5JVOA

Crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
b'GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine repressor
publication title Tyrosine binding and promiscuity in the arginine repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis.
pubmed doi rcsb
source organism Corynebacterium pseudotuberculosis
molecule tags Dna binding protein
total genus 21
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jvoA00
1WQGA 3LAPA 2P5MA 3BUEA 4J3NA 1BGWA 3OPFA 1EH1A 3CAGA 3VA7A 3NUHA 1DD5A 3LAJA 1XXBA 1WQHA 2XCQA 1B4AA 2ZFZA 4KC6A 1GE9A 1WQFA 3V4GA 3QX3A 4G0UA 1B4BA 1ISEA 5CJ9A 1ZVUA 1WIHA 1BJTA 4KB2A 2RGRA 4GFQA 2KWAA 3OEPA 5JVOA 1IS1A 3OREA 2XCRB 3LPXA 2PHCB 3FOEA 4G0VA 1XXAA 4KDDA 4G0WA 3MMLB 2Y3PA 4FM9A 1AB4A 4KB4A 4DDQA 3L4JA 3FOFA 1XXCA 4KAWX 3ERED 3L4KA 2XCOA 3FHZA 1EK8A 1F9NA
chains in the Genus database with same CATH superfamily
3AQOA 1O27A 2R93K 1O26A 2Y0SL 3CAGA 5IYBK 4A3JC 2JA7K 2JA8C 3GSIA 1C0AA 1IW7A 4A3FC 1R9TC 1B4BA 1ISEA 3TFHA 1JVIA 4KB2A 4A3MC 3FKIC 3S15K 3GTQC 3H3VD 3JSTA 4QIWL 4PAAA 5IYDC 1IQ0A 3L4JA 2BE5A 4Q4ZA 4BY1C 3GEHA 4A3LC 5IOTA 2R92K 1WSVA 3GEIA 3GDZA 4A3DK 1F9NA 1KQ4A 3A8KA 1BGWA 2GSUA 5M3MK 1EH1A 1PJ5A 3GTGA 2A69A 4LK0A 3HOVC 5IOQA 4XCHA 2R7ZC 3QX3A 2NVTC 1XZQB 2JA6A 5C44C 1BDFA 3OREA 4AYBD 3HOXK 1Y1VC 4G0VA 3H3VL 1INNA 3GTPC 2Y3PA 4C3JC 1XZPA 1TWGC 2E2JK 3T00A 2PA8D 1EK8A 4A3BC 1IBAA 3N0BA 5EGEA 3GTLA 3HKZD 4A3GC 1J6XA 5M5YK 3SZYA 5JFEA 2JA8K 4GZYA 4A3FK 1XXBA 1EQRA 1R9TK 3HOWC 3HOUK 4LJZA 5M3FK 2WAQL 2E2IC 4AYBL 3GTQK 3LPXA 4WILA 3S1MC 2O5IA 4JK1A 4MQ9A 4X6AC 1JQWA 4BY1K 4G7ZA 1TWCA 4G7OA 3HKZL 4NOIA 4OIPA 3AQPA 1WQGA 3I4NK 2JA5C 4MEXA 3S2HC 3HOVK 2R7ZK 2R93C 3GTJC 5IYBC 2JA7C 2NVTK 1VLOA 3GTOC 4P9SA 4XSXA 1SMYA 1TWFC 5C44K 1HQMA 2YU9A 5D4DA 1I50A 1I6VA 3MMLB 4A3IC 4C3JK 1V5VA 4C3IK 1TWGK 5TMCA 1XXCA 3G4AA 4A3BK 1WCMC 4BKWA 1G51A 3HOZC 2V6SA 3AD7C 3HOWK 2JH3A 4KC6A 4C45A 2FQTA 2VUMA 3ADAC 2E2IK 4WJ3M 3S1MK 3PO2C 3AD8C 5EGHA 2E2HC 3M3YK 3ERED 5C4JC 2E2JC 2JA5K 3BUEA 1ZBSA 3OPFA 3S2HK 4PABA 3VA7A 1TWAA 3GTJK 4Y7NC 1GE9A 3GTOK 2ZUFA 1TWFK 5IOSA 3TTGA 3OEPA 3HOUC 1IS1A 4A93C 1O28A 4KN7A 1K83A 4LOWA 4A3IK 4BY7C 1JOEA 4QJVA 2GSNA 3GTMA 1WCMK 4KM8A 1I3QA 3FKIA 1SFOK 3HOZK 4ZH4A 3I4NC 5FJ8K 3M4OC 4XLNA 3LAJA 3V4GA 3N3YA 3A8JA 1DCHA 5FLMC 4KMDA 5CJ9A 1BJTA 1UV7A 1TWHA 4KATA 2XCRB 3S1NK 3PO2K 2PPBA 4XLPA 3GTGC 1YNJA 2E2HK 4C3IC 1O2BA 2GSOA 4M1XA 3L4KA 5C4JK 1USOA 3G4CA 3H0GK 3I4MK 5TJ3A 1J98A 1Y1VA 3GTKK 3GTPA 4GTDA 1Y1WA 4Y7NK 2XCQA 4YFNA 4A3KC 4BBSK 4C2MC 1YNNA 3AD9C 2B63A 2EBBA 3GTLC 4A93K 5IP9C 4BY7K 3CQZA 3M3YC 4C3HC 2PA8L 4OIQA 4J3NA 2NVYA 4WJ4A 1J6WA 3IPJA 3S1RK 3M4OK 3S17C 1WSRA 2D6FC 2NVXA 1HI9A 5FLMK 3EQLA 2WB1D 1O29A 4GTEA 1IL2A 1TWCC 4KMUA 3S2DK 4GTCA 3AH5A 1DCPA 2ZUEA 1XXAA 3S1QC 3GTGK 4BXXK 2A68A 2R93A 2JA7A 2RH6A 4KB4A 4KMAA 4O2DA 1ZXOA 4QJVB 2JA6K 1ZYRA 2YU9C 1PJ6A 1VH2A 1SFOC 1I50C 4Y52C 5C4XK 3RZDC 4A3KK 2CFAB 4C2MK 2P8TA 2WB1L 5M5WK 1O25A 2R92A 3GTLK 4LQYA 4GTLA 5JVOA 5IP9K 3S14K 3S1NC 3WODA 1I6HC 1XPPA 4OIOA 4KAWX 2VUMC 4AH6A 2XCOA 4C3HK 3H0GC 3I4MC 1VJEA 4YFKA 4A3EC 2GAGC 3S17K 3GTKC 1WOPA 1WQHA 2ZFZA 1B4AA 1TWCK 4BBSC 2RGRA 3A8IA 4GFQA 2KWAA 1X31C 3S1QK 2V6TA 4OIRA 1WORA 4QIWD 2A6EA 2NVQC 3K7AK 1TWAC 4FM9A 2PMZD 1R9TA 4BBRK 4YG2A 3BP8C 2YU9K 3PO3C 3BP3A 1I50K 4Y52K 3GTQA 1K83C 1F93A 3RZDK 2CFAA 3S16C 3S1RC 4BLBA 4OINA 4KASA 4G0UA 3GTMC 1USMA 2FQOA 1I3QC 4GTBA 4P5BA 3S2DC 4A3CC 1I6HK 2PMZL 4KN4A 3GIRA 4DDQA 5IYCC 2VUMK 4BXXC 2R7ZA 2O5JA 4LR2A 5TMFA 2V6UA 2JA6C 1TWHC 1IE0A 4A3EK 3LAPA 1WOSA 1DD5A 4LLGA 3TFIA 1DCOA 5C4XC 1TWGA 1F7UA 2WAQD 1ZVUA 4ILDA 5IP7C 4KDDA 1EFWA 1TWAK 2NVQK 1EI6A 1Y1WC 5L46A 2W7VA 3S14C 1AB4A 1F7VA 5C3EK 2A6HA 3S0XA 2B63C 3PO3K 2E2IA 1K83K 4A3JK 2CW0A 4KARA 3S16K 1RU0A 3NUHA 1WQFA 3CQZC 3GTMK 1O2AA 1I3QK 1VGXA 3FKIK 4A3MK 4A3CK 4BLAA 1WOOA 3Q3QA 2JA5A 2NVYC 2PHCB 5IYDK 1VRQC 4KM9A 4RMFA 4XSZA 5IYCK 3GTJA 2NVXC 4A3LK 3RZOC 3K7AC 3GTOA 3T02A 4KMHA 1TWFA 1TWHK 4BBRC 3HOYC 4Q5SA 3T01A 1J6VA 1YCLA 1YX2A 1BS2A 5IORA 1XZQA 4P5AA 4LK1A 3HXAA 5HL8A 1WIHA 1ZQ1C 5IP7K 1WCMA 1Y1VK 4GT9A 1SFOA 3GTPK 5E68A 3S15C 1Y1WK 4G0WA 1O2FB 3TFJA 1L0WA 4FZBA 2B63K 4A3GK 4YFXA 2R92C 4A3DC 2P5MA 4GTAA 1PJ7A 3GEEA 2Y0SD 3CQZK 2GAHC 2E2HA 4G7HA 3N0CA 5CHPA 4MEYA 4GTFA 3H0GA 1O24A 2NVYK 4X6AK 3FOEA 3GTKA 3HOXC 2NVXK 3RZOK 3SZZA 3FOFA 3DXJA 5M5XK 1XZPB 5C3EC 3HOYK 3FHZA
chains in the Genus database with same CATH topology
4BKWA 3LAPA 4J3NA 2NVYA 3AQOA 1O27A 1O26A 3CAGA 1DD5A 2JH3A 2NVXA 4KC6A 2VUMA 1TWGA 1O29A 1B4BA 4GTEA 1ISEA 1ZVUA 4KB2A 4ILDA 4GTCA 3AH5A 1XXAA 4KDDA 2R93A 2JA7A 2RH6A 1AB4A 4KB4A 3L4JA 5EGHA 3S0XA 4KMAA 1ZXOA 3ERED 5IOTA 1F9NA 1KQ4A 2E2IA 3BUEA 1ZBSA 1BGWA 3OPFA 2GSUA 4KARA 1EH1A 3VA7A 1TWAA 3GTGA 3NUHA 5IOQA 1GE9A 2CFAB 1WQFA 3QX3A 1O2AA 1O25A 5IOSA 2JA6A 2R92A 4LQYA 3OEPA 4GTLA 5JVOA 4BLAA 1IS1A 3OREA 3Q3QA 2JA5A 1O28A 2PHCB 1K83A 4G0VA 4KM9A 2Y3PA 4C3JC 3GTJA 2GSNA 4KAWX 3GTOA 3GTMA 4KMHA 2XCOA 1TWFA 4KM8A 1EK8A 1I3QA 3FKIA 3N0BA 5EGEA 3GTLA 5JFEA 5IORA 3LAJA 1XXBA 1WQHA 2ZFZA 1B4AA 4P5AA 3V4GA 3N3YA 4KMDA 5CJ9A 2RGRA 1WIHA 1BJTA 1WCMA 4GFQA 2KWAA 1TWHA 4KATA 4GT9A 2XCRB 1SFOA 3LPXA 4G0WA 4FM9A 1R9TA 4C3IC 1O2BA 2GSOA 4M1XA 4FZBA 3L4KA 3G4CA 1TWCA 5TJ3A 3AQPA 1WQGA 1Y1VA 2P5MA 4GTAA 3GTQA 3GTPA 4GTDA 1Y1WA 2CFAA 2XCQA 4BLBA 4KASA 2E2HA 4C2MC 4G0UA 3N0CA 5CHPA 2B63A 4GTFA 3H0GA 1O24A 4GTBA 2YU9A 4P5BA 3FOEA 1I50A 3GTKA 3MMLB 4DDQA 2R7ZA 3CQZA 3FOFA 1XXCA 3G4AA 4LR2A 3FHZA 4C3HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQG A;  3LAP A;  2P5M A;  3BUE A;  4J3N A;  1BGW A;  3OPF A;  1EH1 A;  3CAG A;  3VA7 A;  3NUH A;  1DD5 A;  3LAJ A;  1XXB A;  1WQH A;  2XCQ A;  1B4A A;  2ZFZ A;  4KC6 A;  1GE9 A;  1WQF A;  3V4G A;  3QX3 A;  4G0U A;  1B4B A;  1ISE A;  5CJ9 A;  1ZVU A;  1WIH A;  1BJT A;  4KB2 A;  2RGR A;  4GFQ A;  2KWA A;  3OEP A;  5JVO A;  1IS1 A;  3ORE A;  2XCR B;  3LPX A;  2PHC B;  3FOE A;  4G0V A;  1XXA A;  4KDD A;  4G0W A;  3MML B;  2Y3P A;  4FM9 A;  1AB4 A;  4KB4 A;  4DDQ A;  3L4J A;  3FOF A;  1XXC A;  4KAW X;  3ERE D;  3L4K A;  2XCO A;  3FHZ A;  1EK8 A;  1F9N A; 
#chains in the Genus database with same CATH topology
 3AQO A;  1O27 A;  2R93 K;  1O26 A;  2Y0S L;  3CAG A;  5IYB K;  4A3J C;  2JA7 K;  2JA8 C;  3GSI A;  1C0A A;  1IW7 A;  4A3F C;  1R9T C;  1B4B A;  1ISE A;  3TFH A;  1JVI A;  4KB2 A;  4A3M C;  3FKI C;  3S15 K;  3GTQ C;  3H3V D;  3JST A;  4QIW L;  4PAA A;  5IYD C;  1IQ0 A;  3L4J A;  2BE5 A;  4Q4Z A;  4BY1 C;  3GEH A;  4A3L C;  5IOT A;  2R92 K;  1WSV A;  3GEI A;  3GDZ A;  4A3D K;  1F9N A;  1KQ4 A;  3A8K A;  1BGW A;  2GSU A;  5M3M K;  1EH1 A;  1PJ5 A;  3GTG A;  2A69 A;  4LK0 A;  3HOV C;  5IOQ A;  4XCH A;  2R7Z C;  3QX3 A;  2NVT C;  1XZQ B;  2JA6 A;  5C44 C;  1BDF A;  3ORE A;  4AYB D;  3HOX K;  1Y1V C;  4G0V A;  3H3V L;  1INN A;  3GTP C;  2Y3P A;  4C3J C;  1XZP A;  1TWG C;  2E2J K;  3T00 A;  2PA8 D;  1EK8 A;  4A3B C;  1IBA A;  3N0B A;  5EGE A;  3GTL A;  3HKZ D;  4A3G C;  1J6X A;  5M5Y K;  3SZY A;  5JFE A;  2JA8 K;  4GZY A;  4A3F K;  1XXB A;  1EQR A;  1R9T K;  3HOW C;  3HOU K;  4LJZ A;  5M3F K;  2WAQ L;  2E2I C;  4AYB L;  3GTQ K;  3LPX A;  4WIL A;  3S1M C;  2O5I A;  4JK1 A;  4MQ9 A;  4X6A C;  1JQW A;  4BY1 K;  4G7Z A;  1TWC A;  4G7O A;  3HKZ L;  4NOI A;  4OIP A;  3AQP A;  1WQG A;  3I4N K;  2JA5 C;  4MEX A;  3S2H C;  3HOV K;  2R7Z K;  2R93 C;  3GTJ C;  5IYB C;  2JA7 C;  2NVT K;  1VLO A;  3GTO C;  4P9S A;  4XSX A;  1SMY A;  1TWF C;  5C44 K;  1HQM A;  2YU9 A;  5D4D A;  1I50 A;  1I6V A;  3MML B;  4A3I C;  4C3J K;  1V5V A;  4C3I K;  1TWG K;  5TMC A;  1XXC A;  3G4A A;  4A3B K;  1WCM C;  4BKW A;  1G51 A;  3HOZ C;  2V6S A;  3AD7 C;  3HOW K;  2JH3 A;  4KC6 A;  4C45 A;  2FQT A;  2VUM A;  3ADA C;  2E2I K;  4WJ3 M;  3S1M K;  3PO2 C;  3AD8 C;  5EGH A;  2E2H C;  3M3Y K;  3ERE D;  5C4J C;  2E2J C;  2JA5 K;  3BUE A;  1ZBS A;  3OPF A;  3S2H K;  4PAB A;  3VA7 A;  1TWA A;  3GTJ K;  4Y7N C;  1GE9 A;  3GTO K;  2ZUF A;  1TWF K;  5IOS A;  3TTG A;  3OEP A;  3HOU C;  1IS1 A;  4A93 C;  1O28 A;  4KN7 A;  1K83 A;  4LOW A;  4A3I K;  4BY7 C;  1JOE A;  4QJV A;  2GSN A;  3GTM A;  1WCM K;  4KM8 A;  1I3Q A;  3FKI A;  1SFO K;  3HOZ K;  4ZH4 A;  3I4N C;  5FJ8 K;  3M4O C;  4XLN A;  3LAJ A;  3V4G A;  3N3Y A;  3A8J A;  1DCH A;  5FLM C;  4KMD A;  5CJ9 A;  1BJT A;  1UV7 A;  1TWH A;  4KAT A;  2XCR B;  3S1N K;  3PO2 K;  2PPB A;  4XLP A;  3GTG C;  1YNJ A;  2E2H K;  4C3I C;  1O2B A;  2GSO A;  4M1X A;  3L4K A;  5C4J K;  1USO A;  3G4C A;  3H0G K;  3I4M K;  5TJ3 A;  1J98 A;  1Y1V A;  3GTK K;  3GTP A;  4GTD A;  1Y1W A;  4Y7N K;  2XCQ A;  4YFN A;  4A3K C;  4BBS K;  4C2M C;  1YNN A;  3AD9 C;  2B63 A;  2EBB A;  3GTL C;  4A93 K;  5IP9 C;  4BY7 K;  3CQZ A;  3M3Y C;  4C3H C;  2PA8 L;  4OIQ A;  4J3N A;  2NVY A;  4WJ4 A;  1J6W A;  3IPJ A;  3S1R K;  3M4O K;  3S17 C;  1WSR A;  2D6F C;  2NVX A;  1HI9 A;  5FLM K;  3EQL A;  2WB1 D;  1O29 A;  4GTE A;  1IL2 A;  1TWC C;  4KMU A;  3S2D K;  4GTC A;  3AH5 A;  1DCP A;  2ZUE A;  1XXA A;  3S1Q C;  3GTG K;  4BXX K;  2A68 A;  2R93 A;  2JA7 A;  2RH6 A;  4KB4 A;  4KMA A;  4O2D A;  1ZXO A;  4QJV B;  2JA6 K;  1ZYR A;  2YU9 C;  1PJ6 A;  1VH2 A;  1SFO C;  1I50 C;  4Y52 C;  5C4X K;  3RZD C;  4A3K K;  2CFA B;  4C2M K;  2P8T A;  2WB1 L;  5M5W K;  1O25 A;  2R92 A;  3GTL K;  4LQY A;  4GTL A;  5JVO A;  5IP9 K;  3S14 K;  3S1N C;  3WOD A;  1I6H C;  1XPP A;  4OIO A;  4KAW X;  2VUM C;  4AH6 A;  2XCO A;  4C3H K;  3H0G C;  3I4M C;  1VJE A;  4YFK A;  4A3E C;  2GAG C;  3S17 K;  3GTK C;  1WOP A;  1WQH A;  2ZFZ A;  1B4A A;  1TWC K;  4BBS C;  2RGR A;  3A8I A;  4GFQ A;  2KWA A;  1X31 C;  3S1Q K;  2V6T A;  4OIR A;  1WOR A;  4QIW D;  2A6E A;  2NVQ C;  3K7A K;  1TWA C;  4FM9 A;  2PMZ D;  1R9T A;  4BBR K;  4YG2 A;  3BP8 C;  2YU9 K;  3PO3 C;  3BP3 A;  1I50 K;  4Y52 K;  3GTQ A;  1K83 C;  1F93 A;  3RZD K;  2CFA A;  3S16 C;  3S1R C;  4BLB A;  4OIN A;  4KAS A;  4G0U A;  3GTM C;  1USM A;  2FQO A;  1I3Q C;  4GTB A;  4P5B A;  3S2D C;  4A3C C;  1I6H K;  2PMZ L;  4KN4 A;  3GIR A;  4DDQ A;  5IYC C;  2VUM K;  4BXX C;  2R7Z A;  2O5J A;  4LR2 A;  5TMF A;  2V6U A;  2JA6 C;  1TWH C;  1IE0 A;  4A3E K;  3LAP A;  1WOS A;  1DD5 A;  4LLG A;  3TFI A;  1DCO A;  5C4X C;  1TWG A;  1F7U A;  2WAQ D;  1ZVU A;  4ILD A;  5IP7 C;  4KDD A;  1EFW A;  1TWA K;  2NVQ K;  1EI6 A;  1Y1W C;  5L46 A;  2W7V A;  3S14 C;  1AB4 A;  1F7V A;  5C3E K;  2A6H A;  3S0X A;  2B63 C;  3PO3 K;  2E2I A;  1K83 K;  4A3J K;  2CW0 A;  4KAR A;  3S16 K;  1RU0 A;  3NUH A;  1WQF A;  3CQZ C;  3GTM K;  1O2A A;  1I3Q K;  1VGX A;  3FKI K;  4A3M K;  4A3C K;  4BLA A;  1WOO A;  3Q3Q A;  2JA5 A;  2NVY C;  2PHC B;  5IYD K;  1VRQ C;  4KM9 A;  4RMF A;  4XSZ A;  5IYC K;  3GTJ A;  2NVX C;  4A3L K;  3RZO C;  3K7A C;  3GTO A;  3T02 A;  4KMH A;  1TWF A;  1TWH K;  4BBR C;  3HOY C;  4Q5S A;  3T01 A;  1J6V A;  1YCL A;  1YX2 A;  1BS2 A;  5IOR A;  1XZQ A;  4P5A A;  4LK1 A;  3HXA A;  5HL8 A;  1WIH A;  1ZQ1 C;  5IP7 K;  1WCM A;  1Y1V K;  4GT9 A;  1SFO A;  3GTP K;  5E68 A;  3S15 C;  1Y1W K;  4G0W A;  1O2F B;  3TFJ A;  1L0W A;  4FZB A;  2B63 K;  4A3G K;  4YFX A;  2R92 C;  4A3D C;  2P5M A;  4GTA A;  1PJ7 A;  3GEE A;  2Y0S D;  3CQZ K;  2GAH C;  2E2H A;  4G7H A;  3N0C A;  5CHP A;  4MEY A;  4GTF A;  3H0G A;  1O24 A;  2NVY K;  4X6A K;  3FOE A;  3GTK A;  3HOX C;  2NVX K;  3RZO K;  3SZZ A;  3FOF A;  3DXJ A;  5M5X K;  1XZP B;  5C3E C;  3HOY K;  3FHZ A; 
#chains in the Genus database with same CATH homology
 4BKW A;  3LAP A;  4J3N A;  2NVY A;  3AQO A;  1O27 A;  1O26 A;  3CAG A;  1DD5 A;  2JH3 A;  2NVX A;  4KC6 A;  2VUM A;  1TWG A;  1O29 A;  1B4B A;  4GTE A;  1ISE A;  1ZVU A;  4KB2 A;  4ILD A;  4GTC A;  3AH5 A;  1XXA A;  4KDD A;  2R93 A;  2JA7 A;  2RH6 A;  1AB4 A;  4KB4 A;  3L4J A;  5EGH A;  3S0X A;  4KMA A;  1ZXO A;  3ERE D;  5IOT A;  1F9N A;  1KQ4 A;  2E2I A;  3BUE A;  1ZBS A;  1BGW A;  3OPF A;  2GSU A;  4KAR A;  1EH1 A;  3VA7 A;  1TWA A;  3GTG A;  3NUH A;  5IOQ A;  1GE9 A;  2CFA B;  1WQF A;  3QX3 A;  1O2A A;  1O25 A;  5IOS A;  2JA6 A;  2R92 A;  4LQY A;  3OEP A;  4GTL A;  5JVO A;  4BLA A;  1IS1 A;  3ORE A;  3Q3Q A;  2JA5 A;  1O28 A;  2PHC B;  1K83 A;  4G0V A;  4KM9 A;  2Y3P A;  4C3J C;  3GTJ A;  2GSN A;  4KAW X;  3GTO A;  3GTM A;  4KMH A;  2XCO A;  1TWF A;  4KM8 A;  1EK8 A;  1I3Q A;  3FKI A;  3N0B A;  5EGE A;  3GTL A;  5JFE A;  5IOR A;  3LAJ A;  1XXB A;  1WQH A;  2ZFZ A;  1B4A A;  4P5A A;  3V4G A;  3N3Y A;  4KMD A;  5CJ9 A;  2RGR A;  1WIH A;  1BJT A;  1WCM A;  4GFQ A;  2KWA A;  1TWH A;  4KAT A;  4GT9 A;  2XCR B;  1SFO A;  3LPX A;  4G0W A;  4FM9 A;  1R9T A;  4C3I C;  1O2B A;  2GSO A;  4M1X A;  4FZB A;  3L4K A;  3G4C A;  1TWC A;  5TJ3 A;  3AQP A;  1WQG A;  1Y1V A;  2P5M A;  4GTA A;  3GTQ A;  3GTP A;  4GTD A;  1Y1W A;  2CFA A;  2XCQ A;  4BLB A;  4KAS A;  2E2H A;  4C2M C;  4G0U A;  3N0C A;  5CHP A;  2B63 A;  4GTF A;  3H0G A;  1O24 A;  4GTB A;  2YU9 A;  4P5B A;  3FOE A;  1I50 A;  3GTK A;  3MML B;  4DDQ A;  2R7Z A;  3CQZ A;  3FOF A;  1XXC A;  3G4A A;  4LR2 A;  3FHZ A;  4C3H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...