5JVOA

Crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arginine repressor
publication title Tyrosine binding and promiscuity in the arginine repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis.
pubmed doi rcsb
source organism Corynebacterium pseudotuberculosis
molecule tags Dna binding protein
total genus 21
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jvoA00
1WQHA 1WQGA 2PHCB 3L4KA 3QX3A 1WQFA 4KB4A 1B4AA 4GFQA 1IS1A 4KC6A 5CJ9A 4J3NA 2Y3PA 1B4BA 1XXAA 2XCQA 3MMLB 2XCOA 2ZFZA 4G0VA 3FOEA 1DD5A 4DDQA 3OREA 3CAGA 2XCRB 1ISEA 4FM9A 3LAPA 3OEPA 1BGWA 3BUEA 3VA7A 3FOFA 4KAWX 4KB2A 1ZVUA 1WIHA 3OPFA 4KDDA 5JVOA 1AB4A 2KWAA 1GE9A 3NUHA 1XXBA 2P5MA 3LPXA 3ERED 1BJTA 4G0WA 4G0UA 1EH1A 3FHZA 1XXCA 3V4GA 3L4JA 2RGRA 1F9NA 3LAJA 1EK8A
chains in the Genus database with same CATH superfamily
4KM9A 4A93C 3H0GC 4BY1K 1SFOC 4MEYA 4QIWL 4J3NA 4NOIA 4G7ZA 1I3QK 1J6WA 4P5BA 2R93K 3OEPA 5M5WK 3BP3A 1IE0A 3NUHA 3IPJA 1WCMK 3K7AK 2NVXA 3SZYA 3CQZK 4C3HC 2R92K 3AQOA 2NVTC 3RZDK 3S16K 3GTPA 4A3FC 2R7ZA 4A3GK 1WQGA 3QX3A 4C3IK 2O5IA 1HI9A 2E2HK 3GTKK 4GZYA 1EFWA 1WOSA 3GTQK 1BS2A 4A3EK 4C45A 1I6HC 3LAPA 5M3MK 3H3VL 1WOOA 2YU9K 1XZPB 2R7ZC 4Y7NC 4A3JK 3PO3K 2GAGC 1I50A 4GTBA 3S1RC 3S15K 1ZXOA 3T01A 2B63A 5M5YK 1ZBSA 4KMHA 3WODA 1XXCA 4A3DK 2E2IA 4Y52C 5C4JK 2JA5K 1F93A 3N3YA 4KC6A 1WOPA 2XCQA 4C3JK 4JK1A 1O29A 4YFKA 3I4MC 5IP7K 3GTGA 1R9TA 4A3BK 3TFJA 5EGEA 4BY1C 4BBRC 5C44C 1PJ6A 3HOWK 3S1MC 4A3LC 4WJ4A 2D6FC 3GSIA 3V4GA 3S1NC 4WILA 4YFNA 5TJ3A 2PMZD 3GTGC 5EGHA 1XPPA 2FQOA 5L46A 4BXXK 4M1XA 5IORA 3M3YK 4A3KK 4Q4ZA 3FOEA 4DDQA 3RZDC 3GTLK 1VRQC 3BUEA 1DCOA 1VJEA 3HOXK 3GTKC 4A3CK 1PJ5A 5FLMK 3S17C 3GTJK 1KQ4A 2JA7K 5C3EK 4AYBD 3EQLA 4GT9A 1K83A 3FHZA 2JA8C 2RGRA 4KMUA 1WQHA 2PA8D 3GEIA 1F7UA 4P5AA 1YNNA 1DD5A 4LR2A 3N0CA 3H0GA 2NVYK 2E2JC 4OINA 1K83C 1TWFA 1JVIA 4QJVA 4G7OA 4A3IK 4XLNA 1IW7A 2NVXK 4X6AK 4BY7K 1PJ7A 4G7HA 3S2HK 1TWHK 1O28A 3RZOC 3GTPK 3HOZK 3S1QC 4PAAA 1O24A 1TWFC 1WSVA 4MEXA 2NVQK 3VA7A 3A8JA 4BBSC 5JVOA 3HOUK 3GTMA 1USOA 5IP9K 5IYDK 1O2AA 3TFHA 4XLPA 3ERED 1I50K 1DCHA 1SMYA 4G0UA 1HQMA 3I4NC 3GTLC 4C2MK 2B63K 3LAJA 2E2IK 2WB1L 1WQFA 1O2BA 5IYCK 1C0AA 4BLAA 2CFAA 2JA6C 4KASA 2VUMA 3GTMC 2Y3PA 1J6VA 2XCOA 3HXAA 1Y1VA 3M4OC 5IYBC 1BGWA 4KMDA 2WB1D 2V6SA 2KWAA 2WAQL 5CHPA 3GTOA 3G4CA 2VUMC 1TWAK 1Y1VC 3FKIK 3PO2K 4BKWA 2A69A 5D4DA 2WAQD 2EBBA 3S14K 3S2DC 2V6TA 1I3QA 1WORA 2R93A 4KN7A 1TWGK 1TWCK 2RH6A 4GTDA 3GTOC 5C4XC 1Y1WC 1WCMA 2PMZL 3HOZC 2R92A 3GEEA 5E68A 1I3QC 3HOYK 1BDFA 1I6VA 2E2HA 2R93C 1ZQ1C 1EK8A 3GTKA 2Y0SD 1RU0A 1INNA 4KB4A 5IP9C 4GFQA 4LOWA 1VGXA 1WCMC 3K7AC 3Q3QA 4QJVB 4A3MK 4AYBL 1L0WA 3CQZC 3JSTA 2R92C 5TMFA 2YU9A 3S16C 4GTFA 4A93K 1IQ0A 3H0GK 1G51A 4A3GC 4C3IC 1SFOK 2PA8L 2E2HC 2A68A 2O5JA 1JQWA 3GEHA 3GTQC 3HKZD 5FJ8K 2JA5A 4A3EC 4LK1A 3AD7C 1F9NA 2A6EA 2YU9C 1B4AA 2GSNA 4A3JC 3PO3C 5M5XK 1B4BA 3S15C 4LK0A 1DCPA 1YCLA 4C3HK 1ISEA 4A3DC 1X31C 1O27A 4A3FK 2FQTA 4KAWX 5C4JC 2JA5C 3T00A 2CFAB 1IBAA 4C3JC 1TWGC 2BE5A 5IP7C 4A3BC 1I6HK 3AD8C 3TTGA 1F7VA 1YX2A 2R7ZK 4Y7NK 5IOTA 3HOWC 4RMFA 1VH2A 3S1RK 4GTLA 4KN4A 3GTLA 1XZQA 3ADAC 1YNJA 3HOVK 3N0BA 4Y52K 2JA6A 3TFIA 3GTJA 1ZVUA 1WIHA 2JA7A 4KM8A 4AH6A 3S0XA 4BXXC 4OIPA 3GIRA 4YFXA 3I4MK 1IL2A 3T02A 3M3YC 4A3KC 3A8KA 1UV7A 1WSRA 4KARA 4BBRK 1J6XA 2P8TA 4ZH4A 5C44K 3HOXC 4A3CC 5CJ9A 5FLMC 3S1MK 3GTJC 4A3LK 2JA7C 2NVYA 5C3EC 4G0VA 2GSOA 3S1NK 4FM9A 2ZUEA 5IOSA 3SZZA 3GTGK 1R9TK 4KDDA 1EI6A 4PABA 1GE9A 4QIWD 2V6UA 1XXBA 4LJZA 1TWHA 2A6HA 1J98A 1EH1A 1Y1WA 3GDZA 2NVYC 2PHCB 1USMA 3AQPA 3S17K 4XSZA 2JH3A 1XXAA 3MMLB 4A3IC 2NVXC 2JA8K 3AH5A 4X6AC 4LLGA 4BY7C 1V5VA 1TWHC 3S2HC 2GAHC 2Y0SL 3GTPC 4OIRA 3CQZA 3LPXA 4KATA 3HOVC 2E2JK 3H3VD 2NVQC 3G4AA 1K83K 3HOUC 3GTQA 3A8IA 4Q5SA 5IYDC 2ZFZA 4BLBA 3HKZL 1I50C 5TMCA 3OREA 2XCRB 4C2MC 2B63C 4WJ3M 3FOFA 3RZOK 4KB2A 2E2IC 4XSXA 4YG2A 5JFEA 5IYCC 4OIQA 3S1QK 4O2DA 5HL8A 1TWAA 1XZQB 3BP8C 3FKIA 1TWFK 2CW0A 3CAGA 3DXJA 1R9TC 2GSUA 4BBSK 1XZPA 1IS1A 1TWGA 1TWCA 4FZBA 3I4NK 5IOQA 1TWAC 2NVTK 3FKIC 1EQRA 4LQYA 3PO2C 3OPFA 1AB4A 2JA6K 3S14C 3GTMK 4XCHA 4ILDA 1BJTA 1TWCC 3M4OK 5IYBK 2ZUFA 4GTCA 1ZYRA 3L4KA 1JOEA 4KMAA 5M3FK 1O26A 4OIOA 4GTEA 2VUMK 3HOYC 1O25A 2W7VA 4P9SA 1SFOA 1Y1VK 2PPBA 1VLOA 3S2DK 1O2FB 4MQ9A 2P5MA 3AD9C 4G0WA 4A3MC 4GTAA 3L4JA 3GTOK 5C4XK 1Y1WK
chains in the Genus database with same CATH topology
4KM9A 1WQHA 2PHCB 4KB4A 4GFQA 3AQPA 2JH3A 4J3NA 1XXAA 3Q3QA 3MMLB 4P5AA 1DD5A 4LR2A 3N0CA 4P5BA 3AH5A 3H0GA 2YU9A 3OEPA 4GTFA 4C3IC 3NUHA 1TWFA 2NVXA 3CQZA 3LPXA 4KATA 2JA5A 4C3HC 3AQOA 1F9NA 3GTPA 2R7ZA 1O28A 1WQGA 3G4AA 3QX3A 1B4AA 3GTQA 2GSNA 1B4BA 1O24A 2ZFZA 4BLBA 3OREA 2XCRB 4C2MC 1ISEA 1O27A 3LAPA 3VA7A 3FOFA 4KAWX 4KB2A 5JVOA 3GTMA 5JFEA 2CFAB 1O2AA 1I50A 4GTBA 1ZXOA 1TWAA 4C3JC 3ERED 2B63A 3FKIA 1ZBSA 4KMHA 4G0UA 1XXCA 2E2IA 3LAJA 3CAGA 2GSUA 1WQFA 1O2BA 4BLAA 2CFAA 3N3YA 4KASA 4KC6A 1IS1A 1TWGA 1TWCA 5IOTA 3GTKA 2VUMA 2Y3PA 4GTLA 2XCQA 3GTLA 2XCOA 4FZBA 1O29A 1Y1VA 3GTGA 5IOQA 1R9TA 3N0BA 5EGEA 1BGWA 2JA6A 4KMDA 4LQYA 3GTJA 1ZVUA 1WIHA 3OPFA 2JA7A 1AB4A 2KWAA 4KM8A 3S0XA 4ILDA 5CHPA 1BJTA 3GTOA 3G4CA 3V4GA 4GTCA 5TJ3A 3L4KA 4BKWA 4KARA 4KMAA 5EGHA 5CJ9A 1I3QA 1O26A 2NVYA 4GTEA 4M1XA 2R93A 5IORA 2RH6A 4GTDA 3FOEA 2GSOA 4DDQA 4FM9A 1O25A 1SFOA 5IOSA 3BUEA 4KDDA 1WCMA 1GE9A 2R92A 1KQ4A 1XXBA 2P5MA 4G0WA 1TWHA 4GT9A 1EH1A 4GTAA 1K83A 3FHZA 3L4JA 2RGRA 1Y1WA 2E2HA 4G0VA 1EK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQH A;  1WQG A;  2PHC B;  3L4K A;  3QX3 A;  1WQF A;  4KB4 A;  1B4A A;  4GFQ A;  1IS1 A;  4KC6 A;  5CJ9 A;  4J3N A;  2Y3P A;  1B4B A;  1XXA A;  2XCQ A;  3MML B;  2XCO A;  2ZFZ A;  4G0V A;  3FOE A;  1DD5 A;  4DDQ A;  3ORE A;  3CAG A;  2XCR B;  1ISE A;  4FM9 A;  3LAP A;  3OEP A;  1BGW A;  3BUE A;  3VA7 A;  3FOF A;  4KAW X;  4KB2 A;  1ZVU A;  1WIH A;  3OPF A;  4KDD A;  5JVO A;  1AB4 A;  2KWA A;  1GE9 A;  3NUH A;  1XXB A;  2P5M A;  3LPX A;  3ERE D;  1BJT A;  4G0W A;  4G0U A;  1EH1 A;  3FHZ A;  1XXC A;  3V4G A;  3L4J A;  2RGR A;  1F9N A;  3LAJ A;  1EK8 A; 
#chains in the Genus database with same CATH topology
 4KM9 A;  4A93 C;  3H0G C;  4BY1 K;  1SFO C;  4MEY A;  4QIW L;  4J3N A;  4NOI A;  4G7Z A;  1I3Q K;  1J6W A;  4P5B A;  2R93 K;  3OEP A;  5M5W K;  3BP3 A;  1IE0 A;  3NUH A;  3IPJ A;  1WCM K;  3K7A K;  2NVX A;  3SZY A;  3CQZ K;  4C3H C;  2R92 K;  3AQO A;  2NVT C;  3RZD K;  3S16 K;  3GTP A;  4A3F C;  2R7Z A;  4A3G K;  1WQG A;  3QX3 A;  4C3I K;  2O5I A;  1HI9 A;  2E2H K;  3GTK K;  4GZY A;  1EFW A;  1WOS A;  3GTQ K;  1BS2 A;  4A3E K;  4C45 A;  1I6H C;  3LAP A;  5M3M K;  3H3V L;  1WOO A;  2YU9 K;  1XZP B;  2R7Z C;  4Y7N C;  4A3J K;  3PO3 K;  2GAG C;  1I50 A;  4GTB A;  3S1R C;  3S15 K;  1ZXO A;  3T01 A;  2B63 A;  5M5Y K;  1ZBS A;  4KMH A;  3WOD A;  1XXC A;  4A3D K;  2E2I A;  4Y52 C;  5C4J K;  2JA5 K;  1F93 A;  3N3Y A;  4KC6 A;  1WOP A;  2XCQ A;  4C3J K;  4JK1 A;  1O29 A;  4YFK A;  3I4M C;  5IP7 K;  3GTG A;  1R9T A;  4A3B K;  3TFJ A;  5EGE A;  4BY1 C;  4BBR C;  5C44 C;  1PJ6 A;  3HOW K;  3S1M C;  4A3L C;  4WJ4 A;  2D6F C;  3GSI A;  3V4G A;  3S1N C;  4WIL A;  4YFN A;  5TJ3 A;  2PMZ D;  3GTG C;  5EGH A;  1XPP A;  2FQO A;  5L46 A;  4BXX K;  4M1X A;  5IOR A;  3M3Y K;  4A3K K;  4Q4Z A;  3FOE A;  4DDQ A;  3RZD C;  3GTL K;  1VRQ C;  3BUE A;  1DCO A;  1VJE A;  3HOX K;  3GTK C;  4A3C K;  1PJ5 A;  5FLM K;  3S17 C;  3GTJ K;  1KQ4 A;  2JA7 K;  5C3E K;  4AYB D;  3EQL A;  4GT9 A;  1K83 A;  3FHZ A;  2JA8 C;  2RGR A;  4KMU A;  1WQH A;  2PA8 D;  3GEI A;  1F7U A;  4P5A A;  1YNN A;  1DD5 A;  4LR2 A;  3N0C A;  3H0G A;  2NVY K;  2E2J C;  4OIN A;  1K83 C;  1TWF A;  1JVI A;  4QJV A;  4G7O A;  4A3I K;  4XLN A;  1IW7 A;  2NVX K;  4X6A K;  4BY7 K;  1PJ7 A;  4G7H A;  3S2H K;  1TWH K;  1O28 A;  3RZO C;  3GTP K;  3HOZ K;  3S1Q C;  4PAA A;  1O24 A;  1TWF C;  1WSV A;  4MEX A;  2NVQ K;  3VA7 A;  3A8J A;  4BBS C;  5JVO A;  3HOU K;  3GTM A;  1USO A;  5IP9 K;  5IYD K;  1O2A A;  3TFH A;  4XLP A;  3ERE D;  1I50 K;  1DCH A;  1SMY A;  4G0U A;  1HQM A;  3I4N C;  3GTL C;  4C2M K;  2B63 K;  3LAJ A;  2E2I K;  2WB1 L;  1WQF A;  1O2B A;  5IYC K;  1C0A A;  4BLA A;  2CFA A;  2JA6 C;  4KAS A;  2VUM A;  3GTM C;  2Y3P A;  1J6V A;  2XCO A;  3HXA A;  1Y1V A;  3M4O C;  5IYB C;  1BGW A;  4KMD A;  2WB1 D;  2V6S A;  2KWA A;  2WAQ L;  5CHP A;  3GTO A;  3G4C A;  2VUM C;  1TWA K;  1Y1V C;  3FKI K;  3PO2 K;  4BKW A;  2A69 A;  5D4D A;  2WAQ D;  2EBB A;  3S14 K;  3S2D C;  2V6T A;  1I3Q A;  1WOR A;  2R93 A;  4KN7 A;  1TWG K;  1TWC K;  2RH6 A;  4GTD A;  3GTO C;  5C4X C;  1Y1W C;  1WCM A;  2PMZ L;  3HOZ C;  2R92 A;  3GEE A;  5E68 A;  1I3Q C;  3HOY K;  1BDF A;  1I6V A;  2E2H A;  2R93 C;  1ZQ1 C;  1EK8 A;  3GTK A;  2Y0S D;  1RU0 A;  1INN A;  4KB4 A;  5IP9 C;  4GFQ A;  4LOW A;  1VGX A;  1WCM C;  3K7A C;  3Q3Q A;  4QJV B;  4A3M K;  4AYB L;  1L0W A;  3CQZ C;  3JST A;  2R92 C;  5TMF A;  2YU9 A;  3S16 C;  4GTF A;  4A93 K;  1IQ0 A;  3H0G K;  1G51 A;  4A3G C;  4C3I C;  1SFO K;  2PA8 L;  2E2H C;  2A68 A;  2O5J A;  1JQW A;  3GEH A;  3GTQ C;  3HKZ D;  5FJ8 K;  2JA5 A;  4A3E C;  4LK1 A;  3AD7 C;  1F9N A;  2A6E A;  2YU9 C;  1B4A A;  2GSN A;  4A3J C;  3PO3 C;  5M5X K;  1B4B A;  3S15 C;  4LK0 A;  1DCP A;  1YCL A;  4C3H K;  1ISE A;  4A3D C;  1X31 C;  1O27 A;  4A3F K;  2FQT A;  4KAW X;  5C4J C;  2JA5 C;  3T00 A;  2CFA B;  1IBA A;  4C3J C;  1TWG C;  2BE5 A;  5IP7 C;  4A3B C;  1I6H K;  3AD8 C;  3TTG A;  1F7V A;  1YX2 A;  2R7Z K;  4Y7N K;  5IOT A;  3HOW C;  4RMF A;  1VH2 A;  3S1R K;  4GTL A;  4KN4 A;  3GTL A;  1XZQ A;  3ADA C;  1YNJ A;  3HOV K;  3N0B A;  4Y52 K;  2JA6 A;  3TFI A;  3GTJ A;  1ZVU A;  1WIH A;  2JA7 A;  4KM8 A;  4AH6 A;  3S0X A;  4BXX C;  4OIP A;  3GIR A;  4YFX A;  3I4M K;  1IL2 A;  3T02 A;  3M3Y C;  4A3K C;  3A8K A;  1UV7 A;  1WSR A;  4KAR A;  4BBR K;  1J6X A;  2P8T A;  4ZH4 A;  5C44 K;  3HOX C;  4A3C C;  5CJ9 A;  5FLM C;  3S1M K;  3GTJ C;  4A3L K;  2JA7 C;  2NVY A;  5C3E C;  4G0V A;  2GSO A;  3S1N K;  4FM9 A;  2ZUE A;  5IOS A;  3SZZ A;  3GTG K;  1R9T K;  4KDD A;  1EI6 A;  4PAB A;  1GE9 A;  4QIW D;  2V6U A;  1XXB A;  4LJZ A;  1TWH A;  2A6H A;  1J98 A;  1EH1 A;  1Y1W A;  3GDZ A;  2NVY C;  2PHC B;  1USM A;  3AQP A;  3S17 K;  4XSZ A;  2JH3 A;  1XXA A;  3MML B;  4A3I C;  2NVX C;  2JA8 K;  3AH5 A;  4X6A C;  4LLG A;  4BY7 C;  1V5V A;  1TWH C;  3S2H C;  2GAH C;  2Y0S L;  3GTP C;  4OIR A;  3CQZ A;  3LPX A;  4KAT A;  3HOV C;  2E2J K;  3H3V D;  2NVQ C;  3G4A A;  1K83 K;  3HOU C;  3GTQ A;  3A8I A;  4Q5S A;  5IYD C;  2ZFZ A;  4BLB A;  3HKZ L;  1I50 C;  5TMC A;  3ORE A;  2XCR B;  4C2M C;  2B63 C;  4WJ3 M;  3FOF A;  3RZO K;  4KB2 A;  2E2I C;  4XSX A;  4YG2 A;  5JFE A;  5IYC C;  4OIQ A;  3S1Q K;  4O2D A;  5HL8 A;  1TWA A;  1XZQ B;  3BP8 C;  3FKI A;  1TWF K;  2CW0 A;  3CAG A;  3DXJ A;  1R9T C;  2GSU A;  4BBS K;  1XZP A;  1IS1 A;  1TWG A;  1TWC A;  4FZB A;  3I4N K;  5IOQ A;  1TWA C;  2NVT K;  3FKI C;  1EQR A;  4LQY A;  3PO2 C;  3OPF A;  1AB4 A;  2JA6 K;  3S14 C;  3GTM K;  4XCH A;  4ILD A;  1BJT A;  1TWC C;  3M4O K;  5IYB K;  2ZUF A;  4GTC A;  1ZYR A;  3L4K A;  1JOE A;  4KMA A;  5M3F K;  1O26 A;  4OIO A;  4GTE A;  2VUM K;  3HOY C;  1O25 A;  2W7V A;  4P9S A;  1SFO A;  1Y1V K;  2PPB A;  1VLO A;  3S2D K;  1O2F B;  4MQ9 A;  2P5M A;  3AD9 C;  4G0W A;  4A3M C;  4GTA A;  3L4J A;  3GTO K;  5C4X K;  1Y1W K; 
#chains in the Genus database with same CATH homology
 4KM9 A;  1WQH A;  2PHC B;  4KB4 A;  4GFQ A;  3AQP A;  2JH3 A;  4J3N A;  1XXA A;  3Q3Q A;  3MML B;  4P5A A;  1DD5 A;  4LR2 A;  3N0C A;  4P5B A;  3AH5 A;  3H0G A;  2YU9 A;  3OEP A;  4GTF A;  4C3I C;  3NUH A;  1TWF A;  2NVX A;  3CQZ A;  3LPX A;  4KAT A;  2JA5 A;  4C3H C;  3AQO A;  1F9N A;  3GTP A;  2R7Z A;  1O28 A;  1WQG A;  3G4A A;  3QX3 A;  1B4A A;  3GTQ A;  2GSN A;  1B4B A;  1O24 A;  2ZFZ A;  4BLB A;  3ORE A;  2XCR B;  4C2M C;  1ISE A;  1O27 A;  3LAP A;  3VA7 A;  3FOF A;  4KAW X;  4KB2 A;  5JVO A;  3GTM A;  5JFE A;  2CFA B;  1O2A A;  1I50 A;  4GTB A;  1ZXO A;  1TWA A;  4C3J C;  3ERE D;  2B63 A;  3FKI A;  1ZBS A;  4KMH A;  4G0U A;  1XXC A;  2E2I A;  3LAJ A;  3CAG A;  2GSU A;  1WQF A;  1O2B A;  4BLA A;  2CFA A;  3N3Y A;  4KAS A;  4KC6 A;  1IS1 A;  1TWG A;  1TWC A;  5IOT A;  3GTK A;  2VUM A;  2Y3P A;  4GTL A;  2XCQ A;  3GTL A;  2XCO A;  4FZB A;  1O29 A;  1Y1V A;  3GTG A;  5IOQ A;  1R9T A;  3N0B A;  5EGE A;  1BGW A;  2JA6 A;  4KMD A;  4LQY A;  3GTJ A;  1ZVU A;  1WIH A;  3OPF A;  2JA7 A;  1AB4 A;  2KWA A;  4KM8 A;  3S0X A;  4ILD A;  5CHP A;  1BJT A;  3GTO A;  3G4C A;  3V4G A;  4GTC A;  5TJ3 A;  3L4K A;  4BKW A;  4KAR A;  4KMA A;  5EGH A;  5CJ9 A;  1I3Q A;  1O26 A;  2NVY A;  4GTE A;  4M1X A;  2R93 A;  5IOR A;  2RH6 A;  4GTD A;  3FOE A;  2GSO A;  4DDQ A;  4FM9 A;  1O25 A;  1SFO A;  5IOS A;  3BUE A;  4KDD A;  1WCM A;  1GE9 A;  2R92 A;  1KQ4 A;  1XXB A;  2P5M A;  4G0W A;  1TWH A;  4GT9 A;  1EH1 A;  4GTA A;  1K83 A;  3FHZ A;  3L4J A;  2RGR A;  1Y1W A;  2E2H A;  4G0V A;  1EK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...