2ZFZA

Crystal structure of the c-terminal domain hexamer of argr from mycobacterium tuberculosis in complex with arginine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
77
structure length
77
Chain Sequence
TDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine repressor
publication title Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 22
structure length 77
sequence length 77
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2zfzA00
1WQGA 4DDQA 4KAWX 1IS1A 2P5MA 3VA7A 2KWAA 1EK8A 3LAPA 4FM9A 3OREA 2Y3PA 5CJ9A 2XCRB 3FOFA 2XCQA 3L4JA 4G0UA 3LAJA 2RGRA 3LPXA 1XXAA 1XXCA 4KC6A 3MMLB 4KB2A 1B4AA 2XCOA 1WQHA 2ZFZA 4G0WA 1DD5A 3OEPA 3L4KA 3BUEA 1F9NA 3FOEA 1EH1A 3V4GA 5JVOA 3FHZA 3OPFA 4J3NA 1WIHA 3CAGA 4G0VA 1B4BA 1BJTA 1GE9A 4GFQA 3QX3A 1AB4A 1ZVUA 3ERED 3NUHA 1WQFA 1XXBA 4KDDA 2PHCB 4KB4A 1ISEA 1BGWA
chains in the Genus database with same CATH superfamily
3GTJC 3GTKA 2WAQD 2O5JA 4NOIA 3LAJA 5FJ8K 2R92C 1TWCA 1IE0A 1IL2A 1J6WA 3CQZK 2E2HC 2JH3A 2GSUA 4PABA 4KMAA 3HOXC 5IYBC 2JA5C 3GTJK 1XZQB 3GDZA 4XLPA 5IYDC 3T02A 3HOYC 3LAPA 3EQLA 2R92K 1Y1VC 4G0UA 5TJ3A 2NVYA 3AD8C 2PPBA 1SFOA 1J6VA 1YNJA 1EI6A 2FQOA 4JK1A 3GTPC 3HOUC 4AYBD 2E2HK 5M5YK 2NVQC 3FKIA 3HOXK 4KARA 3G4CA 5IYBK 1TWFC 1IBAA 4A3JC 2JA5K 3CAGA 3ERED 5C4XC 3AD9C 4KDDA 3S2HC 5IYDK 3HOYK 4MEYA 4DDQA 4BY1C 4WJ3M 3GTKC 2PA8D 3GIRA 1Y1VK 4KMUA 4GTLA 2B63A 4C3HC 1USMA 1L0WA 3GTPK 3HOUK 4XCHA 3A8IA 1TWCC 2NVQK 3S1NC 4OINA 1X31C 1TWFK 2W7VA 3SZZA 4A3JK 4LK1A 1F9NA 1XZPA 3N0CA 3FHZA 1WIHA 5C4XK 4G0VA 2PMZD 3S2HK 2V6TA 4P5BA 5IP9C 2ZUFA 4BY1K 4ILDA 3GTKK 2ZUEA 3A8KA 1WCMA 1TWGC 2RH6A 3AH5A 3TFJA 2YU9A 2WAQL 4YFXA 3S17C 2R7ZA 1TWCK 4QIWD 3S1NK 2NVYC 1DCOA 1SFOC 4ZH4A 4A3LC 4KC6A 3BP8C 3TFIA 4P9SA 5C3EC 5EGHA 3L4KA 2WB1D 3FKIC 3FOEA 2CFAA 5IP9K 1HI9A 4XSXA 4QJVA 3RZDC 3GTLA 1ZYRA 1I3QA 2D6FC 1ISEA 1TWGK 1HQMA 5IORA 4PAAA 4X6AC 4A3IC 1VLOA 1O29A 3BP3A 4KM8A 3S17K 2NVYK 1RU0A 1SFOK 4GTAA 4A3LK 4Y52C 5C3EK 3S1QC 5JFEA 4A3MC 2R93A 2CW0A 3FKIK 3DXJA 1WOPA 2VUMA 1F7UA 4GTEA 4C3JC 3RZDK 1B4BA 1PJ6A 1O2AA 3HOZC 4G0WA 4A3IK 4GTDA 2PA8L 4YFKA 2YU9C 4Y52K 4GT9A 1O25A 3HXAA 5CHPA 2GAHC 2R7ZC 3S1QK 4A3MK 2JA8C 1TWHC 1DCHA 4OIQA 1TWAA 4C3JK 1EH1A 4J3NA 1BJTA 1EFWA 3HOZK 2PMZL 3GTLC 1WOOA 1I3QC 1VRQC 1DCPA 1J98A 5E68A 2YU9K 1ZQ1C 3OREA 4BLAA 2FQTA 2R7ZK 4C45A 2JA8K 1TWHK 4QIWL 4FZBA 1K83A 1BDFA 1XXCA 3JSTA 1EQRA 2R93C 1J6XA 4BBSC 4QJVB 2WB1L 3N0BA 4Y7NC 2VUMC 1Y1WA 3GTOC 1F7VA 3GTLK 1O24A 1IW7A 1I3QK 1ZBSA 3S2DC 3PO2C 4FM9A 3TFHA 5IOTA 2O5IA 3LPXA 1V5VA 2R93K 4BBSK 3S1MC 5TMFA 4A3KC 4KN4A 5M3MK 3ADAC 4Y7NK 1TWAC 2VUMK 5IOQA 3GTOK 2JA6A 3SZYA 4KMHA 5L46A 3S2DK 3PO2K 4LJZA 1BGWA 1WQGA 4BKWA 3H3VD 3HOVC 2NVXA 4C3HK 4A3CC 2EBBA 4AH6A 3S1MK 3GEEA 4A3KK 5FLMC 1B4AA 3T00A 1TWAK 4A3BC 1DD5A 2A69A 4GTFA 3S14C 2GSNA 4G7OA 1O2FB 5IOSA 1Y1WC 4BBRC 4GFQA 3QX3A 4LOWA 3S15C 1ZXOA 3HOWC 3GTGA 4KAWX 4A3EC 3HOVK 4A3CK 2JA7A 3FOFA 3T01A 1JOEA 1XZQA 3H0GA 2XCQA 4OIPA 1G51A 2B63C 4Q5SA 5FLMK 2RGRA 5EGEA 3S16C 4A3BK 5M3FK 4GTCA 4BY7C 4OIOA 2ZFZA 1INNA 3S14K 4BLBA 5HL8A 3PO3C 3GSIA 2E2IA 1Y1WK 4BBRK 2JA6C 3OPFA 3S15K 1WSVA 3HOWK 1AB4A 3N3YA 3M3YC 4XLNA 3NUHA 1YCLA 2A68A 1XXBA 4A3EK 3WODA 4X6AK 2E2JC 1XPPA 3GEIA 1Y1VA 1WCMC 2NVXC 2B63K 3GTMA 1SMYA 3IPJA 3S16K 4M1XA 4BY7K 3S1RC 1YNNA 5TMCA 3PO3K 1USOA 4KB2A 1XZPB 2A6EA 5M5XK 1JQWA 4G7HA 2JA6K 1TWFA 4RMFA 1O26A 3M3YK 1VJEA 1C0AA 4A93C 2GSOA 1YX2A 2E2JK 3GTGC 3M4OC 1IS1A 1WCMK 2NVXK 3H3VL 3A8JA 4WILA 2XCRB 2JA7C 2A6HA 3H0GC 3L4JA 3S1RK 1JVIA 5IP7C 3GTQA 4MQ9A 4LK0A 4LQYA 4OIRA 2CFAB 2BE5A 2E2IC 3HKZD 4Q4ZA 4C3IC 4A93K 4O2DA 1I6VA 3GTGK 3M4OK 1I50A 1TWGA 2JA7K 3H0GK 1O28A 2Y3PA 5CJ9A 1R9TA 3GTMC 5IP7K 2GAGC 4A3DC 1KQ4A 1F93A 1XXAA 3AQOA 4KM9A 2Y0SD 4MEXA 2E2IK 1IQ0A 4GZYA 2V6UA 4C3IK 1I6HC 1BS2A 3K7AC 3I4MC 2V6SA 5IYCC 4LR2A 2NVTC 1EK8A 2P8TA 4KATA 5C44C 3GTMK 5M5WK 4A3DK 3GTQC 1K83C 3MMLB 3I4NC 1WQHA 4YFNA 1I6HK 3CQZA 1VGXA 3K7AK 3I4MK 3V4GA 1PJ5A 5IYCK 3GEHA 5D4DA 3AD7C 1ZVUA 2NVTK 2PHCB 3GTJA 4XSZA 1I50C 5C44K 4C2MC 2P5MA 3VA7A 2KWAA 1VH2A 1O2BA 3AQPA 4GTBA 1R9TC 1WSRA 3GTQK 2R92A 1PJ7A 1K83K 1TWHA 4KN7A 4LLGA 3Q3QA 3TTGA 3I4NK 4G7ZA 2E2HA 4A3FC 3OEPA 4BXXC 3BUEA 1WOSA 1GE9A 3HKZL 2JA5A 3RZOC 3S0XA 4YG2A 1I50K 4C2MK 4KB4A 1WORA 5C4JC 4A3GC 3G4AA 1R9TK 4P5AA 4KMDA 3GTPA 4AYBL 4A3FK 2XCOA 4BXXK 2Y0SL 3CQZC 3GTOA 5JVOA 3RZOK 4WJ4A 4KASA 1UV7A 1O27A 5C4JK 1WQFA 4A3GK
chains in the Genus database with same CATH topology
1I50A 1WQGA 4BKWA 5IORA 1TWGA 3GTKA 1O28A 2Y3PA 5CJ9A 1O29A 4KM8A 2NVXA 1R9TA 3LAJA 1KQ4A 4GTAA 1TWCA 1XXAA 5JFEA 1B4AA 3AQOA 4KM9A 2R93A 1DD5A 2JH3A 2GSUA 4GTFA 4KMAA 2VUMA 4GTEA 2GSNA 4C3JC 1B4BA 5IOSA 4GFQA 3QX3A 1O2AA 1ZXOA 4LR2A 3GTGA 4G0WA 4KAWX 1EK8A 4GTDA 3LAPA 4KATA 3FOFA 2JA7A 3H0GA 4GT9A 2XCQA 4G0UA 1O25A 5TJ3A 2NVYA 5CHPA 2RGRA 1SFOA 5EGEA 4GTCA 3MMLB 1WQHA 2ZFZA 3FKIA 1TWAA 4BLBA 3CQZA 4KARA 3G4CA 2E2IA 1EH1A 3V4GA 3OPFA 4J3NA 3CAGA 1BJTA 1AB4A 1ZVUA 3N3YA 3ERED 3NUHA 1XXBA 4KDDA 2PHCB 3GTJA 4DDQA 4C2MC 2P5MA 3VA7A 2KWAA 3OREA 1O2BA 1Y1VA 4BLAA 3AQPA 4GTLA 2B63A 3GTMA 4C3HC 4GTBA 4M1XA 2R92A 1TWHA 1K83A 4FZBA 3Q3QA 1XXCA 4KB2A 2E2HA 3OEPA 1TWFA 1O26A 3BUEA 1F9NA 3N0BA 3N0CA 3FHZA 1GE9A 1WIHA 4G0VA 1Y1WA 1O24A 2JA5A 3S0XA 4P5BA 1ZBSA 4ILDA 4KB4A 2GSOA 1IS1A 3G4AA 1WCMA 4FM9A 2RH6A 3AH5A 2XCRB 2YU9A 4P5AA 3L4JA 4KMDA 2R7ZA 5IOTA 3LPXA 3GTPA 3GTQA 4KC6A 2XCOA 4LQYA 2CFAB 5EGHA 3L4KA 5IOQA 2JA6A 3FOEA 3GTOA 2CFAA 5JVOA 4KMHA 4C3IC 4KASA 3GTLA 1O27A 1WQFA 1I3QA 1ISEA 1BGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQG A;  4DDQ A;  4KAW X;  1IS1 A;  2P5M A;  3VA7 A;  2KWA A;  1EK8 A;  3LAP A;  4FM9 A;  3ORE A;  2Y3P A;  5CJ9 A;  2XCR B;  3FOF A;  2XCQ A;  3L4J A;  4G0U A;  3LAJ A;  2RGR A;  3LPX A;  1XXA A;  1XXC A;  4KC6 A;  3MML B;  4KB2 A;  1B4A A;  2XCO A;  1WQH A;  2ZFZ A;  4G0W A;  1DD5 A;  3OEP A;  3L4K A;  3BUE A;  1F9N A;  3FOE A;  1EH1 A;  3V4G A;  5JVO A;  3FHZ A;  3OPF A;  4J3N A;  1WIH A;  3CAG A;  4G0V A;  1B4B A;  1BJT A;  1GE9 A;  4GFQ A;  3QX3 A;  1AB4 A;  1ZVU A;  3ERE D;  3NUH A;  1WQF A;  1XXB A;  4KDD A;  2PHC B;  4KB4 A;  1ISE A;  1BGW A; 
#chains in the Genus database with same CATH topology
 3GTJ C;  3GTK A;  2WAQ D;  2O5J A;  4NOI A;  3LAJ A;  5FJ8 K;  2R92 C;  1TWC A;  1IE0 A;  1IL2 A;  1J6W A;  3CQZ K;  2E2H C;  2JH3 A;  2GSU A;  4PAB A;  4KMA A;  3HOX C;  5IYB C;  2JA5 C;  3GTJ K;  1XZQ B;  3GDZ A;  4XLP A;  5IYD C;  3T02 A;  3HOY C;  3LAP A;  3EQL A;  2R92 K;  1Y1V C;  4G0U A;  5TJ3 A;  2NVY A;  3AD8 C;  2PPB A;  1SFO A;  1J6V A;  1YNJ A;  1EI6 A;  2FQO A;  4JK1 A;  3GTP C;  3HOU C;  4AYB D;  2E2H K;  5M5Y K;  2NVQ C;  3FKI A;  3HOX K;  4KAR A;  3G4C A;  5IYB K;  1TWF C;  1IBA A;  4A3J C;  2JA5 K;  3CAG A;  3ERE D;  5C4X C;  3AD9 C;  4KDD A;  3S2H C;  5IYD K;  3HOY K;  4MEY A;  4DDQ A;  4BY1 C;  4WJ3 M;  3GTK C;  2PA8 D;  3GIR A;  1Y1V K;  4KMU A;  4GTL A;  2B63 A;  4C3H C;  1USM A;  1L0W A;  3GTP K;  3HOU K;  4XCH A;  3A8I A;  1TWC C;  2NVQ K;  3S1N C;  4OIN A;  1X31 C;  1TWF K;  2W7V A;  3SZZ A;  4A3J K;  4LK1 A;  1F9N A;  1XZP A;  3N0C A;  3FHZ A;  1WIH A;  5C4X K;  4G0V A;  2PMZ D;  3S2H K;  2V6T A;  4P5B A;  5IP9 C;  2ZUF A;  4BY1 K;  4ILD A;  3GTK K;  2ZUE A;  3A8K A;  1WCM A;  1TWG C;  2RH6 A;  3AH5 A;  3TFJ A;  2YU9 A;  2WAQ L;  4YFX A;  3S17 C;  2R7Z A;  1TWC K;  4QIW D;  3S1N K;  2NVY C;  1DCO A;  1SFO C;  4ZH4 A;  4A3L C;  4KC6 A;  3BP8 C;  3TFI A;  4P9S A;  5C3E C;  5EGH A;  3L4K A;  2WB1 D;  3FKI C;  3FOE A;  2CFA A;  5IP9 K;  1HI9 A;  4XSX A;  4QJV A;  3RZD C;  3GTL A;  1ZYR A;  1I3Q A;  2D6F C;  1ISE A;  1TWG K;  1HQM A;  5IOR A;  4PAA A;  4X6A C;  4A3I C;  1VLO A;  1O29 A;  3BP3 A;  4KM8 A;  3S17 K;  2NVY K;  1RU0 A;  1SFO K;  4GTA A;  4A3L K;  4Y52 C;  5C3E K;  3S1Q C;  5JFE A;  4A3M C;  2R93 A;  2CW0 A;  3FKI K;  3DXJ A;  1WOP A;  2VUM A;  1F7U A;  4GTE A;  4C3J C;  3RZD K;  1B4B A;  1PJ6 A;  1O2A A;  3HOZ C;  4G0W A;  4A3I K;  4GTD A;  2PA8 L;  4YFK A;  2YU9 C;  4Y52 K;  4GT9 A;  1O25 A;  3HXA A;  5CHP A;  2GAH C;  2R7Z C;  3S1Q K;  4A3M K;  2JA8 C;  1TWH C;  1DCH A;  4OIQ A;  1TWA A;  4C3J K;  1EH1 A;  4J3N A;  1BJT A;  1EFW A;  3HOZ K;  2PMZ L;  3GTL C;  1WOO A;  1I3Q C;  1VRQ C;  1DCP A;  1J98 A;  5E68 A;  2YU9 K;  1ZQ1 C;  3ORE A;  4BLA A;  2FQT A;  2R7Z K;  4C45 A;  2JA8 K;  1TWH K;  4QIW L;  4FZB A;  1K83 A;  1BDF A;  1XXC A;  3JST A;  1EQR A;  2R93 C;  1J6X A;  4BBS C;  4QJV B;  2WB1 L;  3N0B A;  4Y7N C;  2VUM C;  1Y1W A;  3GTO C;  1F7V A;  3GTL K;  1O24 A;  1IW7 A;  1I3Q K;  1ZBS A;  3S2D C;  3PO2 C;  4FM9 A;  3TFH A;  5IOT A;  2O5I A;  3LPX A;  1V5V A;  2R93 K;  4BBS K;  3S1M C;  5TMF A;  4A3K C;  4KN4 A;  5M3M K;  3ADA C;  4Y7N K;  1TWA C;  2VUM K;  5IOQ A;  3GTO K;  2JA6 A;  3SZY A;  4KMH A;  5L46 A;  3S2D K;  3PO2 K;  4LJZ A;  1BGW A;  1WQG A;  4BKW A;  3H3V D;  3HOV C;  2NVX A;  4C3H K;  4A3C C;  2EBB A;  4AH6 A;  3S1M K;  3GEE A;  4A3K K;  5FLM C;  1B4A A;  3T00 A;  1TWA K;  4A3B C;  1DD5 A;  2A69 A;  4GTF A;  3S14 C;  2GSN A;  4G7O A;  1O2F B;  5IOS A;  1Y1W C;  4BBR C;  4GFQ A;  3QX3 A;  4LOW A;  3S15 C;  1ZXO A;  3HOW C;  3GTG A;  4KAW X;  4A3E C;  3HOV K;  4A3C K;  2JA7 A;  3FOF A;  3T01 A;  1JOE A;  1XZQ A;  3H0G A;  2XCQ A;  4OIP A;  1G51 A;  2B63 C;  4Q5S A;  5FLM K;  2RGR A;  5EGE A;  3S16 C;  4A3B K;  5M3F K;  4GTC A;  4BY7 C;  4OIO A;  2ZFZ A;  1INN A;  3S14 K;  4BLB A;  5HL8 A;  3PO3 C;  3GSI A;  2E2I A;  1Y1W K;  4BBR K;  2JA6 C;  3OPF A;  3S15 K;  1WSV A;  3HOW K;  1AB4 A;  3N3Y A;  3M3Y C;  4XLN A;  3NUH A;  1YCL A;  2A68 A;  1XXB A;  4A3E K;  3WOD A;  4X6A K;  2E2J C;  1XPP A;  3GEI A;  1Y1V A;  1WCM C;  2NVX C;  2B63 K;  3GTM A;  1SMY A;  3IPJ A;  3S16 K;  4M1X A;  4BY7 K;  3S1R C;  1YNN A;  5TMC A;  3PO3 K;  1USO A;  4KB2 A;  1XZP B;  2A6E A;  5M5X K;  1JQW A;  4G7H A;  2JA6 K;  1TWF A;  4RMF A;  1O26 A;  3M3Y K;  1VJE A;  1C0A A;  4A93 C;  2GSO A;  1YX2 A;  2E2J K;  3GTG C;  3M4O C;  1IS1 A;  1WCM K;  2NVX K;  3H3V L;  3A8J A;  4WIL A;  2XCR B;  2JA7 C;  2A6H A;  3H0G C;  3L4J A;  3S1R K;  1JVI A;  5IP7 C;  3GTQ A;  4MQ9 A;  4LK0 A;  4LQY A;  4OIR A;  2CFA B;  2BE5 A;  2E2I C;  3HKZ D;  4Q4Z A;  4C3I C;  4A93 K;  4O2D A;  1I6V A;  3GTG K;  3M4O K;  1I50 A;  1TWG A;  2JA7 K;  3H0G K;  1O28 A;  2Y3P A;  5CJ9 A;  1R9T A;  3GTM C;  5IP7 K;  2GAG C;  4A3D C;  1KQ4 A;  1F93 A;  1XXA A;  3AQO A;  4KM9 A;  2Y0S D;  4MEX A;  2E2I K;  1IQ0 A;  4GZY A;  2V6U A;  4C3I K;  1I6H C;  1BS2 A;  3K7A C;  3I4M C;  2V6S A;  5IYC C;  4LR2 A;  2NVT C;  1EK8 A;  2P8T A;  4KAT A;  5C44 C;  3GTM K;  5M5W K;  4A3D K;  3GTQ C;  1K83 C;  3MML B;  3I4N C;  1WQH A;  4YFN A;  1I6H K;  3CQZ A;  1VGX A;  3K7A K;  3I4M K;  3V4G A;  1PJ5 A;  5IYC K;  3GEH A;  5D4D A;  3AD7 C;  1ZVU A;  2NVT K;  2PHC B;  3GTJ A;  4XSZ A;  1I50 C;  5C44 K;  4C2M C;  2P5M A;  3VA7 A;  2KWA A;  1VH2 A;  1O2B A;  3AQP A;  4GTB A;  1R9T C;  1WSR A;  3GTQ K;  2R92 A;  1PJ7 A;  1K83 K;  1TWH A;  4KN7 A;  4LLG A;  3Q3Q A;  3TTG A;  3I4N K;  4G7Z A;  2E2H A;  4A3F C;  3OEP A;  4BXX C;  3BUE A;  1WOS A;  1GE9 A;  3HKZ L;  2JA5 A;  3RZO C;  3S0X A;  4YG2 A;  1I50 K;  4C2M K;  4KB4 A;  1WOR A;  5C4J C;  4A3G C;  3G4A A;  1R9T K;  4P5A A;  4KMD A;  3GTP A;  4AYB L;  4A3F K;  2XCO A;  4BXX K;  2Y0S L;  3CQZ C;  3GTO A;  5JVO A;  3RZO K;  4WJ4 A;  4KAS A;  1UV7 A;  1O27 A;  5C4J K;  1WQF A;  4A3G K; 
#chains in the Genus database with same CATH homology
 1I50 A;  1WQG A;  4BKW A;  5IOR A;  1TWG A;  3GTK A;  1O28 A;  2Y3P A;  5CJ9 A;  1O29 A;  4KM8 A;  2NVX A;  1R9T A;  3LAJ A;  1KQ4 A;  4GTA A;  1TWC A;  1XXA A;  5JFE A;  1B4A A;  3AQO A;  4KM9 A;  2R93 A;  1DD5 A;  2JH3 A;  2GSU A;  4GTF A;  4KMA A;  2VUM A;  4GTE A;  2GSN A;  4C3J C;  1B4B A;  5IOS A;  4GFQ A;  3QX3 A;  1O2A A;  1ZXO A;  4LR2 A;  3GTG A;  4G0W A;  4KAW X;  1EK8 A;  4GTD A;  3LAP A;  4KAT A;  3FOF A;  2JA7 A;  3H0G A;  4GT9 A;  2XCQ A;  4G0U A;  1O25 A;  5TJ3 A;  2NVY A;  5CHP A;  2RGR A;  1SFO A;  5EGE A;  4GTC A;  3MML B;  1WQH A;  2ZFZ A;  3FKI A;  1TWA A;  4BLB A;  3CQZ A;  4KAR A;  3G4C A;  2E2I A;  1EH1 A;  3V4G A;  3OPF A;  4J3N A;  3CAG A;  1BJT A;  1AB4 A;  1ZVU A;  3N3Y A;  3ERE D;  3NUH A;  1XXB A;  4KDD A;  2PHC B;  3GTJ A;  4DDQ A;  4C2M C;  2P5M A;  3VA7 A;  2KWA A;  3ORE A;  1O2B A;  1Y1V A;  4BLA A;  3AQP A;  4GTL A;  2B63 A;  3GTM A;  4C3H C;  4GTB A;  4M1X A;  2R92 A;  1TWH A;  1K83 A;  4FZB A;  3Q3Q A;  1XXC A;  4KB2 A;  2E2H A;  3OEP A;  1TWF A;  1O26 A;  3BUE A;  1F9N A;  3N0B A;  3N0C A;  3FHZ A;  1GE9 A;  1WIH A;  4G0V A;  1Y1W A;  1O24 A;  2JA5 A;  3S0X A;  4P5B A;  1ZBS A;  4ILD A;  4KB4 A;  2GSO A;  1IS1 A;  3G4A A;  1WCM A;  4FM9 A;  2RH6 A;  3AH5 A;  2XCR B;  2YU9 A;  4P5A A;  3L4J A;  4KMD A;  2R7Z A;  5IOT A;  3LPX A;  3GTP A;  3GTQ A;  4KC6 A;  2XCO A;  4LQY A;  2CFA B;  5EGH A;  3L4K A;  5IOQ A;  2JA6 A;  3FOE A;  3GTO A;  2CFA A;  5JVO A;  4KMH A;  4C3I C;  4KAS A;  3GTL A;  1O27 A;  1WQF A;  1I3Q A;  1ISE A;  1BGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...