5JVOA

Crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine repressor
publication title Tyrosine binding and promiscuity in the arginine repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis.
pubmed doi rcsb
source organism Corynebacterium pseudotuberculosis
molecule tags Dna binding protein
total genus 21
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jvoA00
1EK8A 3LPXA 1ISEA 1WIHA 1WQGA 1BJTA 3OREA 4KAWX 3FOFA 3NUHA 2ZFZA 2Y3PA 2KWAA 1BGWA 3FOEA 1F9NA 3VA7A 1EH1A 1XXBA 1AB4A 4KC6A 3FHZA 1IS1A 2XCOA 3ERED 3CAGA 4FM9A 5JVOA 4G0WA 3QX3A 1B4AA 3V4GA 4GFQA 5CJ9A 4DDQA 2RGRA 2PHCB 3L4KA 1WQHA 2XCQA 3OPFA 3LAPA 3MMLB 3L4JA 1ZVUA 4KB2A 4KB4A 1XXAA 1XXCA 4G0UA 3LAJA 2P5MA 1B4BA 4KDDA 3BUEA 1WQFA 1DD5A 3OEPA 4J3NA 2XCRB 1GE9A 4G0VA
chains in the Genus database with same CATH superfamily
4QJVB 4AYBL 3CQZK 4NOIA 4OIQA 1YX2A 3GTPC 4A3JC 1X31C 1XZPA 3N3YA 2V6TA 3ERED 5IOTA 2PMZL 1B4AA 4LLGA 4DDQA 2R7ZC 3HOVK 2E2JK 3G4CA 2PHCB 3PO3C 1BS2A 2XCQA 3GDZA 1TWCK 4A3FK 3GTJC 1L0WA 5C4JK 2NVQK 3PO2K 3ADAC 3HOUK 2NVYC 3RZOC 4Y7NC 1BJTA 2VUMC 1IW7A 2W7VA 4ILDA 3S0XA 4KMDA 3GTMA 3S15C 1KQ4A 1VRQC 4FM9A 4AYBD 3S17K 3GTMK 1ZQ1C 3LAPA 2GSUA 3GTPA 2WAQD 4G0UA 4LJZA 3SZYA 3LAJA 2P5MA 1DD5A 1VGXA 4RMFA 4A3KC 2B63C 2PMZD 4G0VA 2A68A 1USMA 3GTPK 4JK1A 3S2DK 3I4NC 4C3HK 4BLBA 3GTKC 4KMHA 4OIPA 4MQ9A 1XXBA 3TFHA 5FLMK 2GAHC 5JVOA 4YFKA 3GTJA 1WCMK 4A3MC 1F93A 3GTOC 3PO3K 5IYDC 5TJ3A 2NVYA 2GSNA 1Y1WC 1K83C 4LK0A 2VUMA 3GTJK 4KASA 1F7VA 4XLNA 4A3DK 4WJ4A 1YCLA 4BXXC 4XSZA 5M5WK 2XCRB 4Y7NK 3S1RK 2VUMK 4LOWA 3CQZC 1TWFC 3S1MC 2KWAA 5M5XK 1BGWA 5CHPA 3EQLA 3S15K 4GTAA 3H3VL 1DCOA 5IYBC 4ZH4A 3N0CA 3QX3A 2ZUEA 4GFQA 2B63A 3L4KA 2E2JC 1TWCC 1TWAC 4A3KK 4A3FC 3G4AA 3M4OK 1O2BA 3PO2C 3I4NK 3HOUC 4XCHA 4QIWL 4P9SA 3GTOA 3S14K 3VA7A 1I50K 1ZBSA 1Y1WA 1K83A 1EFWA 4PAAA 3GTOK 1PJ5A 5IYDK 2EBBA 5M3MK 5FJ8K 3TTGA 3HOXC 1IQ0A 3S17C 1Y1WK 4G7ZA 3MMLB 1K83K 3GTLK 3CQZA 1XZQA 1TWFA 4BXXK 5L46A 3S2HK 1I6VA 2CFAA 3S1MK 1TWFK 2WB1D 3S2DC 4C3HC 1I6HK 4BY1K 1ZXOA 2GSOA 4KC6A 1J6VA 3HKZL 3CAGA 3JSTA 5IYBK 5FLMC 1TWCA 1TWAA 3GEIA 4XLPA 4C2MK 5TMFA 3T01A 5CJ9A 2P8TA 3V4GA 5E68A 1XPPA 2RGRA 4G7HA 1WCMC 4KM8A 2ZUFA 1WOPA 1ZVUA 2NVXK 2JA7C 1TWAK 1XXAA 2PA8L 1DCPA 4A3IK 4GTEA 3RZDK 4A3DC 5C44K 3S1RC 4A3BK 4GTFA 1HI9A 3GTGK 1YNJA 2BE5A 1JQWA 3GTQC 3HOXK 3BP8C 4PABA 3L4JA 1VLOA 4OIRA 1O24A 4QJVA 1O27A 3BP3A 4MEXA 5IYCC 3M4OC 3HOZC 3FOFA 4A3LC 1WCMA 2PA8D 3WODA 1AB4A 2YU9K 3S14C 1I50C 2JA7A 1Y1VK 3A8KA 3S1QK 4A3CC 2A6EA 4GTDA 3AQPA 4M1XA 2JA7K 2JA5C 3GTLC 3N0BA 1I3QK 1WIHA 1WQGA 4C3JC 2O5IA 3S2HC 3GTQA 3S16K 4OIOA 2JH3A 1JVIA 3FOEA 1I6HC 1EH1A 4BY1C 4BBRC 2Y0SL 4KN7A 3T02A 2PPBA 4G0WA 3GTQK 5M3FK 3GEEA 4C2MC 4Q5SA 5C3EC 1UV7A 1HQMA 3T00A 3M3YK 2NVXC 3BUEA 1WSRA 4GT9A 4A3IC 3DXJA 1BDFA 1EK8A 5IYCK 3RZDC 3HOZK 2CFAB 2A69A 1O2AA 2E2HC 1I50A 5IOQA 2R93K 1C0AA 4A3LK 5C44C 1F9NA 1SFOC 4A3BC 1XZPB 4BY7K 3GEHA 2JA5A 4LK1A 3GTGC 1VH2A 4A3CK 3GTLA 4OINA 4AH6A 5C4XC 1VJEA 2JA5K 4KB2A 4XSXA 2E2IC 5IOSA 1WQFA 2Y0SD 3H3VD 4C3JK 1ISEA 4YG2A 1R9TK 4BKWA 1RU0A 3K7AK 2FQOA 2Y3PA 4BBRK 4KMUA 4A3EK 1TWHC 2YU9C 2NVXA 1Y1VC 3AQOA 4LR2A 5C3EK 3S1QC 4A3GK 4QIWD 2E2HA 2NVTK 3AD8C 4MEYA 3A8IA 4YFNA 3HOWK 1SFOA 4G7OA 3IPJA 1USOA 2E2HK 4BBSK 4GTBA 3H0GK 2JA8K 3GIRA 4KAWX 1I3QC 1O28A 3GTGA 3NUHA 2WAQL 5EGEA 5TMCA 5JFEA 1ZYRA 1SFOK 2V6UA 3S16C 1F7UA 4KMAA 3FHZA 1INNA 2A6HA 4Q4ZA 1EI6A 2E2IA 2FQTA 1O29A 4KARA 5C4XK 3I4MK 5IP9K 4KB4A 2E2IK 1WOSA 3SZZA 3M3YC 1J6XA 3HKZD 4A93C 3HXAA 1EQRA 1TWHA 2YU9A 4Y52C 2R93C 3A8JA 1Y1VA 1IL2A 1G51A 4X6AC 1TWHK 2XCOA 2CW0A 4BY7C 2JA6C 1J98A 3HOYK 3OPFA 4C3IC 4P5AA 1I3QA 1O25A 3OEPA 1SMYA 5IORA 1WOOA 3LPXA 1TWGC 3Q3QA 3S1NC 4A3JK 3OREA 1R9TC 4KM9A 2V6SA 2R7ZA 1PJ7A 2GAGC 4LQYA 3GSIA 3FKIC 3K7AC 1IS1A 4GTCA 2R92C 2R7ZK 1YNNA 4A3EC 1V5VA 4KATA 1WQHA 3AD7C 1WSVA 4A3GC 1B4BA 2NVTC 2R93A 1XZQB 4J3NA 4A93K 2NVYK 3RZOK 2O5JA 5IP7C 3HOWC 4Y52K 2JA6A 5EGHA 4BBSC 3H0GC 2JA8C 2ZFZA 4X6AK 5M5YK 4WJ3M 2JA6K 5D4DA 2WB1L 4KN4A 3TFIA 3HOVC 3AD9C 4C3IK 4WILA 1TWGA 1DCHA 3I4MC 1J6WA 2B63K 1R9TA 3GTKA 4KDDA 5IP9C 4C45A 3FKIA 4BLAA 5C4JC 2NVQC 1TWGK 3S1NK 2R92A 3GTKK 2RH6A 4O2DA 2D6FC 4P5BA 1WORA 3FKIK 2R92K 1JOEA 1O2FB 4FZBA 4A3MK 1IE0A 4YFXA 1IBAA 3HOYC 3TFJA 4GTLA 1PJ6A 3GTMC 5HL8A 1O26A 1XXCA 3H0GA 3AH5A 4GZYA 5IP7K 1GE9A
chains in the Genus database with same CATH topology
3N0BA 1O2BA 1WIHA 1WQGA 1TWHA 4C3JC 2YU9A 3GTQA 1Y1VA 3GTOA 2JH3A 3N3YA 3FOEA 3VA7A 1EH1A 1ZBSA 3ERED 2XCOA 5IOTA 1Y1WA 1K83A 4G0WA 1B4AA 4DDQA 3G4CA 2PHCB 4C2MC 2XCQA 3OPFA 3MMLB 4C3IC 4P5AA 3CQZA 1TWFA 1I3QA 1O25A 3BUEA 3OEPA 4GT9A 5IORA 1EK8A 3LPXA 2CFAA 2CFAB 3Q3QA 1BJTA 1O2AA 1I50A 5IOQA 3OREA 4KM9A 2R7ZA 4ILDA 4C3HC 4LQYA 3S0XA 4KMDA 1ZXOA 2GSOA 1F9NA 4KC6A 3GTMA 1KQ4A 1IS1A 4GTCA 3CAGA 4FM9A 2JA5A 1TWCA 1TWAA 3V4GA 2RGRA 5CJ9A 4KATA 3GTLA 1WQHA 4KM8A 3LAPA 1ZVUA 2GSUA 4KB2A 3GTPA 4G0UA 1XXAA 5IOSA 3LAJA 2P5MA 1B4BA 2R93A 1WQFA 1DD5A 4GTEA 4J3NA 4G0VA 1ISEA 4BKWA 5EGHA 2JA6A 4BLBA 4KMHA 2ZFZA 2Y3PA 1XXBA 4GTFA 5JVOA 2NVXA 3GTJA 3AQOA 4LR2A 5TJ3A 2NVYA 2GSNA 1TWGA 3L4JA 2E2HA 2VUMA 4KASA 1R9TA 3GTKA 4KDDA 1O24A 3FKIA 4BLAA 2XCRB 1SFOA 1O27A 4GTBA 2R92A 2RH6A 4KAWX 1O28A 3FOFA 3GTGA 3NUHA 4P5BA 5EGEA 5JFEA 2KWAA 1WCMA 1BGWA 5CHPA 4KMAA 1AB4A 3FHZA 4GTAA 2JA7A 4FZBA 2E2IA 3N0CA 3QX3A 4GFQA 2B63A 1O29A 4GTDA 4KARA 3L4KA 4GTLA 3AQPA 4M1XA 4KB4A 1O26A 1XXCA 3H0GA 3AH5A 3G4AA 1GE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EK8 A;  3LPX A;  1ISE A;  1WIH A;  1WQG A;  1BJT A;  3ORE A;  4KAW X;  3FOF A;  3NUH A;  2ZFZ A;  2Y3P A;  2KWA A;  1BGW A;  3FOE A;  1F9N A;  3VA7 A;  1EH1 A;  1XXB A;  1AB4 A;  4KC6 A;  3FHZ A;  1IS1 A;  2XCO A;  3ERE D;  3CAG A;  4FM9 A;  5JVO A;  4G0W A;  3QX3 A;  1B4A A;  3V4G A;  4GFQ A;  5CJ9 A;  4DDQ A;  2RGR A;  2PHC B;  3L4K A;  1WQH A;  2XCQ A;  3OPF A;  3LAP A;  3MML B;  3L4J A;  1ZVU A;  4KB2 A;  4KB4 A;  1XXA A;  1XXC A;  4G0U A;  3LAJ A;  2P5M A;  1B4B A;  4KDD A;  3BUE A;  1WQF A;  1DD5 A;  3OEP A;  4J3N A;  2XCR B;  1GE9 A;  4G0V A; 
#chains in the Genus database with same CATH topology
 4QJV B;  4AYB L;  3CQZ K;  4NOI A;  4OIQ A;  1YX2 A;  3GTP C;  4A3J C;  1X31 C;  1XZP A;  3N3Y A;  2V6T A;  3ERE D;  5IOT A;  2PMZ L;  1B4A A;  4LLG A;  4DDQ A;  2R7Z C;  3HOV K;  2E2J K;  3G4C A;  2PHC B;  3PO3 C;  1BS2 A;  2XCQ A;  3GDZ A;  1TWC K;  4A3F K;  3GTJ C;  1L0W A;  5C4J K;  2NVQ K;  3PO2 K;  3ADA C;  3HOU K;  2NVY C;  3RZO C;  4Y7N C;  1BJT A;  2VUM C;  1IW7 A;  2W7V A;  4ILD A;  3S0X A;  4KMD A;  3GTM A;  3S15 C;  1KQ4 A;  1VRQ C;  4FM9 A;  4AYB D;  3S17 K;  3GTM K;  1ZQ1 C;  3LAP A;  2GSU A;  3GTP A;  2WAQ D;  4G0U A;  4LJZ A;  3SZY A;  3LAJ A;  2P5M A;  1DD5 A;  1VGX A;  4RMF A;  4A3K C;  2B63 C;  2PMZ D;  4G0V A;  2A68 A;  1USM A;  3GTP K;  4JK1 A;  3S2D K;  3I4N C;  4C3H K;  4BLB A;  3GTK C;  4KMH A;  4OIP A;  4MQ9 A;  1XXB A;  3TFH A;  5FLM K;  2GAH C;  5JVO A;  4YFK A;  3GTJ A;  1WCM K;  4A3M C;  1F93 A;  3GTO C;  3PO3 K;  5IYD C;  5TJ3 A;  2NVY A;  2GSN A;  1Y1W C;  1K83 C;  4LK0 A;  2VUM A;  3GTJ K;  4KAS A;  1F7V A;  4XLN A;  4A3D K;  4WJ4 A;  1YCL A;  4BXX C;  4XSZ A;  5M5W K;  2XCR B;  4Y7N K;  3S1R K;  2VUM K;  4LOW A;  3CQZ C;  1TWF C;  3S1M C;  2KWA A;  5M5X K;  1BGW A;  5CHP A;  3EQL A;  3S15 K;  4GTA A;  3H3V L;  1DCO A;  5IYB C;  4ZH4 A;  3N0C A;  3QX3 A;  2ZUE A;  4GFQ A;  2B63 A;  3L4K A;  2E2J C;  1TWC C;  1TWA C;  4A3K K;  4A3F C;  3G4A A;  3M4O K;  1O2B A;  3PO2 C;  3I4N K;  3HOU C;  4XCH A;  4QIW L;  4P9S A;  3GTO A;  3S14 K;  3VA7 A;  1I50 K;  1ZBS A;  1Y1W A;  1K83 A;  1EFW A;  4PAA A;  3GTO K;  1PJ5 A;  5IYD K;  2EBB A;  5M3M K;  5FJ8 K;  3TTG A;  3HOX C;  1IQ0 A;  3S17 C;  1Y1W K;  4G7Z A;  3MML B;  1K83 K;  3GTL K;  3CQZ A;  1XZQ A;  1TWF A;  4BXX K;  5L46 A;  3S2H K;  1I6V A;  2CFA A;  3S1M K;  1TWF K;  2WB1 D;  3S2D C;  4C3H C;  1I6H K;  4BY1 K;  1ZXO A;  2GSO A;  4KC6 A;  1J6V A;  3HKZ L;  3CAG A;  3JST A;  5IYB K;  5FLM C;  1TWC A;  1TWA A;  3GEI A;  4XLP A;  4C2M K;  5TMF A;  3T01 A;  5CJ9 A;  2P8T A;  3V4G A;  5E68 A;  1XPP A;  2RGR A;  4G7H A;  1WCM C;  4KM8 A;  2ZUF A;  1WOP A;  1ZVU A;  2NVX K;  2JA7 C;  1TWA K;  1XXA A;  2PA8 L;  1DCP A;  4A3I K;  4GTE A;  3RZD K;  4A3D C;  5C44 K;  3S1R C;  4A3B K;  4GTF A;  1HI9 A;  3GTG K;  1YNJ A;  2BE5 A;  1JQW A;  3GTQ C;  3HOX K;  3BP8 C;  4PAB A;  3L4J A;  1VLO A;  4OIR A;  1O24 A;  4QJV A;  1O27 A;  3BP3 A;  4MEX A;  5IYC C;  3M4O C;  3HOZ C;  3FOF A;  4A3L C;  1WCM A;  2PA8 D;  3WOD A;  1AB4 A;  2YU9 K;  3S14 C;  1I50 C;  2JA7 A;  1Y1V K;  3A8K A;  3S1Q K;  4A3C C;  2A6E A;  4GTD A;  3AQP A;  4M1X A;  2JA7 K;  2JA5 C;  3GTL C;  3N0B A;  1I3Q K;  1WIH A;  1WQG A;  4C3J C;  2O5I A;  3S2H C;  3GTQ A;  3S16 K;  4OIO A;  2JH3 A;  1JVI A;  3FOE A;  1I6H C;  1EH1 A;  4BY1 C;  4BBR C;  2Y0S L;  4KN7 A;  3T02 A;  2PPB A;  4G0W A;  3GTQ K;  5M3F K;  3GEE A;  4C2M C;  4Q5S A;  5C3E C;  1UV7 A;  1HQM A;  3T00 A;  3M3Y K;  2NVX C;  3BUE A;  1WSR A;  4GT9 A;  4A3I C;  3DXJ A;  1BDF A;  1EK8 A;  5IYC K;  3RZD C;  3HOZ K;  2CFA B;  2A69 A;  1O2A A;  2E2H C;  1I50 A;  5IOQ A;  2R93 K;  1C0A A;  4A3L K;  5C44 C;  1F9N A;  1SFO C;  4A3B C;  1XZP B;  4BY7 K;  3GEH A;  2JA5 A;  4LK1 A;  3GTG C;  1VH2 A;  4A3C K;  3GTL A;  4OIN A;  4AH6 A;  5C4X C;  1VJE A;  2JA5 K;  4KB2 A;  4XSX A;  2E2I C;  5IOS A;  1WQF A;  2Y0S D;  3H3V D;  4C3J K;  1ISE A;  4YG2 A;  1R9T K;  4BKW A;  1RU0 A;  3K7A K;  2FQO A;  2Y3P A;  4BBR K;  4KMU A;  4A3E K;  1TWH C;  2YU9 C;  2NVX A;  1Y1V C;  3AQO A;  4LR2 A;  5C3E K;  3S1Q C;  4A3G K;  4QIW D;  2E2H A;  2NVT K;  3AD8 C;  4MEY A;  3A8I A;  4YFN A;  3HOW K;  1SFO A;  4G7O A;  3IPJ A;  1USO A;  2E2H K;  4BBS K;  4GTB A;  3H0G K;  2JA8 K;  3GIR A;  4KAW X;  1I3Q C;  1O28 A;  3GTG A;  3NUH A;  2WAQ L;  5EGE A;  5TMC A;  5JFE A;  1ZYR A;  1SFO K;  2V6U A;  3S16 C;  1F7U A;  4KMA A;  3FHZ A;  1INN A;  2A6H A;  4Q4Z A;  1EI6 A;  2E2I A;  2FQT A;  1O29 A;  4KAR A;  5C4X K;  3I4M K;  5IP9 K;  4KB4 A;  2E2I K;  1WOS A;  3SZZ A;  3M3Y C;  1J6X A;  3HKZ D;  4A93 C;  3HXA A;  1EQR A;  1TWH A;  2YU9 A;  4Y52 C;  2R93 C;  3A8J A;  1Y1V A;  1IL2 A;  1G51 A;  4X6A C;  1TWH K;  2XCO A;  2CW0 A;  4BY7 C;  2JA6 C;  1J98 A;  3HOY K;  3OPF A;  4C3I C;  4P5A A;  1I3Q A;  1O25 A;  3OEP A;  1SMY A;  5IOR A;  1WOO A;  3LPX A;  1TWG C;  3Q3Q A;  3S1N C;  4A3J K;  3ORE A;  1R9T C;  4KM9 A;  2V6S A;  2R7Z A;  1PJ7 A;  2GAG C;  4LQY A;  3GSI A;  3FKI C;  3K7A C;  1IS1 A;  4GTC A;  2R92 C;  2R7Z K;  1YNN A;  4A3E C;  1V5V A;  4KAT A;  1WQH A;  3AD7 C;  1WSV A;  4A3G C;  1B4B A;  2NVT C;  2R93 A;  1XZQ B;  4J3N A;  4A93 K;  2NVY K;  3RZO K;  2O5J A;  5IP7 C;  3HOW C;  4Y52 K;  2JA6 A;  5EGH A;  4BBS C;  3H0G C;  2JA8 C;  2ZFZ A;  4X6A K;  5M5Y K;  4WJ3 M;  2JA6 K;  5D4D A;  2WB1 L;  4KN4 A;  3TFI A;  3HOV C;  3AD9 C;  4C3I K;  4WIL A;  1TWG A;  1DCH A;  3I4M C;  1J6W A;  2B63 K;  1R9T A;  3GTK A;  4KDD A;  5IP9 C;  4C45 A;  3FKI A;  4BLA A;  5C4J C;  2NVQ C;  1TWG K;  3S1N K;  2R92 A;  3GTK K;  2RH6 A;  4O2D A;  2D6F C;  4P5B A;  1WOR A;  3FKI K;  2R92 K;  1JOE A;  1O2F B;  4FZB A;  4A3M K;  1IE0 A;  4YFX A;  1IBA A;  3HOY C;  3TFJ A;  4GTL A;  1PJ6 A;  3GTM C;  5HL8 A;  1O26 A;  1XXC A;  3H0G A;  3AH5 A;  4GZY A;  5IP7 K;  1GE9 A; 
#chains in the Genus database with same CATH homology
 3N0B A;  1O2B A;  1WIH A;  1WQG A;  1TWH A;  4C3J C;  2YU9 A;  3GTQ A;  1Y1V A;  3GTO A;  2JH3 A;  3N3Y A;  3FOE A;  3VA7 A;  1EH1 A;  1ZBS A;  3ERE D;  2XCO A;  5IOT A;  1Y1W A;  1K83 A;  4G0W A;  1B4A A;  4DDQ A;  3G4C A;  2PHC B;  4C2M C;  2XCQ A;  3OPF A;  3MML B;  4C3I C;  4P5A A;  3CQZ A;  1TWF A;  1I3Q A;  1O25 A;  3BUE A;  3OEP A;  4GT9 A;  5IOR A;  1EK8 A;  3LPX A;  2CFA A;  2CFA B;  3Q3Q A;  1BJT A;  1O2A A;  1I50 A;  5IOQ A;  3ORE A;  4KM9 A;  2R7Z A;  4ILD A;  4C3H C;  4LQY A;  3S0X A;  4KMD A;  1ZXO A;  2GSO A;  1F9N A;  4KC6 A;  3GTM A;  1KQ4 A;  1IS1 A;  4GTC A;  3CAG A;  4FM9 A;  2JA5 A;  1TWC A;  1TWA A;  3V4G A;  2RGR A;  5CJ9 A;  4KAT A;  3GTL A;  1WQH A;  4KM8 A;  3LAP A;  1ZVU A;  2GSU A;  4KB2 A;  3GTP A;  4G0U A;  1XXA A;  5IOS A;  3LAJ A;  2P5M A;  1B4B A;  2R93 A;  1WQF A;  1DD5 A;  4GTE A;  4J3N A;  4G0V A;  1ISE A;  4BKW A;  5EGH A;  2JA6 A;  4BLB A;  4KMH A;  2ZFZ A;  2Y3P A;  1XXB A;  4GTF A;  5JVO A;  2NVX A;  3GTJ A;  3AQO A;  4LR2 A;  5TJ3 A;  2NVY A;  2GSN A;  1TWG A;  3L4J A;  2E2H A;  2VUM A;  4KAS A;  1R9T A;  3GTK A;  4KDD A;  1O24 A;  3FKI A;  4BLA A;  2XCR B;  1SFO A;  1O27 A;  4GTB A;  2R92 A;  2RH6 A;  4KAW X;  1O28 A;  3FOF A;  3GTG A;  3NUH A;  4P5B A;  5EGE A;  5JFE A;  2KWA A;  1WCM A;  1BGW A;  5CHP A;  4KMA A;  1AB4 A;  3FHZ A;  4GTA A;  2JA7 A;  4FZB A;  2E2I A;  3N0C A;  3QX3 A;  4GFQ A;  2B63 A;  1O29 A;  4GTD A;  4KAR A;  3L4K A;  4GTL A;  3AQP A;  4M1X A;  4KB4 A;  1O26 A;  1XXC A;  3H0G A;  3AH5 A;  3G4A A;  1GE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...