5C4XK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4xK00
4KN7A 4A3GC 2E2JK 4X6AC 3PO3C 1TWHC 2WB1D 3GTOK 2NVYK 4C2MK 2E2JC 3HOZC 3S2HC 5IYBC 2YU9K 2NVTK 2A68A 5C3EK 2NVYC 3EQLA 4KMUA 4QJVA 2Y0SL 4BY1K 4A93C 3GTJK 3RZOK 2YU9C 4C3JK 5IYCK 4Q4ZA 4BY1C 3HOVC 3RZOC 3S16C 5C4XC 4A3IK 1TWFC 5IYCC 4MEXA 3S1NK 4A3IC 3PO2K 4XLPA 3K7AK 4MEYA 3S1NC 1SFOK 1BDFA 5M3FK 4BXXK 1XPPA 3K7AC 5M5YK 4Y7NK 4A3DC 2WAQD 4BBRC 2PMZD 4LK0A 4NOIA 4JK1A 4AYBD 3HOXK 1SFOC 4BXXC 4YFNA 2A6HA 3WODA 5IP7K 4BY7C 1HQMA 1TWAK 4G7OA 2PA8D 4QJVB 5IP7C 2O5IA 1WCMK 3GTLC 4X6AK 1TWAC 5IP9C 4A3KK 4A3FK 2R92K 2NVQK 4MQ9A 1YNJA 3FKIK 3GTOC 5C44K 4KN4A 2A69A 5FJ8K 1YNNA 4OIQA 2NVQC 4Y52K 2NVTC 5C3EC 3HKZD 3GTMK 1SMYA 3GTJC 3H3VD 4Y52C 1TWGK 3HOWK 4XLNA 3S2DK 3S15K 4YG2A 3HOWC 3S17K 3S2DC 4A3BK 4A3MK 3I4MK 2E2HK 3PO2C 3S17C 3HOYK 4G7HA 3S1RK 4QIWD 4A3BC 4A3MC 3I4MC 4A3LK 3HOYC 4Y7NC 3M4OK 3S1RC 3HOXC 4ZH4A 4C3IK 3GTGK 4A3LC 1I6HK 1Y1VK 1K83K 2WB1L 2R93K 1TWCK 4A3CK 2Y0SD 2E2IK 1I6HC 4LJZA 1Y1WK 4Q5SA 1Y1VC 1K83C 1WCMC 2VUMK 1TWCC 2BE5A 4A3KC 3H0GK 3GTQK 4A3FC 2E2IC 2R92C 4A3CC 1Y1WC 3DXJA 2JA7K 2VUMC 5D4DA 2PPBA 4A3EK 5FLMK 3H0GC 3FKIC 3M3YK 5C44C 4XSZA 2R93C 3M3YC 5TMCA 2B63K 2JA8K 4LLGA 2JA5K 2CW0A 3GTMC 5IYDK 3S1QK 1ZYRA 1TWGC 4BBSK 2JA8C 1R9TK 2JA5C 4G7ZA 5IYDC 1IW7A 3S1QC 4OIOA 4A3JK 3S15C 5M5XK 3PO3K 2WAQL 2PMZL 4AYBL 4A3JC 3HOZK 5C4JK 2E2HC 3S1MK 3S2HK 5IYBK 4YFXA 1I3QK 4A93K 3HOUK 3I4NK 2PA8L 4LK1A 5C4JC 3GTPK 4XSXA 3S1MC 1I3QC 3M4OC 3HOUC 3HOVK 3I4NC 3RZDK 3GTPC 5M5WK 3GTGC 5C4XK 1TWFK 4BY7K 3RZDC 3CQZK 4OIPA 4OIRA 4GZYA 5TMFA 3HKZL 3GTQC 2NVXK 4OINA 3CQZC 2O5JA 1I6VA 3H3VL 3GTKK 2JA7C 3S14K 4C3HK 1I50K 4A3EC 5FLMC 2NVXC 4A3DK 3GTKC 4BBRK 3S14C 1I50C 2JA6K 2B63C 2JA6C 2R7ZK 3S16K 4A3GK 4YFKA 5M3MK 3GTLK 4BBSC 1R9TC 1TWHK 5IP9K 2A6EA 4QIWL 2R7ZC
chains in the Genus database with same CATH superfamily
4KN7A 1JOEA 4A3GC 2E2JK 2V6SA 1TWHC 2XCRB 2NVYK 1J6WA 3S2HC 2NVTK 4QJVA 1Y1VA 1WCMA 4C2MC 4BY1K 2R93A 1EK8A 4KASA 2E2IA 1XZQA 4Q4ZA 3RZOC 4C3JC 4MEXA 1C0AA 4M1XA 4A3IC 1O25A 4MEYA 1BDFA 4GTDA 3FHZA 1WQGA 4NOIA 1WSVA 4YFNA 4BY7C 2P8TA 1JVIA 4QJVB 5IP7C 2XCQA 1WCMK 4A3KK 1VRQC 4KMDA 4MQ9A 1WORA 5C44K 4KN4A 3T00A 2NVTC 1WQHA 3HXAA 3CQZA 4G0WA 2GSOA 1DCPA 3GTKA 5IORA 2B63A 4LOWA 3S17C 4KATA 5TJ3A 2JA6A 4G7HA 3S1RK 4A3MC 3GTGK 1K83K 1TWCK 4BLBA 1O28A 2Y0SD 4C3IC 1I6HC 4LJZA 1Y1WK 1GE9A 1Y1VC 1WCMC 2R93C 2BE5A 4A3KC 3H0GK 1G51A 2E2IC 2XCOA 2PPBA 4A3EK 3M3YK 5C44C 3TFHA 1ISEA 4KDDA 2B63K 4WJ4A 4LLGA 4J3NA 5EGEA 3S1QC 4A3JK 1SFOA 3N3YA 3HOZK 1XXAA 1UV7A 5IYBK 3I4NK 1TWAA 1WOOA 3VA7A 4KB2A 4BLAA 3GTGC 2R92A 4KMHA 1PJ7A 4OIPA 4GZYA 4OINA 3CQZC 2O5JA 2FQOA 3A8JA 4C3HK 1I50K 4A3EC 1VLOA 3GTKC 4BBRK 2B63C 2JA6C 3S16K 4A3GK 3QX3A 4KM9A 1TWHK 5IP9K 4WJ3M 1IS1A 3T02A 4C2MK 3HOZC 5IYBC 2V6UA 3EQLA 1O2AA 2Y0SL 3FOFA 3GTJK 3BP3A 3RZOK 4ILDA 1WOSA 4C3JK 3GTQA 4P5AA 4A3IK 1O29A 4C3HC 3K7AC 4BY7K 2WAQD 4BBRC 2PMZD 1SFOC 4AYBD 4BXXC 5IP7K 1HQMA 2RH6A 2PA8D 3S0XA 1YX2A 4KAWX 4X6AK 1TWAC 5IP9C 3G4CA 4A3FK 1I3QA 3N0BA 3GTPA 1RU0A 3JSTA 2NVQC 1YNNA 1WSRA 1WQFA 1TWFA 3GTJC 4Y52C 2NVXA 4YG2A 3HOWC 3S17K 1EQRA 1XXBA 1YCLA 2GSUA 4A3MK 2R7ZA 3AQPA 4A3LC 4ZH4A 4C3IK 1I6HK 4FZBA 1Y1VK 3OPFA 2R93K 2E2IK 4Q5SA 4X6AC 4A3CC 3OREA 4A3FC 2YU9A 3DXJA 1X31C 3IPJA 5TMCA 3GEHA 1PJ6A 3S1QK 4BBSK 1ZQ1C 2ZFZA 4XCHA 2JA8C 5IYDC 1IW7A 4OIOA 1INNA 3PO3K 5IOTA 1USOA 2WAQL 2PMZL 4AYBL 4YFXA 1IQ0A 4KM8A 3AD7C 3GTLA 2PA8L 5C4JC 1I3QC 3HOUC 1XZPA 3GTPC 5M5WK 3GTOA 1J6XA 3CQZK 1O2BA 3FKIA 1O26A 2ZUEA 5TMFA 3GTKK 1EI6A 5L46A 2NVXC 4A3DK 1TWGA 1WOPA 2JA6K 2JH3A 1J98A 1J6VA 3ERED 3TFJA 4KC6A 4YFKA 3MMLB 5M3MK 4G0VA 3GTLK 4BBSC 2E2HA 2R7ZC 3FOEA 5CJ9A 1XZPB 3PO3C 4LQYA 2WB1D 3GTOK 3ADAC 4FM9A 2A68A 3SZYA 3NUHA 5HL8A 1L0WA 1JQWA 2YU9C 4WILA 2VUMA 2D6FC 2ZUFA 3AQOA 2JA7A 5IYCC 4GTFA 1USMA 3K7AK 3S1NC 1SFOK 5M3FK 2JA5A 4BXXK 2V6TA 1XPPA 4A3DC 4Y7NK 4LK0A 4JK1A 3HOXK 1R9TA 4GTLA 1TWAK 4O2DA 4G7OA 1F9NA 3GTLC 1IE0A 2R92K 2NVQK 4C45A 3LAJA 3GTOC 2A69A 2GAGC 5FJ8K 1B4BA 4Y52K 3SZZA 1SMYA 5EGHA 1BGWA 1DCHA 2EBBA 3HOWK 4XLNA 2GAHC 3S2DC 3BP8C 4G0UA 4A3BC 3I4MC 4A3LK 3HOYC 4Y7NC 3M4OK 3HOXC 2WB1L 4A3CK 2NVYA 4GTBA 4GT9A 3GTQK 2R92C 2VUMC 5D4DA 5FLMK 3L4JA 4XSZA 2W7VA 3AD8C 2JA8K 4PABA 2CW0A 5IYDK 3GEEA 2JA5C 5M5XK 1ZBSA 1O27A 3TTGA 5IOQA 3BUEA 2Y3PA 5C4JK 1I3QK 4A93K 3HOUK 3S1MC 3TFIA 3GTPK 3T01A 3GIRA 3M4OC 1VH2A 3HOVK 5C4XK 1TWFK 2P5MA 3RZDC 4OIRA 3GTQC 2NVXK 1I6VA 5FLMC 5E68A 3AH5A 3S14C 3G4AA 1F7VA 1O2FB 2R7ZK 1XXCA 1YNJA 4GTEA 4GTCA 1XZQB 4KMAA 1O24A 2E2JC 3GEIA 2YU9K 4A93C 5C3EK 3GTGA 2NVYC 4KMUA 4AH6A 1K83A 1TWCA 1F93A 1Y1WA 5IYCK 4BY1C 3HOVC 2FQTA 3H0GA 4LR2A 5C4XC 1TWFC 3LAPA 5JFEA 3S1NK 3GSIA 3LPXA 3GTMA 3PO2K 4XLPA 3V4GA 1ZXOA 5M5YK 3Q3QA 1F7UA 2A6HA 3WODA 1HI9A 3AD9C 3CAGA 2O5IA 4KARA 3FKIK 1B4AA 4OIQA 1DD5A 1V5VA 5CHPA 5C3EC 3HKZD 3GTMK 3H3VD 1TWGK 1DCOA 1EFWA 3S2DK 3S15K 1I50A 2CFAA 4A3BK 2PHCB 3I4MK 2E2HK 3PO2C 3HOYK 4BKWA 4QIWD 4KB4A 1VJEA 4RMFA 3S1RC 1TWHA 2KWAA 4GTAA 4PAAA 1IBAA 3GDZA 1PJ5A 1K83C 2VUMK 1TWCC 1Y1WC 2JA7K 3GTJA 3H0GC 3FKIC 1KQ4A 2CFAB 3M3YC 5IOSA 4P5BA 1VGXA 2JA5K 3GTMC 1ZYRA 1TWGC 1R9TK 4G7ZA 3S15C 3L4KA 4A3JC 1AB4A 4DDQA 2E2HC 3S1MK 3S2HK 4LK1A 4XSXA 5JVOA 4P9SA 3I4NC 1BS2A 3RZDK 3A8IA 3HKZL 1BJTA 4GFQA 2RGRA 1ZVUA 3H3VL 2JA7C 3S14K 1WIHA 1IL2A 3OEPA 1EH1A 1I50C 2GSNA 3N0CA 3A8KA 1R9TC 2A6EA 4QIWL 3S16C
chains in the Genus database with same CATH topology
4KN7A 4A3GC 2E2JK 4X6AC 3PO3C 1TWHC 2WB1D 3GTOK 2NVYK 4C2MK 2E2JC 3HOZC 3S2HC 5IYBC 2YU9K 2NVTK 2A68A 5C3EK 2NVYC 3EQLA 4KMUA 4QJVA 2Y0SL 4BY1K 4A93C 3GTJK 3RZOK 2YU9C 4C3JK 5IYCK 4Q4ZA 4BY1C 3HOVC 3RZOC 3S16C 5C4XC 4A3IK 1TWFC 5IYCC 4MEXA 3S1NK 4A3IC 3PO2K 4XLPA 3K7AK 4MEYA 3S1NC 1SFOK 1BDFA 5M3FK 4BXXK 1XPPA 3K7AC 5M5YK 4Y7NK 4A3DC 2WAQD 4BBRC 2PMZD 4LK0A 4NOIA 4JK1A 4AYBD 3HOXK 1SFOC 4BXXC 4YFNA 2A6HA 3WODA 5IP7K 4BY7C 1HQMA 1TWAK 4G7OA 2PA8D 4QJVB 5IP7C 2O5IA 1WCMK 3GTLC 4X6AK 1TWAC 5IP9C 4A3KK 4A3FK 2R92K 2NVQK 4MQ9A 1YNJA 3FKIK 3GTOC 5C44K 4KN4A 2A69A 5FJ8K 1YNNA 4OIQA 2NVQC 4Y52K 2NVTC 5C3EC 3HKZD 3GTMK 1SMYA 3GTJC 3H3VD 4Y52C 1TWGK 3HOWK 4XLNA 3S2DK 3S15K 4YG2A 3HOWC 3S17K 3S2DC 4A3BK 4A3MK 3I4MK 2E2HK 3PO2C 3S17C 3HOYK 4G7HA 3S1RK 4QIWD 4A3BC 4A3MC 3I4MC 4A3LK 3HOYC 4Y7NC 3M4OK 3S1RC 3HOXC 4ZH4A 4C3IK 3GTGK 4A3LC 1I6HK 1Y1VK 1K83K 2WB1L 2R93K 1TWCK 4A3CK 2Y0SD 2E2IK 1I6HC 4LJZA 1Y1WK 4Q5SA 1Y1VC 1K83C 1WCMC 2VUMK 1TWCC 2BE5A 4A3KC 3H0GK 3GTQK 4A3FC 2E2IC 2R92C 4A3CC 1Y1WC 3DXJA 2JA7K 2VUMC 5D4DA 2PPBA 4A3EK 5FLMK 3H0GC 3FKIC 3M3YK 5C44C 4XSZA 2R93C 3M3YC 5TMCA 2B63K 2JA8K 4LLGA 2JA5K 2CW0A 3GTMC 5IYDK 3S1QK 1ZYRA 1TWGC 4BBSK 2JA8C 1R9TK 2JA5C 4G7ZA 5IYDC 1IW7A 3S1QC 4OIOA 4A3JK 3S15C 5M5XK 3PO3K 2WAQL 2PMZL 4AYBL 4A3JC 3HOZK 5C4JK 2E2HC 3S1MK 3S2HK 5IYBK 4YFXA 1I3QK 4A93K 3HOUK 3I4NK 2PA8L 4LK1A 5C4JC 3GTPK 4XSXA 3S1MC 1I3QC 3M4OC 3HOUC 3HOVK 3I4NC 3RZDK 3GTPC 5M5WK 3GTGC 5C4XK 1TWFK 4BY7K 3RZDC 3CQZK 4OIPA 4OIRA 4GZYA 5TMFA 3HKZL 3GTQC 2NVXK 4OINA 3CQZC 2O5JA 1I6VA 3H3VL 3GTKK 2JA7C 3S14K 4C3HK 1I50K 4A3EC 5FLMC 2NVXC 4A3DK 3GTKC 4BBRK 3S14C 1I50C 2JA6K 2B63C 2JA6C 2R7ZK 3S16K 4A3GK 4YFKA 5M3MK 3GTLK 4BBSC 1R9TC 1TWHK 5IP9K 2A6EA 4QIWL 2R7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 A;  4A3G C;  2E2J K;  4X6A C;  3PO3 C;  1TWH C;  2WB1 D;  3GTO K;  2NVY K;  4C2M K;  2E2J C;  3HOZ C;  3S2H C;  5IYB C;  2YU9 K;  2NVT K;  2A68 A;  5C3E K;  2NVY C;  3EQL A;  4KMU A;  4QJV A;  2Y0S L;  4BY1 K;  4A93 C;  3GTJ K;  3RZO K;  2YU9 C;  4C3J K;  5IYC K;  4Q4Z A;  4BY1 C;  3HOV C;  3RZO C;  3S16 C;  5C4X C;  4A3I K;  1TWF C;  5IYC C;  4MEX A;  3S1N K;  4A3I C;  3PO2 K;  4XLP A;  3K7A K;  4MEY A;  3S1N C;  1SFO K;  1BDF A;  5M3F K;  4BXX K;  1XPP A;  3K7A C;  5M5Y K;  4Y7N K;  4A3D C;  2WAQ D;  4BBR C;  2PMZ D;  4LK0 A;  4NOI A;  4JK1 A;  4AYB D;  3HOX K;  1SFO C;  4BXX C;  4YFN A;  2A6H A;  3WOD A;  5IP7 K;  4BY7 C;  1HQM A;  1TWA K;  4G7O A;  2PA8 D;  4QJV B;  5IP7 C;  2O5I A;  1WCM K;  3GTL C;  4X6A K;  1TWA C;  5IP9 C;  4A3K K;  4A3F K;  2R92 K;  2NVQ K;  4MQ9 A;  1YNJ A;  3FKI K;  3GTO C;  5C44 K;  4KN4 A;  2A69 A;  5FJ8 K;  1YNN A;  4OIQ A;  2NVQ C;  4Y52 K;  2NVT C;  5C3E C;  3HKZ D;  3GTM K;  1SMY A;  3GTJ C;  3H3V D;  4Y52 C;  1TWG K;  3HOW K;  4XLN A;  3S2D K;  3S15 K;  4YG2 A;  3HOW C;  3S17 K;  3S2D C;  4A3B K;  4A3M K;  3I4M K;  2E2H K;  3PO2 C;  3S17 C;  3HOY K;  4G7H A;  3S1R K;  4QIW D;  4A3B C;  4A3M C;  3I4M C;  4A3L K;  3HOY C;  4Y7N C;  3M4O K;  3S1R C;  3HOX C;  4ZH4 A;  4C3I K;  3GTG K;  4A3L C;  1I6H K;  1Y1V K;  1K83 K;  2WB1 L;  2R93 K;  1TWC K;  4A3C K;  2Y0S D;  2E2I K;  1I6H C;  4LJZ A;  1Y1W K;  4Q5S A;  1Y1V C;  1K83 C;  1WCM C;  2VUM K;  1TWC C;  2BE5 A;  4A3K C;  3H0G K;  3GTQ K;  4A3F C;  2E2I C;  2R92 C;  4A3C C;  1Y1W C;  3DXJ A;  2JA7 K;  2VUM C;  5D4D A;  2PPB A;  4A3E K;  5FLM K;  3H0G C;  3FKI C;  3M3Y K;  5C44 C;  4XSZ A;  2R93 C;  3M3Y C;  5TMC A;  2B63 K;  2JA8 K;  4LLG A;  2JA5 K;  2CW0 A;  3GTM C;  5IYD K;  3S1Q K;  1ZYR A;  1TWG C;  4BBS K;  2JA8 C;  1R9T K;  2JA5 C;  4G7Z A;  5IYD C;  1IW7 A;  3S1Q C;  4OIO A;  4A3J K;  3S15 C;  5M5X K;  3PO3 K;  2WAQ L;  2PMZ L;  4AYB L;  4A3J C;  3HOZ K;  5C4J K;  2E2H C;  3S1M K;  3S2H K;  5IYB K;  4YFX A;  1I3Q K;  4A93 K;  3HOU K;  3I4N K;  2PA8 L;  4LK1 A;  5C4J C;  3GTP K;  4XSX A;  3S1M C;  1I3Q C;  3M4O C;  3HOU C;  3HOV K;  3I4N C;  3RZD K;  3GTP C;  5M5W K;  3GTG C;  5C4X K;  1TWF K;  4BY7 K;  3RZD C;  3CQZ K;  4OIP A;  4OIR A;  4GZY A;  5TMF A;  3HKZ L;  3GTQ C;  2NVX K;  4OIN A;  3CQZ C;  2O5J A;  1I6V A;  3H3V L;  3GTK K;  2JA7 C;  3S14 K;  4C3H K;  1I50 K;  4A3E C;  5FLM C;  2NVX C;  4A3D K;  3GTK C;  4BBR K;  3S14 C;  1I50 C;  2JA6 K;  2B63 C;  2JA6 C;  2R7Z K;  3S16 K;  4A3G K;  4YFK A;  5M3M K;  3GTL K;  4BBS C;  1R9T C;  1TWH K;  5IP9 K;  2A6E A;  4QIW L;  2R7Z C; 
#chains in the Genus database with same CATH topology
 4KN7 A;  1JOE A;  4A3G C;  2E2J K;  2V6S A;  1TWH C;  2XCR B;  2NVY K;  1J6W A;  3S2H C;  2NVT K;  4QJV A;  1Y1V A;  1WCM A;  4C2M C;  4BY1 K;  2R93 A;  1EK8 A;  4KAS A;  2E2I A;  1XZQ A;  4Q4Z A;  3RZO C;  4C3J C;  4MEX A;  1C0A A;  4M1X A;  4A3I C;  1O25 A;  4MEY A;  1BDF A;  4GTD A;  3FHZ A;  1WQG A;  4NOI A;  1WSV A;  4YFN A;  4BY7 C;  2P8T A;  1JVI A;  4QJV B;  5IP7 C;  2XCQ A;  1WCM K;  4A3K K;  1VRQ C;  4KMD A;  4MQ9 A;  1WOR A;  5C44 K;  4KN4 A;  3T00 A;  2NVT C;  1WQH A;  3HXA A;  3CQZ A;  4G0W A;  2GSO A;  1DCP A;  3GTK A;  5IOR A;  2B63 A;  4LOW A;  3S17 C;  4KAT A;  5TJ3 A;  2JA6 A;  4G7H A;  3S1R K;  4A3M C;  3GTG K;  1K83 K;  1TWC K;  4BLB A;  1O28 A;  2Y0S D;  4C3I C;  1I6H C;  4LJZ A;  1Y1W K;  1GE9 A;  1Y1V C;  1WCM C;  2R93 C;  2BE5 A;  4A3K C;  3H0G K;  1G51 A;  2E2I C;  2XCO A;  2PPB A;  4A3E K;  3M3Y K;  5C44 C;  3TFH A;  1ISE A;  4KDD A;  2B63 K;  4WJ4 A;  4LLG A;  4J3N A;  5EGE A;  3S1Q C;  4A3J K;  1SFO A;  3N3Y A;  3HOZ K;  1XXA A;  1UV7 A;  5IYB K;  3I4N K;  1TWA A;  1WOO A;  3VA7 A;  4KB2 A;  4BLA A;  3GTG C;  2R92 A;  4KMH A;  1PJ7 A;  4OIP A;  4GZY A;  4OIN A;  3CQZ C;  2O5J A;  2FQO A;  3A8J A;  4C3H K;  1I50 K;  4A3E C;  1VLO A;  3GTK C;  4BBR K;  2B63 C;  2JA6 C;  3S16 K;  4A3G K;  3QX3 A;  4KM9 A;  1TWH K;  5IP9 K;  4WJ3 M;  1IS1 A;  3T02 A;  4C2M K;  3HOZ C;  5IYB C;  2V6U A;  3EQL A;  1O2A A;  2Y0S L;  3FOF A;  3GTJ K;  3BP3 A;  3RZO K;  4ILD A;  1WOS A;  4C3J K;  3GTQ A;  4P5A A;  4A3I K;  1O29 A;  4C3H C;  3K7A C;  4BY7 K;  2WAQ D;  4BBR C;  2PMZ D;  1SFO C;  4AYB D;  4BXX C;  5IP7 K;  1HQM A;  2RH6 A;  2PA8 D;  3S0X A;  1YX2 A;  4KAW X;  4X6A K;  1TWA C;  5IP9 C;  3G4C A;  4A3F K;  1I3Q A;  3N0B A;  3GTP A;  1RU0 A;  3JST A;  2NVQ C;  1YNN A;  1WSR A;  1WQF A;  1TWF A;  3GTJ C;  4Y52 C;  2NVX A;  4YG2 A;  3HOW C;  3S17 K;  1EQR A;  1XXB A;  1YCL A;  2GSU A;  4A3M K;  2R7Z A;  3AQP A;  4A3L C;  4ZH4 A;  4C3I K;  1I6H K;  4FZB A;  1Y1V K;  3OPF A;  2R93 K;  2E2I K;  4Q5S A;  4X6A C;  4A3C C;  3ORE A;  4A3F C;  2YU9 A;  3DXJ A;  1X31 C;  3IPJ A;  5TMC A;  3GEH A;  1PJ6 A;  3S1Q K;  4BBS K;  1ZQ1 C;  2ZFZ A;  4XCH A;  2JA8 C;  5IYD C;  1IW7 A;  4OIO A;  1INN A;  3PO3 K;  5IOT A;  1USO A;  2WAQ L;  2PMZ L;  4AYB L;  4YFX A;  1IQ0 A;  4KM8 A;  3AD7 C;  3GTL A;  2PA8 L;  5C4J C;  1I3Q C;  3HOU C;  1XZP A;  3GTP C;  5M5W K;  3GTO A;  1J6X A;  3CQZ K;  1O2B A;  3FKI A;  1O26 A;  2ZUE A;  5TMF A;  3GTK K;  1EI6 A;  5L46 A;  2NVX C;  4A3D K;  1TWG A;  1WOP A;  2JA6 K;  2JH3 A;  1J98 A;  1J6V A;  3ERE D;  3TFJ A;  4KC6 A;  4YFK A;  3MML B;  5M3M K;  4G0V A;  3GTL K;  4BBS C;  2E2H A;  2R7Z C;  3FOE A;  5CJ9 A;  1XZP B;  3PO3 C;  4LQY A;  2WB1 D;  3GTO K;  3ADA C;  4FM9 A;  2A68 A;  3SZY A;  3NUH A;  5HL8 A;  1L0W A;  1JQW A;  2YU9 C;  4WIL A;  2VUM A;  2D6F C;  2ZUF A;  3AQO A;  2JA7 A;  5IYC C;  4GTF A;  1USM A;  3K7A K;  3S1N C;  1SFO K;  5M3F K;  2JA5 A;  4BXX K;  2V6T A;  1XPP A;  4A3D C;  4Y7N K;  4LK0 A;  4JK1 A;  3HOX K;  1R9T A;  4GTL A;  1TWA K;  4O2D A;  4G7O A;  1F9N A;  3GTL C;  1IE0 A;  2R92 K;  2NVQ K;  4C45 A;  3LAJ A;  3GTO C;  2A69 A;  2GAG C;  5FJ8 K;  1B4B A;  4Y52 K;  3SZZ A;  1SMY A;  5EGH A;  1BGW A;  1DCH A;  2EBB A;  3HOW K;  4XLN A;  2GAH C;  3S2D C;  3BP8 C;  4G0U A;  4A3B C;  3I4M C;  4A3L K;  3HOY C;  4Y7N C;  3M4O K;  3HOX C;  2WB1 L;  4A3C K;  2NVY A;  4GTB A;  4GT9 A;  3GTQ K;  2R92 C;  2VUM C;  5D4D A;  5FLM K;  3L4J A;  4XSZ A;  2W7V A;  3AD8 C;  2JA8 K;  4PAB A;  2CW0 A;  5IYD K;  3GEE A;  2JA5 C;  5M5X K;  1ZBS A;  1O27 A;  3TTG A;  5IOQ A;  3BUE A;  2Y3P A;  5C4J K;  1I3Q K;  4A93 K;  3HOU K;  3S1M C;  3TFI A;  3GTP K;  3T01 A;  3GIR A;  3M4O C;  1VH2 A;  3HOV K;  5C4X K;  1TWF K;  2P5M A;  3RZD C;  4OIR A;  3GTQ C;  2NVX K;  1I6V A;  5FLM C;  5E68 A;  3AH5 A;  3S14 C;  3G4A A;  1F7V A;  1O2F B;  2R7Z K;  1XXC A;  1YNJ A;  4GTE A;  4GTC A;  1XZQ B;  4KMA A;  1O24 A;  2E2J C;  3GEI A;  2YU9 K;  4A93 C;  5C3E K;  3GTG A;  2NVY C;  4KMU A;  4AH6 A;  1K83 A;  1TWC A;  1F93 A;  1Y1W A;  5IYC K;  4BY1 C;  3HOV C;  2FQT A;  3H0G A;  4LR2 A;  5C4X C;  1TWF C;  3LAP A;  5JFE A;  3S1N K;  3GSI A;  3LPX A;  3GTM A;  3PO2 K;  4XLP A;  3V4G A;  1ZXO A;  5M5Y K;  3Q3Q A;  1F7U A;  2A6H A;  3WOD A;  1HI9 A;  3AD9 C;  3CAG A;  2O5I A;  4KAR A;  3FKI K;  1B4A A;  4OIQ A;  1DD5 A;  1V5V A;  5CHP A;  5C3E C;  3HKZ D;  3GTM K;  3H3V D;  1TWG K;  1DCO A;  1EFW A;  3S2D K;  3S15 K;  1I50 A;  2CFA A;  4A3B K;  2PHC B;  3I4M K;  2E2H K;  3PO2 C;  3HOY K;  4BKW A;  4QIW D;  4KB4 A;  1VJE A;  4RMF A;  3S1R C;  1TWH A;  2KWA A;  4GTA A;  4PAA A;  1IBA A;  3GDZ A;  1PJ5 A;  1K83 C;  2VUM K;  1TWC C;  1Y1W C;  2JA7 K;  3GTJ A;  3H0G C;  3FKI C;  1KQ4 A;  2CFA B;  3M3Y C;  5IOS A;  4P5B A;  1VGX A;  2JA5 K;  3GTM C;  1ZYR A;  1TWG C;  1R9T K;  4G7Z A;  3S15 C;  3L4K A;  4A3J C;  1AB4 A;  4DDQ A;  2E2H C;  3S1M K;  3S2H K;  4LK1 A;  4XSX A;  5JVO A;  4P9S A;  3I4N C;  1BS2 A;  3RZD K;  3A8I A;  3HKZ L;  1BJT A;  4GFQ A;  2RGR A;  1ZVU A;  3H3V L;  2JA7 C;  3S14 K;  1WIH A;  1IL2 A;  3OEP A;  1EH1 A;  1I50 C;  2GSN A;  3N0C A;  3A8K A;  1R9T C;  2A6E A;  4QIW L;  3S16 C; 
#chains in the Genus database with same CATH homology
 4KN7 A;  4A3G C;  2E2J K;  4X6A C;  3PO3 C;  1TWH C;  2WB1 D;  3GTO K;  2NVY K;  4C2M K;  2E2J C;  3HOZ C;  3S2H C;  5IYB C;  2YU9 K;  2NVT K;  2A68 A;  5C3E K;  2NVY C;  3EQL A;  4KMU A;  4QJV A;  2Y0S L;  4BY1 K;  4A93 C;  3GTJ K;  3RZO K;  2YU9 C;  4C3J K;  5IYC K;  4Q4Z A;  4BY1 C;  3HOV C;  3RZO C;  3S16 C;  5C4X C;  4A3I K;  1TWF C;  5IYC C;  4MEX A;  3S1N K;  4A3I C;  3PO2 K;  4XLP A;  3K7A K;  4MEY A;  3S1N C;  1SFO K;  1BDF A;  5M3F K;  4BXX K;  1XPP A;  3K7A C;  5M5Y K;  4Y7N K;  4A3D C;  2WAQ D;  4BBR C;  2PMZ D;  4LK0 A;  4NOI A;  4JK1 A;  4AYB D;  3HOX K;  1SFO C;  4BXX C;  4YFN A;  2A6H A;  3WOD A;  5IP7 K;  4BY7 C;  1HQM A;  1TWA K;  4G7O A;  2PA8 D;  4QJV B;  5IP7 C;  2O5I A;  1WCM K;  3GTL C;  4X6A K;  1TWA C;  5IP9 C;  4A3K K;  4A3F K;  2R92 K;  2NVQ K;  4MQ9 A;  1YNJ A;  3FKI K;  3GTO C;  5C44 K;  4KN4 A;  2A69 A;  5FJ8 K;  1YNN A;  4OIQ A;  2NVQ C;  4Y52 K;  2NVT C;  5C3E C;  3HKZ D;  3GTM K;  1SMY A;  3GTJ C;  3H3V D;  4Y52 C;  1TWG K;  3HOW K;  4XLN A;  3S2D K;  3S15 K;  4YG2 A;  3HOW C;  3S17 K;  3S2D C;  4A3B K;  4A3M K;  3I4M K;  2E2H K;  3PO2 C;  3S17 C;  3HOY K;  4G7H A;  3S1R K;  4QIW D;  4A3B C;  4A3M C;  3I4M C;  4A3L K;  3HOY C;  4Y7N C;  3M4O K;  3S1R C;  3HOX C;  4ZH4 A;  4C3I K;  3GTG K;  4A3L C;  1I6H K;  1Y1V K;  1K83 K;  2WB1 L;  2R93 K;  1TWC K;  4A3C K;  2Y0S D;  2E2I K;  1I6H C;  4LJZ A;  1Y1W K;  4Q5S A;  1Y1V C;  1K83 C;  1WCM C;  2VUM K;  1TWC C;  2BE5 A;  4A3K C;  3H0G K;  3GTQ K;  4A3F C;  2E2I C;  2R92 C;  4A3C C;  1Y1W C;  3DXJ A;  2JA7 K;  2VUM C;  5D4D A;  2PPB A;  4A3E K;  5FLM K;  3H0G C;  3FKI C;  3M3Y K;  5C44 C;  4XSZ A;  2R93 C;  3M3Y C;  5TMC A;  2B63 K;  2JA8 K;  4LLG A;  2JA5 K;  2CW0 A;  3GTM C;  5IYD K;  3S1Q K;  1ZYR A;  1TWG C;  4BBS K;  2JA8 C;  1R9T K;  2JA5 C;  4G7Z A;  5IYD C;  1IW7 A;  3S1Q C;  4OIO A;  4A3J K;  3S15 C;  5M5X K;  3PO3 K;  2WAQ L;  2PMZ L;  4AYB L;  4A3J C;  3HOZ K;  5C4J K;  2E2H C;  3S1M K;  3S2H K;  5IYB K;  4YFX A;  1I3Q K;  4A93 K;  3HOU K;  3I4N K;  2PA8 L;  4LK1 A;  5C4J C;  3GTP K;  4XSX A;  3S1M C;  1I3Q C;  3M4O C;  3HOU C;  3HOV K;  3I4N C;  3RZD K;  3GTP C;  5M5W K;  3GTG C;  5C4X K;  1TWF K;  4BY7 K;  3RZD C;  3CQZ K;  4OIP A;  4OIR A;  4GZY A;  5TMF A;  3HKZ L;  3GTQ C;  2NVX K;  4OIN A;  3CQZ C;  2O5J A;  1I6V A;  3H3V L;  3GTK K;  2JA7 C;  3S14 K;  4C3H K;  1I50 K;  4A3E C;  5FLM C;  2NVX C;  4A3D K;  3GTK C;  4BBR K;  3S14 C;  1I50 C;  2JA6 K;  2B63 C;  2JA6 C;  2R7Z K;  3S16 K;  4A3G K;  4YFK A;  5M3M K;  3GTL K;  4BBS C;  1R9T C;  1TWH K;  5IP9 K;  2A6E A;  4QIW L;  2R7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...