2ZFZA

Crystal structure of the c-terminal domain hexamer of argr from mycobacterium tuberculosis in complex with arginine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
TDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Arginine repressor
publication title Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 22
structure length 77
sequence length 77
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2zfzA00
4FM9A 2PHCB 4G0WA 1BGWA 1B4AA 3L4JA 1EK8A 3OREA 4DDQA 3LAJA 3OPFA 1WQHA 1EH1A 3LPXA 1BJTA 2KWAA 2P5MA 3MMLB 3ERED 3LAPA 4KB4A 1AB4A 1ISEA 3QX3A 2XCRB 4KC6A 1F9NA 1WQFA 5JVOA 4KAWX 3NUHA 3FHZA 3BUEA 4GFQA 4G0UA 2ZFZA 4J3NA 5CJ9A 1GE9A 2RGRA 1XXAA 4KB2A 1XXCA 1DD5A 1XXBA 2XCOA 3OEPA 2XCQA 3V4GA 4G0VA 1WIHA 1ZVUA 3CAGA 3L4KA 3FOEA 3FOFA 1B4BA 2Y3PA 4KDDA 1WQGA 1IS1A 3VA7A
chains in the Genus database with same CATH superfamily
4P5BA 5FLMC 2O5IA 4NOIA 3JSTA 4A3DC 1TWHC 1R9TK 3EQLA 4MEYA 4KMHA 3BP8C 1GE9A 5IOQA 4QJVB 4LQYA 1USMA 4BY7K 4WILA 4OIOA 3S14K 3H0GC 2E2IA 4GTEA 1VGXA 5C4XC 3GTGK 2CFAB 4KMDA 1WOPA 2NVTK 2A69A 2WAQL 4FZBA 1USOA 1EFWA 3AD7C 2PA8L 4JK1A 4WJ3M 3AD8C 4YFKA 2JA7A 2D6FC 3GEHA 4GZYA 4C2MK 5C3EK 3V4GA 2R93C 4X6AC 4GTDA 1K83K 1BS2A 1JVIA 1HQMA 1IS1A 4A3GC 2JA5A 2PHCB 1BGWA 3GTKK 3GTGC 1WQHA 1YX2A 3S1MK 3GEEA 1VJEA 1X31C 3K7AK 2VUMC 3HOUC 2V6TA 1I6VA 3M4OK 2Y0SL 4A3JC 4BY1C 2WAQD 1BDFA 2NVQC 2NVXK 1I6HC 4A3LC 1SFOA 1XXCA 1G51A 2PA8D 1TWAC 4G0VA 3N3YA 1Y1VK 3L4KA 2PMZL 4G7ZA 1SMYA 1L0WA 4GTBA 4A3KK 3VA7A 3GTQA 1XZQB 1TWFC 3G4AA 4PABA 4A3FK 1YCLA 2KWAA 3PO2C 3MMLB 3GTKC 4C3HK 5IOTA 3FKIK 3TFJA 4MEXA 5EGEA 1TWGA 3CQZC 2B63K 2JA6K 3WODA 3GSIA 4KAWX 2W7VA 3BUEA 1PJ5A 1RU0A 1Y1WA 3S0XA 1TWCC 1I50A 2Y0SD 5IYCC 1VRQC 4AYBL 3GTJK 4KM9A 2JA8C 2A6EA 2FQOA 4C3IK 2YU9C 3GIRA 1F7UA 3RZDC 3GTPA 4ILDA 4LR2A 1WCMC 4OIRA 1WORA 1WQGA 4Y7NK 5FLMK 4A3DK 1TWHK 4A3KC 3GTLC 3LPXA 1R9TA 5IYDC 5E68A 5C44K 4BBSC 4GTFA 4O2DA 4P5AA 4Q5SA 5L46A 1KQ4A 4QIWD 3H0GK 1F7VA 5IYBC 5C4XK 3GTGA 5M5YK 4LK1A 4PAAA 1IL2A 4GTAA 3L4JA 1B4AA 4A3IC 4DDQA 4Y7NC 1WSRA 2BE5A 1J98A 3GTMC 4OIPA 4RMFA 5C44C 1JQWA 3IPJA 4YG2A 1XXAA 3T02A 4BXXC 2R93K 4X6AK 3PO3C 3GTOC 1K83A 3HOVC 3S17C 4A3GK 3ADAC 1B4BA 2Y3PA 4C3JC 3M3YC 5IP7C 5M3MK 4C45A 3BP3A 5IOSA 1EK8A 2VUMK 3N0BA 3HOUK 4A3EC 3LAPA 4P9SA 4A3JK 2E2HK 4BY1K 1O2FB 1IE0A 2XCRB 1WOSA 1XZPA 1I3QC 1ZXOA 2NVQK 4BBRC 2NVXA 1I6HK 4A3LK 1IW7A 1TWAK 2RGRA 1WSVA 1DD5A 3S1NC 1Y1VA 3SZZA 2R7ZC 3S16C 3TFHA 5M3FK 4G7OA 4KDDA 2R92C 1IQ0A 1DCPA 1TWFK 4KN4A 4A93C 2ZUFA 2GSNA 3PO2K 2E2JC 2P5MA 3FKIA 4OIQA 3S1RC 3A8KA 3CQZK 2B63A 2JA6A 3I4MC 2E2HC 1TWCK 4KATA 1O24A 4XSZA 5IYCK 3GTJA 2JA8K 2WB1L 4OINA 2YU9K 2NVYC 3RZDK 1WCMK 4BKWA 1TWHA 3GTLK 2EBBA 4LK0A 1IBAA 5IYDK 4BBSK 5IP9C 4A3BC 4Y52C 2RH6A 3HKZL 5HL8A 1ZQ1C 1O25A 1O2AA 5FJ8K 3AD9C 3AQOA 3H0GA 5JFEA 5IYBK 5EGHA 2A68A 1ZBSA 1DCHA 2WB1D 3TTGA 2E2IC 4A3IK 3HOXK 4YFXA 5C4JC 2PMZD 3GTMK 2O5JA 4KC6A 1XZPB 4BXXK 2JA7C 2R93A 2GSUA 3PO3K 3GTOK 3HOVK 3HOYC 1WIHA 3T00A 3S15C 3S17K 4C3JK 3M3YK 1EQRA 4GT9A 3G4CA 5IP7K 1YNJA 4GTCA 4FM9A 4G0WA 4A3MC 5TMCA 4AYBD 2JA5C 3OREA 3S2HC 2VUMA 3HOXC 4A3EK 1BJTA 1O26A 2E2HA 4KB4A 5IORA 1I3QK 4M1XA 2GAGC 4BBRK 3GEIA 3NUHA 1TWAA 2V6SA 2GAHC 3Q3QA 4KB2A 3S1NK 3OEPA 2PPBA 2R7ZK 3S16K 1SFOC 3HOWC 3H3VL 1J6VA 3SZYA 2R92K 1TWFA 4KM8A 4A93K 4KN7A 3HOZC 3GTKA 2E2JK 2ZUEA 3OPFA 3S1RK 3GTQC 3CQZA 3I4NC 3S1QC 3I4MK 1F93A 3TFIA 2GSOA 4KMAA 4YFNA 1TWCA 1TWGC 4G0UA 2ZFZA 1Y1WC 2NVYK 2V6UA 2XCOA 2YU9A 1I50C 1WCMA 1O29A 1V5VA 1HI9A 3RZOC 3AH5A 3GTPC 3GTLA 4A3CC 1DCOA 1J6XA 3H3VD 3AQPA 3LAJA 5IP9K 5TMFA 4A3BK 4Y52K 2P8TA 3HXAA 5D4DA 1R9TC 1F9NA 1UV7A 5CJ9A 1O27A 3S2DK 3N0CA 4BY7C 3S14C 2E2IK 1O2BA 3T01A 3GDZA 5C4JK 1O28A 3DXJA 3GTMA 4KMUA 2NVTC 4G7HA 4LJZA 3QX3A 2CW0A 1YNNA 5CHPA 4GTLA 4QJVA 2JA7K 4J3NA 2A6HA 4XLNA 3HOYK 3GTOA 4C2MC 3S15K 1PJ7A 1XXBA 5C3EC 2XCQA 3CAGA 4MQ9A 4LLGA 3S2DC 2CFAA 1K83C 4A3MK 2JA5K 3S2HK 5TJ3A 4BLBA 5M5XK 1EH1A 3S1MC 1I3QA 3K7AC 1VH2A 3A8JA 1AB4A 4QIWL 4XCHA 1PJ6A 1ZYRA 4XLPA 1INNA 1WQFA 3M4OC 4GFQA 2NVXC 2R7ZA 1VLOA 3HKZD 1SFOK 3HOWK 1JOEA 4XSXA 3FOEA 2R92A 1Y1VC 4WJ4A 3HOZK 4BLAA 4ZH4A 3GTQK 4KASA 3I4NK 3S1QK 1C0AA 4Q4ZA 3ERED 4A3FC 4LOWA 1XPPA 2FQTA 4C3HC 4KARA 3FKIC 1ISEA 1TWGK 2B63C 5JVOA 2JA6C 3FHZA 2JH3A 1Y1WK 1J6WA 4AH6A 3A8IA 2NVYA 1I50K 1EI6A 1ZVUA 5M5WK 3GTJC 1WOOA 3FOFA 3RZOK 4C3IC 3GTPK 4A3CK 1XZQA
chains in the Genus database with same CATH topology
4BKWA 4P5BA 1TWHA 3AQPA 3LAJA 3LPXA 1R9TA 2RH6A 4GTFA 4P5AA 1F9NA 4KMHA 1O25A 1O2AA 1KQ4A 5CJ9A 1O27A 1GE9A 5IOQA 3AQOA 3H0GA 4LQYA 5JFEA 3N0CA 5EGHA 2E2IA 1ZBSA 3GTGA 4GTEA 2CFAB 1O2BA 4KMDA 4GTAA 3L4JA 1B4AA 1O28A 4DDQA 3GTMA 4FZBA 3QX3A 4KC6A 2JA7A 5CHPA 4GTLA 4J3NA 2R93A 1XXAA 2GSUA 3GTOA 4C2MC 1XXBA 3V4GA 2XCQA 1WIHA 3CAGA 1K83A 2CFAA 4GTDA 4GT9A 1B4BA 2Y3PA 3G4CA 4GTCA 4C3JC 1IS1A 2JA5A 4FM9A 2PHCB 4G0WA 1BGWA 5TJ3A 5IOSA 4BLBA 1EK8A 3OREA 2VUMA 1WQHA 1EH1A 3N0BA 1BJTA 1O26A 3LAPA 4KB4A 5IORA 1I3QA 2E2HA 1AB4A 4M1XA 2XCRB 1WQFA 1ZXOA 3NUHA 4GFQA 2NVXA 1TWAA 3Q3QA 2RGRA 1SFOA 4KB2A 1XXCA 2R7ZA 1DD5A 3OEPA 4G0VA 3N3YA 1Y1VA 3L4KA 3FOEA 2R92A 4KDDA 4GTBA 1TWFA 3VA7A 4KM8A 4BLAA 3GTQA 3GTKA 2GSNA 3G4AA 4KASA 3OPFA 3ERED 2KWAA 2P5MA 3FKIA 3CQZA 3MMLB 5IOTA 2B63A 4KARA 5EGEA 4C3HC 1TWGA 2GSOA 2JA6A 1ISEA 4KMAA 1TWCA 5JVOA 4KAWX 1Y1WA 3FHZA 2JH3A 3BUEA 4G0UA 3S0XA 2ZFZA 4KATA 1O24A 2NVYA 1I50A 3GTJA 2XCOA 2YU9A 1ZVUA 4KM9A 1WCMA 1O29A 3GTPA 4ILDA 3FOFA 4C3IC 4LR2A 1WQGA 3AH5A 3GTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM9 A;  2PHC B;  4G0W A;  1BGW A;  1B4A A;  3L4J A;  1EK8 A;  3ORE A;  4DDQ A;  3LAJ A;  3OPF A;  1WQH A;  1EH1 A;  3LPX A;  1BJT A;  2KWA A;  2P5M A;  3MML B;  3ERE D;  3LAP A;  4KB4 A;  1AB4 A;  1ISE A;  3QX3 A;  2XCR B;  4KC6 A;  1F9N A;  1WQF A;  5JVO A;  4KAW X;  3NUH A;  3FHZ A;  3BUE A;  4GFQ A;  4G0U A;  2ZFZ A;  4J3N A;  5CJ9 A;  1GE9 A;  2RGR A;  1XXA A;  4KB2 A;  1XXC A;  1DD5 A;  1XXB A;  2XCO A;  3OEP A;  2XCQ A;  3V4G A;  4G0V A;  1WIH A;  1ZVU A;  3CAG A;  3L4K A;  3FOE A;  3FOF A;  1B4B A;  2Y3P A;  4KDD A;  1WQG A;  1IS1 A;  3VA7 A; 
#chains in the Genus database with same CATH topology
 4P5B A;  5FLM C;  2O5I A;  4NOI A;  3JST A;  4A3D C;  1TWH C;  1R9T K;  3EQL A;  4MEY A;  4KMH A;  3BP8 C;  1GE9 A;  5IOQ A;  4QJV B;  4LQY A;  1USM A;  4BY7 K;  4WIL A;  4OIO A;  3S14 K;  3H0G C;  2E2I A;  4GTE A;  1VGX A;  5C4X C;  3GTG K;  2CFA B;  4KMD A;  1WOP A;  2NVT K;  2A69 A;  2WAQ L;  4FZB A;  1USO A;  1EFW A;  3AD7 C;  2PA8 L;  4JK1 A;  4WJ3 M;  3AD8 C;  4YFK A;  2JA7 A;  2D6F C;  3GEH A;  4GZY A;  4C2M K;  5C3E K;  3V4G A;  2R93 C;  4X6A C;  4GTD A;  1K83 K;  1BS2 A;  1JVI A;  1HQM A;  1IS1 A;  4A3G C;  2JA5 A;  2PHC B;  1BGW A;  3GTK K;  3GTG C;  1WQH A;  1YX2 A;  3S1M K;  3GEE A;  1VJE A;  1X31 C;  3K7A K;  2VUM C;  3HOU C;  2V6T A;  1I6V A;  3M4O K;  2Y0S L;  4A3J C;  4BY1 C;  2WAQ D;  1BDF A;  2NVQ C;  2NVX K;  1I6H C;  4A3L C;  1SFO A;  1XXC A;  1G51 A;  2PA8 D;  1TWA C;  4G0V A;  3N3Y A;  1Y1V K;  3L4K A;  2PMZ L;  4G7Z A;  1SMY A;  1L0W A;  4GTB A;  4A3K K;  3VA7 A;  3GTQ A;  1XZQ B;  1TWF C;  3G4A A;  4PAB A;  4A3F K;  1YCL A;  2KWA A;  3PO2 C;  3MML B;  3GTK C;  4C3H K;  5IOT A;  3FKI K;  3TFJ A;  4MEX A;  5EGE A;  1TWG A;  3CQZ C;  2B63 K;  2JA6 K;  3WOD A;  3GSI A;  4KAW X;  2W7V A;  3BUE A;  1PJ5 A;  1RU0 A;  1Y1W A;  3S0X A;  1TWC C;  1I50 A;  2Y0S D;  5IYC C;  1VRQ C;  4AYB L;  3GTJ K;  4KM9 A;  2JA8 C;  2A6E A;  2FQO A;  4C3I K;  2YU9 C;  3GIR A;  1F7U A;  3RZD C;  3GTP A;  4ILD A;  4LR2 A;  1WCM C;  4OIR A;  1WOR A;  1WQG A;  4Y7N K;  5FLM K;  4A3D K;  1TWH K;  4A3K C;  3GTL C;  3LPX A;  1R9T A;  5IYD C;  5E68 A;  5C44 K;  4BBS C;  4GTF A;  4O2D A;  4P5A A;  4Q5S A;  5L46 A;  1KQ4 A;  4QIW D;  3H0G K;  1F7V A;  5IYB C;  5C4X K;  3GTG A;  5M5Y K;  4LK1 A;  4PAA A;  1IL2 A;  4GTA A;  3L4J A;  1B4A A;  4A3I C;  4DDQ A;  4Y7N C;  1WSR A;  2BE5 A;  1J98 A;  3GTM C;  4OIP A;  4RMF A;  5C44 C;  1JQW A;  3IPJ A;  4YG2 A;  1XXA A;  3T02 A;  4BXX C;  2R93 K;  4X6A K;  3PO3 C;  3GTO C;  1K83 A;  3HOV C;  3S17 C;  4A3G K;  3ADA C;  1B4B A;  2Y3P A;  4C3J C;  3M3Y C;  5IP7 C;  5M3M K;  4C45 A;  3BP3 A;  5IOS A;  1EK8 A;  2VUM K;  3N0B A;  3HOU K;  4A3E C;  3LAP A;  4P9S A;  4A3J K;  2E2H K;  4BY1 K;  1O2F B;  1IE0 A;  2XCR B;  1WOS A;  1XZP A;  1I3Q C;  1ZXO A;  2NVQ K;  4BBR C;  2NVX A;  1I6H K;  4A3L K;  1IW7 A;  1TWA K;  2RGR A;  1WSV A;  1DD5 A;  3S1N C;  1Y1V A;  3SZZ A;  2R7Z C;  3S16 C;  3TFH A;  5M3F K;  4G7O A;  4KDD A;  2R92 C;  1IQ0 A;  1DCP A;  1TWF K;  4KN4 A;  4A93 C;  2ZUF A;  2GSN A;  3PO2 K;  2E2J C;  2P5M A;  3FKI A;  4OIQ A;  3S1R C;  3A8K A;  3CQZ K;  2B63 A;  2JA6 A;  3I4M C;  2E2H C;  1TWC K;  4KAT A;  1O24 A;  4XSZ A;  5IYC K;  3GTJ A;  2JA8 K;  2WB1 L;  4OIN A;  2YU9 K;  2NVY C;  3RZD K;  1WCM K;  4BKW A;  1TWH A;  3GTL K;  2EBB A;  4LK0 A;  1IBA A;  5IYD K;  4BBS K;  5IP9 C;  4A3B C;  4Y52 C;  2RH6 A;  3HKZ L;  5HL8 A;  1ZQ1 C;  1O25 A;  1O2A A;  5FJ8 K;  3AD9 C;  3AQO A;  3H0G A;  5JFE A;  5IYB K;  5EGH A;  2A68 A;  1ZBS A;  1DCH A;  2WB1 D;  3TTG A;  2E2I C;  4A3I K;  3HOX K;  4YFX A;  5C4J C;  2PMZ D;  3GTM K;  2O5J A;  4KC6 A;  1XZP B;  4BXX K;  2JA7 C;  2R93 A;  2GSU A;  3PO3 K;  3GTO K;  3HOV K;  3HOY C;  1WIH A;  3T00 A;  3S15 C;  3S17 K;  4C3J K;  3M3Y K;  1EQR A;  4GT9 A;  3G4C A;  5IP7 K;  1YNJ A;  4GTC A;  4FM9 A;  4G0W A;  4A3M C;  5TMC A;  4AYB D;  2JA5 C;  3ORE A;  3S2H C;  2VUM A;  3HOX C;  4A3E K;  1BJT A;  1O26 A;  2E2H A;  4KB4 A;  5IOR A;  1I3Q K;  4M1X A;  2GAG C;  4BBR K;  3GEI A;  3NUH A;  1TWA A;  2V6S A;  2GAH C;  3Q3Q A;  4KB2 A;  3S1N K;  3OEP A;  2PPB A;  2R7Z K;  3S16 K;  1SFO C;  3HOW C;  3H3V L;  1J6V A;  3SZY A;  2R92 K;  1TWF A;  4KM8 A;  4A93 K;  4KN7 A;  3HOZ C;  3GTK A;  2E2J K;  2ZUE A;  3OPF A;  3S1R K;  3GTQ C;  3CQZ A;  3I4N C;  3S1Q C;  3I4M K;  1F93 A;  3TFI A;  2GSO A;  4KMA A;  4YFN A;  1TWC A;  1TWG C;  4G0U A;  2ZFZ A;  1Y1W C;  2NVY K;  2V6U A;  2XCO A;  2YU9 A;  1I50 C;  1WCM A;  1O29 A;  1V5V A;  1HI9 A;  3RZO C;  3AH5 A;  3GTP C;  3GTL A;  4A3C C;  1DCO A;  1J6X A;  3H3V D;  3AQP A;  3LAJ A;  5IP9 K;  5TMF A;  4A3B K;  4Y52 K;  2P8T A;  3HXA A;  5D4D A;  1R9T C;  1F9N A;  1UV7 A;  5CJ9 A;  1O27 A;  3S2D K;  3N0C A;  4BY7 C;  3S14 C;  2E2I K;  1O2B A;  3T01 A;  3GDZ A;  5C4J K;  1O28 A;  3DXJ A;  3GTM A;  4KMU A;  2NVT C;  4G7H A;  4LJZ A;  3QX3 A;  2CW0 A;  1YNN A;  5CHP A;  4GTL A;  4QJV A;  2JA7 K;  4J3N A;  2A6H A;  4XLN A;  3HOY K;  3GTO A;  4C2M C;  3S15 K;  1PJ7 A;  1XXB A;  5C3E C;  2XCQ A;  3CAG A;  4MQ9 A;  4LLG A;  3S2D C;  2CFA A;  1K83 C;  4A3M K;  2JA5 K;  3S2H K;  5TJ3 A;  4BLB A;  5M5X K;  1EH1 A;  3S1M C;  1I3Q A;  3K7A C;  1VH2 A;  3A8J A;  1AB4 A;  4QIW L;  4XCH A;  1PJ6 A;  1ZYR A;  4XLP A;  1INN A;  1WQF A;  3M4O C;  4GFQ A;  2NVX C;  2R7Z A;  1VLO A;  3HKZ D;  1SFO K;  3HOW K;  1JOE A;  4XSX A;  3FOE A;  2R92 A;  1Y1V C;  4WJ4 A;  3HOZ K;  4BLA A;  4ZH4 A;  3GTQ K;  4KAS A;  3I4N K;  3S1Q K;  1C0A A;  4Q4Z A;  3ERE D;  4A3F C;  4LOW A;  1XPP A;  2FQT A;  4C3H C;  4KAR A;  3FKI C;  1ISE A;  1TWG K;  2B63 C;  5JVO A;  2JA6 C;  3FHZ A;  2JH3 A;  1Y1W K;  1J6W A;  4AH6 A;  3A8I A;  2NVY A;  1I50 K;  1EI6 A;  1ZVU A;  5M5W K;  3GTJ C;  1WOO A;  3FOF A;  3RZO K;  4C3I C;  3GTP K;  4A3C K;  1XZQ A; 
#chains in the Genus database with same CATH homology
 4BKW A;  4P5B A;  1TWH A;  3AQP A;  3LAJ A;  3LPX A;  1R9T A;  2RH6 A;  4GTF A;  4P5A A;  1F9N A;  4KMH A;  1O25 A;  1O2A A;  1KQ4 A;  5CJ9 A;  1O27 A;  1GE9 A;  5IOQ A;  3AQO A;  3H0G A;  4LQY A;  5JFE A;  3N0C A;  5EGH A;  2E2I A;  1ZBS A;  3GTG A;  4GTE A;  2CFA B;  1O2B A;  4KMD A;  4GTA A;  3L4J A;  1B4A A;  1O28 A;  4DDQ A;  3GTM A;  4FZB A;  3QX3 A;  4KC6 A;  2JA7 A;  5CHP A;  4GTL A;  4J3N A;  2R93 A;  1XXA A;  2GSU A;  3GTO A;  4C2M C;  1XXB A;  3V4G A;  2XCQ A;  1WIH A;  3CAG A;  1K83 A;  2CFA A;  4GTD A;  4GT9 A;  1B4B A;  2Y3P A;  3G4C A;  4GTC A;  4C3J C;  1IS1 A;  2JA5 A;  4FM9 A;  2PHC B;  4G0W A;  1BGW A;  5TJ3 A;  5IOS A;  4BLB A;  1EK8 A;  3ORE A;  2VUM A;  1WQH A;  1EH1 A;  3N0B A;  1BJT A;  1O26 A;  3LAP A;  4KB4 A;  5IOR A;  1I3Q A;  2E2H A;  1AB4 A;  4M1X A;  2XCR B;  1WQF A;  1ZXO A;  3NUH A;  4GFQ A;  2NVX A;  1TWA A;  3Q3Q A;  2RGR A;  1SFO A;  4KB2 A;  1XXC A;  2R7Z A;  1DD5 A;  3OEP A;  4G0V A;  3N3Y A;  1Y1V A;  3L4K A;  3FOE A;  2R92 A;  4KDD A;  4GTB A;  1TWF A;  3VA7 A;  4KM8 A;  4BLA A;  3GTQ A;  3GTK A;  2GSN A;  3G4A A;  4KAS A;  3OPF A;  3ERE D;  2KWA A;  2P5M A;  3FKI A;  3CQZ A;  3MML B;  5IOT A;  2B63 A;  4KAR A;  5EGE A;  4C3H C;  1TWG A;  2GSO A;  2JA6 A;  1ISE A;  4KMA A;  1TWC A;  5JVO A;  4KAW X;  1Y1W A;  3FHZ A;  2JH3 A;  3BUE A;  4G0U A;  3S0X A;  2ZFZ A;  4KAT A;  1O24 A;  2NVY A;  1I50 A;  3GTJ A;  2XCO A;  2YU9 A;  1ZVU A;  4KM9 A;  1WCM A;  1O29 A;  3GTP A;  4ILD A;  3FOF A;  4C3I C;  4LR2 A;  1WQG A;  3AH5 A;  3GTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...