5C4XK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4xK00
4LJZA 5IYDC 2WAQL 5IYBK 2CW0A 3WODA 5C44K 4OINA 4BBRC 4A3MC 4BBSK 2A69A 3S2DK 1I50C 4A3DC 2WB1D 3HOZK 4A93K 3S16K 3HOWK 5C44C 2JA5C 1Y1VK 1TWFK 4QIWD 2YU9K 5D4DA 3H3VD 2WAQD 2A6HA 4AYBL 3I4NC 4BXXC 2PA8L 3HOWC 2JA8K 1Y1WC 4G7OA 5C3EK 4A3EK 1I3QK 1YNJA 1SFOK 2JA7C 1WCMK 3GTJK 2O5JA 4A3FK 4A3EC 1SFOC 2O5IA 4Q4ZA 4A3LC 2R92C 4KN7A 5M3FK 1HQMA 2BE5A 2E2HC 3GTOK 3GTJC 3I4MK 3PO2C 5IYDK 2B63C 5IYCK 4A3MK 4BY1C 2A6EA 1I50K 4BY7C 3S1MK 2Y0SL 4C3JK 1TWHK 4ZH4A 2JA5K 4YFNA 5IYCC 2PMZL 3S1MC 5IP7C 3I4NK 5M5XK 2NVXC 4BXXK 1TWHC 4LK0A 1Y1WK 4A3IK 4A3CC 2VUMC 4X6AK 2R7ZC 4XSZA 2JA7K 2A68A 4A3JC 3S2HK 3S1QK 1K83C 3EQLA 5FLMK 5TMFA 4A3IC 3HOVC 4X6AC 1TWGK 1TWCC 3CQZC 3FKIC 5M5YK 2JA6K 3S2HC 2R92K 3PO2K 2E2HK 4A3LK 3PO3C 3HKZL 4XLPA 3S1QC 5FLMC 3S1NC 1TWAC 3M3YK 1TWGC 2JA6C 3GTPC 2NVQC 2B63K 4AYBD 5IP9C 2PA8D 2E2IC 4BY1K 4YFKA 4BY7K 3M3YC 3HOUC 4YFXA 4C3IK 3HOYC 4NOIA 3S15C 1R9TC 5IP7K 2PPBA 3H0GC 2NVXK 3GTLK 4A3BC 4A3CK 3HOXC 2VUMK 1XPPA 3S14C 3GTQC 2R7ZK 4A3JK 1YNNA 3K7AK 4GZYA 3GTMC 5C4XC 1K83K 5C4JC 3GTLC 3DXJA 3HOVK 2E2JK 3S17C 1TWCK 3CQZK 3FKIK 2Y0SD 3K7AC 4OIQA 4Y7NC 3PO3K 4Q5SA 3S1NK 2PMZD 1TWAK 2E2JC 3GTPK 2NVQK 3GTKC 5M5WK 5IP9K 2E2IK 3M4OC 4KN4A 3GTGC 3RZDC 2WB1L 1ZYRA 3HOUK 3S1RC 2NVYC 3HOYK 4MEYA 4QIWL 3S15K 4YG2A 4A3GC 4JK1A 1I6HK 1R9TK 2R93K 1I6VA 3H0GK 4A3BK 4Y52K 3HKZD 3HOXK 4A3KC 3S14K 4XSXA 3GTQK 1BDFA 1I6HC 5IYBC 3GTMK 5C4XK 2R93C 5C4JK 4OIPA 4Y52C 2NVTK 4C2MK 4BBSC 3S17K 3S2DC 3HOZC 4QJVB 4A93C 4C3HK 4Y7NK 4G7ZA 4MEXA 3S16C 4LK1A 5M3MK 2NVTC 1Y1VC 1TWFC 2YU9C 4LLGA 5FJ8K 3GTKK 4XLNA 4KMUA 2JA8C 3M4OK 3GTGK 5C3EC 4OIRA 1I3QC 3RZDK 3RZOK 1IW7A 4MQ9A 5TMCA 4G7HA 3S1RK 1WCMC 2NVYK 4A3GK 4A3FC 3RZOC 4OIOA 4QJVA 1SMYA 3I4MC 3GTOC 4BBRK 4A3KK 3H3VL 4A3DK
chains in the Genus database with same CATH superfamily
1BS2A 5IYDC 2CW0A 4BBRC 4WJ4A 4G0UA 4KAWX 1DCPA 1ZBSA 1V5VA 4WILA 5IORA 3ADAC 1YCLA 3T02A 3BP8C 1L0WA 1PJ5A 3L4KA 1B4AA 5IOQA 4A3EC 3FHZA 1SFOC 4Q4ZA 3I4MK 4KN7A 3PO2C 3A8KA 2B63C 5IYCK 2RH6A 1I50K 4C3JK 3GIRA 5L46A 1PJ7A 4ZH4A 2JA5K 1X31C 4YFNA 3TFIA 5EGEA 5IP7C 2NVXC 4BXXK 1TWHC 4KB4A 1Y1WK 3TFJA 2JA7K 2A68A 4GTAA 1SFOA 2JA6K 3CQZC 1JOEA 3S2HC 2E2HK 3PO3C 3S1NC 4DDQA 3M3YK 1TWGC 2GAGC 4KMDA 4AYBD 2E2IC 4YFKA 5EGHA 1XZPB 1ZXOA 4NOIA 1TWHA 1DD5A 3GTLK 4A3BC 1XZQB 1EQRA 3S14C 3BP3A 3CAGA 1YNNA 3K7AK 1O2AA 3CQZA 2E2JK 3S17C 1O28A 1TWCK 2FQOA 4KDDA 1TWGA 1JVIA 2E2IA 2Y3PA 1DCHA 5CJ9A 5IP9K 5E68A 1WOOA 4BKWA 1ZYRA 1DCOA 1ISEA 3H0GK 2CFAB 3HOXK 3FOEA 4A3KC 3GTQK 1I6HC 1IS1A 4BBSC 1IE0A 1K83A 2GSNA 3AD9C 4G0VA 3AD8C 5M3MK 3FKIA 4O2DA 1Y1VC 1TWFC 2W7VA 4XLNA 1TWAA 3GTPA 1O26A 5C3EC 3GTGK 5IOTA 3JSTA 1WCMC 1WSVA 4AH6A 1SMYA 4GTEA 3GTOC 4BBRK 3ERED 4LJZA 2WAQL 5IYBK 3WODA 4KB2A 3VA7A 4OINA 1IBAA 2ZUEA 4A3DC 3TTGA 4A93K 1TWFA 3S16K 3AH5A 5C44C 3H3VD 2YU9K 3GEHA 2A6HA 3I4NC 3OREA 2PA8L 2JA8K 2XCOA 3GTKA 4A3EK 1SFOK 1I3QK 1WCMA 2O5JA 3GTOA 1XXBA 1XXAA 4P5BA 5M3FK 1HQMA 2BE5A 3GTJC 4GTCA 3NUHA 4A3MK 3AD7C 2Y0SL 1TWHK 4KASA 3LPXA 3T01A 4LOWA 5M5XK 3IPJA 3SZYA 1XXCA 4A3CC 2VUMC 2ZUFA 2R7ZC 4A3JC 3S2HK 3EQLA 4A3IC 1TWGK 4A3LK 1F7UA 3GTJA 1PJ6A 2R92K 1EK8A 3HKZL 4XLPA 1GE9A 4GTLA 2XCRB 5JVOA 3N3YA 4BY1K 1HI9A 4BY7K 4C3IK 3S15C 4XCHA 4GFQA 1R9TC 1YX2A 2VUMA 2R7ZA 1XPPA 1WSRA 3TFHA 3GTMC 5C4XC 1K83K 5C4JC 3HOVK 3AQPA 3FKIK 1XZPA 3HXAA 4Y7NC 4PAAA 2PMZD 1TWAK 3GTPK 4WJ3M 2NVQK 3OPFA 1XZQA 4KN4A 3BUEA 2B63A 3RZDC 3HOUK 3HOYK 4MEYA 4JK1A 1I6HK 2JH3A 3GTMA 2NVXA 1BDFA 1ZQ1C 2D6FC 2R93C 4Y52C 4C2MK 4QJVB 4M1XA 4BLAA 4MEXA 4LK1A 2P8TA 5FJ8K 3GTKK 3GEEA 2V6UA 3M4OK 1J98A 1F9NA 4OIRA 4FZBA 4MQ9A 3S1RK 4PABA 4KATA 2NVYK 3N0CA 3GEIA 4A3GK 3A8JA 3RZOC 4OIOA 3I4MC 1O29A 1WORA 1O27A 4A3DK 2R93A 5C44K 4P5AA 2A69A 3S2DK 1I50C 1WOSA 2WB1D 3HOZK 2JA5C 4QIWD 2WAQD 4AYBL 4BXXC 3HOWC 1Y1WC 1YNJA 2JA7C 2P5MA 4KC6A 3GTJK 4GTBA 4LQYA 4A3FK 1WQGA 2O5IA 4FM9A 1USOA 1F7VA 2E2HC 1EH1A 5IYDK 1I50A 3T00A 2A6EA 3G4AA 4P9SA 2PHCB 2JA5A 4J3NA 1O2FB 1B4BA 3V4GA 4KMHA 3S1MC 1Y1WA 1Y1VA 4LK0A 2RGRA 2JA7A 4A3IK 4KMAA 1VGXA 2V6SA 3Q3QA 2E2HA 5M5YK 1TWCC 4X6AC 1KQ4A 3PO2K 3S1QC 5FLMC 1O25A 1VJEA 2B63K 5IP9C 4YFXA 2GSUA 5IP7K 3H0GC 2NVXK 3G4CA 5HL8A 3HOXC 3GTQC 4GZYA 1TWCA 3DXJA 1BJTA 3CQZK 4Q5SA 3PO3K 3S1NK 3GSIA 1O24A 3LAPA 2ZFZA 2E2IK 3GTGC 1USMA 4ILDA 3L4JA 3H0GA 4G0WA 2R93K 4A3BK 1G51A 3GTQA 4Y52K 3S14K 1VH2A 5IYBC 4OIPA 5JFEA 3S17K 4GTFA 4A93C 4G7ZA 3S16C 2GAHC 3LAJA 2NVTC 2YU9C 3N0BA 3GTGA 4C3HC 4KMUA 2JA8C 1I3QC 3RZOK 5TMCA 4G7HA 4GT9A 1RU0A 4QJVA 4A3KK 1R9TA 3S0XA 4A3MC 4BBSK 1EI6A 1J6WA 2YU9A 1O2BA 3HOWK 1Y1VK 1TWFK 5D4DA 1C0AA 1I3QA 4G7OA 5C3EK 3FOFA 1WCMK 5IOSA 2CFAA 4A3LC 4GTDA 2R92C 4KARA 3GTOK 1IQ0A 3AQOA 3GDZA 4BY1C 4BY7C 3S1MK 4C3IC 1WQFA 5IYCC 2PMZL 2KWAA 4C3JC 3QX3A 3I4NK 4X6AK 4LR2A 4XSZA 3S1QK 1K83C 5FLMK 1WIHA 5TMFA 3HOVC 2R92A 1ZVUA 3FKIC 1TWAC 4RMFA 2JA6C 3GTPC 2NVQC 2PA8D 1J6VA 1EFWA 3OEPA 3M3YC 4C45A 3HOUC 3MMLB 3HOYC 2FQTA 2PPBA 1VLOA 4A3CK 2VUMK 2R7ZK 4A3JK 3GTLC 4C2MC 4OIQA 2Y0SD 3K7AC 1IL2A 2JA6A 1UV7A 2E2JC 3GTKC 5M5WK 2V6TA 3M4OC 1F93A 5CHPA 2WB1L 3S1RC 1JQWA 2NVYC 3A8IA 2GSOA 4QIWL 3S15K 1INNA 4YG2A 4KM9A 4A3GC 1R9TK 1I6VA 1WQHA 2XCQA 3HKZD 4XSXA 3GTLA 1J6XA 3GTMK 5C4XK 1WOPA 5C4JK 2NVTK 4BLBA 2EBBA 3S2DC 3HOZC 4C3HK 4Y7NK 1VRQC 4LLGA 3RZDK 2NVYA 1IW7A 4KM8A 4A3FC 1BGWA 1AB4A 5TJ3A 3H3VL 3SZZA
chains in the Genus database with same CATH topology
4LJZA 5IYDC 2WAQL 5IYBK 2CW0A 3WODA 5C44K 4OINA 4BBRC 4A3MC 4BBSK 2A69A 3S2DK 1I50C 4A3DC 2WB1D 3HOZK 4A93K 3S16K 3HOWK 5C44C 2JA5C 1Y1VK 1TWFK 4QIWD 2YU9K 5D4DA 3H3VD 2WAQD 2A6HA 4AYBL 3I4NC 4BXXC 2PA8L 3HOWC 2JA8K 1Y1WC 4G7OA 5C3EK 4A3EK 1I3QK 1YNJA 1SFOK 2JA7C 1WCMK 3GTJK 2O5JA 4A3FK 4A3EC 1SFOC 2O5IA 4Q4ZA 4A3LC 2R92C 4KN7A 5M3FK 1HQMA 2BE5A 2E2HC 3GTOK 3GTJC 3I4MK 3PO2C 5IYDK 2B63C 5IYCK 4A3MK 4BY1C 2A6EA 1I50K 4BY7C 3S1MK 2Y0SL 4C3JK 1TWHK 4ZH4A 2JA5K 4YFNA 5IYCC 2PMZL 3S1MC 5IP7C 3I4NK 5M5XK 2NVXC 4BXXK 1TWHC 4LK0A 1Y1WK 4A3IK 4A3CC 2VUMC 4X6AK 2R7ZC 4XSZA 2JA7K 2A68A 4A3JC 3S2HK 3S1QK 1K83C 3EQLA 5FLMK 5TMFA 4A3IC 3HOVC 4X6AC 1TWGK 1TWCC 3CQZC 3FKIC 5M5YK 2JA6K 3S2HC 2R92K 3PO2K 2E2HK 4A3LK 3PO3C 3HKZL 4XLPA 3S1QC 5FLMC 3S1NC 1TWAC 3M3YK 1TWGC 2JA6C 3GTPC 2NVQC 2B63K 4AYBD 5IP9C 2PA8D 2E2IC 4BY1K 4YFKA 4BY7K 3M3YC 3HOUC 4YFXA 4C3IK 3HOYC 4NOIA 3S15C 1R9TC 5IP7K 2PPBA 3H0GC 2NVXK 3GTLK 4A3BC 4A3CK 3HOXC 2VUMK 1XPPA 3S14C 3GTQC 2R7ZK 4A3JK 1YNNA 3K7AK 4GZYA 3GTMC 5C4XC 1K83K 5C4JC 3GTLC 3DXJA 3HOVK 2E2JK 3S17C 1TWCK 3CQZK 3FKIK 2Y0SD 3K7AC 4OIQA 4Y7NC 3PO3K 4Q5SA 3S1NK 2PMZD 1TWAK 2E2JC 3GTPK 2NVQK 3GTKC 5M5WK 5IP9K 2E2IK 3M4OC 4KN4A 3GTGC 3RZDC 2WB1L 1ZYRA 3HOUK 3S1RC 2NVYC 3HOYK 4MEYA 4QIWL 3S15K 4YG2A 4A3GC 4JK1A 1I6HK 1R9TK 2R93K 1I6VA 3H0GK 4A3BK 4Y52K 3HKZD 3HOXK 4A3KC 3S14K 4XSXA 3GTQK 1BDFA 1I6HC 5IYBC 3GTMK 5C4XK 2R93C 5C4JK 4OIPA 4Y52C 2NVTK 4C2MK 4BBSC 3S17K 3S2DC 3HOZC 4QJVB 4A93C 4C3HK 4Y7NK 4G7ZA 4MEXA 3S16C 4LK1A 5M3MK 2NVTC 1Y1VC 1TWFC 2YU9C 4LLGA 5FJ8K 3GTKK 4XLNA 4KMUA 2JA8C 3M4OK 3GTGK 5C3EC 4OIRA 1I3QC 3RZDK 3RZOK 1IW7A 4MQ9A 5TMCA 4G7HA 3S1RK 1WCMC 2NVYK 4A3GK 4A3FC 3RZOC 4OIOA 4QJVA 1SMYA 3I4MC 3GTOC 4BBRK 4A3KK 3H3VL 4A3DK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJZ A;  5IYD C;  2WAQ L;  5IYB K;  2CW0 A;  3WOD A;  5C44 K;  4OIN A;  4BBR C;  4A3M C;  4BBS K;  2A69 A;  3S2D K;  1I50 C;  4A3D C;  2WB1 D;  3HOZ K;  4A93 K;  3S16 K;  3HOW K;  5C44 C;  2JA5 C;  1Y1V K;  1TWF K;  4QIW D;  2YU9 K;  5D4D A;  3H3V D;  2WAQ D;  2A6H A;  4AYB L;  3I4N C;  4BXX C;  2PA8 L;  3HOW C;  2JA8 K;  1Y1W C;  4G7O A;  5C3E K;  4A3E K;  1I3Q K;  1YNJ A;  1SFO K;  2JA7 C;  1WCM K;  3GTJ K;  2O5J A;  4A3F K;  4A3E C;  1SFO C;  2O5I A;  4Q4Z A;  4A3L C;  2R92 C;  4KN7 A;  5M3F K;  1HQM A;  2BE5 A;  2E2H C;  3GTO K;  3GTJ C;  3I4M K;  3PO2 C;  5IYD K;  2B63 C;  5IYC K;  4A3M K;  4BY1 C;  2A6E A;  1I50 K;  4BY7 C;  3S1M K;  2Y0S L;  4C3J K;  1TWH K;  4ZH4 A;  2JA5 K;  4YFN A;  5IYC C;  2PMZ L;  3S1M C;  5IP7 C;  3I4N K;  5M5X K;  2NVX C;  4BXX K;  1TWH C;  4LK0 A;  1Y1W K;  4A3I K;  4A3C C;  2VUM C;  4X6A K;  2R7Z C;  4XSZ A;  2JA7 K;  2A68 A;  4A3J C;  3S2H K;  3S1Q K;  1K83 C;  3EQL A;  5FLM K;  5TMF A;  4A3I C;  3HOV C;  4X6A C;  1TWG K;  1TWC C;  3CQZ C;  3FKI C;  5M5Y K;  2JA6 K;  3S2H C;  2R92 K;  3PO2 K;  2E2H K;  4A3L K;  3PO3 C;  3HKZ L;  4XLP A;  3S1Q C;  5FLM C;  3S1N C;  1TWA C;  3M3Y K;  1TWG C;  2JA6 C;  3GTP C;  2NVQ C;  2B63 K;  4AYB D;  5IP9 C;  2PA8 D;  2E2I C;  4BY1 K;  4YFK A;  4BY7 K;  3M3Y C;  3HOU C;  4YFX A;  4C3I K;  3HOY C;  4NOI A;  3S15 C;  1R9T C;  5IP7 K;  2PPB A;  3H0G C;  2NVX K;  3GTL K;  4A3B C;  4A3C K;  3HOX C;  2VUM K;  1XPP A;  3S14 C;  3GTQ C;  2R7Z K;  4A3J K;  1YNN A;  3K7A K;  4GZY A;  3GTM C;  5C4X C;  1K83 K;  5C4J C;  3GTL C;  3DXJ A;  3HOV K;  2E2J K;  3S17 C;  1TWC K;  3CQZ K;  3FKI K;  2Y0S D;  3K7A C;  4OIQ A;  4Y7N C;  3PO3 K;  4Q5S A;  3S1N K;  2PMZ D;  1TWA K;  2E2J C;  3GTP K;  2NVQ K;  3GTK C;  5M5W K;  5IP9 K;  2E2I K;  3M4O C;  4KN4 A;  3GTG C;  3RZD C;  2WB1 L;  1ZYR A;  3HOU K;  3S1R C;  2NVY C;  3HOY K;  4MEY A;  4QIW L;  3S15 K;  4YG2 A;  4A3G C;  4JK1 A;  1I6H K;  1R9T K;  2R93 K;  1I6V A;  3H0G K;  4A3B K;  4Y52 K;  3HKZ D;  3HOX K;  4A3K C;  3S14 K;  4XSX A;  3GTQ K;  1BDF A;  1I6H C;  5IYB C;  3GTM K;  5C4X K;  2R93 C;  5C4J K;  4OIP A;  4Y52 C;  2NVT K;  4C2M K;  4BBS C;  3S17 K;  3S2D C;  3HOZ C;  4QJV B;  4A93 C;  4C3H K;  4Y7N K;  4G7Z A;  4MEX A;  3S16 C;  4LK1 A;  5M3M K;  2NVT C;  1Y1V C;  1TWF C;  2YU9 C;  4LLG A;  5FJ8 K;  3GTK K;  4XLN A;  4KMU A;  2JA8 C;  3M4O K;  3GTG K;  5C3E C;  4OIR A;  1I3Q C;  3RZD K;  3RZO K;  1IW7 A;  4MQ9 A;  5TMC A;  4G7H A;  3S1R K;  1WCM C;  2NVY K;  4A3G K;  4A3F C;  3RZO C;  4OIO A;  4QJV A;  1SMY A;  3I4M C;  3GTO C;  4BBR K;  4A3K K;  3H3V L;  4A3D K; 
#chains in the Genus database with same CATH topology
 1BS2 A;  5IYD C;  2CW0 A;  4BBR C;  4WJ4 A;  4G0U A;  4KAW X;  1DCP A;  1ZBS A;  1V5V A;  4WIL A;  5IOR A;  3ADA C;  1YCL A;  3T02 A;  3BP8 C;  1L0W A;  1PJ5 A;  3L4K A;  1B4A A;  5IOQ A;  4A3E C;  3FHZ A;  1SFO C;  4Q4Z A;  3I4M K;  4KN7 A;  3PO2 C;  3A8K A;  2B63 C;  5IYC K;  2RH6 A;  1I50 K;  4C3J K;  3GIR A;  5L46 A;  1PJ7 A;  4ZH4 A;  2JA5 K;  1X31 C;  4YFN A;  3TFI A;  5EGE A;  5IP7 C;  2NVX C;  4BXX K;  1TWH C;  4KB4 A;  1Y1W K;  3TFJ A;  2JA7 K;  2A68 A;  4GTA A;  1SFO A;  2JA6 K;  3CQZ C;  1JOE A;  3S2H C;  2E2H K;  3PO3 C;  3S1N C;  4DDQ A;  3M3Y K;  1TWG C;  2GAG C;  4KMD A;  4AYB D;  2E2I C;  4YFK A;  5EGH A;  1XZP B;  1ZXO A;  4NOI A;  1TWH A;  1DD5 A;  3GTL K;  4A3B C;  1XZQ B;  1EQR A;  3S14 C;  3BP3 A;  3CAG A;  1YNN A;  3K7A K;  1O2A A;  3CQZ A;  2E2J K;  3S17 C;  1O28 A;  1TWC K;  2FQO A;  4KDD A;  1TWG A;  1JVI A;  2E2I A;  2Y3P A;  1DCH A;  5CJ9 A;  5IP9 K;  5E68 A;  1WOO A;  4BKW A;  1ZYR A;  1DCO A;  1ISE A;  3H0G K;  2CFA B;  3HOX K;  3FOE A;  4A3K C;  3GTQ K;  1I6H C;  1IS1 A;  4BBS C;  1IE0 A;  1K83 A;  2GSN A;  3AD9 C;  4G0V A;  3AD8 C;  5M3M K;  3FKI A;  4O2D A;  1Y1V C;  1TWF C;  2W7V A;  4XLN A;  1TWA A;  3GTP A;  1O26 A;  5C3E C;  3GTG K;  5IOT A;  3JST A;  1WCM C;  1WSV A;  4AH6 A;  1SMY A;  4GTE A;  3GTO C;  4BBR K;  3ERE D;  4LJZ A;  2WAQ L;  5IYB K;  3WOD A;  4KB2 A;  3VA7 A;  4OIN A;  1IBA A;  2ZUE A;  4A3D C;  3TTG A;  4A93 K;  1TWF A;  3S16 K;  3AH5 A;  5C44 C;  3H3V D;  2YU9 K;  3GEH A;  2A6H A;  3I4N C;  3ORE A;  2PA8 L;  2JA8 K;  2XCO A;  3GTK A;  4A3E K;  1SFO K;  1I3Q K;  1WCM A;  2O5J A;  3GTO A;  1XXB A;  1XXA A;  4P5B A;  5M3F K;  1HQM A;  2BE5 A;  3GTJ C;  4GTC A;  3NUH A;  4A3M K;  3AD7 C;  2Y0S L;  1TWH K;  4KAS A;  3LPX A;  3T01 A;  4LOW A;  5M5X K;  3IPJ A;  3SZY A;  1XXC A;  4A3C C;  2VUM C;  2ZUF A;  2R7Z C;  4A3J C;  3S2H K;  3EQL A;  4A3I C;  1TWG K;  4A3L K;  1F7U A;  3GTJ A;  1PJ6 A;  2R92 K;  1EK8 A;  3HKZ L;  4XLP A;  1GE9 A;  4GTL A;  2XCR B;  5JVO A;  3N3Y A;  4BY1 K;  1HI9 A;  4BY7 K;  4C3I K;  3S15 C;  4XCH A;  4GFQ A;  1R9T C;  1YX2 A;  2VUM A;  2R7Z A;  1XPP A;  1WSR A;  3TFH A;  3GTM C;  5C4X C;  1K83 K;  5C4J C;  3HOV K;  3AQP A;  3FKI K;  1XZP A;  3HXA A;  4Y7N C;  4PAA A;  2PMZ D;  1TWA K;  3GTP K;  4WJ3 M;  2NVQ K;  3OPF A;  1XZQ A;  4KN4 A;  3BUE A;  2B63 A;  3RZD C;  3HOU K;  3HOY K;  4MEY A;  4JK1 A;  1I6H K;  2JH3 A;  3GTM A;  2NVX A;  1BDF A;  1ZQ1 C;  2D6F C;  2R93 C;  4Y52 C;  4C2M K;  4QJV B;  4M1X A;  4BLA A;  4MEX A;  4LK1 A;  2P8T A;  5FJ8 K;  3GTK K;  3GEE A;  2V6U A;  3M4O K;  1J98 A;  1F9N A;  4OIR A;  4FZB A;  4MQ9 A;  3S1R K;  4PAB A;  4KAT A;  2NVY K;  3N0C A;  3GEI A;  4A3G K;  3A8J A;  3RZO C;  4OIO A;  3I4M C;  1O29 A;  1WOR A;  1O27 A;  4A3D K;  2R93 A;  5C44 K;  4P5A A;  2A69 A;  3S2D K;  1I50 C;  1WOS A;  2WB1 D;  3HOZ K;  2JA5 C;  4QIW D;  2WAQ D;  4AYB L;  4BXX C;  3HOW C;  1Y1W C;  1YNJ A;  2JA7 C;  2P5M A;  4KC6 A;  3GTJ K;  4GTB A;  4LQY A;  4A3F K;  1WQG A;  2O5I A;  4FM9 A;  1USO A;  1F7V A;  2E2H C;  1EH1 A;  5IYD K;  1I50 A;  3T00 A;  2A6E A;  3G4A A;  4P9S A;  2PHC B;  2JA5 A;  4J3N A;  1O2F B;  1B4B A;  3V4G A;  4KMH A;  3S1M C;  1Y1W A;  1Y1V A;  4LK0 A;  2RGR A;  2JA7 A;  4A3I K;  4KMA A;  1VGX A;  2V6S A;  3Q3Q A;  2E2H A;  5M5Y K;  1TWC C;  4X6A C;  1KQ4 A;  3PO2 K;  3S1Q C;  5FLM C;  1O25 A;  1VJE A;  2B63 K;  5IP9 C;  4YFX A;  2GSU A;  5IP7 K;  3H0G C;  2NVX K;  3G4C A;  5HL8 A;  3HOX C;  3GTQ C;  4GZY A;  1TWC A;  3DXJ A;  1BJT A;  3CQZ K;  4Q5S A;  3PO3 K;  3S1N K;  3GSI A;  1O24 A;  3LAP A;  2ZFZ A;  2E2I K;  3GTG C;  1USM A;  4ILD A;  3L4J A;  3H0G A;  4G0W A;  2R93 K;  4A3B K;  1G51 A;  3GTQ A;  4Y52 K;  3S14 K;  1VH2 A;  5IYB C;  4OIP A;  5JFE A;  3S17 K;  4GTF A;  4A93 C;  4G7Z A;  3S16 C;  2GAH C;  3LAJ A;  2NVT C;  2YU9 C;  3N0B A;  3GTG A;  4C3H C;  4KMU A;  2JA8 C;  1I3Q C;  3RZO K;  5TMC A;  4G7H A;  4GT9 A;  1RU0 A;  4QJV A;  4A3K K;  1R9T A;  3S0X A;  4A3M C;  4BBS K;  1EI6 A;  1J6W A;  2YU9 A;  1O2B A;  3HOW K;  1Y1V K;  1TWF K;  5D4D A;  1C0A A;  1I3Q A;  4G7O A;  5C3E K;  3FOF A;  1WCM K;  5IOS A;  2CFA A;  4A3L C;  4GTD A;  2R92 C;  4KAR A;  3GTO K;  1IQ0 A;  3AQO A;  3GDZ A;  4BY1 C;  4BY7 C;  3S1M K;  4C3I C;  1WQF A;  5IYC C;  2PMZ L;  2KWA A;  4C3J C;  3QX3 A;  3I4N K;  4X6A K;  4LR2 A;  4XSZ A;  3S1Q K;  1K83 C;  5FLM K;  1WIH A;  5TMF A;  3HOV C;  2R92 A;  1ZVU A;  3FKI C;  1TWA C;  4RMF A;  2JA6 C;  3GTP C;  2NVQ C;  2PA8 D;  1J6V A;  1EFW A;  3OEP A;  3M3Y C;  4C45 A;  3HOU C;  3MML B;  3HOY C;  2FQT A;  2PPB A;  1VLO A;  4A3C K;  2VUM K;  2R7Z K;  4A3J K;  3GTL C;  4C2M C;  4OIQ A;  2Y0S D;  3K7A C;  1IL2 A;  2JA6 A;  1UV7 A;  2E2J C;  3GTK C;  5M5W K;  2V6T A;  3M4O C;  1F93 A;  5CHP A;  2WB1 L;  3S1R C;  1JQW A;  2NVY C;  3A8I A;  2GSO A;  4QIW L;  3S15 K;  1INN A;  4YG2 A;  4KM9 A;  4A3G C;  1R9T K;  1I6V A;  1WQH A;  2XCQ A;  3HKZ D;  4XSX A;  3GTL A;  1J6X A;  3GTM K;  5C4X K;  1WOP A;  5C4J K;  2NVT K;  4BLB A;  2EBB A;  3S2D C;  3HOZ C;  4C3H K;  4Y7N K;  1VRQ C;  4LLG A;  3RZD K;  2NVY A;  1IW7 A;  4KM8 A;  4A3F C;  1BGW A;  1AB4 A;  5TJ3 A;  3H3V L;  3SZZ A; 
#chains in the Genus database with same CATH homology
 4LJZ A;  5IYD C;  2WAQ L;  5IYB K;  2CW0 A;  3WOD A;  5C44 K;  4OIN A;  4BBR C;  4A3M C;  4BBS K;  2A69 A;  3S2D K;  1I50 C;  4A3D C;  2WB1 D;  3HOZ K;  4A93 K;  3S16 K;  3HOW K;  5C44 C;  2JA5 C;  1Y1V K;  1TWF K;  4QIW D;  2YU9 K;  5D4D A;  3H3V D;  2WAQ D;  2A6H A;  4AYB L;  3I4N C;  4BXX C;  2PA8 L;  3HOW C;  2JA8 K;  1Y1W C;  4G7O A;  5C3E K;  4A3E K;  1I3Q K;  1YNJ A;  1SFO K;  2JA7 C;  1WCM K;  3GTJ K;  2O5J A;  4A3F K;  4A3E C;  1SFO C;  2O5I A;  4Q4Z A;  4A3L C;  2R92 C;  4KN7 A;  5M3F K;  1HQM A;  2BE5 A;  2E2H C;  3GTO K;  3GTJ C;  3I4M K;  3PO2 C;  5IYD K;  2B63 C;  5IYC K;  4A3M K;  4BY1 C;  2A6E A;  1I50 K;  4BY7 C;  3S1M K;  2Y0S L;  4C3J K;  1TWH K;  4ZH4 A;  2JA5 K;  4YFN A;  5IYC C;  2PMZ L;  3S1M C;  5IP7 C;  3I4N K;  5M5X K;  2NVX C;  4BXX K;  1TWH C;  4LK0 A;  1Y1W K;  4A3I K;  4A3C C;  2VUM C;  4X6A K;  2R7Z C;  4XSZ A;  2JA7 K;  2A68 A;  4A3J C;  3S2H K;  3S1Q K;  1K83 C;  3EQL A;  5FLM K;  5TMF A;  4A3I C;  3HOV C;  4X6A C;  1TWG K;  1TWC C;  3CQZ C;  3FKI C;  5M5Y K;  2JA6 K;  3S2H C;  2R92 K;  3PO2 K;  2E2H K;  4A3L K;  3PO3 C;  3HKZ L;  4XLP A;  3S1Q C;  5FLM C;  3S1N C;  1TWA C;  3M3Y K;  1TWG C;  2JA6 C;  3GTP C;  2NVQ C;  2B63 K;  4AYB D;  5IP9 C;  2PA8 D;  2E2I C;  4BY1 K;  4YFK A;  4BY7 K;  3M3Y C;  3HOU C;  4YFX A;  4C3I K;  3HOY C;  4NOI A;  3S15 C;  1R9T C;  5IP7 K;  2PPB A;  3H0G C;  2NVX K;  3GTL K;  4A3B C;  4A3C K;  3HOX C;  2VUM K;  1XPP A;  3S14 C;  3GTQ C;  2R7Z K;  4A3J K;  1YNN A;  3K7A K;  4GZY A;  3GTM C;  5C4X C;  1K83 K;  5C4J C;  3GTL C;  3DXJ A;  3HOV K;  2E2J K;  3S17 C;  1TWC K;  3CQZ K;  3FKI K;  2Y0S D;  3K7A C;  4OIQ A;  4Y7N C;  3PO3 K;  4Q5S A;  3S1N K;  2PMZ D;  1TWA K;  2E2J C;  3GTP K;  2NVQ K;  3GTK C;  5M5W K;  5IP9 K;  2E2I K;  3M4O C;  4KN4 A;  3GTG C;  3RZD C;  2WB1 L;  1ZYR A;  3HOU K;  3S1R C;  2NVY C;  3HOY K;  4MEY A;  4QIW L;  3S15 K;  4YG2 A;  4A3G C;  4JK1 A;  1I6H K;  1R9T K;  2R93 K;  1I6V A;  3H0G K;  4A3B K;  4Y52 K;  3HKZ D;  3HOX K;  4A3K C;  3S14 K;  4XSX A;  3GTQ K;  1BDF A;  1I6H C;  5IYB C;  3GTM K;  5C4X K;  2R93 C;  5C4J K;  4OIP A;  4Y52 C;  2NVT K;  4C2M K;  4BBS C;  3S17 K;  3S2D C;  3HOZ C;  4QJV B;  4A93 C;  4C3H K;  4Y7N K;  4G7Z A;  4MEX A;  3S16 C;  4LK1 A;  5M3M K;  2NVT C;  1Y1V C;  1TWF C;  2YU9 C;  4LLG A;  5FJ8 K;  3GTK K;  4XLN A;  4KMU A;  2JA8 C;  3M4O K;  3GTG K;  5C3E C;  4OIR A;  1I3Q C;  3RZD K;  3RZO K;  1IW7 A;  4MQ9 A;  5TMC A;  4G7H A;  3S1R K;  1WCM C;  2NVY K;  4A3G K;  4A3F C;  3RZO C;  4OIO A;  4QJV A;  1SMY A;  3I4M C;  3GTO C;  4BBR K;  4A3K K;  3H3V L;  4A3D K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...