5JVOA

Crystal structure of the arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tyrosine binding and promiscuity in the arginine repressor from the pathogenic bacterium Corynebacterium pseudotuberculosis.
pubmed doi rcsb
source organism Corynebacterium pseudotuberculosis
molecule tags Dna binding protein
molecule keywords Arginine repressor
total genus 21
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jvoA00
2ZFZA 2Y3PA 1B4BA 2KWAA 4DDQA 3NUHA 2XCRB 5JVOA 3QX3A 1XXAA 1WQFA 3OPFA 4KAWX 5CJ9A 4G0UA 3ERED 3OREA 2RGRA 4G0VA 1B4AA 1EK8A 3OEPA 3FHZA 2P5MA 3BUEA 3V4GA 4KC6A 3VA7A 3FOFA 2XCOA 1IS1A 3LAPA 1EH1A 1F9NA 1XXCA 1BGWA 1WQGA 3LPXA 4KB2A 1GE9A 1WIHA 3LAJA 2XCQA 1XXBA 1WQHA 1ZVUA 4KB4A 4GFQA 4KDDA 4G0WA 4J3NA 3MMLB 3FOEA 3L4JA 1AB4A 1DD5A 3CAGA 1ISEA 1BJTA 2PHCB 4FM9A 3L4KA
chains in the Genus database with same CATH superfamily
2E2HK 3N0BA 3S1NC 4MEXA 5FLMC 1Y1WK 3M3YC 3A8KA 2JA7A 4MQ9A 1TWHC 3GTMA 2NVTK 4WILA 3HOXC 4Q5SA 5HL8A 3RZOC 3GTKA 3H3VD 3GTQC 5TMFA 2XCQA 3K7AK 4YFXA 1SMYA 2VUMK 4G0WA 5L46A 4YG2A 3DXJA 1USMA 3G4CA 4KMUA 4A3CC 4C3HK 3S0XA 3CQZC 3T00A 2XCRB 4O2DA 2JA7K 2JH3A 3S15C 4A3JC 4KATA 3RZDK 1I50C 3AD9C 3GTGK 1I50K 3FOFA 2R7ZC 5IYDK 4GTEA 1F9NA 3PO3K 4A3GK 4AYBL 3M3YK 1TWFC 4A3GC 1TWHK 3GTJK 1K83A 3S1MC 5EGHA 1XZQA 2A6HA 2NVYC 2V6TA 4KM9A 3TFJA 4BLBA 4G7HA 3GTLA 4KM8A 1KQ4A 1TWFA 3LAPA 5FJ8K 4A93C 3T02A 3RZDC 4A93K 5JFEA 1WCMA 4C3JK 1DCPA 3GSIA 4FZBA 5IYDC 2R7ZK 1VJEA 2JA5A 4C3JC 3PO3C 1PJ6A 2PPBA 4A3BC 1WSRA 3GTJC 2Y3PA 4BXXC 1B4BA 2WB1D 3SZYA 2CFAA 4P5AA 3HKZL 1TWCA 2R92A 4C45A 5IP7C 3GTKK 2V6UA 1WQGA 4PABA 4MEYA 4QIWL 1XXBA 5IORA 5D4DA 3GDZA 3S1QK 1HQMA 3MMLB 3CAGA 3HOXK 4WJ4A 3RZOK 5C44C 2E2JK 3M4OC 4LJZA 5EGEA 3GTQK 2R93A 4AH6A 1TWCC 1O25A 3K7AC 2R92C 1TWCK 1Y1WA 1EK8A 4QIWD 1EI6A 1O29A 2P5MA 3GTMC 3HOZC 4A3CK 3HOZK 3S2HC 1YNNA 5C4JC 1PJ5A 3CQZK 4A3FC 1INNA 1YX2A 3HOWK 3GTQA 2W7VA 1HI9A 4XCHA 1VH2A 4A3EK 4A3IK 4A3IC 1TWFK 4YFNA 5TJ3A 1Y1WC 3QX3A 3H0GA 2CW0A 3GTLK 2NVTC 3GTLC 2E2JC 4QJVA 2R7ZA 4GTAA 5IP9C 3WODA 1BGWA 3GTPC 4ZH4A 1JOEA 4JK1A 1XZPA 4BBRC 5CHPA 1SFOK 1WOSA 3FKIK 4KN7A 4BBRK 5TMCA 1DD5A 5IOTA 2ZUEA 3TFHA 1BJTA 3S2HK 3SZZA 3HOWC 1O2BA 1VRQC 1C0AA 4G0UA 3GEEA 1EFWA 1O24A 3FHZA 4LK0A 3GTPA 2WB1L 2XCOA 1IS1A 1O2FB 4AYBD 4A3BK 1BDFA 4A3DK 4LLGA 3FKIA 3A8IA 3S1MK 3BP3A 4OIQA 3A8JA 5IP9K 3S14C 3S17C 5IP7K 2NVYK 2B63A 4P9SA 2NVQK 1I3QK 1VLOA 4LK1A 2NVQC 2R93K 4X6AC 4KAWX 4KN4A 4RMFA 1O2AA 2RGRA 2R93C 1EH1A 2PMZL 1J98A 3ADAC 2Y0SD 3I4NC 1JQWA 2JA8K 4XLPA 2B63C 1JVIA 1YNJA 3L4JA 2NVXC 3H0GK 4G7OA 2B63K 3HOVK 3GTOK 4GTBA 4GT9A 3HOVC 4A3DC 4PAAA 4BLAA 4BXXK 1V5VA 1J6XA 4QJVB 2O5JA 1TWHA 1I3QC 2GSUA 3PO2C 2VUMA 3GTKC 2GAHC 1DCOA 4A3KK 3EQLA 4KDDA 4A3KC 4J3NA 5M5XK 3FOEA 4LR2A 1AB4A 1ISEA 5IYCC 3N3YA 4OIRA 3M4OK 3GIRA 3GTPK 3AD8C 4KMHA 2JA8C 5JVOA 1VGXA 3CQZA 1XXAA 1SFOC 1I50A 3TTGA 3H0GC 3GTOC 2E2HA 1UV7A 4A3LC 2JA6K 1IE0A 2RH6A 2JA6C 1BS2A 4WJ3M 1XXCA 3LPXA 1K83C 1YCLA 4A3FK 1R9TC 3BP8C 1WQHA 3S1RK 2E2IC 4BBSK 5M3FK 3H3VL 4A3EC 3PO2K 3N0CA 4GZYA 2KWAA 2PMZD 1WQFA 3OPFA 1TWGK 4A3MK 1ZBSA 4NOIA 4KC6A 3HOYK 3HOUK 1TWAA 3S14K 3HOYC 3JSTA 2E2IA 4KB2A 2Y0SL 4P5BA 2GAGC 3GTGA 4Q4ZA 2PA8D 4X6AK 3FKIC 1TWGA 4C2MK 1WORA 4C3IC 1I6HC 3GTJA 2A6EA 4C3IK 3GEIA 1R9TK 3S1NK 5C4XC 5IYBC 4BBSC 1I6VA 3IPJA 3I4NK 1TWAC 2BE5A 1WOPA 3OEPA 1TWAK 4OIOA 3GEHA 1I3QA 1GE9A 1WIHA 1TWGC 3LAJA 1IL2A 4KASA 2VUMC 1PJ7A 5C3EK 2PA8L 2FQOA 2O5IA 3S2DK 2NVXA 4BY7K 3HXAA 2CFAB 3TFIA 3HKZD 2YU9A 1RU0A 3S17K 3S2DC 4BY1K 2JA7C 4DDQA 2GSOA 1DCHA 2JA5K 4Y7NC 4Y7NK 5M5WK 3Q3QA 1SFOA 1IQ0A 1WSVA 2FQTA 2E2HC 2WAQD 3GTOA 3S16C 5IYBK 5FLMK 1ZVUA 1G51A 5E68A 2YU9C 4GTCA 2NVXK 2YU9K 3AQOA 2EBBA 1X31C 2P8TA 2V6SA 2GSNA 1IBAA 2A69A 1XZPB 5C3EC 3I4MC 4XSXA 3S1RC 1IW7A 3OREA 3I4MK 4BY7C 1XZQB 3V4GA 4BY1C 3AH5A 3AD7C 4C3HC 4LOWA 4Y52C 2JA6A 1ZYRA 1EQRA 2ZUFA 3S15K 3T01A 4LQYA 4A3JK 1R9TA 4KB4A 1Y1VC 4GFQA 3GTGC 1F7UA 3S16K 5IOQA 2PHCB 4FM9A 5IYCK 3L4KA 1ZQ1C 4BKWA 1F93A 1O27A 3NUHA 4XSZA 4KMDA 4M1XA 1F7VA 2D6FC 4G0VA 1B4AA 4A3LK 3BUEA 4C2MC 3VA7A 2A68A 4GTLA 1WCMK 1Y1VA 5C4XK 1K83K 1WCMC 4ILDA 4XLNA 3S1QC 2E2IK 1O28A 2NVYA 1L0WA 1J6VA 1USOA 5M5YK 4Y52K 5C44K 4KMAA 2ZFZA 1J6WA 3G4AA 4GTDA 1Y1VK 5M3MK 2R92K 5CJ9A 1O26A 4OIPA 3ERED 4YFKA 3GTMK 4A3MC 2WAQL 3HOUC 3AQPA 5C4JK 1ZXOA 4KARA 2JA5C 4G7ZA 1WOOA 4OINA 4GTFA 1I6HK 1XPPA 5IOSA
chains in the Genus database with same CATH topology
3N0BA 4BLAA 5EGEA 4DDQA 2GSOA 2R93A 1O25A 2JA7A 2YU9A 3GTMA 1Y1WA 1TWHA 1EK8A 1O29A 2P5MA 3Q3QA 1SFOA 2GSUA 3GTOA 3GTKA 2VUMA 3GTQA 2XCQA 1ZVUA 4KDDA 4G0WA 4J3NA 4GTCA 3FOEA 4LR2A 1AB4A 1ISEA 3G4CA 3AQOA 3S0XA 3N3YA 2GSNA 5TJ3A 2XCRB 4KMHA 2JH3A 5JVOA 3CQZA 1XXAA 3H0GA 3QX3A 1I50A 4KATA 3OREA 2E2HA 3V4GA 3FOFA 3AH5A 2RH6A 4GTEA 4C3HC 2R7ZA 1F9NA 4GTAA 1XXCA 1BGWA 3LPXA 2JA6A 5CHPA 1WQHA 4LQYA 1K83A 1R9TA 5EGHA 4KB4A 4GFQA 1DD5A 5IOTA 1BJTA 3N0CA 5IOQA 2PHCB 4FM9A 3L4KA 4KM9A 1O2BA 4BKWA 1O27A 4BLBA 2KWAA 3NUHA 1WQFA 3OPFA 3GTLA 4KMDA 4M1XA 4G0UA 4KM8A 1O24A 4G0VA 1B4AA 3FHZA 3BUEA 1ZBSA 1KQ4A 4KC6A 4C2MC 3VA7A 1TWFA 2XCOA 3GTPA 1IS1A 3LAPA 1TWAA 4GTLA 2E2IA 4KB2A 1Y1VA 4P5BA 3GTGA 3FKIA 5JFEA 4ILDA 1WCMA 1O28A 2NVYA 1TWGA 4FZBA 2JA5A 4C3JC 4C3IC 3GTJA 2B63A 4KMAA 2ZFZA 2Y3PA 3G4AA 1B4BA 4GTDA 2CFAA 4KAWX 4P5AA 5CJ9A 1O26A 3ERED 1O2AA 2RGRA 3OEPA 1TWCA 2R92A 1EH1A 3AQPA 1ZXOA 1WQGA 1I3QA 1GE9A 4KARA 1WIHA 3LAJA 1XXBA 4KASA 5IORA 3MMLB 3L4JA 3CAGA 2NVXA 4GTFA 4GTBA 2CFAB 4GT9A 5IOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFZ A;  2Y3P A;  1B4B A;  2KWA A;  4DDQ A;  3NUH A;  2XCR B;  5JVO A;  3QX3 A;  1XXA A;  1WQF A;  3OPF A;  4KAW X;  5CJ9 A;  4G0U A;  3ERE D;  3ORE A;  2RGR A;  4G0V A;  1B4A A;  1EK8 A;  3OEP A;  3FHZ A;  2P5M A;  3BUE A;  3V4G A;  4KC6 A;  3VA7 A;  3FOF A;  2XCO A;  1IS1 A;  3LAP A;  1EH1 A;  1F9N A;  1XXC A;  1BGW A;  1WQG A;  3LPX A;  4KB2 A;  1GE9 A;  1WIH A;  3LAJ A;  2XCQ A;  1XXB A;  1WQH A;  1ZVU A;  4KB4 A;  4GFQ A;  4KDD A;  4G0W A;  4J3N A;  3MML B;  3FOE A;  3L4J A;  1AB4 A;  1DD5 A;  3CAG A;  1ISE A;  1BJT A;  2PHC B;  4FM9 A;  3L4K A; 
#chains in the Genus database with same CATH topology
 2E2H K;  3N0B A;  3S1N C;  4MEX A;  5FLM C;  1Y1W K;  3M3Y C;  3A8K A;  2JA7 A;  4MQ9 A;  1TWH C;  3GTM A;  2NVT K;  4WIL A;  3HOX C;  4Q5S A;  5HL8 A;  3RZO C;  3GTK A;  3H3V D;  3GTQ C;  5TMF A;  2XCQ A;  3K7A K;  4YFX A;  1SMY A;  2VUM K;  4G0W A;  5L46 A;  4YG2 A;  3DXJ A;  1USM A;  3G4C A;  4KMU A;  4A3C C;  4C3H K;  3S0X A;  3CQZ C;  3T00 A;  2XCR B;  4O2D A;  2JA7 K;  2JH3 A;  3S15 C;  4A3J C;  4KAT A;  3RZD K;  1I50 C;  3AD9 C;  3GTG K;  1I50 K;  3FOF A;  2R7Z C;  5IYD K;  4GTE A;  1F9N A;  3PO3 K;  4A3G K;  4AYB L;  3M3Y K;  1TWF C;  4A3G C;  1TWH K;  3GTJ K;  1K83 A;  3S1M C;  5EGH A;  1XZQ A;  2A6H A;  2NVY C;  2V6T A;  4KM9 A;  3TFJ A;  4BLB A;  4G7H A;  3GTL A;  4KM8 A;  1KQ4 A;  1TWF A;  3LAP A;  5FJ8 K;  4A93 C;  3T02 A;  3RZD C;  4A93 K;  5JFE A;  1WCM A;  4C3J K;  1DCP A;  3GSI A;  4FZB A;  5IYD C;  2R7Z K;  1VJE A;  2JA5 A;  4C3J C;  3PO3 C;  1PJ6 A;  2PPB A;  4A3B C;  1WSR A;  3GTJ C;  2Y3P A;  4BXX C;  1B4B A;  2WB1 D;  3SZY A;  2CFA A;  4P5A A;  3HKZ L;  1TWC A;  2R92 A;  4C45 A;  5IP7 C;  3GTK K;  2V6U A;  1WQG A;  4PAB A;  4MEY A;  4QIW L;  1XXB A;  5IOR A;  5D4D A;  3GDZ A;  3S1Q K;  1HQM A;  3MML B;  3CAG A;  3HOX K;  4WJ4 A;  3RZO K;  5C44 C;  2E2J K;  3M4O C;  4LJZ A;  5EGE A;  3GTQ K;  2R93 A;  4AH6 A;  1TWC C;  1O25 A;  3K7A C;  2R92 C;  1TWC K;  1Y1W A;  1EK8 A;  4QIW D;  1EI6 A;  1O29 A;  2P5M A;  3GTM C;  3HOZ C;  4A3C K;  3HOZ K;  3S2H C;  1YNN A;  5C4J C;  1PJ5 A;  3CQZ K;  4A3F C;  1INN A;  1YX2 A;  3HOW K;  3GTQ A;  2W7V A;  1HI9 A;  4XCH A;  1VH2 A;  4A3E K;  4A3I K;  4A3I C;  1TWF K;  4YFN A;  5TJ3 A;  1Y1W C;  3QX3 A;  3H0G A;  2CW0 A;  3GTL K;  2NVT C;  3GTL C;  2E2J C;  4QJV A;  2R7Z A;  4GTA A;  5IP9 C;  3WOD A;  1BGW A;  3GTP C;  4ZH4 A;  1JOE A;  4JK1 A;  1XZP A;  4BBR C;  5CHP A;  1SFO K;  1WOS A;  3FKI K;  4KN7 A;  4BBR K;  5TMC A;  1DD5 A;  5IOT A;  2ZUE A;  3TFH A;  1BJT A;  3S2H K;  3SZZ A;  3HOW C;  1O2B A;  1VRQ C;  1C0A A;  4G0U A;  3GEE A;  1EFW A;  1O24 A;  3FHZ A;  4LK0 A;  3GTP A;  2WB1 L;  2XCO A;  1IS1 A;  1O2F B;  4AYB D;  4A3B K;  1BDF A;  4A3D K;  4LLG A;  3FKI A;  3A8I A;  3S1M K;  3BP3 A;  4OIQ A;  3A8J A;  5IP9 K;  3S14 C;  3S17 C;  5IP7 K;  2NVY K;  2B63 A;  4P9S A;  2NVQ K;  1I3Q K;  1VLO A;  4LK1 A;  2NVQ C;  2R93 K;  4X6A C;  4KAW X;  4KN4 A;  4RMF A;  1O2A A;  2RGR A;  2R93 C;  1EH1 A;  2PMZ L;  1J98 A;  3ADA C;  2Y0S D;  3I4N C;  1JQW A;  2JA8 K;  4XLP A;  2B63 C;  1JVI A;  1YNJ A;  3L4J A;  2NVX C;  3H0G K;  4G7O A;  2B63 K;  3HOV K;  3GTO K;  4GTB A;  4GT9 A;  3HOV C;  4A3D C;  4PAA A;  4BLA A;  4BXX K;  1V5V A;  1J6X A;  4QJV B;  2O5J A;  1TWH A;  1I3Q C;  2GSU A;  3PO2 C;  2VUM A;  3GTK C;  2GAH C;  1DCO A;  4A3K K;  3EQL A;  4KDD A;  4A3K C;  4J3N A;  5M5X K;  3FOE A;  4LR2 A;  1AB4 A;  1ISE A;  5IYC C;  3N3Y A;  4OIR A;  3M4O K;  3GIR A;  3GTP K;  3AD8 C;  4KMH A;  2JA8 C;  5JVO A;  1VGX A;  3CQZ A;  1XXA A;  1SFO C;  1I50 A;  3TTG A;  3H0G C;  3GTO C;  2E2H A;  1UV7 A;  4A3L C;  2JA6 K;  1IE0 A;  2RH6 A;  2JA6 C;  1BS2 A;  4WJ3 M;  1XXC A;  3LPX A;  1K83 C;  1YCL A;  4A3F K;  1R9T C;  3BP8 C;  1WQH A;  3S1R K;  2E2I C;  4BBS K;  5M3F K;  3H3V L;  4A3E C;  3PO2 K;  3N0C A;  4GZY A;  2KWA A;  2PMZ D;  1WQF A;  3OPF A;  1TWG K;  4A3M K;  1ZBS A;  4NOI A;  4KC6 A;  3HOY K;  3HOU K;  1TWA A;  3S14 K;  3HOY C;  3JST A;  2E2I A;  4KB2 A;  2Y0S L;  4P5B A;  2GAG C;  3GTG A;  4Q4Z A;  2PA8 D;  4X6A K;  3FKI C;  1TWG A;  4C2M K;  1WOR A;  4C3I C;  1I6H C;  3GTJ A;  2A6E A;  4C3I K;  3GEI A;  1R9T K;  3S1N K;  5C4X C;  5IYB C;  4BBS C;  1I6V A;  3IPJ A;  3I4N K;  1TWA C;  2BE5 A;  1WOP A;  3OEP A;  1TWA K;  4OIO A;  3GEH A;  1I3Q A;  1GE9 A;  1WIH A;  1TWG C;  3LAJ A;  1IL2 A;  4KAS A;  2VUM C;  1PJ7 A;  5C3E K;  2PA8 L;  2FQO A;  2O5I A;  3S2D K;  2NVX A;  4BY7 K;  3HXA A;  2CFA B;  3TFI A;  3HKZ D;  2YU9 A;  1RU0 A;  3S17 K;  3S2D C;  4BY1 K;  2JA7 C;  4DDQ A;  2GSO A;  1DCH A;  2JA5 K;  4Y7N C;  4Y7N K;  5M5W K;  3Q3Q A;  1SFO A;  1IQ0 A;  1WSV A;  2FQT A;  2E2H C;  2WAQ D;  3GTO A;  3S16 C;  5IYB K;  5FLM K;  1ZVU A;  1G51 A;  5E68 A;  2YU9 C;  4GTC A;  2NVX K;  2YU9 K;  3AQO A;  2EBB A;  1X31 C;  2P8T A;  2V6S A;  2GSN A;  1IBA A;  2A69 A;  1XZP B;  5C3E C;  3I4M C;  4XSX A;  3S1R C;  1IW7 A;  3ORE A;  3I4M K;  4BY7 C;  1XZQ B;  3V4G A;  4BY1 C;  3AH5 A;  3AD7 C;  4C3H C;  4LOW A;  4Y52 C;  2JA6 A;  1ZYR A;  1EQR A;  2ZUF A;  3S15 K;  3T01 A;  4LQY A;  4A3J K;  1R9T A;  4KB4 A;  1Y1V C;  4GFQ A;  3GTG C;  1F7U A;  3S16 K;  5IOQ A;  2PHC B;  4FM9 A;  5IYC K;  3L4K A;  1ZQ1 C;  4BKW A;  1F93 A;  1O27 A;  3NUH A;  4XSZ A;  4KMD A;  4M1X A;  1F7V A;  2D6F C;  4G0V A;  1B4A A;  4A3L K;  3BUE A;  4C2M C;  3VA7 A;  2A68 A;  4GTL A;  1WCM K;  1Y1V A;  5C4X K;  1K83 K;  1WCM C;  4ILD A;  4XLN A;  3S1Q C;  2E2I K;  1O28 A;  2NVY A;  1L0W A;  1J6V A;  1USO A;  5M5Y K;  4Y52 K;  5C44 K;  4KMA A;  2ZFZ A;  1J6W A;  3G4A A;  4GTD A;  1Y1V K;  5M3M K;  2R92 K;  5CJ9 A;  1O26 A;  4OIP A;  3ERE D;  4YFK A;  3GTM K;  4A3M C;  2WAQ L;  3HOU C;  3AQP A;  5C4J K;  1ZXO A;  4KAR A;  2JA5 C;  4G7Z A;  1WOO A;  4OIN A;  4GTF A;  1I6H K;  1XPP A;  5IOS A; 
#chains in the Genus database with same CATH homology
 3N0B A;  4BLA A;  5EGE A;  4DDQ A;  2GSO A;  2R93 A;  1O25 A;  2JA7 A;  2YU9 A;  3GTM A;  1Y1W A;  1TWH A;  1EK8 A;  1O29 A;  2P5M A;  3Q3Q A;  1SFO A;  2GSU A;  3GTO A;  3GTK A;  2VUM A;  3GTQ A;  2XCQ A;  1ZVU A;  4KDD A;  4G0W A;  4J3N A;  4GTC A;  3FOE A;  4LR2 A;  1AB4 A;  1ISE A;  3G4C A;  3AQO A;  3S0X A;  3N3Y A;  2GSN A;  5TJ3 A;  2XCR B;  4KMH A;  2JH3 A;  5JVO A;  3CQZ A;  1XXA A;  3H0G A;  3QX3 A;  1I50 A;  4KAT A;  3ORE A;  2E2H A;  3V4G A;  3FOF A;  3AH5 A;  2RH6 A;  4GTE A;  4C3H C;  2R7Z A;  1F9N A;  4GTA A;  1XXC A;  1BGW A;  3LPX A;  2JA6 A;  5CHP A;  1WQH A;  4LQY A;  1K83 A;  1R9T A;  5EGH A;  4KB4 A;  4GFQ A;  1DD5 A;  5IOT A;  1BJT A;  3N0C A;  5IOQ A;  2PHC B;  4FM9 A;  3L4K A;  4KM9 A;  1O2B A;  4BKW A;  1O27 A;  4BLB A;  2KWA A;  3NUH A;  1WQF A;  3OPF A;  3GTL A;  4KMD A;  4M1X A;  4G0U A;  4KM8 A;  1O24 A;  4G0V A;  1B4A A;  3FHZ A;  3BUE A;  1ZBS A;  1KQ4 A;  4KC6 A;  4C2M C;  3VA7 A;  1TWF A;  2XCO A;  3GTP A;  1IS1 A;  3LAP A;  1TWA A;  4GTL A;  2E2I A;  4KB2 A;  1Y1V A;  4P5B A;  3GTG A;  3FKI A;  5JFE A;  4ILD A;  1WCM A;  1O28 A;  2NVY A;  1TWG A;  4FZB A;  2JA5 A;  4C3J C;  4C3I C;  3GTJ A;  2B63 A;  4KMA A;  2ZFZ A;  2Y3P A;  3G4A A;  1B4B A;  4GTD A;  2CFA A;  4KAW X;  4P5A A;  5CJ9 A;  1O26 A;  3ERE D;  1O2A A;  2RGR A;  3OEP A;  1TWC A;  2R92 A;  1EH1 A;  3AQP A;  1ZXO A;  1WQG A;  1I3Q A;  1GE9 A;  4KAR A;  1WIH A;  3LAJ A;  1XXB A;  4KAS A;  5IOR A;  3MML B;  3L4J A;  3CAG A;  2NVX A;  4GTF A;  4GTB A;  2CFA B;  4GT9 A;  5IOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...