5C4XK

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/rna/dna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5c4xK00
3HOUC 3HOWK 4C2MK 3GTJK 3M4OC 4Y52K 5IYCC 3GTGK 3PO3C 5TMCA 4BY7K 4C3IK 4QIWD 3CQZK 5FJ8K 4MEYA 3GTGC 5FLMC 3HOZK 4BBSC 1Y1WK 4XLPA 5C3EC 3RZOK 2Y0SD 2R7ZC 4KN7A 2PMZD 5IYBK 2NVQK 1TWGC 1Y1VK 4BY1C 4A3KK 2NVXC 2E2IC 5D4DA 2YU9C 2NVQC 2R92K 3GTKK 4A3LC 4MEXA 2PA8L 5C3EK 4QJVB 3S17K 5C44C 4A3DC 3S1QC 4A3FC 3GTMK 4BY7C 4ZH4A 1WCMC 3H0GC 3S1NK 3S2DC 5IYCK 4AYBD 3PO3K 3WODA 4Y52C 3HOUK 3HOWC 3S15C 4BBSK 4A3BK 1SMYA 1WCMK 2E2JC 2JA8C 4A3GK 3I4MC 4A3FK 3S1QK 2R93K 3K7AC 3I4NC 3HKZL 5M3MK 4G7ZA 5IP7C 1TWFC 2BE5A 3HOVK 4Y7NK 4BBRK 5M5YK 5M3FK 3GTPK 2YU9K 5C4XC 2VUMC 4BXXC 1Y1VC 4BY1K 3HOYC 3S16K 2PMZL 2R7ZK 1TWHC 3GTQC 1IW7A 5M5WK 3HOXC 1R9TK 1Y1WC 1BDFA 5TMFA 1TWAK 5FLMK 2JA7K 3HOZC 4QIWL 4X6AK 1SFOK 2A68A 4A3JK 4Q4ZA 4G7HA 1K83K 4A3JC 2WB1L 4X6AC 4NOIA 3GTJC 1I50K 3RZDK 2JA5C 4G7OA 3HOXK 4A3EC 1I6HK 5C4JC 3FKIC 2NVTC 4A93K 2A6HA 3GTPC 2Y0SL 4BBRC 3HKZD 1I3QK 1ZYRA 2PPBA 1TWFK 2JA6C 3HOVC 3PO2C 3S2HC 4GZYA 3S14C 3FKIK 4A3IC 4A3GC 2R93C 2PA8D 4YFXA 1I6HC 2E2JK 1I6VA 2WAQL 4A3MK 4JK1A 4C3HK 4C3JK 5IYDC 3S1RK 2B63C 2O5IA 3M3YK 2B63K 3S1MC 5IYDK 4YFKA 3H0GK 3S2DK 5IP9C 3S14K 4YG2A 3GTMC 4A3CC 2JA6K 2JA7C 1TWCK 2O5JA 4QJVA 4LJZA 1R9TC 2NVTK 3GTLK 2R92C 4LK0A 5M5XK 4OINA 3GTLC 4KMUA 5C4XK 3HOYK 3DXJA 5IYBC 1TWCC 2A6EA 4LK1A 3H3VD 3RZOC 4A3CK 4LLGA 5IP7K 2CW0A 4KN4A 1K83C 1YNJA 3K7AK 3CQZC 3EQLA 5IP9K 3I4NK 1SFOC 4XSZA 3S1MK 1YNNA 4MQ9A 4A3BC 1TWAC 3M3YC 1HQMA 3RZDC 3M4OK 4OIOA 4A3MC 3S1RC 3GTKC 4AYBL 1TWHK 3GTQK 4OIPA 2E2HC 4XSXA 4A3IK 3S16C 3S1NC 2E2IK 4Q5SA 4BXXK 2WB1D 2VUMK 3PO2K 2NVYC 5C44K 1I3QC 3S2HK 4A3DK 4OIRA 4Y7NC 3S17C 3GTOK 3GTOC 4A93C 3H3VL 4XLNA 4OIQA 2A69A 2NVYK 4YFNA 2WAQD 5C4JK 3I4MK 2NVXK 4A3KC 4A3LK 2JA8K 1XPPA 1TWGK 4A3EK 2JA5K 2E2HK 1I50C 3S15K
chains in the Genus database with same CATH superfamily
4C2MK 3M4OC 3GTKA 5IYCC 3GTGK 5TMCA 1TWAA 1ZQ1C 4QIWD 4PAAA 5FJ8K 5C3EC 3T02A 2NVYA 1TWGC 3GDZA 2NVXC 2PA8L 1DCPA 4WJ4A 4A3DC 1O2BA 4ZH4A 3S1NK 2R92A 3PO3K 3WODA 1USMA 4BBSK 4A3BK 4C3HC 1SMYA 1WCMK 2E2JC 1JOEA 3S1QK 3K7AC 4G7ZA 4Y7NK 4BBRK 2P5MA 1I50A 3A8IA 1F9NA 1Y1VC 4BY1K 4G0VA 4G0WA 4KM9A 1R9TK 5FLMK 1WORA 1IE0A 1SFOK 2A68A 1JQWA 1Y1WA 3GTJC 3GTQA 1WSRA 2V6UA 1I50K 4A3EC 3ADAC 1O25A 1DD5A 1EI6A 3HKZD 1I3QK 2JA6C 1TWFK 3V4GA 3FKIK 4A3IC 1F93A 4A3GC 2PA8D 2E2JK 2O5IA 5IYDC 5IYDK 3BUEA 3S14K 1KQ4A 4YG2A 1O29A 2JA6K 1L0WA 2GSUA 3CAGA 4WJ3M 4C45A 4KARA 4LK0A 5M5XK 4KMUA 2JA7A 1TWCC 2A6EA 4J3NA 3H3VD 4A3CK 3H0GA 2CW0A 3S0XA 3I4NK 3N0BA 4XSZA 4MQ9A 4GTBA 1XZPA 1HQMA 3M4OK 3S1RC 2FQOA 4BXXK 4KMHA 1O27A 3GTPA 3T00A 4Y7NC 3S17C 3GTOC 4A93C 4GTAA 2V6TA 2A69A 2NVYK 2ZUFA 2WAQD 3FOEA 4KASA 3S15K 3HXAA 1XZPB 1INNA 4KB2A 1EFWA 3GTOA 2PMZD 4A3LC 2R92K 2Y3PA 1XXBA 4LQYA 1WCMA 1EK8A 1BJTA 2GSNA 3GTMK 4BY7C 3AQPA 3H0GC 4XCHA 3S2DC 5IYCK 3HOUK 3HOWC 2ZFZA 2B63A 2JA8C 2GSOA 2R93K 1VLOA 3L4JA 2CFAA 4KMAA 5HL8A 4GT9A 5IP7C 2BE5A 4G0UA 3GTPK 2YU9K 5C4XC 2VUMC 2V6SA 3GTQC 1C0AA 3SZYA 1Y1WC 4GTLA 5TMFA 1TWAK 3HOZC 3AH5A 4BLAA 4Q4ZA 4G7HA 1O26A 4GTEA 1XZQB 4KC6A 5JVOA 4ILDA 2EBBA 4G7OA 1DCOA 1WQFA 3FKIC 2NVTC 1ZXOA 1ZYRA 4GTCA 4GZYA 1J6XA 1ZVUA 1I6HC 1WQHA 2E2HA 1XZQA 3AD9C 3AD8C 2KWAA 1EQRA 4A3CC 1TWCK 1R9TC 3GTLK 1WSVA 2FQTA 2R92C 2YU9A 4LR2A 3DXJA 4LK1A 2R7ZA 2JA6A 1O2AA 4LLGA 4KN4A 1K83C 1YNJA 3K7AK 3CQZC 1J6VA 4A3BC 3M3YC 3GTQK 4Q5SA 1XXAA 5CJ9A 1JVIA 3S16C 1WIHA 3S1NC 2VUMK 3BP3A 3PO2K 2NVYC 5C44K 3TFJA 1I3QA 1BGWA 3S2HK 1UV7A 3GTOK 3H3VL 1PJ5A 4OIQA 5C4JK 1G51A 2NVXK 4A3KC 2JA8K 4A3EK 1WOSA 3GEIA 2E2HK 1I50C 3HOUC 3HOWK 3GTJK 1Y1VA 4C3IC 4BY7K 1PJ6A 3GEHA 1SFOA 4C3IK 4KATA 3GTGC 5FLMC 3RZOK 2Y0SD 2R7ZC 5IYBK 3FOFA 2NVQK 1BS2A 1Y1VK 3Q3QA 4LOWA 4A3KK 4BY1C 5D4DA 1V5VA 1TWFA 1RU0A 5C44C 3S1QC 4A3FC 1WCMC 4Y52C 4KAWX 1F7UA 3S15C 3AD7C 1PJ7A 5IOSA 4A3GK 4A3FK 4P5BA 1WOPA 5M3MK 1TWFC 3HOVK 5CHPA 3MMLB 4BXXC 2JA5A 1WOOA 1YCLA 2PMZL 2R7ZK 1IW7A 2JA7K 4WILA 4A3JK 3GSIA 1AB4A 3L4KA 4A3JC 4M1XA 4KDDA 4BLBA 4C2MC 1IS1A 1TWHA 4NOIA 4KMDA 3RZDK 4GTFA 1J98A 2JA5C 1I6HK 5C4JC 3SZZA 4KM8A 4GFQA 2A6HA 1VGXA 5IOTA 2Y0SL 4BBRC 3S2HC 3TFHA 3HOVC 3PO2C 3S14C 3TTGA 4AH6A 2WAQL 4A3MK 3GTKK 4JK1A 4C3HK 1HI9A 3M3YK 5IOQA 5IORA 4DDQA 4BKWA 4QJVA 3OREA 4LJZA 5JFEA 3HOYK 4OINA 3GTLC 2RGRA 5C4XK 5IYBC 1B4AA 3RZOC 1R9TA 5IP7K 5IP9K 1VJEA 3A8JA 1SFOC 2RH6A 3GIRA 3S1MK 1YNNA 4C3JC 4OIOA 4O2DA 4OIPA 2E2HC 1O28A 1TWGA 4RMFA 2WB1D 1DCHA 1O24A 4GTDA 2D6FC 1B4BA 2GAGC 1EH1A 4YFNA 4A3LK 1XPPA 2E2IA 2E2IC 4FZBA 4BBSC 4Y52K 3FHZA 3PO3C 2CFAB 1K83A 1XXCA 3AQOA 3CQZK 4MEYA 3HOZK 4FM9A 1Y1WK 4XLPA 3GTLA 4KN7A 1TWCA 2NVQC 2YU9C 3OPFA 4MEXA 5C3EK 4QJVB 3S17K 1YX2A 2ZUEA 3LAPA 4AYBD 3IPJA 3ERED 5E68A 1O2FB 3I4MC 3I4NC 3HKZL 3JSTA 5M3FK 5M5YK 3GTMA 4P9SA 3OEPA 1ZBSA 3HOYC 3S16K 1TWHC 5M5WK 3HOXC 2NVXA 3N3YA 1BDFA 4QIWL 4X6AK 1F7VA 3GTJA 4KB4A 3LPXA 1K83K 2WB1L 4X6AC 1VRQC 2JH3A 3HOXK 1ISEA 5EGEA 4A93K 2VUMA 3GTPC 1USOA 2PPBA 5EGHA 1IBAA 1X31C 4PABA 2R93C 4YFXA 1VH2A 1I6VA 3S1RK 3QX3A 2B63C 4C3JK 3T01A 2B63K 3S1MC 2XCRB 4YFKA 3CQZA 3H0GK 5TJ3A 3S2DK 5IP9C 2GAHC 3GTMC 2PHCB 3BP8C 2JA7C 3A8KA 2O5JA 3N0CA 3GEEA 2NVTK 1J6WA 4P5AA 2XCQA 3G4AA 3EQLA 3G4CA 1TWAC 2P8TA 2W7VA 4A3MC 3GTKC 4AYBL 1TWHK 3NUHA 4XSXA 3VA7A 4A3IK 3GTGA 2E2IK 3TFIA 2XCOA 1WQGA 3LAJA 4A3DK 1I3QC 2R93A 4OIRA 1GE9A 3FKIA 5L46A 4XLNA 3I4MK 1IQ0A 1IL2A 1TWGK 2JA5K 3RZDC
chains in the Genus database with same CATH topology
3HOUC 3HOWK 4C2MK 3GTJK 3M4OC 4Y52K 5IYCC 3GTGK 3PO3C 5TMCA 4BY7K 4C3IK 4QIWD 3CQZK 5FJ8K 4MEYA 3GTGC 5FLMC 3HOZK 4BBSC 1Y1WK 4XLPA 5C3EC 3RZOK 2Y0SD 2R7ZC 4KN7A 2PMZD 5IYBK 2NVQK 1TWGC 1Y1VK 4BY1C 4A3KK 2NVXC 2E2IC 5D4DA 2YU9C 2NVQC 2R92K 3GTKK 4A3LC 4MEXA 2PA8L 5C3EK 4QJVB 3S17K 5C44C 4A3DC 3S1QC 4A3FC 3GTMK 4BY7C 4ZH4A 1WCMC 3H0GC 3S1NK 3S2DC 5IYCK 4AYBD 3PO3K 3WODA 4Y52C 3HOUK 3HOWC 3S15C 4BBSK 4A3BK 1SMYA 1WCMK 2E2JC 2JA8C 4A3GK 3I4MC 4A3FK 3S1QK 2R93K 3K7AC 3I4NC 3HKZL 5M3MK 4G7ZA 5IP7C 1TWFC 2BE5A 3HOVK 4Y7NK 4BBRK 5M5YK 5M3FK 3GTPK 2YU9K 5C4XC 2VUMC 4BXXC 1Y1VC 4BY1K 3HOYC 3S16K 2PMZL 2R7ZK 1TWHC 3GTQC 1IW7A 5M5WK 3HOXC 1R9TK 1Y1WC 1BDFA 5TMFA 1TWAK 5FLMK 2JA7K 3HOZC 4QIWL 4X6AK 1SFOK 2A68A 4A3JK 4Q4ZA 4G7HA 1K83K 4A3JC 2WB1L 4X6AC 4NOIA 3GTJC 1I50K 3RZDK 2JA5C 4G7OA 3HOXK 4A3EC 1I6HK 5C4JC 3FKIC 2NVTC 4A93K 2A6HA 3GTPC 2Y0SL 4BBRC 3HKZD 1I3QK 1ZYRA 2PPBA 1TWFK 2JA6C 3HOVC 3PO2C 3S2HC 4GZYA 3S14C 3FKIK 4A3IC 4A3GC 2R93C 2PA8D 4YFXA 1I6HC 2E2JK 1I6VA 2WAQL 4A3MK 4JK1A 4C3HK 4C3JK 5IYDC 3S1RK 2B63C 2O5IA 3M3YK 2B63K 3S1MC 5IYDK 4YFKA 3H0GK 3S2DK 5IP9C 3S14K 4YG2A 3GTMC 4A3CC 2JA6K 2JA7C 1TWCK 2O5JA 4QJVA 4LJZA 1R9TC 2NVTK 3GTLK 2R92C 4LK0A 5M5XK 4OINA 3GTLC 4KMUA 5C4XK 3HOYK 3DXJA 5IYBC 1TWCC 2A6EA 4LK1A 3H3VD 3RZOC 4A3CK 4LLGA 5IP7K 2CW0A 4KN4A 1K83C 1YNJA 3K7AK 3CQZC 3EQLA 5IP9K 3I4NK 1SFOC 4XSZA 3S1MK 1YNNA 4MQ9A 4A3BC 1TWAC 3M3YC 1HQMA 3RZDC 3M4OK 4OIOA 4A3MC 3S1RC 3GTKC 4AYBL 1TWHK 3GTQK 4OIPA 2E2HC 4XSXA 4A3IK 3S16C 3S1NC 2E2IK 4Q5SA 4BXXK 2WB1D 2VUMK 3PO2K 2NVYC 5C44K 1I3QC 3S2HK 4A3DK 4OIRA 4Y7NC 3S17C 3GTOK 3GTOC 4A93C 3H3VL 4XLNA 4OIQA 2A69A 2NVYK 4YFNA 2WAQD 5C4JK 3I4MK 2NVXK 4A3KC 4A3LK 2JA8K 1XPPA 1TWGK 4A3EK 2JA5K 2E2HK 1I50C 3S15K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU C;  3HOW K;  4C2M K;  3GTJ K;  3M4O C;  4Y52 K;  5IYC C;  3GTG K;  3PO3 C;  5TMC A;  4BY7 K;  4C3I K;  4QIW D;  3CQZ K;  5FJ8 K;  4MEY A;  3GTG C;  5FLM C;  3HOZ K;  4BBS C;  1Y1W K;  4XLP A;  5C3E C;  3RZO K;  2Y0S D;  2R7Z C;  4KN7 A;  2PMZ D;  5IYB K;  2NVQ K;  1TWG C;  1Y1V K;  4BY1 C;  4A3K K;  2NVX C;  2E2I C;  5D4D A;  2YU9 C;  2NVQ C;  2R92 K;  3GTK K;  4A3L C;  4MEX A;  2PA8 L;  5C3E K;  4QJV B;  3S17 K;  5C44 C;  4A3D C;  3S1Q C;  4A3F C;  3GTM K;  4BY7 C;  4ZH4 A;  1WCM C;  3H0G C;  3S1N K;  3S2D C;  5IYC K;  4AYB D;  3PO3 K;  3WOD A;  4Y52 C;  3HOU K;  3HOW C;  3S15 C;  4BBS K;  4A3B K;  1SMY A;  1WCM K;  2E2J C;  2JA8 C;  4A3G K;  3I4M C;  4A3F K;  3S1Q K;  2R93 K;  3K7A C;  3I4N C;  3HKZ L;  5M3M K;  4G7Z A;  5IP7 C;  1TWF C;  2BE5 A;  3HOV K;  4Y7N K;  4BBR K;  5M5Y K;  5M3F K;  3GTP K;  2YU9 K;  5C4X C;  2VUM C;  4BXX C;  1Y1V C;  4BY1 K;  3HOY C;  3S16 K;  2PMZ L;  2R7Z K;  1TWH C;  3GTQ C;  1IW7 A;  5M5W K;  3HOX C;  1R9T K;  1Y1W C;  1BDF A;  5TMF A;  1TWA K;  5FLM K;  2JA7 K;  3HOZ C;  4QIW L;  4X6A K;  1SFO K;  2A68 A;  4A3J K;  4Q4Z A;  4G7H A;  1K83 K;  4A3J C;  2WB1 L;  4X6A C;  4NOI A;  3GTJ C;  1I50 K;  3RZD K;  2JA5 C;  4G7O A;  3HOX K;  4A3E C;  1I6H K;  5C4J C;  3FKI C;  2NVT C;  4A93 K;  2A6H A;  3GTP C;  2Y0S L;  4BBR C;  3HKZ D;  1I3Q K;  1ZYR A;  2PPB A;  1TWF K;  2JA6 C;  3HOV C;  3PO2 C;  3S2H C;  4GZY A;  3S14 C;  3FKI K;  4A3I C;  4A3G C;  2R93 C;  2PA8 D;  4YFX A;  1I6H C;  2E2J K;  1I6V A;  2WAQ L;  4A3M K;  4JK1 A;  4C3H K;  4C3J K;  5IYD C;  3S1R K;  2B63 C;  2O5I A;  3M3Y K;  2B63 K;  3S1M C;  5IYD K;  4YFK A;  3H0G K;  3S2D K;  5IP9 C;  3S14 K;  4YG2 A;  3GTM C;  4A3C C;  2JA6 K;  2JA7 C;  1TWC K;  2O5J A;  4QJV A;  4LJZ A;  1R9T C;  2NVT K;  3GTL K;  2R92 C;  4LK0 A;  5M5X K;  4OIN A;  3GTL C;  4KMU A;  5C4X K;  3HOY K;  3DXJ A;  5IYB C;  1TWC C;  2A6E A;  4LK1 A;  3H3V D;  3RZO C;  4A3C K;  4LLG A;  5IP7 K;  2CW0 A;  4KN4 A;  1K83 C;  1YNJ A;  3K7A K;  3CQZ C;  3EQL A;  5IP9 K;  3I4N K;  1SFO C;  4XSZ A;  3S1M K;  1YNN A;  4MQ9 A;  4A3B C;  1TWA C;  3M3Y C;  1HQM A;  3RZD C;  3M4O K;  4OIO A;  4A3M C;  3S1R C;  3GTK C;  4AYB L;  1TWH K;  3GTQ K;  4OIP A;  2E2H C;  4XSX A;  4A3I K;  3S16 C;  3S1N C;  2E2I K;  4Q5S A;  4BXX K;  2WB1 D;  2VUM K;  3PO2 K;  2NVY C;  5C44 K;  1I3Q C;  3S2H K;  4A3D K;  4OIR A;  4Y7N C;  3S17 C;  3GTO K;  3GTO C;  4A93 C;  3H3V L;  4XLN A;  4OIQ A;  2A69 A;  2NVY K;  4YFN A;  2WAQ D;  5C4J K;  3I4M K;  2NVX K;  4A3K C;  4A3L K;  2JA8 K;  1XPP A;  1TWG K;  4A3E K;  2JA5 K;  2E2H K;  1I50 C;  3S15 K; 
#chains in the Genus database with same CATH topology
 4C2M K;  3M4O C;  3GTK A;  5IYC C;  3GTG K;  5TMC A;  1TWA A;  1ZQ1 C;  4QIW D;  4PAA A;  5FJ8 K;  5C3E C;  3T02 A;  2NVY A;  1TWG C;  3GDZ A;  2NVX C;  2PA8 L;  1DCP A;  4WJ4 A;  4A3D C;  1O2B A;  4ZH4 A;  3S1N K;  2R92 A;  3PO3 K;  3WOD A;  1USM A;  4BBS K;  4A3B K;  4C3H C;  1SMY A;  1WCM K;  2E2J C;  1JOE A;  3S1Q K;  3K7A C;  4G7Z A;  4Y7N K;  4BBR K;  2P5M A;  1I50 A;  3A8I A;  1F9N A;  1Y1V C;  4BY1 K;  4G0V A;  4G0W A;  4KM9 A;  1R9T K;  5FLM K;  1WOR A;  1IE0 A;  1SFO K;  2A68 A;  1JQW A;  1Y1W A;  3GTJ C;  3GTQ A;  1WSR A;  2V6U A;  1I50 K;  4A3E C;  3ADA C;  1O25 A;  1DD5 A;  1EI6 A;  3HKZ D;  1I3Q K;  2JA6 C;  1TWF K;  3V4G A;  3FKI K;  4A3I C;  1F93 A;  4A3G C;  2PA8 D;  2E2J K;  2O5I A;  5IYD C;  5IYD K;  3BUE A;  3S14 K;  1KQ4 A;  4YG2 A;  1O29 A;  2JA6 K;  1L0W A;  2GSU A;  3CAG A;  4WJ3 M;  4C45 A;  4KAR A;  4LK0 A;  5M5X K;  4KMU A;  2JA7 A;  1TWC C;  2A6E A;  4J3N A;  3H3V D;  4A3C K;  3H0G A;  2CW0 A;  3S0X A;  3I4N K;  3N0B A;  4XSZ A;  4MQ9 A;  4GTB A;  1XZP A;  1HQM A;  3M4O K;  3S1R C;  2FQO A;  4BXX K;  4KMH A;  1O27 A;  3GTP A;  3T00 A;  4Y7N C;  3S17 C;  3GTO C;  4A93 C;  4GTA A;  2V6T A;  2A69 A;  2NVY K;  2ZUF A;  2WAQ D;  3FOE A;  4KAS A;  3S15 K;  3HXA A;  1XZP B;  1INN A;  4KB2 A;  1EFW A;  3GTO A;  2PMZ D;  4A3L C;  2R92 K;  2Y3P A;  1XXB A;  4LQY A;  1WCM A;  1EK8 A;  1BJT A;  2GSN A;  3GTM K;  4BY7 C;  3AQP A;  3H0G C;  4XCH A;  3S2D C;  5IYC K;  3HOU K;  3HOW C;  2ZFZ A;  2B63 A;  2JA8 C;  2GSO A;  2R93 K;  1VLO A;  3L4J A;  2CFA A;  4KMA A;  5HL8 A;  4GT9 A;  5IP7 C;  2BE5 A;  4G0U A;  3GTP K;  2YU9 K;  5C4X C;  2VUM C;  2V6S A;  3GTQ C;  1C0A A;  3SZY A;  1Y1W C;  4GTL A;  5TMF A;  1TWA K;  3HOZ C;  3AH5 A;  4BLA A;  4Q4Z A;  4G7H A;  1O26 A;  4GTE A;  1XZQ B;  4KC6 A;  5JVO A;  4ILD A;  2EBB A;  4G7O A;  1DCO A;  1WQF A;  3FKI C;  2NVT C;  1ZXO A;  1ZYR A;  4GTC A;  4GZY A;  1J6X A;  1ZVU A;  1I6H C;  1WQH A;  2E2H A;  1XZQ A;  3AD9 C;  3AD8 C;  2KWA A;  1EQR A;  4A3C C;  1TWC K;  1R9T C;  3GTL K;  1WSV A;  2FQT A;  2R92 C;  2YU9 A;  4LR2 A;  3DXJ A;  4LK1 A;  2R7Z A;  2JA6 A;  1O2A A;  4LLG A;  4KN4 A;  1K83 C;  1YNJ A;  3K7A K;  3CQZ C;  1J6V A;  4A3B C;  3M3Y C;  3GTQ K;  4Q5S A;  1XXA A;  5CJ9 A;  1JVI A;  3S16 C;  1WIH A;  3S1N C;  2VUM K;  3BP3 A;  3PO2 K;  2NVY C;  5C44 K;  3TFJ A;  1I3Q A;  1BGW A;  3S2H K;  1UV7 A;  3GTO K;  3H3V L;  1PJ5 A;  4OIQ A;  5C4J K;  1G51 A;  2NVX K;  4A3K C;  2JA8 K;  4A3E K;  1WOS A;  3GEI A;  2E2H K;  1I50 C;  3HOU C;  3HOW K;  3GTJ K;  1Y1V A;  4C3I C;  4BY7 K;  1PJ6 A;  3GEH A;  1SFO A;  4C3I K;  4KAT A;  3GTG C;  5FLM C;  3RZO K;  2Y0S D;  2R7Z C;  5IYB K;  3FOF A;  2NVQ K;  1BS2 A;  1Y1V K;  3Q3Q A;  4LOW A;  4A3K K;  4BY1 C;  5D4D A;  1V5V A;  1TWF A;  1RU0 A;  5C44 C;  3S1Q C;  4A3F C;  1WCM C;  4Y52 C;  4KAW X;  1F7U A;  3S15 C;  3AD7 C;  1PJ7 A;  5IOS A;  4A3G K;  4A3F K;  4P5B A;  1WOP A;  5M3M K;  1TWF C;  3HOV K;  5CHP A;  3MML B;  4BXX C;  2JA5 A;  1WOO A;  1YCL A;  2PMZ L;  2R7Z K;  1IW7 A;  2JA7 K;  4WIL A;  4A3J K;  3GSI A;  1AB4 A;  3L4K A;  4A3J C;  4M1X A;  4KDD A;  4BLB A;  4C2M C;  1IS1 A;  1TWH A;  4NOI A;  4KMD A;  3RZD K;  4GTF A;  1J98 A;  2JA5 C;  1I6H K;  5C4J C;  3SZZ A;  4KM8 A;  4GFQ A;  2A6H A;  1VGX A;  5IOT A;  2Y0S L;  4BBR C;  3S2H C;  3TFH A;  3HOV C;  3PO2 C;  3S14 C;  3TTG A;  4AH6 A;  2WAQ L;  4A3M K;  3GTK K;  4JK1 A;  4C3H K;  1HI9 A;  3M3Y K;  5IOQ A;  5IOR A;  4DDQ A;  4BKW A;  4QJV A;  3ORE A;  4LJZ A;  5JFE A;  3HOY K;  4OIN A;  3GTL C;  2RGR A;  5C4X K;  5IYB C;  1B4A A;  3RZO C;  1R9T A;  5IP7 K;  5IP9 K;  1VJE A;  3A8J A;  1SFO C;  2RH6 A;  3GIR A;  3S1M K;  1YNN A;  4C3J C;  4OIO A;  4O2D A;  4OIP A;  2E2H C;  1O28 A;  1TWG A;  4RMF A;  2WB1 D;  1DCH A;  1O24 A;  4GTD A;  2D6F C;  1B4B A;  2GAG C;  1EH1 A;  4YFN A;  4A3L K;  1XPP A;  2E2I A;  2E2I C;  4FZB A;  4BBS C;  4Y52 K;  3FHZ A;  3PO3 C;  2CFA B;  1K83 A;  1XXC A;  3AQO A;  3CQZ K;  4MEY A;  3HOZ K;  4FM9 A;  1Y1W K;  4XLP A;  3GTL A;  4KN7 A;  1TWC A;  2NVQ C;  2YU9 C;  3OPF A;  4MEX A;  5C3E K;  4QJV B;  3S17 K;  1YX2 A;  2ZUE A;  3LAP A;  4AYB D;  3IPJ A;  3ERE D;  5E68 A;  1O2F B;  3I4M C;  3I4N C;  3HKZ L;  3JST A;  5M3F K;  5M5Y K;  3GTM A;  4P9S A;  3OEP A;  1ZBS A;  3HOY C;  3S16 K;  1TWH C;  5M5W K;  3HOX C;  2NVX A;  3N3Y A;  1BDF A;  4QIW L;  4X6A K;  1F7V A;  3GTJ A;  4KB4 A;  3LPX A;  1K83 K;  2WB1 L;  4X6A C;  1VRQ C;  2JH3 A;  3HOX K;  1ISE A;  5EGE A;  4A93 K;  2VUM A;  3GTP C;  1USO A;  2PPB A;  5EGH A;  1IBA A;  1X31 C;  4PAB A;  2R93 C;  4YFX A;  1VH2 A;  1I6V A;  3S1R K;  3QX3 A;  2B63 C;  4C3J K;  3T01 A;  2B63 K;  3S1M C;  2XCR B;  4YFK A;  3CQZ A;  3H0G K;  5TJ3 A;  3S2D K;  5IP9 C;  2GAH C;  3GTM C;  2PHC B;  3BP8 C;  2JA7 C;  3A8K A;  2O5J A;  3N0C A;  3GEE A;  2NVT K;  1J6W A;  4P5A A;  2XCQ A;  3G4A A;  3EQL A;  3G4C A;  1TWA C;  2P8T A;  2W7V A;  4A3M C;  3GTK C;  4AYB L;  1TWH K;  3NUH A;  4XSX A;  3VA7 A;  4A3I K;  3GTG A;  2E2I K;  3TFI A;  2XCO A;  1WQG A;  3LAJ A;  4A3D K;  1I3Q C;  2R93 A;  4OIR A;  1GE9 A;  3FKI A;  5L46 A;  4XLN A;  3I4M K;  1IQ0 A;  1IL2 A;  1TWG K;  2JA5 K;  3RZD C; 
#chains in the Genus database with same CATH homology
 3HOU C;  3HOW K;  4C2M K;  3GTJ K;  3M4O C;  4Y52 K;  5IYC C;  3GTG K;  3PO3 C;  5TMC A;  4BY7 K;  4C3I K;  4QIW D;  3CQZ K;  5FJ8 K;  4MEY A;  3GTG C;  5FLM C;  3HOZ K;  4BBS C;  1Y1W K;  4XLP A;  5C3E C;  3RZO K;  2Y0S D;  2R7Z C;  4KN7 A;  2PMZ D;  5IYB K;  2NVQ K;  1TWG C;  1Y1V K;  4BY1 C;  4A3K K;  2NVX C;  2E2I C;  5D4D A;  2YU9 C;  2NVQ C;  2R92 K;  3GTK K;  4A3L C;  4MEX A;  2PA8 L;  5C3E K;  4QJV B;  3S17 K;  5C44 C;  4A3D C;  3S1Q C;  4A3F C;  3GTM K;  4BY7 C;  4ZH4 A;  1WCM C;  3H0G C;  3S1N K;  3S2D C;  5IYC K;  4AYB D;  3PO3 K;  3WOD A;  4Y52 C;  3HOU K;  3HOW C;  3S15 C;  4BBS K;  4A3B K;  1SMY A;  1WCM K;  2E2J C;  2JA8 C;  4A3G K;  3I4M C;  4A3F K;  3S1Q K;  2R93 K;  3K7A C;  3I4N C;  3HKZ L;  5M3M K;  4G7Z A;  5IP7 C;  1TWF C;  2BE5 A;  3HOV K;  4Y7N K;  4BBR K;  5M5Y K;  5M3F K;  3GTP K;  2YU9 K;  5C4X C;  2VUM C;  4BXX C;  1Y1V C;  4BY1 K;  3HOY C;  3S16 K;  2PMZ L;  2R7Z K;  1TWH C;  3GTQ C;  1IW7 A;  5M5W K;  3HOX C;  1R9T K;  1Y1W C;  1BDF A;  5TMF A;  1TWA K;  5FLM K;  2JA7 K;  3HOZ C;  4QIW L;  4X6A K;  1SFO K;  2A68 A;  4A3J K;  4Q4Z A;  4G7H A;  1K83 K;  4A3J C;  2WB1 L;  4X6A C;  4NOI A;  3GTJ C;  1I50 K;  3RZD K;  2JA5 C;  4G7O A;  3HOX K;  4A3E C;  1I6H K;  5C4J C;  3FKI C;  2NVT C;  4A93 K;  2A6H A;  3GTP C;  2Y0S L;  4BBR C;  3HKZ D;  1I3Q K;  1ZYR A;  2PPB A;  1TWF K;  2JA6 C;  3HOV C;  3PO2 C;  3S2H C;  4GZY A;  3S14 C;  3FKI K;  4A3I C;  4A3G C;  2R93 C;  2PA8 D;  4YFX A;  1I6H C;  2E2J K;  1I6V A;  2WAQ L;  4A3M K;  4JK1 A;  4C3H K;  4C3J K;  5IYD C;  3S1R K;  2B63 C;  2O5I A;  3M3Y K;  2B63 K;  3S1M C;  5IYD K;  4YFK A;  3H0G K;  3S2D K;  5IP9 C;  3S14 K;  4YG2 A;  3GTM C;  4A3C C;  2JA6 K;  2JA7 C;  1TWC K;  2O5J A;  4QJV A;  4LJZ A;  1R9T C;  2NVT K;  3GTL K;  2R92 C;  4LK0 A;  5M5X K;  4OIN A;  3GTL C;  4KMU A;  5C4X K;  3HOY K;  3DXJ A;  5IYB C;  1TWC C;  2A6E A;  4LK1 A;  3H3V D;  3RZO C;  4A3C K;  4LLG A;  5IP7 K;  2CW0 A;  4KN4 A;  1K83 C;  1YNJ A;  3K7A K;  3CQZ C;  3EQL A;  5IP9 K;  3I4N K;  1SFO C;  4XSZ A;  3S1M K;  1YNN A;  4MQ9 A;  4A3B C;  1TWA C;  3M3Y C;  1HQM A;  3RZD C;  3M4O K;  4OIO A;  4A3M C;  3S1R C;  3GTK C;  4AYB L;  1TWH K;  3GTQ K;  4OIP A;  2E2H C;  4XSX A;  4A3I K;  3S16 C;  3S1N C;  2E2I K;  4Q5S A;  4BXX K;  2WB1 D;  2VUM K;  3PO2 K;  2NVY C;  5C44 K;  1I3Q C;  3S2H K;  4A3D K;  4OIR A;  4Y7N C;  3S17 C;  3GTO K;  3GTO C;  4A93 C;  3H3V L;  4XLN A;  4OIQ A;  2A69 A;  2NVY K;  4YFN A;  2WAQ D;  5C4J K;  3I4M K;  2NVX K;  4A3K C;  4A3L K;  2JA8 K;  1XPP A;  1TWG K;  4A3E K;  2JA5 K;  2E2H K;  1I50 C;  3S15 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...