3S1R C;  2R93 C;  1TWC C;  4Q5S A;  3S17 C;  5IYC K;  2VUM C;  4BBS K;  1WCM K;  4Q4Z A;  4A3E K;  3I4M C;  2R92 K;  2B63 K;  4C3J K;  3PO3 C;  4A3M K;  5C4J C;  3GTO C;  3RZO C;  3HOY C;  4A93 K;  3S14 K;  4LK1 A;  3GTK C;  1K83 K;  4BXX C;  1Y1V C;  4A3K C;  3M4O C;  1ZYR A;  1YNN A;  2YU9 K;  3I4N K;  4QIW D;  3HKZ L;  4OIP A;  3DXJ A;  1SMY A;  4Y7N C;  2A68 A;  1SFO K;  3HOW C;  1I3Q C;  3S1R K;  2BE5 A;  4BY7 C;  2R93 K;  4GZY A;  3S15 C;  2O5I A;  4A3C C;  2R7Z K;  1TWF C;  5IP7 C;  5M5X K;  3HOV C;  3HOZ K;  5M3F K;  2JA6 C;  4A93 C;  4MEX A;  4KN7 A;  1Y1V K;  2A69 A;  2NVY C;  5C4X K;  2PA8 D;  3HOX C;  3FKI C;  4QIW L;  4YFN A;  3M4O K;  2O5J A;  4JK1 A;  4Y7N K;  3HOW K;  3GTJ C;  1TWG K;  1TWA C;  3M3Y K;  1I50 K;  4X6A K;  4Y52 C;  3H0G K;  4AYB L;  3PO2 C;  2E2H C;  2NVQ C;  2A6E A;  5FLM K;  4A3D K;  1TWF K;  1Y1W C;  3GTP C;  2NVX K;  3S1N K;  4BBR K;  2WAQ D;  5IYD C;  2E2J C;  3S1M C;  5FJ8 K;  4A3G C;  2Y0S D;  1TWC K;  2PA8 L;  1HQM A;  4KMU A;  4C2M K;  4G7Z A;  2VUM K;  3GTG C;  3S17 K;  5IP9 C;  3GTQ C;  4BY1 C;  3HOU C;  3S2D C;  3I4M K;  3S2H C;  5C3E C;  3GTJ K;  3EQL A;  3CQZ C;  3WOD A;  2CW0 A;  5C4J K;  3GTO K;  3HOY K;  3RZO K;  3PO3 K;  3GTK K;  1XPP A;  5M5Y K;  2PMZ D;  1R9T C;  2PPB A;  3GTL C;  2E2H K;  4QJV A;  2NVQ K;  2JA8 C;  2NVT C;  4A3K K;  3S1Q C;  4LK0 A;  4BXX K;  4A3L C;  1TWH C;  3GTM C;  4MEY A;  4A3F C;  5IYD K;  2JA7 C;  5D4D A;  1I3Q K;  3K7A C;  2Y0S L;  4LJZ A;  4BBS C;  4BY7 K;  5IYB C;  4A3E C;  4NOI A;  2B63 C;  4A3J C;  3S15 K;  4A3B C;  5IP9 K;  3HOU K;  4A3C K;  1K83 C;  5IP7 K;  3RZD C;  1I6H C;  4X6A C;  4XLN A;  5C44 C;  3CQZ K;  3HOV K;  2WB1 D;  4XSX A;  5TMF A;  2PMZ L;  4YFX A;  2E2I C;  2YU9 C;  4OIQ A;  2JA6 K;  3I4N C;  1R9T K;  3GTL K;  2JA8 K;  2NVT K;  4C3H K;  2NVY K;  4KN4 A;  4YFK A;  3HOX K;  3FKI K;  4A3F K;  4G7O A;  5TMC A;  2JA7 K;  1BDF A;  3K7A K;  1TWA K;  2JA5 C;  4OIN A;  4OIR A;  1YNJ A;  5IYB K;  4A3I C;  2R7Z C;  3S16 C;  4Y52 K;  4G7H A;  4A3B K;  4A3J K;  3PO2 K;  4ZH4 A;  3HOZ C;  2A6H A;  3RZD K;  2WAQ L;  1Y1W K;  3GTP K;  5C44 K;  1I6H K;  2WB1 L;  3H3V D;  4QJV B;  4LLG A;  5C4X C;  5IYC C;  2E2J K;  2E2I K;  3S1M K;  4A3G K;  3GTQ K;  1WCM C;  4YG2 A;  2R92 C;  1IW7 A;  4XSZ A;  3GTG K;  3M3Y C;  1TWG C;  4A3M C;  1I50 C;  4OIO A;  5M5W K;  4BY1 K; 
#chains in the Genus database with same CATH topology
 1F93 A;  3S2D K;  3H0G C;  5C3E K;  3N3Y A;  4A3I K;  2NVX C;  4BBR C;  1I6V A;  1YCL A;  3H3V L;  2R93 C;  3AQP A;  1Y1W A;  4G0W A;  1WSV A;  2VUM C;  4KMA A;  4A3E K;  2R92 K;  2B63 K;  1EFW A;  3RZO C;  3GTG A;  3GTQ A;  4BXX C;  1BGW A;  3GEH A;  1YNN A;  2YU9 K;  3HKZ L;  1C0A A;  3GTL A;  3HOW C;  4GT9 A;  1F9N A;  1O25 A;  2R93 K;  2R7Z K;  1TWF C;  1JVI A;  2GSO A;  2B63 A;  1VJE A;  3HOZ K;  4KM8 A;  3GEI A;  2ZFZ A;  2A69 A;  1WOS A;  4C2M C;  2NVY C;  4YFN A;  4GFQ A;  2YU9 A;  3HOW K;  4LQY A;  4GTD A;  1WQG A;  2E2H C;  1DCP A;  2A6E A;  3LAJ A;  1TWF K;  3GTP C;  3S1N K;  2R7Z A;  3MML B;  4XCH A;  2Y0S D;  2PA8 L;  3OEP A;  4C2M K;  3S17 K;  1VGX A;  5IP9 C;  4GTA A;  5JVO A;  3WOD A;  4C3I C;  5CHP A;  1EH1 A;  1XPP A;  5M5Y K;  3ORE A;  2E2H K;  2JA8 C;  2NVT C;  4A3K K;  4LK0 A;  4MEY A;  4A3F C;  1TWF A;  3AH5 A;  4KMD A;  5D4D A;  1HI9 A;  4KAW X;  5IOT A;  3S15 K;  5IP9 K;  1IQ0 A;  1K83 C;  3T00 A;  4PAA A;  5IP7 K;  5C44 C;  3HOV K;  4XSX A;  5TMF A;  2JA8 K;  2NVT K;  3T02 A;  4YFK A;  2XCO A;  3FKI K;  4KDD A;  4A3F K;  4GTB A;  2ZUE A;  2ZUF A;  2P8T A;  1WSR A;  5IOQ A;  3CAG A;  1ISE A;  5C44 K;  3H3V D;  4KM9 A;  1WIH A;  2E2J K;  3S1M K;  1WCM C;  2GSU A;  4A93 C;  4OIO A;  4X6A C;  3FKI A;  2RH6 A;  5TJ3 A;  5HL8 A;  1ZXO A;  4XLP A;  3GTJ A;  4FZB A;  3FOF A;  4KAS A;  3HKZ D;  1SFO C;  3GTM K;  4BBS K;  1AB4 A;  1WCM K;  4Q4Z A;  3I4M C;  4C3J K;  1XZP A;  4P5A A;  3PO3 C;  4A93 K;  3NUH A;  2GSN A;  3HOY C;  3GTK C;  3GDZ A;  5IOS A;  4C45 A;  1SMY A;  3DXJ A;  1R9T A;  2EBB A;  2A68 A;  1SFO K;  1I3Q C;  4BY7 C;  1WQH A;  3GTM A;  2O5I A;  3AD8 C;  1J6W A;  1DCO A;  1V5V A;  3AD7 C;  5C4X K;  2PA8 D;  3HOX C;  4QIW L;  2E2I A;  4JK1 A;  1TWA C;  1I50 K;  1SFO A;  4WJ3 M;  3H0G K;  3GSI A;  3PO2 C;  2NVQ C;  1XZP B;  2NVX K;  4BBR K;  5FJ8 K;  3AQO A;  4P9S A;  3FOE A;  3N0B A;  4G7Z A;  2VUM K;  3HOU C;  1IS1 A;  3S2H C;  2R92 A;  1USO A;  3RZO K;  1I50 A;  2XCQ A;  2NVQ K;  4QJV A;  3H0G A;  3S1Q C;  4BXX K;  4A3L C;  1TWH C;  2XCR B;  4PAB A;  2JA7 C;  2NVX A;  4GTE A;  4A3B C;  4A3J C;  2R93 A;  1J6X A;  1O2F B;  3HOU K;  2VUM A;  1O27 A;  1UV7 A;  1JQW A;  1IBA A;  4YFX A;  1O28 A;  3I4N C;  1O29 A;  2NVY K;  3TFH A;  2JA7 K;  4G0U A;  2JA5 C;  4OIN A;  4OIR A;  3S16 C;  5CJ9 A;  4A3B K;  4A3J K;  1WOO A;  2D6F C;  3GTP K;  4QJV B;  5IYC C;  4YG2 A;  1G51 A;  1O2A A;  3M3Y C;  1TWG C;  2NVY A;  5M5W K;  2JA5 K;  4AYB D;  4C3I K;  5FLM C;  3S16 K;  4A3D C;  3SZY A;  1DD5 A;  2E2H A;  1VLO A;  3GTP A;  1YX2 A;  1TWC C;  1X31 C;  5IYC K;  3S0X A;  3JST A;  1IE0 A;  1EI6 A;  5C4J C;  3GTO C;  4O2D A;  1K83 K;  3A8K A;  2RGR A;  1Y1V C;  2JA5 A;  1XZQ A;  4QIW D;  4Y7N C;  3GIR A;  4GZY A;  4A3C C;  5M5X K;  1O24 A;  5M3F K;  3L4J A;  2JA6 C;  1PJ5 A;  4MEX A;  2GAG C;  1K83 A;  1Y1V K;  4C3H C;  1INN A;  2P5M A;  2O5J A;  3LPX A;  4Y7N K;  4KAR A;  4X6A K;  4Y52 C;  4GTF A;  4DDQ A;  3BP8 C;  4M1X A;  4AYB L;  1I50 C;  1Y1W C;  4GTL A;  2WAQ D;  3HXA A;  5IYD C;  4J3N A;  4A3G C;  4KC6 A;  3V4G A;  1XZQ B;  1WOP A;  1HQM A;  4KMU A;  3GTG C;  3T01 A;  3GTQ C;  4BY1 C;  3S2D C;  3I4M K;  1WCM A;  5C3E C;  3PO3 K;  2CW0 A;  3HOY K;  3GTK K;  3GTL C;  2Y3P A;  2FQT A;  5L46 A;  1B4B A;  5IYD K;  5EGH A;  1I3Q K;  1XXA A;  4LJZ A;  4BY7 K;  4A3E C;  1PJ7 A;  4NOI A;  2B63 C;  3L4K A;  1O26 A;  4LOW A;  2PMZ L;  1BS2 A;  2YU9 C;  3GTL K;  4KMH A;  3GTK A;  4AH6 A;  3HOX K;  3LAP A;  1TWA K;  1YNJ A;  1I3Q A;  2R7Z C;  3PO2 K;  4ZH4 A;  3HOZ C;  2FQO A;  2A6H A;  3AD9 C;  2WAQ L;  1RU0 A;  2WB1 L;  4LLG A;  4ILD A;  3G4A A;  1XXB A;  2CFA A;  4XSZ A;  4A3M C;  4FM9 A;  3S14 C;  3TTG A;  5M3M K;  3S2H K;  3IPJ A;  1KQ4 A;  1TWA A;  1F7U A;  3S1N C;  3S1Q K;  4A3L K;  1TWH K;  4KB2 A;  1ZVU A;  4MQ9 A;  3S1R C;  1EQR A;  4Q5S A;  3S17 C;  4G0V A;  4A3M K;  4GTC A;  3S14 K;  4LK1 A;  3GEE A;  4A3K C;  3M4O C;  1ZYR A;  3VA7 A;  3I4N K;  2GAH C;  4OIP A;  1VH2 A;  1PJ6 A;  1TWH A;  1USM A;  3S1R K;  2BE5 A;  1WOR A;  2CFA B;  3S15 C;  2JA7 A;  4BLA A;  1EK8 A;  5IP7 C;  1B4A A;  1BJT A;  3HOV C;  1ZQ1 C;  4WIL A;  3N0C A;  4KN7 A;  1J98 A;  3BP3 A;  3M4O K;  3A8J A;  3TFJ A;  3FKI C;  2W7V A;  4P5B A;  3BUE A;  1XXC A;  2V6U A;  4LR2 A;  3GTJ C;  1TWG K;  2PHC B;  3M3Y K;  4WJ4 A;  4RMF A;  1DCH A;  5IOR A;  3G4C A;  3Q3Q A;  5FLM K;  1WQF A;  4A3D K;  4BLB A;  2KWA A;  1L0W A;  2E2J C;  3S1M C;  1TWC K;  1GE9 A;  3OPF A;  3TFI A;  4KAT A;  1IL2 A;  3GTJ K;  3EQL A;  3CQZ C;  5C4J K;  3GTO K;  2V6T A;  1TWG A;  2PMZ D;  1R9T C;  2PPB A;  2V6S A;  3SZZ A;  3GTM C;  4BKW A;  3K7A C;  2Y0S L;  4BBS C;  5IYB C;  4C3J C;  1F7V A;  1TWC A;  1ZBS A;  3QX3 A;  4A3C K;  3RZD C;  1I6H C;  4XLN A;  3CQZ K;  2WB1 D;  4KB4 A;  5JFE A;  2E2I C;  4OIQ A;  2JA6 K;  3ERE D;  3GTO A;  5E68 A;  1R9T K;  4C3H K;  4KN4 A;  1Y1V A;  3A8I A;  4G7O A;  1VRQ C;  5TMC A;  1JOE A;  1BDF A;  3K7A K;  2JH3 A;  5IYB K;  4A3I C;  3ADA C;  4Y52 K;  3FHZ A;  4G7H A;  3RZD K;  1Y1W K;  1I6H K;  5C4X C;  3CQZ A;  2E2I K;  1J6V A;  4A3G K;  2JA6 A;  1O2B A;  2R92 C;  1IW7 A;  3GTG K;  5EGE A;  3GTQ K;  4BY1 K; 
#chains in the Genus database with same CATH homology
 3S14 C;  3S2D K;  5M3M K;  3H0G C;  3S2H K;  5C3E K;  2JA5 K;  4AYB D;  4XLP A;  4C3I K;  5FLM C;  3S16 K;  4A3I K;  4A3D C;  2NVX C;  3S1N C;  4BBR C;  1I6V A;  3S1Q K;  3HKZ D;  4A3L K;  1SFO C;  1TWH K;  3GTM K;  4MQ9 A;  3H3V L;  3S1R C;  2R93 C;  1TWC C;  4Q5S A;  3S17 C;  5IYC K;  2VUM C;  4BBS K;  1WCM K;  4Q4Z A;  4A3E K;  3I4M C;  2R92 K;  2B63 K;  4C3J K;  3PO3 C;  4A3M K;  5C4J C;  3GTO C;  3RZO C;  3HOY C;  4A93 K;  3S14 K;  4LK1 A;  3GTK C;  1K83 K;  4BXX C;  1Y1V C;  4A3K C;  3M4O C;  1ZYR A;  1YNN A;  2YU9 K;  3I4N K;  4QIW D;  3HKZ L;  4OIP A;  3DXJ A;  1SMY A;  4Y7N C;  2A68 A;  1SFO K;  3HOW C;  1I3Q C;  3S1R K;  2BE5 A;  4BY7 C;  2R93 K;  4GZY A;  3S15 C;  2O5I A;  4A3C C;  2R7Z K;  1TWF C;  5IP7 C;  5M5X K;  3HOV C;  3HOZ K;  5M3F K;  2JA6 C;  4A93 C;  4MEX A;  4KN7 A;  1Y1V K;  2A69 A;  2NVY C;  5C4X K;  2PA8 D;  3HOX C;  3FKI C;  4QIW L;  4YFN A;  3M4O K;  2O5J A;  4JK1 A;  4Y7N K;  3HOW K;  3GTJ C;  1TWG K;  1TWA C;  3M3Y K;  1I50 K;  4X6A K;  4Y52 C;  3H0G K;  4AYB L;  3PO2 C;  2E2H C;  2NVQ C;  2A6E A;  5FLM K;  4A3D K;  1TWF K;  1Y1W C;  3GTP C;  2NVX K;  3S1N K;  4BBR K;  2WAQ D;  5IYD C;  2E2J C;  3S1M C;  5FJ8 K;  4A3G C;  2Y0S D;  1TWC K;  2PA8 L;  1HQM A;  4KMU A;  4C2M K;  4G7Z A;  2VUM K;  3GTG C;  3S17 K;  5IP9 C;  3GTQ C;  4BY1 C;  3HOU C;  3S2D C;  3I4M K;  3S2H C;  5C3E C;  3GTJ K;  3EQL A;  3CQZ C;  3WOD A;  2CW0 A;  5C4J K;  3GTO K;  3HOY K;  3RZO K;  3PO3 K;  3GTK K;  1XPP A;  5M5Y K;  2PMZ D;  1R9T C;  2PPB A;  3GTL C;  2E2H K;  4QJV A;  2NVQ K;  2JA8 C;  2NVT C;  4A3K K;  3S1Q C;  4LK0 A;  4BXX K;  4A3L C;  1TWH C;  3GTM C;  4MEY A;  4A3F C;  5IYD K;  2JA7 C;  5D4D A;  1I3Q K;  3K7A C;  2Y0S L;  4LJZ A;  4BBS C;  4BY7 K;  5IYB C;  4A3E C;  4NOI A;  2B63 C;  4A3J C;  3S15 K;  4A3B C;  5IP9 K;  3HOU K;  4A3C K;  1K83 C;  5IP7 K;  3RZD C;  1I6H C;  4X6A C;  4XLN A;  5C44 C;  3CQZ K;  3HOV K;  2WB1 D;  4XSX A;  5TMF A;  2PMZ L;  4YFX A;  2E2I C;  2YU9 C;  4OIQ A;  2JA6 K;  3I4N C;  1R9T K;  3GTL K;  2JA8 K;  2NVT K;  4C3H K;  2NVY K;  4KN4 A;  4YFK A;  3HOX K;  3FKI K;  4A3F K;  4G7O A;  5TMC A;  2JA7 K;  1BDF A;  3K7A K;  1TWA K;  2JA5 C;  4OIN A;  4OIR A;  1YNJ A;  5IYB K;  4A3I C;  2R7Z C;  3S16 C;  4Y52 K;  4G7H A;  4A3B K;  4A3J K;  3PO2 K;  4ZH4 A;  3HOZ C;  2A6H A;  3RZD K;  2WAQ L;  1Y1W K;  3GTP K;  5C44 K;  1I6H K;  2WB1 L;  3H3V D;  4QJV B;  4LLG A;  5C4X C;  5IYC C;  2E2J K;  2E2I K;  3S1M K;  4A3G K;  3GTQ K;  1WCM C;  4YG2 A;  2R92 C;  1IW7 A;  4XSZ A;  3GTG K;  3M3Y C;  1TWG C;  4A3M C;  1I50 C;  4OIO A;  5M5W K;  4BY1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...