5JVOA

Crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Arginine repressor
publication title Tyrosine binding and promiscuity in the arginine repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis.
pubmed doi rcsb
source organism Corynebacterium pseudotuberculosis
total genus 21
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jvoA00
1EH1A 4KAWX 1WQFA 2Y3PA 3LAPA 3FOFA 3L4JA 5CJ9A 1WQHA 1BJTA 4KB2A 3CAGA 1EK8A 4FM9A 3OREA 1IS1A 3FHZA 3OPFA 2XCOA 1XXCA 3LAJA 1GE9A 4DDQA 3LPXA 1WQGA 3NUHA 4GFQA 1B4AA 1DD5A 2ZFZA 3V4GA 1ISEA 1XXAA 4KDDA 1BGWA 2RGRA 4G0WA 1ZVUA 2PHCB 2XCRB 2XCQA 4KC6A 2P5MA 4G0UA 4J3NA 3ERED 1AB4A 2KWAA 1WIHA 4KB4A 5JVOA 3L4KA 3QX3A 4G0VA 3FOEA 3MMLB 3OEPA 1F9NA 3VA7A 1B4BA 1XXBA 3BUEA
chains in the Genus database with same CATH superfamily
1R9TA 3LAPA 3GTQA 3HOZK 5CJ9A 3S2HC 4KMUA 1I50C 3S1RK 4XCHA 3IPJA 3JSTA 4GTAA 1TWHC 5M5YK 5IP9K 4WILA 1Y1WK 2E2IK 4A3FK 4A93K 4QIWL 3M3YC 5IOQA 4G0UA 3GTKC 1ZBSA 3AQPA 4YFKA 5JVOA 2A6HA 3M4OC 4G0VA 4GZYA 1SFOK 3H0GC 4MEXA 1IBAA 3GTGC 1BJTA 2ZUFA 4X6AK 1O28A 4A3CK 1KQ4A 4ILDA 4A3MC 1VJEA 3OREA 1IS1A 3LAJA 1K83C 4C45A 2NVXA 4KMDA 2E2HA 1F93A 4P5BA 3BP3A 4KDDA 3GTLK 4LR2A 3SZZA 3I4NC 3S1NC 3QX3A 5IOTA 4GTFA 1F9NA 2R7ZA 3S16C 2V6SA 1IQ0A 4GTLA 1PJ6A 1YNNA 1I3QC 2W7VA 4QIWD 1WOOA 1VGXA 5TMFA 4C3IK 1R9TK 5JFEA 5IP7C 5C3EC 1O27A 3GTPA 3GTMK 1VH2A 2GAGC 3T02A 1F7UA 4LK1A 2E2JC 1WORA 4A3LC 3I4MC 2XCQA 4KC6A 3GEHA 1WIHA 4KB4A 4BY1K 1O2BA 1TWHA 4BLBA 4KAWX 3HOXK 4BY7K 4A3BC 3L4JA 4BBSK 1IW7A 5D4DA 2ZUEA 2D6FC 2GSOA 3S14K 5C4JK 2R92A 4JK1A 1ZYRA 2V6TA 2ZFZA 5IYDK 3H0GA 4OINA 1TWAK 3GTGA 1JVIA 2P5MA 4A3GK 1RU0A 3S17C 3N0BA 3MMLB 4M1XA 2E2HC 3BUEA 1K83A 3TTGA 3N0CA 4Y52C 4Y7NC 2A69A 2Y0SL 2CFAB 1HI9A 4LK0A 3HOVK 2JH3A 2GSNA 5IYBK 3GTPK 3K7AC 1PJ5A 2GSUA 3V4GA 5C4XK 5M5WK 3GIRA 1ZVUA 1I3QA 2XCRB 3RZDK 4A3EC 3S1QC 3S2DC 1SMYA 3CQZC 4ZH4A 4OIOA 4PABA 5HL8A 4BXXC 4OIQA 2JA6A 1I50K 1WQFA 2NVQK 1TWFA 1WQHA 1TWHK 1TWGC 2CFAA 3FKIA 4P9SA 1XPPA 2JA7A 2V6UA 1GE9A 2GAHC 1YNJA 2YU9C 3M3YK 2VUMC 1WQGA 3GEIA 3NUHA 3AD9C 5IYCC 3HOWK 3GTKK 1ISEA 3M4OK 5EGHA 1DCPA 3HOUC 2Y0SD 4XLNA 1BS2A 3ERED 2R92C 3H0GK 1Y1VK 1VRQC 2FQTA 1I6HC 4A3KC 3G4CA 3GTJC 1DCOA 4AYBL 1O26A 3HOZC 4BLAA 4XSXA 1IE0A 1USMA 5FJ8K 3GTOA 1X31C 4GTEA 3I4NK 5TJ3A 4LQYA 4OIPA 3S1NK 1INNA 2E2IC 3GEEA 1O29A 4A3FC 4YG2A 1WCMC 3S16K 4C3HC 2PPBA 3S0XA 1EH1A 4LLGA 2Y3PA 5C3EK 3HOYK 3A8JA 3TFHA 2R93C 3HKZL 3GTQK 4A3DK 2E2JK 3S1MK 2NVYC 4A3CC 2JA6C 4A3LK 3CQZA 3I4MK 2RH6A 1TWFC 3T00A 4MEYA 4AYBD 2JA5C 3FKIC 4KASA 2JA7C 1TWGA 5FLMC 3FOEA 4Q4ZA 1J6VA 1XZQB 3S15C 5C44K 2YU9A 2NVTC 2VUMA 4FZBA 3FHZA 4C3IC 1IL2A 4GTDA 4KARA 3PO2C 4LJZA 3GTMC 3GTJA 2NVXK 2B63C 2E2HK 3HKZD 3RZOK 5M3FK 1XZQA 3G4AA 3DXJA 3GTOC 4Y52K 3PO3K 4C2MC 2CW0A 2WB1L 2JA8C 4BBRC 3EQLA 2R7ZK 2E2IA 5L46A 3K7AK 1WCMA 5CHPA 1J98A 2A6EA 4XSZA 2FQOA 4RMFA 4A3EK 3S1QK 4G7HA 1WOPA 3S2DK 1XXAA 1BGWA 4MQ9A 2RGRA 4PAAA 3CQZK 1SFOA 4AH6A 5IYDC 4BXXK 1JOEA 4J3NA 1C0AA 2R93A 4LOWA 1TWAC 5IOSA 3Q3QA 1B4BA 5M5XK 1WSRA 4KMAA 1TWGK 3S2HK 1O24A 2NVYA 1ZXOA 4KATA 2JA5A 4WJ3M 5IYCK 2O5JA 2XCOA 1ZQ1C 4NOIA 2WB1D 2R92K 1TWCC 4C3JC 1YCLA 3SZYA 4KN7A 3GDZA 3L4KA 4A3KK 3OEPA 4GTCA 3GTGK 2O5IA 3GTMA 5IORA 4A3JC 1UV7A 2PA8L 2A68A 4A3MK 4A3IC 2NVQC 3T01A 3TFIA 3AD7C 1XZPB 1K83K 1O2AA 2B63A 4XLPA 1XXCA 3S1RC 2P8TA 1B4AA 5IP9C 1WCMK 1Y1WC 3HOWC 4C3HK 4A93C 1J6WA 3H3VL 2KWAA 4G7OA 3A8IA 3VA7A 1I3QK 1Y1VC 1XXBA 1WSVA 2R93K 4Q5SA 1BDFA 5IP7K 4G7ZA 1SFOC 1XZPA 3CAGA 2NVYK 1O2FB 2JA6K 5TMCA 4FM9A 1TWFK 1TWAA 2JA5K 4X6AC 4WJ4A 3FKIK 4KM9A 2JA7K 2WAQL 5FLMK 2PA8D 4G0WA 2PHCB 5E68A 4O2DA 3S15K 3N3YA 2NVTK 3GTLC 1WOSA 3AD8C 4A3BK 3A8KA 3AQOA 3FOFA 1I6VA 4KB2A 1TWCA 1F7VA 3PO2K 3H3VD 1EK8A 3HOYC 1V5VA 2BE5A 1YX2A 4KMHA 1R9TC 1HQMA 1PJ7A 3HXAA 3GTQC 4A3DC 1G51A 3S1MC 1DD5A 2B63K 2EBBA 3S17K 3GTOK 1O25A 1I50A 4QJVB 1AB4A 2PMZL 4C2MK 3TFJA 4YFNA 3ADAC 4YFXA 2JA8K 4BBRK 2WAQD 4Y7NK 4BY1C 5C44C 1DCHA 1Y1WA 3HOXC 4BY7C 4GTBA 3GSIA 3GTKA 4BBSC 1EQRA 3BP8C 3S14C 5C4JC 1Y1VA 4KM8A 1J6XA 4QJVA 4GT9A 2NVXC 4A3GC 3RZOC 1USOA 1VLOA 3PO3C 5EGEA 2PMZD 2YU9K 4OIRA 2VUMK 3OPFA 2R7ZC 1TWCK 3GTLA 4C3JK 4DDQA 3LPXA 1EFWA 3HOVC 4GFQA 1EI6A 3HOUK 1JQWA 5IYBC 4BKWA 3WODA 4P5AA 1I6HK 5M3MK 3GTPC 5C4XC 3AH5A 1L0WA 4A3JK 4KN4A 3GTJK 3RZDC 4A3IK
chains in the Genus database with same CATH topology
1K83A 1R9TA 2YU9A 3LAPA 3GTQA 3N0CA 2VUMA 4FZBA 5CJ9A 3CAGA 2CFAB 4GTAA 4FM9A 2JH3A 3FHZA 4C3IC 2GSNA 1TWAA 4GTDA 4KARA 4KM9A 3V4GA 2GSUA 5IOQA 4G0WA 3GTJA 1ZVUA 2PHCB 1I3QA 2XCRB 4G0UA 1ZBSA 3N3YA 3AQPA 5JVOA 4G0VA 3G4AA 3AQOA 2JA6A 4C2MC 1WQFA 3FOFA 1TWFA 1WQHA 1BJTA 4KB2A 1TWCA 2CFAA 2E2IA 3FKIA 1O28A 1EK8A 1KQ4A 4ILDA 2JA7A 3OREA 1IS1A 3LAJA 1WCMA 1GE9A 4KMHA 5CHPA 2NVXA 4KMDA 1WQGA 2E2HA 3NUHA 4P5BA 1DD5A 1ISEA 1XXAA 4KDDA 1BGWA 2RGRA 4LR2A 1SFOA 5EGHA 1O25A 1I50A 4J3NA 3ERED 2R93A 1AB4A 3QX3A 5IOSA 5IOTA 3Q3QA 4GTFA 1F9NA 2R7ZA 1B4BA 4KMAA 1O24A 2NVYA 1ZXOA 3G4CA 4GTLA 1O26A 4KATA 2JA5A 1Y1WA 5JFEA 4GTBA 4BLAA 3GTKA 1O27A 3GTPA 2XCOA 3GTOA 4GTEA 1Y1VA 5TJ3A 4LQYA 4C3JC 4KM8A 1O29A 2XCQA 4KC6A 4GT9A 1WIHA 4KB4A 3L4KA 4C3HC 3OEPA 1O2BA 1TWHA 4GTCA 3S0XA 4BLBA 1EH1A 4KAWX 2Y3PA 3GTMA 3L4JA 5IORA 5EGEA 2GSOA 2R92A 1O2AA 2B63A 3OPFA 1XXCA 3GTLA 4DDQA 3LPXA 3CQZA 2RH6A 4GFQA 1B4AA 2ZFZA 3H0GA 3GTGA 4BKWA 4KASA 4P5AA 2P5MA 1TWGA 2KWAA 3AH5A 3N0BA 3FOEA 3MMLB 4M1XA 3VA7A 1XXBA 3BUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH1 A;  4KAW X;  1WQF A;  2Y3P A;  3LAP A;  3FOF A;  3L4J A;  5CJ9 A;  1WQH A;  1BJT A;  4KB2 A;  3CAG A;  1EK8 A;  4FM9 A;  3ORE A;  1IS1 A;  3FHZ A;  3OPF A;  2XCO A;  1XXC A;  3LAJ A;  1GE9 A;  4DDQ A;  3LPX A;  1WQG A;  3NUH A;  4GFQ A;  1B4A A;  1DD5 A;  2ZFZ A;  3V4G A;  1ISE A;  1XXA A;  4KDD A;  1BGW A;  2RGR A;  4G0W A;  1ZVU A;  2PHC B;  2XCR B;  2XCQ A;  4KC6 A;  2P5M A;  4G0U A;  4J3N A;  3ERE D;  1AB4 A;  2KWA A;  1WIH A;  4KB4 A;  5JVO A;  3L4K A;  3QX3 A;  4G0V A;  3FOE A;  3MML B;  3OEP A;  1F9N A;  3VA7 A;  1B4B A;  1XXB A;  3BUE A; 
#chains in the Genus database with same CATH topology
 1R9T A;  3LAP A;  3GTQ A;  3HOZ K;  5CJ9 A;  3S2H C;  4KMU A;  1I50 C;  3S1R K;  4XCH A;  3IPJ A;  3JST A;  4GTA A;  1TWH C;  5M5Y K;  5IP9 K;  4WIL A;  1Y1W K;  2E2I K;  4A3F K;  4A93 K;  4QIW L;  3M3Y C;  5IOQ A;  4G0U A;  3GTK C;  1ZBS A;  3AQP A;  4YFK A;  5JVO A;  2A6H A;  3M4O C;  4G0V A;  4GZY A;  1SFO K;  3H0G C;  4MEX A;  1IBA A;  3GTG C;  1BJT A;  2ZUF A;  4X6A K;  1O28 A;  4A3C K;  1KQ4 A;  4ILD A;  4A3M C;  1VJE A;  3ORE A;  1IS1 A;  3LAJ A;  1K83 C;  4C45 A;  2NVX A;  4KMD A;  2E2H A;  1F93 A;  4P5B A;  3BP3 A;  4KDD A;  3GTL K;  4LR2 A;  3SZZ A;  3I4N C;  3S1N C;  3QX3 A;  5IOT A;  4GTF A;  1F9N A;  2R7Z A;  3S16 C;  2V6S A;  1IQ0 A;  4GTL A;  1PJ6 A;  1YNN A;  1I3Q C;  2W7V A;  4QIW D;  1WOO A;  1VGX A;  5TMF A;  4C3I K;  1R9T K;  5JFE A;  5IP7 C;  5C3E C;  1O27 A;  3GTP A;  3GTM K;  1VH2 A;  2GAG C;  3T02 A;  1F7U A;  4LK1 A;  2E2J C;  1WOR A;  4A3L C;  3I4M C;  2XCQ A;  4KC6 A;  3GEH A;  1WIH A;  4KB4 A;  4BY1 K;  1O2B A;  1TWH A;  4BLB A;  4KAW X;  3HOX K;  4BY7 K;  4A3B C;  3L4J A;  4BBS K;  1IW7 A;  5D4D A;  2ZUE A;  2D6F C;  2GSO A;  3S14 K;  5C4J K;  2R92 A;  4JK1 A;  1ZYR A;  2V6T A;  2ZFZ A;  5IYD K;  3H0G A;  4OIN A;  1TWA K;  3GTG A;  1JVI A;  2P5M A;  4A3G K;  1RU0 A;  3S17 C;  3N0B A;  3MML B;  4M1X A;  2E2H C;  3BUE A;  1K83 A;  3TTG A;  3N0C A;  4Y52 C;  4Y7N C;  2A69 A;  2Y0S L;  2CFA B;  1HI9 A;  4LK0 A;  3HOV K;  2JH3 A;  2GSN A;  5IYB K;  3GTP K;  3K7A C;  1PJ5 A;  2GSU A;  3V4G A;  5C4X K;  5M5W K;  3GIR A;  1ZVU A;  1I3Q A;  2XCR B;  3RZD K;  4A3E C;  3S1Q C;  3S2D C;  1SMY A;  3CQZ C;  4ZH4 A;  4OIO A;  4PAB A;  5HL8 A;  4BXX C;  4OIQ A;  2JA6 A;  1I50 K;  1WQF A;  2NVQ K;  1TWF A;  1WQH A;  1TWH K;  1TWG C;  2CFA A;  3FKI A;  4P9S A;  1XPP A;  2JA7 A;  2V6U A;  1GE9 A;  2GAH C;  1YNJ A;  2YU9 C;  3M3Y K;  2VUM C;  1WQG A;  3GEI A;  3NUH A;  3AD9 C;  5IYC C;  3HOW K;  3GTK K;  1ISE A;  3M4O K;  5EGH A;  1DCP A;  3HOU C;  2Y0S D;  4XLN A;  1BS2 A;  3ERE D;  2R92 C;  3H0G K;  1Y1V K;  1VRQ C;  2FQT A;  1I6H C;  4A3K C;  3G4C A;  3GTJ C;  1DCO A;  4AYB L;  1O26 A;  3HOZ C;  4BLA A;  4XSX A;  1IE0 A;  1USM A;  5FJ8 K;  3GTO A;  1X31 C;  4GTE A;  3I4N K;  5TJ3 A;  4LQY A;  4OIP A;  3S1N K;  1INN A;  2E2I C;  3GEE A;  1O29 A;  4A3F C;  4YG2 A;  1WCM C;  3S16 K;  4C3H C;  2PPB A;  3S0X A;  1EH1 A;  4LLG A;  2Y3P A;  5C3E K;  3HOY K;  3A8J A;  3TFH A;  2R93 C;  3HKZ L;  3GTQ K;  4A3D K;  2E2J K;  3S1M K;  2NVY C;  4A3C C;  2JA6 C;  4A3L K;  3CQZ A;  3I4M K;  2RH6 A;  1TWF C;  3T00 A;  4MEY A;  4AYB D;  2JA5 C;  3FKI C;  4KAS A;  2JA7 C;  1TWG A;  5FLM C;  3FOE A;  4Q4Z A;  1J6V A;  1XZQ B;  3S15 C;  5C44 K;  2YU9 A;  2NVT C;  2VUM A;  4FZB A;  3FHZ A;  4C3I C;  1IL2 A;  4GTD A;  4KAR A;  3PO2 C;  4LJZ A;  3GTM C;  3GTJ A;  2NVX K;  2B63 C;  2E2H K;  3HKZ D;  3RZO K;  5M3F K;  1XZQ A;  3G4A A;  3DXJ A;  3GTO C;  4Y52 K;  3PO3 K;  4C2M C;  2CW0 A;  2WB1 L;  2JA8 C;  4BBR C;  3EQL A;  2R7Z K;  2E2I A;  5L46 A;  3K7A K;  1WCM A;  5CHP A;  1J98 A;  2A6E A;  4XSZ A;  2FQO A;  4RMF A;  4A3E K;  3S1Q K;  4G7H A;  1WOP A;  3S2D K;  1XXA A;  1BGW A;  4MQ9 A;  2RGR A;  4PAA A;  3CQZ K;  1SFO A;  4AH6 A;  5IYD C;  4BXX K;  1JOE A;  4J3N A;  1C0A A;  2R93 A;  4LOW A;  1TWA C;  5IOS A;  3Q3Q A;  1B4B A;  5M5X K;  1WSR A;  4KMA A;  1TWG K;  3S2H K;  1O24 A;  2NVY A;  1ZXO A;  4KAT A;  2JA5 A;  4WJ3 M;  5IYC K;  2O5J A;  2XCO A;  1ZQ1 C;  4NOI A;  2WB1 D;  2R92 K;  1TWC C;  4C3J C;  1YCL A;  3SZY A;  4KN7 A;  3GDZ A;  3L4K A;  4A3K K;  3OEP A;  4GTC A;  3GTG K;  2O5I A;  3GTM A;  5IOR A;  4A3J C;  1UV7 A;  2PA8 L;  2A68 A;  4A3M K;  4A3I C;  2NVQ C;  3T01 A;  3TFI A;  3AD7 C;  1XZP B;  1K83 K;  1O2A A;  2B63 A;  4XLP A;  1XXC A;  3S1R C;  2P8T A;  1B4A A;  5IP9 C;  1WCM K;  1Y1W C;  3HOW C;  4C3H K;  4A93 C;  1J6W A;  3H3V L;  2KWA A;  4G7O A;  3A8I A;  3VA7 A;  1I3Q K;  1Y1V C;  1XXB A;  1WSV A;  2R93 K;  4Q5S A;  1BDF A;  5IP7 K;  4G7Z A;  1SFO C;  1XZP A;  3CAG A;  2NVY K;  1O2F B;  2JA6 K;  5TMC A;  4FM9 A;  1TWF K;  1TWA A;  2JA5 K;  4X6A C;  4WJ4 A;  3FKI K;  4KM9 A;  2JA7 K;  2WAQ L;  5FLM K;  2PA8 D;  4G0W A;  2PHC B;  5E68 A;  4O2D A;  3S15 K;  3N3Y A;  2NVT K;  3GTL C;  1WOS A;  3AD8 C;  4A3B K;  3A8K A;  3AQO A;  3FOF A;  1I6V A;  4KB2 A;  1TWC A;  1F7V A;  3PO2 K;  3H3V D;  1EK8 A;  3HOY C;  1V5V A;  2BE5 A;  1YX2 A;  4KMH A;  1R9T C;  1HQM A;  1PJ7 A;  3HXA A;  3GTQ C;  4A3D C;  1G51 A;  3S1M C;  1DD5 A;  2B63 K;  2EBB A;  3S17 K;  3GTO K;  1O25 A;  1I50 A;  4QJV B;  1AB4 A;  2PMZ L;  4C2M K;  3TFJ A;  4YFN A;  3ADA C;  4YFX A;  2JA8 K;  4BBR K;  2WAQ D;  4Y7N K;  4BY1 C;  5C44 C;  1DCH A;  1Y1W A;  3HOX C;  4BY7 C;  4GTB A;  3GSI A;  3GTK A;  4BBS C;  1EQR A;  3BP8 C;  3S14 C;  5C4J C;  1Y1V A;  4KM8 A;  1J6X A;  4QJV A;  4GT9 A;  2NVX C;  4A3G C;  3RZO C;  1USO A;  1VLO A;  3PO3 C;  5EGE A;  2PMZ D;  2YU9 K;  4OIR A;  2VUM K;  3OPF A;  2R7Z C;  1TWC K;  3GTL A;  4C3J K;  4DDQ A;  3LPX A;  1EFW A;  3HOV C;  4GFQ A;  1EI6 A;  3HOU K;  1JQW A;  5IYB C;  4BKW A;  3WOD A;  4P5A A;  1I6H K;  5M3M K;  3GTP C;  5C4X C;  3AH5 A;  1L0W A;  4A3J K;  4KN4 A;  3GTJ K;  3RZD C;  4A3I K; 
#chains in the Genus database with same CATH homology
 1K83 A;  1R9T A;  2YU9 A;  3LAP A;  3GTQ A;  3N0C A;  2VUM A;  4FZB A;  5CJ9 A;  3CAG A;  2CFA B;  4GTA A;  4FM9 A;  2JH3 A;  3FHZ A;  4C3I C;  2GSN A;  1TWA A;  4GTD A;  4KAR A;  4KM9 A;  3V4G A;  2GSU A;  5IOQ A;  4G0W A;  3GTJ A;  1ZVU A;  2PHC B;  1I3Q A;  2XCR B;  4G0U A;  1ZBS A;  3N3Y A;  3AQP A;  5JVO A;  4G0V A;  3G4A A;  3AQO A;  2JA6 A;  4C2M C;  1WQF A;  3FOF A;  1TWF A;  1WQH A;  1BJT A;  4KB2 A;  1TWC A;  2CFA A;  2E2I A;  3FKI A;  1O28 A;  1EK8 A;  1KQ4 A;  4ILD A;  2JA7 A;  3ORE A;  1IS1 A;  3LAJ A;  1WCM A;  1GE9 A;  4KMH A;  5CHP A;  2NVX A;  4KMD A;  1WQG A;  2E2H A;  3NUH A;  4P5B A;  1DD5 A;  1ISE A;  1XXA A;  4KDD A;  1BGW A;  2RGR A;  4LR2 A;  1SFO A;  5EGH A;  1O25 A;  1I50 A;  4J3N A;  3ERE D;  2R93 A;  1AB4 A;  3QX3 A;  5IOS A;  5IOT A;  3Q3Q A;  4GTF A;  1F9N A;  2R7Z A;  1B4B A;  4KMA A;  1O24 A;  2NVY A;  1ZXO A;  3G4C A;  4GTL A;  1O26 A;  4KAT A;  2JA5 A;  1Y1W A;  5JFE A;  4GTB A;  4BLA A;  3GTK A;  1O27 A;  3GTP A;  2XCO A;  3GTO A;  4GTE A;  1Y1V A;  5TJ3 A;  4LQY A;  4C3J C;  4KM8 A;  1O29 A;  2XCQ A;  4KC6 A;  4GT9 A;  1WIH A;  4KB4 A;  3L4K A;  4C3H C;  3OEP A;  1O2B A;  1TWH A;  4GTC A;  3S0X A;  4BLB A;  1EH1 A;  4KAW X;  2Y3P A;  3GTM A;  3L4J A;  5IOR A;  5EGE A;  2GSO A;  2R92 A;  1O2A A;  2B63 A;  3OPF A;  1XXC A;  3GTL A;  4DDQ A;  3LPX A;  3CQZ A;  2RH6 A;  4GFQ A;  1B4A A;  2ZFZ A;  3H0G A;  3GTG A;  4BKW A;  4KAS A;  4P5A A;  2P5M A;  1TWG A;  2KWA A;  3AH5 A;  3N0B A;  3FOE A;  3MML B;  4M1X A;  3VA7 A;  1XXB A;  3BUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...