2ZFZA

Crystal structure of the c-terminal domain hexamer of argr from mycobacterium tuberculosis in complex with arginine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
TDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Arginine repressor
total genus 22
structure length 77
sequence length 77
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2zfzA00
1XXBA 3BUEA 4KB4A 3L4KA 2RGRA 3OEPA 3FOEA 1B4AA 2XCOA 1XXAA 4KDDA 1DD5A 1WQFA 1WQGA 3VA7A 4J3NA 4G0WA 1GE9A 4GFQA 3L4JA 3QX3A 1XXCA 1ISEA 1WIHA 2ZFZA 3LPXA 4KAWX 4KC6A 1BGWA 2KWAA 3CAGA 4G0UA 2PHCB 1EK8A 2Y3PA 2P5MA 4KB2A 1BJTA 3OPFA 1IS1A 4G0VA 3V4GA 2XCRB 1EH1A 3OREA 3NUHA 4DDQA 3LAPA 3FHZA 4FM9A 5JVOA 1ZVUA 1B4BA 1F9NA 3MMLB 1AB4A 1WQHA 3FOFA 2XCQA 3LAJA 5CJ9A 3ERED
chains in the Genus database with same CATH superfamily
1XXBA 5C44K 4A93C 2XCOA 3I4MC 1SFOC 1XXAA 1DCHA 1G51A 1TWFC 4BBSC 4G7OA 1GE9A 3T00A 4A3JC 3HOZC 1I50A 1F7UA 3GTMK 4LK1A 4A3FC 3ADAC 1EH1A 4XSXA 5C4JK 3GTGC 4AYBD 1HI9A 2R93K 1WQHA 2E2IK 4KARA 4Y7NC 3FOEA 1R9TA 1TWAA 4FZBA 1WCMC 3GEIA 4C3HK 4MEXA 3FKIC 3S14K 3HOUK 3A8IA 1BDFA 2B63A 4G7ZA 1PJ6A 2CW0A 4A3LK 3N3YA 4GTEA 2R92A 1YX2A 2YU9A 1IE0A 3S1NC 2PA8L 3AD9C 1SMYA 2D6FC 2NVYA 4FM9A 1BS2A 2A6HA 3LAPA 2ZUFA 2B63K 4BLAA 1UV7A 4KN7A 5IORA 1Y1VC 2GAHC 4AH6A 4ZH4A 5IYBC 1I3QK 3CQZK 3GTQC 2R7ZK 1TWCA 1WOSA 1XZQA 4MQ9A 5C3EK 3HXAA 4GTBA 4A93K 1SFOK 1K83A 1EK8A 4BBSK 3GTOA 3HOZK 4KMDA 4LOWA 4OIPA 3GTMC 4LK0A 3ERED 1TWFA 4A3BK 1DD5A 4BBRK 3GTGK 3TFIA 2A69A 2E2IC 4KMHA 4LR2A 5C4XC 1IL2A 4Y7NK 1C0AA 1Y1WA 3HOWK 4C3HC 3GSIA 2PMZL 1EI6A 1WOPA 2PMZD 3HOUC 3GTGA 5IP7C 1F93A 1I6HK 4YFKA 3WODA 4A3LC 3SZZA 3HOVK 3GTLA 3GTPA 2WAQL 1INNA 3S1NK 4GTDA 5M5WK 4BLBA 4GTFA 1IW7A 2PA8D 3GTJA 2B63C 1Y1VK 2R92C 2JA5A 4XLNA 4WJ3M 2WB1L 5TMFA 4X6AK 3LPXA 3PO2C 4C3JK 3AD7C 4WILA 1I3QC 3M4OK 2GSUA 3GTQK 3OPFA 3I4NC 3S1MC 4Y52C 5FJ8K 1Y1VA 5C3EC 2NVQC 1I50K 1AB4A 2XCQA 5CJ9A 4OIRA 2E2HC 3G4AA 1WORA 1WQGA 1IQ0A 1TWGC 3GIRA 5EGEA 3QX3A 3IPJA 1XZPA 4LJZA 4A3BC 1J98A 3GEHA 4BBRC 5C4XK 2VUMC 2JA6K 2A6EA 5M3FK 3HOWC 5TJ3A 4GTCA 3L4KA 3S17K 4XCHA 4YFNA 1VJEA 4KDDA 3EQLA 5M3MK 5IP7K 5M5YK 4G0WA 2E2IA 1I6HC 3L4JA 3HOVC 1O25A 2FQTA 3CQZA 3TTGA 4KB2A 2R7ZA 1VGXA 3V4GA 1TWCK 4MEYA 5JVOA 2R92K 2BE5A 2V6TA 3K7AK 3GTPC 1L0WA 4X6AC 3N0BA 3LAJA 3PO2K 4C3JC 5IOQA 1DCPA 5EGHA 1SFOA 5L46A 3M4OC 3N0CA 3S1RK 3I4NK 3S1MK 2NVXK 2NVTC 5TMCA 4Y52K 3GTOK 4QIWL 5FLMC 1WSRA 2NVQK 1I50C 2V6UA 1ISEA 2E2HK 2R93A 1BGWA 5M5XK 3AQOA 1ZQ1C 1IS1A 3GTKA 3H3VD 2WAQD 1TWGK 3OREA 1R9TK 4QJVB 3TFJA 2P8TA 5IYCC 1JOEA 4KN4A 4PABA 1RU0A 2E2HA 1TWAC 1WCMA 2GSNA 2GSOA 1B4AA 3GTKK 3FKIA 1USOA 5IYDC 2YU9K 3GTLK 2VUMK 2JA6C 4BY1K 5CHPA 3S17C 2PHCB 1F7VA 2A68A 2RH6A 4P9SA 3S15C 2JA5K 3PO3C 4A3GK 3MMLB 3BP3A 4O2DA 3FOFA 3H0GC 1JQWA 3GTQA 1WSVA 1KQ4A 4KASA 1O2BA 1PJ7A 1TWCC 3AH5A 3VA7A 2CFAB 3K7AC 4AYBL 3GTPK 2WB1D 3HOXK 3BP8C 1XPPA 3SZYA 3S1RC 2KWAA 5IP9K 2NVXC 2NVTK 2P5MA 3GTOC 5FLMK 1YNNA 3GTMA 1ZXOA 3HKZD 3RZDK 3DXJA 3S2HK 1JVIA 1X31C 4A3MK 4A3IK 2RGRA 4P5BA 1VLOA 2O5JA 1J6WA 1Y1WK 4A3DC 1R9TC 3RZOC 3A8JA 4G7HA 5IYCK 4GFQA 2Y0SD 4KMUA 1EFWA 2JH3A 2Y0SL 1O24A 4RMFA 4C3IC 1TWAK 4A3EK 2JA7A 1TWHA 3GTKC 3G4CA 5IYDK 4A3KK 2YU9C 2ZUEA 4PAAA 1EQRA 2NVYC 4YG2A 3GTLC 4BY1C 1HQMA 5IOTA 1VH2A 1IBAA 4OIQA 1TWHK 2V6SA 3S0XA 3S15K 4LLGA 4BXXC 3S1QK 2JA5C 2EBBA 3PO3K 4A3GC 4GTAA 2CFAA 1XZPB 3H0GK 1YCLA 4KAWX 4XLPA 4GT9A 2GAGC 2E2JK 3FHZA 4JK1A 5D4DA 4KM9A 5IOSA 3HOXC 3HOYC 4OIOA 2JA8C 1VRQC 5IP9C 2FQOA 4KM8A 5HL8A 1TWGA 4NOIA 1O28A 4BKWA 3GEEA 3RZDC 4A3CK 1XXCA 3JSTA 3S2HC 2NVXA 4A3MC 4A3IC 1O29A 4KC6A 5JFEA 1Y1WC 3H3VL 4A3DK 3RZOK 4DDQA 4KATA 3GDZA 1ZVUA 1F9NA 4P5AA 4C3IK 4C2MC 2O5IA 5E68A 4A3EC 3S16K 1J6XA 3BUEA 3S2DC 4A3KC 3TFHA 3AQPA 1XZQB 1WQFA 3Q3QA 1K83K 2W7VA 2NVYK 3T01A 4Q4ZA 3GTJC 4BY7K 2JA7C 1TWHC 3M3YK 4GTLA 1USMA 1V5VA 4G0UA 5C44C 4LQYA 2Y3PA 4GZYA 3I4MK 1I3QA 4BXXK 4QJVA 1O2FB 1ZYRA 3S1QC 4M1XA 1TWFK 4A3JK 4WJ4A 1PJ5A 4Q5SA 3OEPA 2E2JC 1YNJA 1ZBSA 4J3NA 4A3FK 4C45A 5C4JC 3HOYK 2JA8K 1O27A 4KMAA 2R93C 1O26A 4OINA 4QIWD 1WCMK 3NUHA 3FKIK 3S14C 3HKZL 4A3CC 3T02A 1O2AA 4KB4A 2VUMA 1J6VA 3AD8C 1WOOA 2JA6A 4XSZA 1I6VA 4C2MK 3S16C 1WIHA 2ZFZA 3S2DK 3CAGA 5IYBK 1BJTA 2PPBA 1K83C 3CQZC 4ILDA 4G0VA 2XCRB 1DCOA 2R7ZC 3GTJK 4BY7C 1B4BA 3H0GA 2JA7K 4YFXA 3M3YC 3A8KA
chains in the Genus database with same CATH topology
1XXBA 1WCMA 2GSNA 2GSOA 4GTDA 1B4AA 4KM8A 2XCOA 4GTFA 4BLBA 1XXAA 3FKIA 1TWGA 1O28A 4BKWA 3GTJA 1GE9A 2JA5A 1XXCA 1I50A 2NVXA 5CHPA 3LPXA 1O29A 4KC6A 5JFEA 2PHCB 2GSUA 3OPFA 2RH6A 1EH1A 4DDQA 4KATA 1Y1VA 1ZVUA 1F9NA 3MMLB 4P5AA 1AB4A 1WQHA 3FOFA 2XCQA 4C2MC 5CJ9A 3BUEA 4KARA 3FOEA 3GTQA 3G4AA 1R9TA 1TWAA 3AQPA 1KQ4A 4FZBA 4KASA 1O2BA 1WQGA 1WQFA 3AH5A 3Q3QA 3VA7A 2CFAB 2B63A 5EGEA 3QX3A 3N3YA 4GTEA 2R92A 4GTLA 2KWAA 4G0UA 2YU9A 4LQYA 2Y3PA 2P5MA 1I3QA 2NVYA 4FM9A 4M1XA 3LAPA 4BLAA 5IORA 3GTMA 1ZXOA 5TJ3A 4GTCA 3L4KA 2RGRA 3OEPA 4P5BA 4KDDA 1ZBSA 4J3NA 4G0WA 2E2IA 1TWCA 4GFQA 3L4JA 2JH3A 1O27A 4KMAA 1O24A 1O25A 4C3IC 1O26A 2JA7A 4GTBA 1TWHA 1K83A 3CQZA 1EK8A 3G4CA 4KB2A 2R7ZA 3V4GA 3GTOA 3NUHA 5JVOA 4KMDA 5IOTA 3N0BA 3LAJA 4C3JC 1O2AA 5EGHA 5IOQA 3ERED 1SFOA 4KB4A 2VUMA 3N0CA 1TWFA 1DD5A 3S0XA 2JA6A 4GTAA 2CFAA 4KMHA 4LR2A 1ISEA 1WIHA 2ZFZA 4KAWX 4GT9A 2R93A 1BGWA 3CAGA 1Y1WA 4C3HC 3AQOA 1BJTA 1IS1A 4ILDA 4G0VA 3GTKA 2XCRB 3FHZA 3OREA 3GTGA 4KM9A 5IOSA 1B4BA 3H0GA 3GTLA 2E2HA 3GTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXB A;  3BUE A;  4KB4 A;  3L4K A;  2RGR A;  3OEP A;  3FOE A;  1B4A A;  2XCO A;  1XXA A;  4KDD A;  1DD5 A;  1WQF A;  1WQG A;  3VA7 A;  4J3N A;  4G0W A;  1GE9 A;  4GFQ A;  3L4J A;  3QX3 A;  1XXC A;  1ISE A;  1WIH A;  2ZFZ A;  3LPX A;  4KAW X;  4KC6 A;  1BGW A;  2KWA A;  3CAG A;  4G0U A;  2PHC B;  1EK8 A;  2Y3P A;  2P5M A;  4KB2 A;  1BJT A;  3OPF A;  1IS1 A;  4G0V A;  3V4G A;  2XCR B;  1EH1 A;  3ORE A;  3NUH A;  4DDQ A;  3LAP A;  3FHZ A;  4FM9 A;  5JVO A;  1ZVU A;  1B4B A;  1F9N A;  3MML B;  1AB4 A;  1WQH A;  3FOF A;  2XCQ A;  3LAJ A;  5CJ9 A;  3ERE D; 
#chains in the Genus database with same CATH topology
 1XXB A;  5C44 K;  4A93 C;  2XCO A;  3I4M C;  1SFO C;  1XXA A;  1DCH A;  1G51 A;  1TWF C;  4BBS C;  4G7O A;  1GE9 A;  3T00 A;  4A3J C;  3HOZ C;  1I50 A;  1F7U A;  3GTM K;  4LK1 A;  4A3F C;  3ADA C;  1EH1 A;  4XSX A;  5C4J K;  3GTG C;  4AYB D;  1HI9 A;  2R93 K;  1WQH A;  2E2I K;  4KAR A;  4Y7N C;  3FOE A;  1R9T A;  1TWA A;  4FZB A;  1WCM C;  3GEI A;  4C3H K;  4MEX A;  3FKI C;  3S14 K;  3HOU K;  3A8I A;  1BDF A;  2B63 A;  4G7Z A;  1PJ6 A;  2CW0 A;  4A3L K;  3N3Y A;  4GTE A;  2R92 A;  1YX2 A;  2YU9 A;  1IE0 A;  3S1N C;  2PA8 L;  3AD9 C;  1SMY A;  2D6F C;  2NVY A;  4FM9 A;  1BS2 A;  2A6H A;  3LAP A;  2ZUF A;  2B63 K;  4BLA A;  1UV7 A;  4KN7 A;  5IOR A;  1Y1V C;  2GAH C;  4AH6 A;  4ZH4 A;  5IYB C;  1I3Q K;  3CQZ K;  3GTQ C;  2R7Z K;  1TWC A;  1WOS A;  1XZQ A;  4MQ9 A;  5C3E K;  3HXA A;  4GTB A;  4A93 K;  1SFO K;  1K83 A;  1EK8 A;  4BBS K;  3GTO A;  3HOZ K;  4KMD A;  4LOW A;  4OIP A;  3GTM C;  4LK0 A;  3ERE D;  1TWF A;  4A3B K;  1DD5 A;  4BBR K;  3GTG K;  3TFI A;  2A69 A;  2E2I C;  4KMH A;  4LR2 A;  5C4X C;  1IL2 A;  4Y7N K;  1C0A A;  1Y1W A;  3HOW K;  4C3H C;  3GSI A;  2PMZ L;  1EI6 A;  1WOP A;  2PMZ D;  3HOU C;  3GTG A;  5IP7 C;  1F93 A;  1I6H K;  4YFK A;  3WOD A;  4A3L C;  3SZZ A;  3HOV K;  3GTL A;  3GTP A;  2WAQ L;  1INN A;  3S1N K;  4GTD A;  5M5W K;  4BLB A;  4GTF A;  1IW7 A;  2PA8 D;  3GTJ A;  2B63 C;  1Y1V K;  2R92 C;  2JA5 A;  4XLN A;  4WJ3 M;  2WB1 L;  5TMF A;  4X6A K;  3LPX A;  3PO2 C;  4C3J K;  3AD7 C;  4WIL A;  1I3Q C;  3M4O K;  2GSU A;  3GTQ K;  3OPF A;  3I4N C;  3S1M C;  4Y52 C;  5FJ8 K;  1Y1V A;  5C3E C;  2NVQ C;  1I50 K;  1AB4 A;  2XCQ A;  5CJ9 A;  4OIR A;  2E2H C;  3G4A A;  1WOR A;  1WQG A;  1IQ0 A;  1TWG C;  3GIR A;  5EGE A;  3QX3 A;  3IPJ A;  1XZP A;  4LJZ A;  4A3B C;  1J98 A;  3GEH A;  4BBR C;  5C4X K;  2VUM C;  2JA6 K;  2A6E A;  5M3F K;  3HOW C;  5TJ3 A;  4GTC A;  3L4K A;  3S17 K;  4XCH A;  4YFN A;  1VJE A;  4KDD A;  3EQL A;  5M3M K;  5IP7 K;  5M5Y K;  4G0W A;  2E2I A;  1I6H C;  3L4J A;  3HOV C;  1O25 A;  2FQT A;  3CQZ A;  3TTG A;  4KB2 A;  2R7Z A;  1VGX A;  3V4G A;  1TWC K;  4MEY A;  5JVO A;  2R92 K;  2BE5 A;  2V6T A;  3K7A K;  3GTP C;  1L0W A;  4X6A C;  3N0B A;  3LAJ A;  3PO2 K;  4C3J C;  5IOQ A;  1DCP A;  5EGH A;  1SFO A;  5L46 A;  3M4O C;  3N0C A;  3S1R K;  3I4N K;  3S1M K;  2NVX K;  2NVT C;  5TMC A;  4Y52 K;  3GTO K;  4QIW L;  5FLM C;  1WSR A;  2NVQ K;  1I50 C;  2V6U A;  1ISE A;  2E2H K;  2R93 A;  1BGW A;  5M5X K;  3AQO A;  1ZQ1 C;  1IS1 A;  3GTK A;  3H3V D;  2WAQ D;  1TWG K;  3ORE A;  1R9T K;  4QJV B;  3TFJ A;  2P8T A;  5IYC C;  1JOE A;  4KN4 A;  4PAB A;  1RU0 A;  2E2H A;  1TWA C;  1WCM A;  2GSN A;  2GSO A;  1B4A A;  3GTK K;  3FKI A;  1USO A;  5IYD C;  2YU9 K;  3GTL K;  2VUM K;  2JA6 C;  4BY1 K;  5CHP A;  3S17 C;  2PHC B;  1F7V A;  2A68 A;  2RH6 A;  4P9S A;  3S15 C;  2JA5 K;  3PO3 C;  4A3G K;  3MML B;  3BP3 A;  4O2D A;  3FOF A;  3H0G C;  1JQW A;  3GTQ A;  1WSV A;  1KQ4 A;  4KAS A;  1O2B A;  1PJ7 A;  1TWC C;  3AH5 A;  3VA7 A;  2CFA B;  3K7A C;  4AYB L;  3GTP K;  2WB1 D;  3HOX K;  3BP8 C;  1XPP A;  3SZY A;  3S1R C;  2KWA A;  5IP9 K;  2NVX C;  2NVT K;  2P5M A;  3GTO C;  5FLM K;  1YNN A;  3GTM A;  1ZXO A;  3HKZ D;  3RZD K;  3DXJ A;  3S2H K;  1JVI A;  1X31 C;  4A3M K;  4A3I K;  2RGR A;  4P5B A;  1VLO A;  2O5J A;  1J6W A;  1Y1W K;  4A3D C;  1R9T C;  3RZO C;  3A8J A;  4G7H A;  5IYC K;  4GFQ A;  2Y0S D;  4KMU A;  1EFW A;  2JH3 A;  2Y0S L;  1O24 A;  4RMF A;  4C3I C;  1TWA K;  4A3E K;  2JA7 A;  1TWH A;  3GTK C;  3G4C A;  5IYD K;  4A3K K;  2YU9 C;  2ZUE A;  4PAA A;  1EQR A;  2NVY C;  4YG2 A;  3GTL C;  4BY1 C;  1HQM A;  5IOT A;  1VH2 A;  1IBA A;  4OIQ A;  1TWH K;  2V6S A;  3S0X A;  3S15 K;  4LLG A;  4BXX C;  3S1Q K;  2JA5 C;  2EBB A;  3PO3 K;  4A3G C;  4GTA A;  2CFA A;  1XZP B;  3H0G K;  1YCL A;  4KAW X;  4XLP A;  4GT9 A;  2GAG C;  2E2J K;  3FHZ A;  4JK1 A;  5D4D A;  4KM9 A;  5IOS A;  3HOX C;  3HOY C;  4OIO A;  2JA8 C;  1VRQ C;  5IP9 C;  2FQO A;  4KM8 A;  5HL8 A;  1TWG A;  4NOI A;  1O28 A;  4BKW A;  3GEE A;  3RZD C;  4A3C K;  1XXC A;  3JST A;  3S2H C;  2NVX A;  4A3M C;  4A3I C;  1O29 A;  4KC6 A;  5JFE A;  1Y1W C;  3H3V L;  4A3D K;  3RZO K;  4DDQ A;  4KAT A;  3GDZ A;  1ZVU A;  1F9N A;  4P5A A;  4C3I K;  4C2M C;  2O5I A;  5E68 A;  4A3E C;  3S16 K;  1J6X A;  3BUE A;  3S2D C;  4A3K C;  3TFH A;  3AQP A;  1XZQ B;  1WQF A;  3Q3Q A;  1K83 K;  2W7V A;  2NVY K;  3T01 A;  4Q4Z A;  3GTJ C;  4BY7 K;  2JA7 C;  1TWH C;  3M3Y K;  4GTL A;  1USM A;  1V5V A;  4G0U A;  5C44 C;  4LQY A;  2Y3P A;  4GZY A;  3I4M K;  1I3Q A;  4BXX K;  4QJV A;  1O2F B;  1ZYR A;  3S1Q C;  4M1X A;  1TWF K;  4A3J K;  4WJ4 A;  1PJ5 A;  4Q5S A;  3OEP A;  2E2J C;  1YNJ A;  1ZBS A;  4J3N A;  4A3F K;  4C45 A;  5C4J C;  3HOY K;  2JA8 K;  1O27 A;  4KMA A;  2R93 C;  1O26 A;  4OIN A;  4QIW D;  1WCM K;  3NUH A;  3FKI K;  3S14 C;  3HKZ L;  4A3C C;  3T02 A;  1O2A A;  4KB4 A;  2VUM A;  1J6V A;  3AD8 C;  1WOO A;  2JA6 A;  4XSZ A;  1I6V A;  4C2M K;  3S16 C;  1WIH A;  2ZFZ A;  3S2D K;  3CAG A;  5IYB K;  1BJT A;  2PPB A;  1K83 C;  3CQZ C;  4ILD A;  4G0V A;  2XCR B;  1DCO A;  2R7Z C;  3GTJ K;  4BY7 C;  1B4B A;  3H0G A;  2JA7 K;  4YFX A;  3M3Y C;  3A8K A; 
#chains in the Genus database with same CATH homology
 1XXB A;  1WCM A;  2GSN A;  2GSO A;  4GTD A;  1B4A A;  4KM8 A;  2XCO A;  4GTF A;  4BLB A;  1XXA A;  3FKI A;  1TWG A;  1O28 A;  4BKW A;  3GTJ A;  1GE9 A;  2JA5 A;  1XXC A;  1I50 A;  2NVX A;  5CHP A;  3LPX A;  1O29 A;  4KC6 A;  5JFE A;  2PHC B;  2GSU A;  3OPF A;  2RH6 A;  1EH1 A;  4DDQ A;  4KAT A;  1Y1V A;  1ZVU A;  1F9N A;  3MML B;  4P5A A;  1AB4 A;  1WQH A;  3FOF A;  2XCQ A;  4C2M C;  5CJ9 A;  3BUE A;  4KAR A;  3FOE A;  3GTQ A;  3G4A A;  1R9T A;  1TWA A;  3AQP A;  1KQ4 A;  4FZB A;  4KAS A;  1O2B A;  1WQG A;  1WQF A;  3AH5 A;  3Q3Q A;  3VA7 A;  2CFA B;  2B63 A;  5EGE A;  3QX3 A;  3N3Y A;  4GTE A;  2R92 A;  4GTL A;  2KWA A;  4G0U A;  2YU9 A;  4LQY A;  2Y3P A;  2P5M A;  1I3Q A;  2NVY A;  4FM9 A;  4M1X A;  3LAP A;  4BLA A;  5IOR A;  3GTM A;  1ZXO A;  5TJ3 A;  4GTC A;  3L4K A;  2RGR A;  3OEP A;  4P5B A;  4KDD A;  1ZBS A;  4J3N A;  4G0W A;  2E2I A;  1TWC A;  4GFQ A;  3L4J A;  2JH3 A;  1O27 A;  4KMA A;  1O24 A;  1O25 A;  4C3I C;  1O26 A;  2JA7 A;  4GTB A;  1TWH A;  1K83 A;  3CQZ A;  1EK8 A;  3G4C A;  4KB2 A;  2R7Z A;  3V4G A;  3GTO A;  3NUH A;  5JVO A;  4KMD A;  5IOT A;  3N0B A;  3LAJ A;  4C3J C;  1O2A A;  5EGH A;  5IOQ A;  3ERE D;  1SFO A;  4KB4 A;  2VUM A;  3N0C A;  1TWF A;  1DD5 A;  3S0X A;  2JA6 A;  4GTA A;  2CFA A;  4KMH A;  4LR2 A;  1ISE A;  1WIH A;  2ZFZ A;  4KAW X;  4GT9 A;  2R93 A;  1BGW A;  3CAG A;  1Y1W A;  4C3H C;  3AQO A;  1BJT A;  1IS1 A;  4ILD A;  4G0V A;  3GTK A;  2XCR B;  3FHZ A;  3ORE A;  3GTG A;  4KM9 A;  5IOS A;  1B4B A;  3H0G A;  3GTL A;  2E2H A;  3GTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...