5JVOA

Crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tyrosine binding and promiscuity in the arginine repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis.
pubmed doi rcsb
source organism Corynebacterium pseudotuberculosis
molecule tags Dna binding protein
molecule keywords Arginine repressor
total genus 21
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jvoA00
2ZFZA 2KWAA 3FOEA 3BUEA 1DD5A 1WIHA 3OREA 4DDQA 1IS1A 4GFQA 1XXBA 3FHZA 3FOFA 3LAJA 2RGRA 4G0UA 1ISEA 1BJTA 1EK8A 1B4BA 1XXAA 2P5MA 4KDDA 5CJ9A 4G0WA 4J3NA 1WQFA 2XCOA 4G0VA 2PHCB 2XCQA 1WQHA 1EH1A 1AB4A 2XCRB 3MMLB 4KC6A 3QX3A 4KB4A 3LAPA 3CAGA 1BGWA 3OPFA 3OEPA 1WQGA 3LPXA 5JVOA 2Y3PA 1F9NA 3L4KA 3VA7A 4FM9A 1GE9A 1B4AA 3NUHA 4KAWX 3ERED 1ZVUA 3V4GA 4KB2A 3L4JA 1XXCA
chains in the Genus database with same CATH superfamily
1X31C 5L46A 3S16K 1SFOC 2B63K 4C3HK 1WIHA 2E2HK 3M3YK 5IYDC 2E2IA 3HOWC 4G0VA 1YCLA 3AQOA 2PHCB 3M4OK 3GIRA 4A3EC 1WSVA 1L0WA 2CW0A 3WODA 3S1RC 3HKZL 3A8JA 3CQZK 1WQGA 1O28A 2Y3PA 3L4KA 3S14C 1USOA 4A3BC 4A93K 3TFIA 1G51A 4A3KK 3HOYC 3A8KA 4A3JC 4YFNA 4A3DC 2P5MA 4J3NA 1HI9A 5M5XK 3GTKK 1I6HC 1O2AA 1Y1WA 4KM9A 5C3EC 1TWHK 4A3FC 1GE9A 5CHPA 3S1QC 2WAQL 5JFEA 1DCPA 4GTLA 2KWAA 3GTMC 2V6SA 3BUEA 2RH6A 1XZQA 1ZXOA 2JH3A 4GFQA 3FHZA 4BY7K 1VGXA 4A3KC 2GSUA 4C3IK 3GTJK 2JA6A 5TMFA 3G4AA 4KM8A 3HOUK 3GTPK 5E68A 4KARA 1SFOA 1I3QC 4C45A 4LLGA 3OEPA 1TWAC 1VRQC 3GTGC 4KAWX 5TJ3A 3GTMA 5IYDK 2JA6K 3BP3A 4KMAA 1SMYA 4XSXA 4A3GC 5IYCC 3FKIC 2RGRA 1IW7A 5C4JK 1XPPA 1EFWA 2PPBA 4A3CC 4KASA 3S14K 1AB4A 2NVYC 2FQOA 2R92K 1F7UA 3T00A 1TWAA 4WJ3M 4C3HC 2E2HC 2GSOA 2PMZD 4BBRK 5M3MK 4PABA 1TWGK 4GTDA 3GTPA 4PAAA 3TFHA 3HOWK 1O27A 2R92A 1V5VA 3N0CA 3SZYA 1B4BA 5IORA 3AQPA 4Q4ZA 1UV7A 3GSIA 4GTBA 4G7OA 4GT9A 2E2JC 4A3CK 1J6WA 1K83C 3RZDC 3EQLA 5M3FK 1Y1VK 3OPFA 1VH2A 4KATA 2O5IA 3HOYK 2ZUFA 1PJ7A 4BY7C 4X6AK 1I6VA 4C3IC 3GTJC 3K7AC 2A6HA 3GEIA 1WCMA 2B63C 4DDQA 5IP9K 4Y7NK 1IBAA 3S0XA 4WILA 2WAQD 3S1MC 1EK8A 4XLNA 4RMFA 5IP7C 4XSZA 1KQ4A 2W7VA 1TWAK 1BDFA 3S1QK 2PA8D 3H0GA 3N3YA 1BGWA 2A6EA 3RZDK 3GDZA 3T01A 3LPXA 3HOVK 4YFKA 1RU0A 1C0AA 3S2HC 3H0GK 4X6AC 2CFAA 3AD8C 4A93C 1DD5A 1IE0A 2R7ZC 3K7AK 3OREA 1ZYRA 2GAHC 3S2DC 2NVTC 1XZPA 1I50K 3GTGK 1WQHA 4G7ZA 1EQRA 1INNA 2JA6C 1TWFA 4AYBD 1XZPB 2Y0SL 3TTGA 2FQTA 5JVOA 4A3LK 3DXJA 1WSRA 3V4GA 4KB2A 5C44K 2NVYK 4QIWD 3H0GC 2R93K 5FJ8K 3S17K 2R7ZK 2PA8L 1TWHA 4KDDA 4BBRC 3S2DK 3RZOC 1WOPA 3GTLA 5C4XC 1TWCA 2JA7K 2WB1D 1DCOA 4ILDA 3CAGA 4OIPA 2JA5C 3S15C 5IP9C 4Y7NC 4FM9A 1O29A 3HOXC 4A3IK 2JA8C 3T02A 3ERED 5IYBK 4KN7A 3IPJA 1O24A 1R9TA 4LK1A 1XXBA 4LOWA 5IYCK 2R93C 4FZBA 3ADAC 1JVIA 4OIQA 4G7HA 3GTQA 2XCRB 5EGHA 3S1NK 1BS2A 4BXXK 3I4MC 4BBSK 1YNJA 3I4NK 2ZUEA 3AH5A 4GZYA 3HOZC 5EGEA 5IP7K 2NVXA 1ZVUA 5FLMC 1I50C 2V6TA 3A8IA 4KN4A 5M5YK 3GTQK 3Q3QA 5TMCA 4OIRA 4G0UA 1J98A 3LAJA 4KMUA 3CQZA 3SZZA 3HOVC 4A3LC 1ZBSA 1WQFA 2XCOA 4YFXA 2YU9K 4KC6A 2NVXC 4QIWL 3LAPA 4BLBA 2CFAB 4BY1K 3S1NC 3JSTA 3PO2K 1F9NA 3I4MK 2NVTK 4BBSC 2B63A 1WOOA 3NUHA 1I3QA 3GTKA 2Y0SD 4AYBL 1I50A 4Y52C 2JA7A 4P5AA 1TWGA 3GTOK 2VUMK 3GTQC 4YG2A 3H3VL 4C3JK 4G0WA 1XXAA 3S1MK 4AH6A 2A69A 3S15K 1R9TC 1DCHA 2PMZL 3HOXK 5M5WK 5IYBC 5C44C 2YU9C 4MEXA 2NVXK 4OIOA 3S17C 2R93A 4LJZA 4WJ4A 3AD7C 4P5BA 2GSNA 1TWFK 1O25A 3RZOK 1IQ0A 3S2HK 3FOEA 3M3YC 1Y1WC 1WORA 3BP8C 2JA5K 3GTOC 4BXXC 1BJTA 1WCMK 1TWCC 3TFJA 2NVYA 4LK0A 3GTLC 1EH1A 4A3EK 4A3IC 3QX3A 5IOSA 3S1RK 1O2BA 4C2MK 2VUMA 3PO3K 1F93A 4KMHA 2YU9A 1TWFC 3H3VD 4P9SA 3AD9C 4GTEA 3HXAA 1Y1WK 1ISEA 2P8TA 4BY1C 5CJ9A 3I4NC 3PO2C 2GAGC 3GTKC 3S16C 2E2IC 5C4XK 5FLMK 1ZQ1C 5IOTA 1WOSA 2JA7C 4GTFA 4KMDA 1O26A 4XCHA 4ZH4A 5C3EK 2R7ZA 2VUMC 4A3FK 3VA7A 5D4DA 4C3JC 4BKWA 1EI6A 2JA8K 3L4JA 1YNNA 3PO3C 1F7VA 3CQZC 4LR2A 5IOQA 1IS1A 4M1XA 4NOIA 1Y1VA 1O2FB 1YX2A 4BLAA 4OINA 1VJEA 2NVQK 3HOZK 4XLPA 4JK1A 3HOUC 3MMLB 1IL2A 3HKZD 4Q5SA 1I3QK 1USMA 4A3JK 2A68A 3GTOA 3M4OC 4LQYA 1B4AA 1WCMC 4A3MC 3GTJA 3FKIK 3N0BA 1K83A 5C4JC 3FOFA 1J6XA 4MEYA 2D6FC 4A3BK 4O2DA 2XCQA 2R92C 4QJVB 3GTMK 1VLOA 4A3DK 2WB1L 2V6UA 1TWGC 3G4CA 2JA5A 2BE5A 4QJVA 1TWCK 1HQMA 5HL8A 1SFOK 1I6HK 2E2HA 1J6VA 3GTLK 3GTPC 1JOEA 1XXCA 1PJ5A 2ZFZA 4Y52K 2E2IK 4A3MK 1JQWA 1TWHC 1PJ6A 3GEEA 4MQ9A 4C2MC 2E2JK 1K83K 1R9TK 4A3GK 2O5JA 1XZQB 1Y1VC 4KB4A 3GTGA 2EBBA 4GTAA 4GTCA 3FKIA 3GEHA 2NVQC
chains in the Genus database with same CATH topology
2YU9A 1R9TA 3N0CA 1WIHA 1XXBA 4GTEA 4FZBA 1ISEA 1B4BA 5IORA 3AQPA 5CJ9A 2E2IA 4GTBA 4G0VA 3AQOA 2PHCB 4GT9A 3GTQA 2XCRB 5EGHA 5IOTA 4GTFA 4KMDA 1O26A 3OPFA 2R7ZA 1WQGA 4KATA 1O28A 2Y3PA 3AH5A 3L4KA 3VA7A 5EGEA 4C3JC 4BKWA 2NVXA 1ZVUA 4C3IC 3L4JA 3Q3QA 1WCMA 4LR2A 4DDQA 5IOQA 1IS1A 4M1XA 4G0UA 3S0XA 3LAJA 1Y1VA 1EK8A 3CQZA 4BLAA 2P5MA 4J3NA 1ZBSA 1KQ4A 1WQFA 2XCOA 3H0GA 3MMLB 4KC6A 1O2AA 3LAPA 4BLBA 3N3YA 2CFAB 1BGWA 1Y1WA 3LPXA 4KM9A 3GTOA 1F9NA 4LQYA 1GE9A 1B4AA 2B63A 5CHPA 3NUHA 5JFEA 1I3QA 3GTKA 1I50A 3GTJA 4GTLA 2KWAA 1TWGA 2CFAA 4P5AA 2JA7A 3BUEA 1DD5A 3N0BA 4KMHA 1K83A 3OREA 2RH6A 2JH3A 1ZXOA 4GFQA 3FHZA 3FOFA 4G0WA 1XXAA 2GSUA 2XCQA 1WQHA 2JA6A 3G4AA 4KM8A 4KARA 1TWFA 1SFOA 3OEPA 5JVOA 2R93A 3G4CA 2JA5A 4P5BA 2GSNA 4KAWX 5TJ3A 2E2HA 3V4GA 1O25A 4KB2A 3GTMA 1XXCA 2ZFZA 3FOEA 4KMAA 2RGRA 1TWHA 1BJTA 4KDDA 2NVYA 4C2MC 4KASA 3GTLA 1EH1A 1AB4A 1TWCA 3QX3A 4KB4A 4ILDA 5IOSA 1O2BA 3GTGA 3CAGA 1TWAA 4C3HC 2GSOA 4GTAA 4GTCA 4GTDA 1O29A 3FKIA 4FM9A 3GTPA 2VUMA 3ERED 1O27A 2R92A 1O24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFZ A;  2KWA A;  3FOE A;  3BUE A;  1DD5 A;  1WIH A;  3ORE A;  4DDQ A;  1IS1 A;  4GFQ A;  1XXB A;  3FHZ A;  3FOF A;  3LAJ A;  2RGR A;  4G0U A;  1ISE A;  1BJT A;  1EK8 A;  1B4B A;  1XXA A;  2P5M A;  4KDD A;  5CJ9 A;  4G0W A;  4J3N A;  1WQF A;  2XCO A;  4G0V A;  2PHC B;  2XCQ A;  1WQH A;  1EH1 A;  1AB4 A;  2XCR B;  3MML B;  4KC6 A;  3QX3 A;  4KB4 A;  3LAP A;  3CAG A;  1BGW A;  3OPF A;  3OEP A;  1WQG A;  3LPX A;  5JVO A;  2Y3P A;  1F9N A;  3L4K A;  3VA7 A;  4FM9 A;  1GE9 A;  1B4A A;  3NUH A;  4KAW X;  3ERE D;  1ZVU A;  3V4G A;  4KB2 A;  3L4J A;  1XXC A; 
#chains in the Genus database with same CATH topology
 1X31 C;  5L46 A;  3S16 K;  1SFO C;  2B63 K;  4C3H K;  1WIH A;  2E2H K;  3M3Y K;  5IYD C;  2E2I A;  3HOW C;  4G0V A;  1YCL A;  3AQO A;  2PHC B;  3M4O K;  3GIR A;  4A3E C;  1WSV A;  1L0W A;  2CW0 A;  3WOD A;  3S1R C;  3HKZ L;  3A8J A;  3CQZ K;  1WQG A;  1O28 A;  2Y3P A;  3L4K A;  3S14 C;  1USO A;  4A3B C;  4A93 K;  3TFI A;  1G51 A;  4A3K K;  3HOY C;  3A8K A;  4A3J C;  4YFN A;  4A3D C;  2P5M A;  4J3N A;  1HI9 A;  5M5X K;  3GTK K;  1I6H C;  1O2A A;  1Y1W A;  4KM9 A;  5C3E C;  1TWH K;  4A3F C;  1GE9 A;  5CHP A;  3S1Q C;  2WAQ L;  5JFE A;  1DCP A;  4GTL A;  2KWA A;  3GTM C;  2V6S A;  3BUE A;  2RH6 A;  1XZQ A;  1ZXO A;  2JH3 A;  4GFQ A;  3FHZ A;  4BY7 K;  1VGX A;  4A3K C;  2GSU A;  4C3I K;  3GTJ K;  2JA6 A;  5TMF A;  3G4A A;  4KM8 A;  3HOU K;  3GTP K;  5E68 A;  4KAR A;  1SFO A;  1I3Q C;  4C45 A;  4LLG A;  3OEP A;  1TWA C;  1VRQ C;  3GTG C;  4KAW X;  5TJ3 A;  3GTM A;  5IYD K;  2JA6 K;  3BP3 A;  4KMA A;  1SMY A;  4XSX A;  4A3G C;  5IYC C;  3FKI C;  2RGR A;  1IW7 A;  5C4J K;  1XPP A;  1EFW A;  2PPB A;  4A3C C;  4KAS A;  3S14 K;  1AB4 A;  2NVY C;  2FQO A;  2R92 K;  1F7U A;  3T00 A;  1TWA A;  4WJ3 M;  4C3H C;  2E2H C;  2GSO A;  2PMZ D;  4BBR K;  5M3M K;  4PAB A;  1TWG K;  4GTD A;  3GTP A;  4PAA A;  3TFH A;  3HOW K;  1O27 A;  2R92 A;  1V5V A;  3N0C A;  3SZY A;  1B4B A;  5IOR A;  3AQP A;  4Q4Z A;  1UV7 A;  3GSI A;  4GTB A;  4G7O A;  4GT9 A;  2E2J C;  4A3C K;  1J6W A;  1K83 C;  3RZD C;  3EQL A;  5M3F K;  1Y1V K;  3OPF A;  1VH2 A;  4KAT A;  2O5I A;  3HOY K;  2ZUF A;  1PJ7 A;  4BY7 C;  4X6A K;  1I6V A;  4C3I C;  3GTJ C;  3K7A C;  2A6H A;  3GEI A;  1WCM A;  2B63 C;  4DDQ A;  5IP9 K;  4Y7N K;  1IBA A;  3S0X A;  4WIL A;  2WAQ D;  3S1M C;  1EK8 A;  4XLN A;  4RMF A;  5IP7 C;  4XSZ A;  1KQ4 A;  2W7V A;  1TWA K;  1BDF A;  3S1Q K;  2PA8 D;  3H0G A;  3N3Y A;  1BGW A;  2A6E A;  3RZD K;  3GDZ A;  3T01 A;  3LPX A;  3HOV K;  4YFK A;  1RU0 A;  1C0A A;  3S2H C;  3H0G K;  4X6A C;  2CFA A;  3AD8 C;  4A93 C;  1DD5 A;  1IE0 A;  2R7Z C;  3K7A K;  3ORE A;  1ZYR A;  2GAH C;  3S2D C;  2NVT C;  1XZP A;  1I50 K;  3GTG K;  1WQH A;  4G7Z A;  1EQR A;  1INN A;  2JA6 C;  1TWF A;  4AYB D;  1XZP B;  2Y0S L;  3TTG A;  2FQT A;  5JVO A;  4A3L K;  3DXJ A;  1WSR A;  3V4G A;  4KB2 A;  5C44 K;  2NVY K;  4QIW D;  3H0G C;  2R93 K;  5FJ8 K;  3S17 K;  2R7Z K;  2PA8 L;  1TWH A;  4KDD A;  4BBR C;  3S2D K;  3RZO C;  1WOP A;  3GTL A;  5C4X C;  1TWC A;  2JA7 K;  2WB1 D;  1DCO A;  4ILD A;  3CAG A;  4OIP A;  2JA5 C;  3S15 C;  5IP9 C;  4Y7N C;  4FM9 A;  1O29 A;  3HOX C;  4A3I K;  2JA8 C;  3T02 A;  3ERE D;  5IYB K;  4KN7 A;  3IPJ A;  1O24 A;  1R9T A;  4LK1 A;  1XXB A;  4LOW A;  5IYC K;  2R93 C;  4FZB A;  3ADA C;  1JVI A;  4OIQ A;  4G7H A;  3GTQ A;  2XCR B;  5EGH A;  3S1N K;  1BS2 A;  4BXX K;  3I4M C;  4BBS K;  1YNJ A;  3I4N K;  2ZUE A;  3AH5 A;  4GZY A;  3HOZ C;  5EGE A;  5IP7 K;  2NVX A;  1ZVU A;  5FLM C;  1I50 C;  2V6T A;  3A8I A;  4KN4 A;  5M5Y K;  3GTQ K;  3Q3Q A;  5TMC A;  4OIR A;  4G0U A;  1J98 A;  3LAJ A;  4KMU A;  3CQZ A;  3SZZ A;  3HOV C;  4A3L C;  1ZBS A;  1WQF A;  2XCO A;  4YFX A;  2YU9 K;  4KC6 A;  2NVX C;  4QIW L;  3LAP A;  4BLB A;  2CFA B;  4BY1 K;  3S1N C;  3JST A;  3PO2 K;  1F9N A;  3I4M K;  2NVT K;  4BBS C;  2B63 A;  1WOO A;  3NUH A;  1I3Q A;  3GTK A;  2Y0S D;  4AYB L;  1I50 A;  4Y52 C;  2JA7 A;  4P5A A;  1TWG A;  3GTO K;  2VUM K;  3GTQ C;  4YG2 A;  3H3V L;  4C3J K;  4G0W A;  1XXA A;  3S1M K;  4AH6 A;  2A69 A;  3S15 K;  1R9T C;  1DCH A;  2PMZ L;  3HOX K;  5M5W K;  5IYB C;  5C44 C;  2YU9 C;  4MEX A;  2NVX K;  4OIO A;  3S17 C;  2R93 A;  4LJZ A;  4WJ4 A;  3AD7 C;  4P5B A;  2GSN A;  1TWF K;  1O25 A;  3RZO K;  1IQ0 A;  3S2H K;  3FOE A;  3M3Y C;  1Y1W C;  1WOR A;  3BP8 C;  2JA5 K;  3GTO C;  4BXX C;  1BJT A;  1WCM K;  1TWC C;  3TFJ A;  2NVY A;  4LK0 A;  3GTL C;  1EH1 A;  4A3E K;  4A3I C;  3QX3 A;  5IOS A;  3S1R K;  1O2B A;  4C2M K;  2VUM A;  3PO3 K;  1F93 A;  4KMH A;  2YU9 A;  1TWF C;  3H3V D;  4P9S A;  3AD9 C;  4GTE A;  3HXA A;  1Y1W K;  1ISE A;  2P8T A;  4BY1 C;  5CJ9 A;  3I4N C;  3PO2 C;  2GAG C;  3GTK C;  3S16 C;  2E2I C;  5C4X K;  5FLM K;  1ZQ1 C;  5IOT A;  1WOS A;  2JA7 C;  4GTF A;  4KMD A;  1O26 A;  4XCH A;  4ZH4 A;  5C3E K;  2R7Z A;  2VUM C;  4A3F K;  3VA7 A;  5D4D A;  4C3J C;  4BKW A;  1EI6 A;  2JA8 K;  3L4J A;  1YNN A;  3PO3 C;  1F7V A;  3CQZ C;  4LR2 A;  5IOQ A;  1IS1 A;  4M1X A;  4NOI A;  1Y1V A;  1O2F B;  1YX2 A;  4BLA A;  4OIN A;  1VJE A;  2NVQ K;  3HOZ K;  4XLP A;  4JK1 A;  3HOU C;  3MML B;  1IL2 A;  3HKZ D;  4Q5S A;  1I3Q K;  1USM A;  4A3J K;  2A68 A;  3GTO A;  3M4O C;  4LQY A;  1B4A A;  1WCM C;  4A3M C;  3GTJ A;  3FKI K;  3N0B A;  1K83 A;  5C4J C;  3FOF A;  1J6X A;  4MEY A;  2D6F C;  4A3B K;  4O2D A;  2XCQ A;  2R92 C;  4QJV B;  3GTM K;  1VLO A;  4A3D K;  2WB1 L;  2V6U A;  1TWG C;  3G4C A;  2JA5 A;  2BE5 A;  4QJV A;  1TWC K;  1HQM A;  5HL8 A;  1SFO K;  1I6H K;  2E2H A;  1J6V A;  3GTL K;  3GTP C;  1JOE A;  1XXC A;  1PJ5 A;  2ZFZ A;  4Y52 K;  2E2I K;  4A3M K;  1JQW A;  1TWH C;  1PJ6 A;  3GEE A;  4MQ9 A;  4C2M C;  2E2J K;  1K83 K;  1R9T K;  4A3G K;  2O5J A;  1XZQ B;  1Y1V C;  4KB4 A;  3GTG A;  2EBB A;  4GTA A;  4GTC A;  3FKI A;  3GEH A;  2NVQ C; 
#chains in the Genus database with same CATH homology
 2YU9 A;  1R9T A;  3N0C A;  1WIH A;  1XXB A;  4GTE A;  4FZB A;  1ISE A;  1B4B A;  5IOR A;  3AQP A;  5CJ9 A;  2E2I A;  4GTB A;  4G0V A;  3AQO A;  2PHC B;  4GT9 A;  3GTQ A;  2XCR B;  5EGH A;  5IOT A;  4GTF A;  4KMD A;  1O26 A;  3OPF A;  2R7Z A;  1WQG A;  4KAT A;  1O28 A;  2Y3P A;  3AH5 A;  3L4K A;  3VA7 A;  5EGE A;  4C3J C;  4BKW A;  2NVX A;  1ZVU A;  4C3I C;  3L4J A;  3Q3Q A;  1WCM A;  4LR2 A;  4DDQ A;  5IOQ A;  1IS1 A;  4M1X A;  4G0U A;  3S0X A;  3LAJ A;  1Y1V A;  1EK8 A;  3CQZ A;  4BLA A;  2P5M A;  4J3N A;  1ZBS A;  1KQ4 A;  1WQF A;  2XCO A;  3H0G A;  3MML B;  4KC6 A;  1O2A A;  3LAP A;  4BLB A;  3N3Y A;  2CFA B;  1BGW A;  1Y1W A;  3LPX A;  4KM9 A;  3GTO A;  1F9N A;  4LQY A;  1GE9 A;  1B4A A;  2B63 A;  5CHP A;  3NUH A;  5JFE A;  1I3Q A;  3GTK A;  1I50 A;  3GTJ A;  4GTL A;  2KWA A;  1TWG A;  2CFA A;  4P5A A;  2JA7 A;  3BUE A;  1DD5 A;  3N0B A;  4KMH A;  1K83 A;  3ORE A;  2RH6 A;  2JH3 A;  1ZXO A;  4GFQ A;  3FHZ A;  3FOF A;  4G0W A;  1XXA A;  2GSU A;  2XCQ A;  1WQH A;  2JA6 A;  3G4A A;  4KM8 A;  4KAR A;  1TWF A;  1SFO A;  3OEP A;  5JVO A;  2R93 A;  3G4C A;  2JA5 A;  4P5B A;  2GSN A;  4KAW X;  5TJ3 A;  2E2H A;  3V4G A;  1O25 A;  4KB2 A;  3GTM A;  1XXC A;  2ZFZ A;  3FOE A;  4KMA A;  2RGR A;  1TWH A;  1BJT A;  4KDD A;  2NVY A;  4C2M C;  4KAS A;  3GTL A;  1EH1 A;  1AB4 A;  1TWC A;  3QX3 A;  4KB4 A;  4ILD A;  5IOS A;  1O2B A;  3GTG A;  3CAG A;  1TWA A;  4C3H C;  2GSO A;  4GTA A;  4GTC A;  4GTD A;  1O29 A;  3FKI A;  4FM9 A;  3GTP A;  2VUM A;  3ERE D;  1O27 A;  2R92 A;  1O24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...