2E2HK

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 22
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2e2hK00
2VUMK 4A3GK 2E2IK 3M4OK 2PA8D 1I6HC 2JA8K 3HOUC 5FJ8K 5IYCC 3HOZC 1YNJA 4LK1A 4YG2A 4A3IK 5C4XK 4A3FK 4A3FC 1R9TC 3S14K 3GTGC 3S14C 4A3BC 5C4XC 2YU9K 2E2JK 2PA8L 2E2JC 2B63C 2B63K 4OIPA 4QIWD 4A93C 2VUMC 3H0GK 3RZOK 4A3GC 4LLGA 3S1NK 4BBSK 2JA7K 2O5JA 2Y0SD 4QJVB 5C44K 1YNNA 5TMCA 1K83K 3GTKC 4A3DC 2YU9C 1Y1VC 4A3JK 4KN4A 5IP7C 5TMFA 1I50C 2CW0A 5D4DA 3HOVC 3GTOK 4LK0A 2NVQC 4QJVA 3HKZL 4YFNA 3M3YC 4A3BK 4A3CC 3S2HC 3PO2K 3RZDK 2R93K 1I3QK 3S2DK 4JK1A 3S1RC 3GTQC 4BBSC 4Q5SA 2NVTC 5M5XK 4YFKA 4A3KK 4XLNA 4YFXA 2JA8C 2R7ZC 3HOUK 4KMUA 3I4NK 3CQZK 2NVYC 4A3EK 4MQ9A 4C3JK 3GTGK 3RZOC 2A6EA 4NOIA 3S16K 1ZYRA 3S16C 3S17C 4OINA 3S2DC 1SMYA 4QIWL 2PPBA 2O5IA 2A69A 3S1MK 3S1MC 4OIOA 4AYBD 2E2HK 4XLPA 5IP7K 2WAQL 3GTKK 4A3DK 3GTJC 3PO3C 3PO3K 5M5WK 1TWHK 4C3IK 2A68A 1HQMA 4Q4ZA 4G7HA 2R92C 1TWFK 5M5YK 2JA5K 3S2HK 3I4NC 3HKZD 4BBRK 4Y7NK 4A3IC 3I4MK 4BXXC 3S1NC 5FLMK 5IYDK 3H3VL 5M3MK 5M3FK 3HOXK 1I50K 2JA6K 3GTPC 3HOWC 4A93K 4A3JC 4XSZA 1TWHC 1WCMK 5C4JK 3H3VD 5IYCK 2Y0SL 3HOVK 4BY1C 3HOYK 2BE5A 4A3CK 3S1QK 3S1QC 4OIQA 4C2MK 4Y52C 2WAQD 4A3KC 1WCMC 5C4JC 1Y1WK 3S1RK 4X6AK 1TWAK 4MEYA 1TWCC 1R9TK 2NVXC 3K7AC 3CQZC 3PO2C 4BY7C 4C3HK 4BY7K 2R93C 2E2HC 4A3LK 4MEXA 3S17K 4G7ZA 1TWFC 5IP9C 5IYDC 2JA5C 1I6VA 4OIRA 2NVQK 2A6HA 1Y1WC 2E2IC 3DXJA 3M4OC 1K83C 1I6HK 4A3MC 4A3MK 1TWCK 2NVXK 2R92K 5C3EC 3HOZK 4GZYA 5IYBK 5IYBC 3HOYC 4Y52K 1BDFA 5FLMC 3GTJK 4A3LC 1TWGK 1TWGC 3M3YK 3FKIK 2PMZD 3K7AK 4BXXK 4AYBL 3S15K 1Y1VK 2PMZL 3EQLA 4ZH4A 4BY1K 1SFOK 1XPPA 2NVYK 1SFOC 3RZDC 5C44C 5IP9K 3GTOC 2JA6C 3GTPK 3HOWK 2WB1D 1IW7A 1TWAC 4XSXA 2NVTK 3H0GC 4KN7A 5C3EK 2R7ZK 4BBRC 4Y7NC 3I4MC 3S15C 1I3QC 4X6AC 4G7OA 2JA7C 3WODA 2WB1L 3GTLK 3GTMC 4A3EC 3GTLC 3GTQK 3GTMK 3FKIC 4LJZA 3HOXC
chains in the Genus database with same CATH superfamily
3OEPA 3HOUC 5FJ8K 1O26A 4YG2A 4A3IK 5C4XK 1PJ7A 2GSOA 4A3FC 4GFQA 2E2JK 2PA8L 1R9TA 3TFIA 4C2MC 3BP3A 4A3GC 4C3JC 3RZOK 3S1NK 2O5JA 1ZQ1C 2Y0SD 1WOPA 3FKIA 1WOOA 1Y1VC 2E2HA 1I50C 5D4DA 3HOVC 1IBAA 3GTOK 4QJVA 1TWCA 2NVXA 1IE0A 1PJ5A 1WOSA 4KMDA 2R93K 1EH1A 4DDQA 3S2DK 2NVTC 3T00A 5M5XK 3TTGA 2GAGC 4XLNA 2YU9A 2KWAA 1JVIA 1XZPB 4C3JK 2RGRA 4PAAA 3RZOC 3S16C 4OINA 5TJ3A 3S1MK 2A69A 3A8KA 4OIOA 2GSNA 4AYBD 2E2HK 1IS1A 1O28A 5L46A 1USOA 4RMFA 3PO3C 1VGXA 5HL8A 3GSIA 2A68A 1HQMA 3HXAA 2XCOA 1TWFK 4BXXC 1VRQC 4BBRK 4Y7NK 1Y1VA 3I4MK 3S1NC 5M3MK 3HOXK 1I50K 4A93K 2GAHC 4XSZA 4C3IC 5C4JK 3HOYK 2Y3PA 3HOVK 4BKWA 1C0AA 2BE5A 2D6FC 3S1QK 1BGWA 3GTMA 5CJ9A 4OIQA 1WQHA 4C2MK 4Y52C 1WCMC 4KC6A 1TWAK 1O2FB 1R9TK 4GTDA 3GTPA 1YX2A 1Y1WA 4GTEA 4A3LK 4MEXA 1RU0A 1TWFC 3LAPA 1I6VA 4OIRA 1Y1WC 1DD5A 1K83C 3FOFA 3HOZK 3GTJA 2CFAB 5IYBC 1XZPA 1BDFA 1DCOA 1I50A 4GTFA 1DCHA 3K7AK 3S15K 2PMZL 1SFOK 5C44C 5IP9K 4ILDA 1WSVA 1TWAC 3Q3QA 3H0GC 4KB2A 4O2DA 1I3QC 3GTMC 4A3EC 4GTBA 5IOTA 5JVOA 4LJZA 1YCLA 2VUMK 3ADAC 1O24A 3HOZC 4BXXK 1R9TC 3T01A 1O29A 4A3FK 4A3BC 5C4XC 2B63K 2E2JC 1BJTA 4A93C 1ZVUA 3JSTA 4BBSK 5C44K 5TMCA 1K83K 4A3DC 2YU9C 4C45A 4A3JK 4KN4A 3OPFA 3HKZL 4KMHA 1VLOA 3LPXA 1WQGA 3H0GA 4JK1A 3S1RC 3GTQC 4YFKA 1BS2A 3HOUK 4KMUA 1F9NA 2NVYC 4A3EK 1HI9A 1XXBA 4KM8A 4QIWL 3S1MC 1DCPA 3S0XA 1XXAA 3GTGA 4XLPA 2FQTA 1B4AA 2JA6A 3PO3K 3AQPA 5M5WK 5M5YK 2JA5K 1XZQA 1F7VA 3GTPC 3HOWC 2V6UA 4A3JC 1JQWA 1TWHC 2XCQA 3GEIA 4BY1C 3AD9C 4M1XA 2E2IA 1K83A 3S1QC 2P8TA 4P9SA 3S1RK 1TWCC 2NVXC 1IQ0A 4XCHA 3PO2C 4C3HC 3AD7C 2E2HC 3IPJA 2JA5C 3M4OC 3DXJA 4A3MC 5C3EC 1ZBSA 4Y52K 1TWGK 3M3YK 3FKIK 2PMZD 3EQLA 4KATA 1SFOC 2NVYK 1TWHA 3GTPK 3HOWK 2WB1D 3CAGA 4LOWA 2R7ZK 4G7OA 2JA7C 3WODA 3GTLK 3GTMK 4KDDA 4GTLA 4A3GK 1F93A 3M4OK 3GTLA 2JA8K 2GSUA 3L4KA 2R7ZA 1YNJA 4LK1A 1ZXOA 3S14K 2JH3A 3BUEA 3GTGC 2B63C 1ISEA 1TWAA 3H0GK 4GTCA 3G4AA 4LLGA 1INNA 1J6XA 4BLBA 3GTKC 1TWGA 5IP7C 3OREA 4GT9A 4LK0A 2R92A 4A3BK 3M3YC 3L4JA 1JOEA 4A3CC 2JA7A 3PO2K 1I3QK 5EGHA 1TWFA 3N3YA 4BBSC 4Q5SA 5IOQA 4YFXA 2R7ZC 1O27A 3VA7A 3I4NK 3CQZK 2A6EA 4NOIA 3S2DC 3S17C 2VUMA 4BLAA 3T02A 2PPBA 1G51A 4WJ4A 3N0BA 1EI6A 2PHCB 3CQZA 5IP7K 3TFJA 4A3DK 2V6TA 4C3IK 2W7VA 4G7HA 4G0UA 3TFHA 3HOYC 2R92C 1WSRA 4FZBA 1I3QA 4KMAA 5FLMK 1O2AA 2JA6K 2FQOA 4KASA 1WCMK 3H3VD 3GTOA 2Y0SL 2ZFZA 3AD8C 4A3CK 2ZUEA 3GTQA 4G0WA 5C4JC 3GEEA 1Y1WK 3AH5A 4X6AK 4MEYA 4AH6A 3GIRA 3LAJA 3CQZC 4BY7C 3A8IA 4C3HK 3FOEA 4PABA 3FHZA 3S17K 2A6HA 2E2IC 1I6HK 4A3MK 1KQ4A 3ERED 1WCMA 4A3LC 1TWGC 1J6VA 3GDZA 4WJ3M 2RH6A 5E68A 4AYBL 1Y1VK 4BY1K 2NVYA 1XPPA 3RZDC 3GTOC 3SZZA 2JA6C 2B63A 1GE9A 4KN7A 5C3EK 1B4BA 3S15C 5CHPA 4KARA 2XCRB 2WB1L 4KB4A 3GTLC 4P5BA 3GEHA 3FKIC 2EBBA 1IW7A 2E2IK 1I6HC 2PA8D 4KM9A 1J6WA 5JFEA 5IYCC 4G0VA 1WQFA 1O2BA 3S14C 2YU9K 4LR2A 3AQOA 4J3NA 2CFAA 4OIPA 4QIWD 2VUMC 1SFOA 3A8JA 1EFWA 1O25A 2JA7K 5EGEA 4QJVB 2P5MA 1YNNA 4LQYA 1EK8A 5TMFA 2CW0A 3V4GA 2NVQC 4YFNA 1USMA 3S2HC 3RZDK 4WILA 2JA5A 4A3KK 2JA8C 1V5VA 3GTKA 1XXCA 1EQRA 3SZYA 4MQ9A 3GTGK 1L0WA 3S16K 1VH2A 1ZYRA 3N0CA 3G4CA 1SMYA 1UV7A 1PJ6A 2O5IA 2V6SA 5IORA 1WORA 2WAQL 3GTKK 3GTJC 1TWHK 4Q4ZA 5IYDK 3S2HK 3I4NC 3HKZD 1J98A 4A3IC 1X31C 3H3VL 5M3FK 2ZUFA 5IYCK 1F7UA 3QX3A 2WAQD 4A3KC 1IL2A 3K7AC 2R93C 4BY7K 4P5AA 4G7ZA 5IYDC 5IP9C 2R93A 2NVQK 3MMLB 1TWCK 3NUHA 2NVXK 2R92K 4GZYA 1AB4A 5IYBK 5FLMC 3GTJK 3BP8C 4FM9A 4ZH4A 4XSXA 2NVTK 5IOSA 4BBRC 4Y7NC 3I4MC 4GTAA 1XZQB 4X6AC 1WIHA 4KAWX 1VJEA 3GTQK 3HOXC
chains in the Genus database with same CATH topology
2VUMK 4A3GK 2E2IK 3M4OK 2PA8D 1I6HC 2JA8K 3HOUC 5FJ8K 5IYCC 3HOZC 1YNJA 4LK1A 4YG2A 4A3IK 5C4XK 4A3FK 4A3FC 1R9TC 3S14K 3GTGC 3S14C 4A3BC 5C4XC 2YU9K 2E2JK 2PA8L 2E2JC 2B63C 2B63K 4OIPA 4QIWD 4A93C 2VUMC 3H0GK 3RZOK 4A3GC 4LLGA 3S1NK 4BBSK 2JA7K 2O5JA 2Y0SD 4QJVB 5C44K 1YNNA 5TMCA 1K83K 3GTKC 4A3DC 2YU9C 1Y1VC 4A3JK 4KN4A 5IP7C 5TMFA 1I50C 2CW0A 5D4DA 3HOVC 3GTOK 4LK0A 2NVQC 4QJVA 3HKZL 4YFNA 3M3YC 4A3BK 4A3CC 3S2HC 3PO2K 3RZDK 2R93K 1I3QK 3S2DK 4JK1A 3S1RC 3GTQC 4BBSC 4Q5SA 2NVTC 5M5XK 4YFKA 4A3KK 4XLNA 4YFXA 2JA8C 2R7ZC 3HOUK 4KMUA 3I4NK 3CQZK 2NVYC 4A3EK 4MQ9A 4C3JK 3GTGK 3RZOC 2A6EA 4NOIA 3S16K 1ZYRA 3S16C 3S17C 4OINA 3S2DC 1SMYA 4QIWL 2PPBA 2O5IA 2A69A 3S1MK 3S1MC 4OIOA 4AYBD 2E2HK 4XLPA 5IP7K 2WAQL 3GTKK 4A3DK 3GTJC 3PO3C 3PO3K 5M5WK 1TWHK 4C3IK 2A68A 1HQMA 4Q4ZA 4G7HA 2R92C 1TWFK 5M5YK 2JA5K 3S2HK 3I4NC 3HKZD 4BBRK 4Y7NK 4A3IC 3I4MK 4BXXC 3S1NC 5FLMK 5IYDK 3H3VL 5M3MK 5M3FK 3HOXK 1I50K 2JA6K 3GTPC 3HOWC 4A93K 4A3JC 4XSZA 1TWHC 1WCMK 5C4JK 3H3VD 5IYCK 2Y0SL 3HOVK 4BY1C 3HOYK 2BE5A 4A3CK 3S1QK 3S1QC 4OIQA 4C2MK 4Y52C 2WAQD 4A3KC 1WCMC 5C4JC 1Y1WK 3S1RK 4X6AK 1TWAK 4MEYA 1TWCC 1R9TK 2NVXC 3K7AC 3CQZC 3PO2C 4BY7C 4C3HK 4BY7K 2R93C 2E2HC 4A3LK 4MEXA 3S17K 4G7ZA 1TWFC 5IP9C 5IYDC 2JA5C 1I6VA 4OIRA 2NVQK 2A6HA 1Y1WC 2E2IC 3DXJA 3M4OC 1K83C 1I6HK 4A3MC 4A3MK 1TWCK 2NVXK 2R92K 5C3EC 3HOZK 4GZYA 5IYBK 5IYBC 3HOYC 4Y52K 1BDFA 5FLMC 3GTJK 4A3LC 1TWGK 1TWGC 3M3YK 3FKIK 2PMZD 3K7AK 4BXXK 4AYBL 3S15K 1Y1VK 2PMZL 3EQLA 4ZH4A 4BY1K 1SFOK 1XPPA 2NVYK 1SFOC 3RZDC 5C44C 5IP9K 3GTOC 2JA6C 3GTPK 3HOWK 2WB1D 1IW7A 1TWAC 4XSXA 2NVTK 3H0GC 4KN7A 5C3EK 2R7ZK 4BBRC 4Y7NC 3I4MC 3S15C 1I3QC 4X6AC 4G7OA 2JA7C 3WODA 2WB1L 3GTLK 3GTMC 4A3EC 3GTLC 3GTQK 3GTMK 3FKIC 4LJZA 3HOXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM K;  4A3G K;  2E2I K;  3M4O K;  2PA8 D;  1I6H C;  2JA8 K;  3HOU C;  5FJ8 K;  5IYC C;  3HOZ C;  1YNJ A;  4LK1 A;  4YG2 A;  4A3I K;  5C4X K;  4A3F K;  4A3F C;  1R9T C;  3S14 K;  3GTG C;  3S14 C;  4A3B C;  5C4X C;  2YU9 K;  2E2J K;  2PA8 L;  2E2J C;  2B63 C;  2B63 K;  4OIP A;  4QIW D;  4A93 C;  2VUM C;  3H0G K;  3RZO K;  4A3G C;  4LLG A;  3S1N K;  4BBS K;  2JA7 K;  2O5J A;  2Y0S D;  4QJV B;  5C44 K;  1YNN A;  5TMC A;  1K83 K;  3GTK C;  4A3D C;  2YU9 C;  1Y1V C;  4A3J K;  4KN4 A;  5IP7 C;  5TMF A;  1I50 C;  2CW0 A;  5D4D A;  3HOV C;  3GTO K;  4LK0 A;  2NVQ C;  4QJV A;  3HKZ L;  4YFN A;  3M3Y C;  4A3B K;  4A3C C;  3S2H C;  3PO2 K;  3RZD K;  2R93 K;  1I3Q K;  3S2D K;  4JK1 A;  3S1R C;  3GTQ C;  4BBS C;  4Q5S A;  2NVT C;  5M5X K;  4YFK A;  4A3K K;  4XLN A;  4YFX A;  2JA8 C;  2R7Z C;  3HOU K;  4KMU A;  3I4N K;  3CQZ K;  2NVY C;  4A3E K;  4MQ9 A;  4C3J K;  3GTG K;  3RZO C;  2A6E A;  4NOI A;  3S16 K;  1ZYR A;  3S16 C;  3S17 C;  4OIN A;  3S2D C;  1SMY A;  4QIW L;  2PPB A;  2O5I A;  2A69 A;  3S1M K;  3S1M C;  4OIO A;  4AYB D;  2E2H K;  4XLP A;  5IP7 K;  2WAQ L;  3GTK K;  4A3D K;  3GTJ C;  3PO3 C;  3PO3 K;  5M5W K;  1TWH K;  4C3I K;  2A68 A;  1HQM A;  4Q4Z A;  4G7H A;  2R92 C;  1TWF K;  5M5Y K;  2JA5 K;  3S2H K;  3I4N C;  3HKZ D;  4BBR K;  4Y7N K;  4A3I C;  3I4M K;  4BXX C;  3S1N C;  5FLM K;  5IYD K;  3H3V L;  5M3M K;  5M3F K;  3HOX K;  1I50 K;  2JA6 K;  3GTP C;  3HOW C;  4A93 K;  4A3J C;  4XSZ A;  1TWH C;  1WCM K;  5C4J K;  3H3V D;  5IYC K;  2Y0S L;  3HOV K;  4BY1 C;  3HOY K;  2BE5 A;  4A3C K;  3S1Q K;  3S1Q C;  4OIQ A;  4C2M K;  4Y52 C;  2WAQ D;  4A3K C;  1WCM C;  5C4J C;  1Y1W K;  3S1R K;  4X6A K;  1TWA K;  4MEY A;  1TWC C;  1R9T K;  2NVX C;  3K7A C;  3CQZ C;  3PO2 C;  4BY7 C;  4C3H K;  4BY7 K;  2R93 C;  2E2H C;  4A3L K;  4MEX A;  3S17 K;  4G7Z A;  1TWF C;  5IP9 C;  5IYD C;  2JA5 C;  1I6V A;  4OIR A;  2NVQ K;  2A6H A;  1Y1W C;  2E2I C;  3DXJ A;  3M4O C;  1K83 C;  1I6H K;  4A3M C;  4A3M K;  1TWC K;  2NVX K;  2R92 K;  5C3E C;  3HOZ K;  4GZY A;  5IYB K;  5IYB C;  3HOY C;  4Y52 K;  1BDF A;  5FLM C;  3GTJ K;  4A3L C;  1TWG K;  1TWG C;  3M3Y K;  3FKI K;  2PMZ D;  3K7A K;  4BXX K;  4AYB L;  3S15 K;  1Y1V K;  2PMZ L;  3EQL A;  4ZH4 A;  4BY1 K;  1SFO K;  1XPP A;  2NVY K;  1SFO C;  3RZD C;  5C44 C;  5IP9 K;  3GTO C;  2JA6 C;  3GTP K;  3HOW K;  2WB1 D;  1IW7 A;  1TWA C;  4XSX A;  2NVT K;  3H0G C;  4KN7 A;  5C3E K;  2R7Z K;  4BBR C;  4Y7N C;  3I4M C;  3S15 C;  1I3Q C;  4X6A C;  4G7O A;  2JA7 C;  3WOD A;  2WB1 L;  3GTL K;  3GTM C;  4A3E C;  3GTL C;  3GTQ K;  3GTM K;  3FKI C;  4LJZ A;  3HOX C; 
#chains in the Genus database with same CATH topology
 3OEP A;  3HOU C;  5FJ8 K;  1O26 A;  4YG2 A;  4A3I K;  5C4X K;  1PJ7 A;  2GSO A;  4A3F C;  4GFQ A;  2E2J K;  2PA8 L;  1R9T A;  3TFI A;  4C2M C;  3BP3 A;  4A3G C;  4C3J C;  3RZO K;  3S1N K;  2O5J A;  1ZQ1 C;  2Y0S D;  1WOP A;  3FKI A;  1WOO A;  1Y1V C;  2E2H A;  1I50 C;  5D4D A;  3HOV C;  1IBA A;  3GTO K;  4QJV A;  1TWC A;  2NVX A;  1IE0 A;  1PJ5 A;  1WOS A;  4KMD A;  2R93 K;  1EH1 A;  4DDQ A;  3S2D K;  2NVT C;  3T00 A;  5M5X K;  3TTG A;  2GAG C;  4XLN A;  2YU9 A;  2KWA A;  1JVI A;  1XZP B;  4C3J K;  2RGR A;  4PAA A;  3RZO C;  3S16 C;  4OIN A;  5TJ3 A;  3S1M K;  2A69 A;  3A8K A;  4OIO A;  2GSN A;  4AYB D;  2E2H K;  1IS1 A;  1O28 A;  5L46 A;  1USO A;  4RMF A;  3PO3 C;  1VGX A;  5HL8 A;  3GSI A;  2A68 A;  1HQM A;  3HXA A;  2XCO A;  1TWF K;  4BXX C;  1VRQ C;  4BBR K;  4Y7N K;  1Y1V A;  3I4M K;  3S1N C;  5M3M K;  3HOX K;  1I50 K;  4A93 K;  2GAH C;  4XSZ A;  4C3I C;  5C4J K;  3HOY K;  2Y3P A;  3HOV K;  4BKW A;  1C0A A;  2BE5 A;  2D6F C;  3S1Q K;  1BGW A;  3GTM A;  5CJ9 A;  4OIQ A;  1WQH A;  4C2M K;  4Y52 C;  1WCM C;  4KC6 A;  1TWA K;  1O2F B;  1R9T K;  4GTD A;  3GTP A;  1YX2 A;  1Y1W A;  4GTE A;  4A3L K;  4MEX A;  1RU0 A;  1TWF C;  3LAP A;  1I6V A;  4OIR A;  1Y1W C;  1DD5 A;  1K83 C;  3FOF A;  3HOZ K;  3GTJ A;  2CFA B;  5IYB C;  1XZP A;  1BDF A;  1DCO A;  1I50 A;  4GTF A;  1DCH A;  3K7A K;  3S15 K;  2PMZ L;  1SFO K;  5C44 C;  5IP9 K;  4ILD A;  1WSV A;  1TWA C;  3Q3Q A;  3H0G C;  4KB2 A;  4O2D A;  1I3Q C;  3GTM C;  4A3E C;  4GTB A;  5IOT A;  5JVO A;  4LJZ A;  1YCL A;  2VUM K;  3ADA C;  1O24 A;  3HOZ C;  4BXX K;  1R9T C;  3T01 A;  1O29 A;  4A3F K;  4A3B C;  5C4X C;  2B63 K;  2E2J C;  1BJT A;  4A93 C;  1ZVU A;  3JST A;  4BBS K;  5C44 K;  5TMC A;  1K83 K;  4A3D C;  2YU9 C;  4C45 A;  4A3J K;  4KN4 A;  3OPF A;  3HKZ L;  4KMH A;  1VLO A;  3LPX A;  1WQG A;  3H0G A;  4JK1 A;  3S1R C;  3GTQ C;  4YFK A;  1BS2 A;  3HOU K;  4KMU A;  1F9N A;  2NVY C;  4A3E K;  1HI9 A;  1XXB A;  4KM8 A;  4QIW L;  3S1M C;  1DCP A;  3S0X A;  1XXA A;  3GTG A;  4XLP A;  2FQT A;  1B4A A;  2JA6 A;  3PO3 K;  3AQP A;  5M5W K;  5M5Y K;  2JA5 K;  1XZQ A;  1F7V A;  3GTP C;  3HOW C;  2V6U A;  4A3J C;  1JQW A;  1TWH C;  2XCQ A;  3GEI A;  4BY1 C;  3AD9 C;  4M1X A;  2E2I A;  1K83 A;  3S1Q C;  2P8T A;  4P9S A;  3S1R K;  1TWC C;  2NVX C;  1IQ0 A;  4XCH A;  3PO2 C;  4C3H C;  3AD7 C;  2E2H C;  3IPJ A;  2JA5 C;  3M4O C;  3DXJ A;  4A3M C;  5C3E C;  1ZBS A;  4Y52 K;  1TWG K;  3M3Y K;  3FKI K;  2PMZ D;  3EQL A;  4KAT A;  1SFO C;  2NVY K;  1TWH A;  3GTP K;  3HOW K;  2WB1 D;  3CAG A;  4LOW A;  2R7Z K;  4G7O A;  2JA7 C;  3WOD A;  3GTL K;  3GTM K;  4KDD A;  4GTL A;  4A3G K;  1F93 A;  3M4O K;  3GTL A;  2JA8 K;  2GSU A;  3L4K A;  2R7Z A;  1YNJ A;  4LK1 A;  1ZXO A;  3S14 K;  2JH3 A;  3BUE A;  3GTG C;  2B63 C;  1ISE A;  1TWA A;  3H0G K;  4GTC A;  3G4A A;  4LLG A;  1INN A;  1J6X A;  4BLB A;  3GTK C;  1TWG A;  5IP7 C;  3ORE A;  4GT9 A;  4LK0 A;  2R92 A;  4A3B K;  3M3Y C;  3L4J A;  1JOE A;  4A3C C;  2JA7 A;  3PO2 K;  1I3Q K;  5EGH A;  1TWF A;  3N3Y A;  4BBS C;  4Q5S A;  5IOQ A;  4YFX A;  2R7Z C;  1O27 A;  3VA7 A;  3I4N K;  3CQZ K;  2A6E A;  4NOI A;  3S2D C;  3S17 C;  2VUM A;  4BLA A;  3T02 A;  2PPB A;  1G51 A;  4WJ4 A;  3N0B A;  1EI6 A;  2PHC B;  3CQZ A;  5IP7 K;  3TFJ A;  4A3D K;  2V6T A;  4C3I K;  2W7V A;  4G7H A;  4G0U A;  3TFH A;  3HOY C;  2R92 C;  1WSR A;  4FZB A;  1I3Q A;  4KMA A;  5FLM K;  1O2A A;  2JA6 K;  2FQO A;  4KAS A;  1WCM K;  3H3V D;  3GTO A;  2Y0S L;  2ZFZ A;  3AD8 C;  4A3C K;  2ZUE A;  3GTQ A;  4G0W A;  5C4J C;  3GEE A;  1Y1W K;  3AH5 A;  4X6A K;  4MEY A;  4AH6 A;  3GIR A;  3LAJ A;  3CQZ C;  4BY7 C;  3A8I A;  4C3H K;  3FOE A;  4PAB A;  3FHZ A;  3S17 K;  2A6H A;  2E2I C;  1I6H K;  4A3M K;  1KQ4 A;  3ERE D;  1WCM A;  4A3L C;  1TWG C;  1J6V A;  3GDZ A;  4WJ3 M;  2RH6 A;  5E68 A;  4AYB L;  1Y1V K;  4BY1 K;  2NVY A;  1XPP A;  3RZD C;  3GTO C;  3SZZ A;  2JA6 C;  2B63 A;  1GE9 A;  4KN7 A;  5C3E K;  1B4B A;  3S15 C;  5CHP A;  4KAR A;  2XCR B;  2WB1 L;  4KB4 A;  3GTL C;  4P5B A;  3GEH A;  3FKI C;  2EBB A;  1IW7 A;  2E2I K;  1I6H C;  2PA8 D;  4KM9 A;  1J6W A;  5JFE A;  5IYC C;  4G0V A;  1WQF A;  1O2B A;  3S14 C;  2YU9 K;  4LR2 A;  3AQO A;  4J3N A;  2CFA A;  4OIP A;  4QIW D;  2VUM C;  1SFO A;  3A8J A;  1EFW A;  1O25 A;  2JA7 K;  5EGE A;  4QJV B;  2P5M A;  1YNN A;  4LQY A;  1EK8 A;  5TMF A;  2CW0 A;  3V4G A;  2NVQ C;  4YFN A;  1USM A;  3S2H C;  3RZD K;  4WIL A;  2JA5 A;  4A3K K;  2JA8 C;  1V5V A;  3GTK A;  1XXC A;  1EQR A;  3SZY A;  4MQ9 A;  3GTG K;  1L0W A;  3S16 K;  1VH2 A;  1ZYR A;  3N0C A;  3G4C A;  1SMY A;  1UV7 A;  1PJ6 A;  2O5I A;  2V6S A;  5IOR A;  1WOR A;  2WAQ L;  3GTK K;  3GTJ C;  1TWH K;  4Q4Z A;  5IYD K;  3S2H K;  3I4N C;  3HKZ D;  1J98 A;  4A3I C;  1X31 C;  3H3V L;  5M3F K;  2ZUF A;  5IYC K;  1F7U A;  3QX3 A;  2WAQ D;  4A3K C;  1IL2 A;  3K7A C;  2R93 C;  4BY7 K;  4P5A A;  4G7Z A;  5IYD C;  5IP9 C;  2R93 A;  2NVQ K;  3MML B;  1TWC K;  3NUH A;  2NVX K;  2R92 K;  4GZY A;  1AB4 A;  5IYB K;  5FLM C;  3GTJ K;  3BP8 C;  4FM9 A;  4ZH4 A;  4XSX A;  2NVT K;  5IOS A;  4BBR C;  4Y7N C;  3I4M C;  4GTA A;  1XZQ B;  4X6A C;  1WIH A;  4KAW X;  1VJE A;  3GTQ K;  3HOX C; 
#chains in the Genus database with same CATH homology
 2VUM K;  4A3G K;  2E2I K;  3M4O K;  2PA8 D;  1I6H C;  2JA8 K;  3HOU C;  5FJ8 K;  5IYC C;  3HOZ C;  1YNJ A;  4LK1 A;  4YG2 A;  4A3I K;  5C4X K;  4A3F K;  4A3F C;  1R9T C;  3S14 K;  3GTG C;  3S14 C;  4A3B C;  5C4X C;  2YU9 K;  2E2J K;  2PA8 L;  2E2J C;  2B63 C;  2B63 K;  4OIP A;  4QIW D;  4A93 C;  2VUM C;  3H0G K;  3RZO K;  4A3G C;  4LLG A;  3S1N K;  4BBS K;  2JA7 K;  2O5J A;  2Y0S D;  4QJV B;  5C44 K;  1YNN A;  5TMC A;  1K83 K;  3GTK C;  4A3D C;  2YU9 C;  1Y1V C;  4A3J K;  4KN4 A;  5IP7 C;  5TMF A;  1I50 C;  2CW0 A;  5D4D A;  3HOV C;  3GTO K;  4LK0 A;  2NVQ C;  4QJV A;  3HKZ L;  4YFN A;  3M3Y C;  4A3B K;  4A3C C;  3S2H C;  3PO2 K;  3RZD K;  2R93 K;  1I3Q K;  3S2D K;  4JK1 A;  3S1R C;  3GTQ C;  4BBS C;  4Q5S A;  2NVT C;  5M5X K;  4YFK A;  4A3K K;  4XLN A;  4YFX A;  2JA8 C;  2R7Z C;  3HOU K;  4KMU A;  3I4N K;  3CQZ K;  2NVY C;  4A3E K;  4MQ9 A;  4C3J K;  3GTG K;  3RZO C;  2A6E A;  4NOI A;  3S16 K;  1ZYR A;  3S16 C;  3S17 C;  4OIN A;  3S2D C;  1SMY A;  4QIW L;  2PPB A;  2O5I A;  2A69 A;  3S1M K;  3S1M C;  4OIO A;  4AYB D;  2E2H K;  4XLP A;  5IP7 K;  2WAQ L;  3GTK K;  4A3D K;  3GTJ C;  3PO3 C;  3PO3 K;  5M5W K;  1TWH K;  4C3I K;  2A68 A;  1HQM A;  4Q4Z A;  4G7H A;  2R92 C;  1TWF K;  5M5Y K;  2JA5 K;  3S2H K;  3I4N C;  3HKZ D;  4BBR K;  4Y7N K;  4A3I C;  3I4M K;  4BXX C;  3S1N C;  5FLM K;  5IYD K;  3H3V L;  5M3M K;  5M3F K;  3HOX K;  1I50 K;  2JA6 K;  3GTP C;  3HOW C;  4A93 K;  4A3J C;  4XSZ A;  1TWH C;  1WCM K;  5C4J K;  3H3V D;  5IYC K;  2Y0S L;  3HOV K;  4BY1 C;  3HOY K;  2BE5 A;  4A3C K;  3S1Q K;  3S1Q C;  4OIQ A;  4C2M K;  4Y52 C;  2WAQ D;  4A3K C;  1WCM C;  5C4J C;  1Y1W K;  3S1R K;  4X6A K;  1TWA K;  4MEY A;  1TWC C;  1R9T K;  2NVX C;  3K7A C;  3CQZ C;  3PO2 C;  4BY7 C;  4C3H K;  4BY7 K;  2R93 C;  2E2H C;  4A3L K;  4MEX A;  3S17 K;  4G7Z A;  1TWF C;  5IP9 C;  5IYD C;  2JA5 C;  1I6V A;  4OIR A;  2NVQ K;  2A6H A;  1Y1W C;  2E2I C;  3DXJ A;  3M4O C;  1K83 C;  1I6H K;  4A3M C;  4A3M K;  1TWC K;  2NVX K;  2R92 K;  5C3E C;  3HOZ K;  4GZY A;  5IYB K;  5IYB C;  3HOY C;  4Y52 K;  1BDF A;  5FLM C;  3GTJ K;  4A3L C;  1TWG K;  1TWG C;  3M3Y K;  3FKI K;  2PMZ D;  3K7A K;  4BXX K;  4AYB L;  3S15 K;  1Y1V K;  2PMZ L;  3EQL A;  4ZH4 A;  4BY1 K;  1SFO K;  1XPP A;  2NVY K;  1SFO C;  3RZD C;  5C44 C;  5IP9 K;  3GTO C;  2JA6 C;  3GTP K;  3HOW K;  2WB1 D;  1IW7 A;  1TWA C;  4XSX A;  2NVT K;  3H0G C;  4KN7 A;  5C3E K;  2R7Z K;  4BBR C;  4Y7N C;  3I4M C;  3S15 C;  1I3Q C;  4X6A C;  4G7O A;  2JA7 C;  3WOD A;  2WB1 L;  3GTL K;  3GTM C;  4A3E C;  3GTL C;  3GTQ K;  3GTM K;  3FKI C;  4LJZ A;  3HOX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...