5IP9K

Structure of rna polymerase ii-tfiif complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5ip9K00
4A3GK 3GTOK 3GTGK 1YNJA 3H0GK 3S1RK 4YFNA 4BBSC 4G7OA 2R7ZC 4X6AC 4A3DC 4XLNA 2WB1L 2WB1D 3HKZL 4A3CK 4A3CC 4MQ9A 2B63K 5C3EC 2Y0SL 5M5WK 4KN7A 5C3EK 3GTQC 5C44K 5TMFA 3DXJA 2NVYK 4QIWD 4AYBL 2A6EA 4BY7K 4A3FC 2WAQL 3GTOC 3S15K 1TWGC 3PO2C 3K7AC 3I4NC 3K7AK 3I4NK 4KMUA 1I50C 4A3EK 1YNNA 2NVQC 1I3QK 1I6VA 1TWCK 4BY1C 3HOUC 3S1MK 4MEXA 2VUMC 3GTGC 2PMZD 4A3GC 4Q5SA 1SFOK 4XSZA 3H3VL 2JA7C 2PA8D 4Y52C 3GTPK 4Y52K 3HOVK 1HQMA 4XSXA 1Y1VK 3S1QK 2JA8C 3HOZK 3M3YC 4G7HA 3RZOK 1TWAC 1R9TK 4BBRK 5C4JK 4A3KC 1TWAK 5TMCA 3H3VD 1K83K 3HKZD 4A3IC 3I4MK 2CW0A 4BY7C 1K83C 4A3IK 4A3MC 3S14K 3GTJK 4QIWL 4AYBD 1TWGK 3PO2K 4A93K 4A93C 3GTKK 1BDFA 5FLMK 4OIQA 3CQZC 3HOXC 4OINA 2NVTK 1I50K 1XPPA 2JA7K 2NVTC 3S2DK 3CQZK 4BXXK 5IP7C 3FKIC 4NOIA 2E2HC 4A3DK 3S1NK 4A3BC 5IP9K 1IW7A 2VUMK 3HOYK 2B63C 3S17K 5IYDK 4JK1A 5C44C 1SMYA 4ZH4A 2JA6K 3GTQK 3S2HK 2A69A 4A3FK 3GTPC 3RZDK 2JA5K 1Y1VC 3RZDC 4C2MK 3S1QC 4Q4ZA 2YU9K 4GZYA 4A3EC 4A3LC 2YU9C 2E2JK 1I6HC 5M5XK 3PO3C 4YFXA 3PO3K 1TWCC 4BY1K 4C3IK 1WCMK 2NVQK 4Y7NC 5IYCK 3S16K 4A3BK 5IYCC 5C4XC 2WAQD 1WCMC 5IYBK 3HOWK 3S1MC 1TWHK 3GTJC 1TWHC 2R93C 4BBSK 3HOWC 5FJ8K 3S1RC 4QJVA 3H0GC 2R92C 3HOXK 3S2HC 4BXXC 5FLMC 2R7ZK 2R93K 2A68A 4X6AK 4MEYA 2A6HA 3EQLA 5M3FK 3M3YK 1ZYRA 4G7ZA 2JA8K 4YG2A 2E2IK 4C3JK 4BBRC 5C4JC 4OIRA 3GTMC 4KN4A 3S16C 4LJZA 2JA6C 4OIPA 4A3KK 2NVXC 4XLPA 2JA5C 4A3MK 3S14C 1Y1WK 4QJVB 4A3JC 5M3MK 4A3JK 1Y1WC 3GTKC 4A3LK 3FKIK 1I3QC 2BE5A 5IP7K 2E2HK 2O5IA 2PA8L 3GTLC 3S2DC 5IP9C 3GTLK 3S1NC 3HOUK 1TWFC 3M4OK 1TWFK 5M5YK 2PMZL 5IYDC 3HOYC 3S17C 2R92K 3GTMK 5D4DA 4YFKA 1SFOC 4OIOA 2NVXK 2PPBA 3S15C 3HOVC 4LK1A 3WODA 2Y0SD 3HOZC 4C3HK 1I6HK 2E2IC 2O5JA 2E2JC 4LLGA 1R9TC 3RZOC 4Y7NK 5C4XK 3I4MC 2NVYC 4LK0A 3M4OC 5IYBC
chains in the Genus database with same CATH superfamily
2V6SA 3GTOK 1YNJA 3FOEA 3AQOA 2JH3A 3BUEA 2R7ZC 2XCOA 2WB1D 5C3EC 3GTQC 5TMFA 3MMLB 2NVYK 3A8KA 2JA6A 4BKWA 4AYBL 4BY7K 2WAQL 2JA5A 3K7AK 4KMUA 4GTCA 3GDZA 4A3EK 1IL2A 2NVQC 1I6VA 2P8TA 3S1MK 4MEXA 4GT9A 1EH1A 3GTGC 2PMZD 2R92A 1DCPA 1ZXOA 5JFEA 2R7ZA 3GTPK 3TTGA 4Y52K 2EBBA 4XSXA 3S1QK 2JA8C 4LR2A 3TFHA 1TWAC 1R9TK 4BBRK 1J6XA 1K83K 3AH5A 2CW0A 1K83C 3S14K 5IOSA 4A93K 2CFAA 4OINA 3HOXC 1XPPA 3A8JA 3G4AA 3S1NK 3AD7C 4JK1A 4ZH4A 3GTQK 1J98A 1ZBSA 1O26A 3QX3A 2NVXA 1F7VA 4C2MK 4Q4ZA 2FQTA 2E2JK 1I6HC 1INNA 1J6VA 1I3QA 4G0WA 1TWCC 3BP8C 2NVQK 2WAQD 1BGWA 4M1XA 3HOWK 1TWHC 2R93C 4P9SA 3HOWC 3H0GA 3OEPA 4BXXC 2KWAA 4X6AK 1F9NA 3M3YK 2JA8K 4YG2A 2E2IK 5C4JC 5IORA 1TWAA 4KN4A 3S16C 1WQHA 2NVYA 3GEIA 4XLPA 1EFWA 2JA5C 4A3MK 1DD5A 1TWGA 4GTEA 4XCHA 3FKIK 2E2HK 5IP7K 4G0UA 5JVOA 1TWFK 2PMZL 5IYDC 2R92K 3T00A 1SFOC 2V6UA 2PPBA 3S15C 3GTPA 4LK1A 1Y1VA 3HOZC 4KAWX 3RZOC 1O2BA 5C4XK 4BLBA 2GAGC 3M4OC 3GTGK 3V4GA 3S1RK 4GTBA 4G7OA 4X6AC 1EK8A 3AD9C 4XLNA 4A3DC 4KMHA 1WORA 4KM8A 1O29A 4A3CC 2B63K 2Y0SL 3GIRA 1XXCA 5C3EK 3DXJA 4QIWD 1C0AA 3L4KA 1TWGC 3I4NK 4GTFA 3LAJA 1I3QK 5IOQA 4BY1C 1WOSA 3AQPA 1WQFA 1TWHA 1EQRA 1UV7A 4BLAA 4P5AA 1XXAA 4C3HC 4KARA 3GEHA 3TFJA 4G7HA 2E2IA 2ZUFA 4A3KC 1TWAK 3OREA 1EI6A 1WOPA 4BY7C 3GTOA 1VH2A 4AYBD 3PO2K 4KB2A 4A3LC 1BDFA 3CQZC 1I50K 3ADAC 4WJ3M 4A3BC 1X31C 4PAAA 3S17K 2B63C 5C44C 3S2HK 4A3FK 3RZDK 2JA5K 1Y1VC 3RZDC 4G0VA 1USOA 4C3IK 5IYCK 1B4BA 3S1MC 3GTJC 4BBSK 3GTGA 5FJ8K 4QJVA 5FLMC 1DCOA 2A6HA 1ZYRA 4P5BA 1R9TA 2JA6C 3S14C 1Y1WK 5IOTA 4A3LK 3CQZA 1IS1A 2PA8L 3T02A 2V6TA 3S1NC 1WSRA 1ISEA 1HI9A 4FZBA 5M5YK 2W7VA 3GTQA 1ZVUA 5D4DA 1SFOA 2NVXK 2ZUEA 3HOVC 3WODA 2Y0SD 4C3HK 2O5JA 4LLGA 1O28A 3I4MC 2NVYC 4LK0A 3CAGA 4A3GK 3H0GK 3GTJA 4BBSC 3SZZA 2JA7A 3IPJA 4KDDA 3L4JA 2WB1L 3HKZL 4KM9A 4C3JC 3VA7A 5M5WK 3GSIA 1PJ7A 2A6EA 4A3FC 3GTOC 3S15K 3FHZA 3K7AC 4WILA 1F93A 3GTLA 1TWCK 1WCMA 1TWFA 2VUMC 4RMFA 3HXAA 1L0WA 2JA7C 3H3VL 4Y52C 1XZPA 1F7UA 1Y1VK 3JSTA 3HOZK 3LAPA 3M3YC 5HL8A 5C4JK 5TJ3A 5TMCA 3HKZD 3I4MK 2R93K 4QIWL 4ILDA 1JOEA 1Y1WA 4A93C 3GTKK 4BXXK 2NVTK 3S2DK 3CQZK 5IP7C 3FKIC 4NOIA 2E2HC 4A3DK 1IQ0A 1DCHA 3HOYK 3BP3A 3GTMA 1J6WA 4LOWA 3GTPC 2YU9K 4A3EC 5M5XK 3PO3C 4YFXA 1XZQB 4J3NA 5IYBK 1TWHK 4GTAA 3S1RC 1YX2A 2R92C 3HOXK 3S2HC 4KMAA 1XZPB 2A68A 3EQLA 3GEEA 4G7ZA 4C3JK 4BBRC 4OIRA 2GSNA 3GTMC 4A3KK 4QJVB 4A3JC 3SZYA 5M3MK 1Y1WC 1I50A 3GTKC 2RH6A 3GTLC 3S2DC 3FOFA 5IP9C 3GTLK 1TWFC 3M4OK 2VUMA 4LQYA 3S17C 4YFKA 2GSOA 4OIOA 2XCQA 1BJTA 1O24A 4KC6A 1O2AA 1I6HK 2E2IC 2E2JC 2RGRA 4GFQA 4Y7NK 3NUHA 2PHCB 4C3IC 2FQOA 1K83A 3OPFA 2R93A 4YFNA 3GTKA 3G4CA 4O2DA 5CHPA 1VGXA 4A3CK 3N0CA 4MQ9A 1PJ6A 1IBAA 4KN7A 5E68A 3S0XA 5C44K 1ZQ1C 4PABA 4FM9A 1JQWA 1B4AA 4C2MC 2Y3PA 3PO2C 4KMDA 2YU9A 3I4NC 1I50C 3TFIA 1O25A 1BS2A 1YNNA 1WSVA 1RU0A 3HOUC 3LPXA 4A3GC 4Q5SA 1SFOK 4XSZA 3N0BA 5L46A 5EGEA 2PA8D 2D6FC 3HOVK 1HQMA 1VRQC 3N3YA 3RZOK 1VJEA 4KASA 3H3VD 4A3IC 1O27A 4A3IK 4A3MC 3GTJK 1TWGK 1XXBA 5FLMK 4OIQA 2JA7K 2NVTC 3FKIA 1G51A 2E2HA 3Q3QA 5IP9K 1IW7A 2VUMK 5IYDK 2GAHC 1GE9A 1SMYA 1WIHA 2JA6K 2A69A 4GTDA 1YCLA 1USMA 1KQ4A 3A8IA 2CFAB 3ERED 3S1QC 4GZYA 2YU9C 3PO3K 4BY1K 1TWCA 5C4XC 1WCMK 4Y7NC 3S16K 4A3BK 5IYCC 1WCMC 1JVIA 3H0GC 4GTLA 2R7ZK 4KB4A 4MEYA 4KATA 5M3FK 4AH6A 2B63A 1V5VA 1XZQA 1WOOA 4WJ4A 4LJZA 4OIPA 4DDQA 2NVXC 1VLOA 5EGHA 2P5MA 4A3JK 5CJ9A 2O5IA 1I3QC 2BE5A 3HOUK 1WQGA 2ZFZA 1O2FB 1IE0A 3HOYC 3GTMK 3AD8C 2XCRB 1PJ5A 4C45A 3T01A 1R9TC 1AB4A 2GSUA 5IYBC
chains in the Genus database with same CATH topology
4A3GK 3GTOK 3GTGK 1YNJA 3H0GK 3S1RK 4YFNA 4BBSC 4G7OA 2R7ZC 4X6AC 4A3DC 4XLNA 2WB1L 2WB1D 3HKZL 4A3CK 4A3CC 4MQ9A 2B63K 5C3EC 2Y0SL 5M5WK 4KN7A 5C3EK 3GTQC 5C44K 5TMFA 3DXJA 2NVYK 4QIWD 4AYBL 2A6EA 4BY7K 4A3FC 2WAQL 3GTOC 3S15K 1TWGC 3PO2C 3K7AC 3I4NC 3K7AK 3I4NK 4KMUA 1I50C 4A3EK 1YNNA 2NVQC 1I3QK 1I6VA 1TWCK 4BY1C 3HOUC 3S1MK 4MEXA 2VUMC 3GTGC 2PMZD 4A3GC 4Q5SA 1SFOK 4XSZA 3H3VL 2JA7C 2PA8D 4Y52C 3GTPK 4Y52K 3HOVK 1HQMA 4XSXA 1Y1VK 3S1QK 2JA8C 3HOZK 3M3YC 4G7HA 3RZOK 1TWAC 1R9TK 4BBRK 5C4JK 4A3KC 1TWAK 5TMCA 3H3VD 1K83K 3HKZD 4A3IC 3I4MK 2CW0A 4BY7C 1K83C 4A3IK 4A3MC 3S14K 3GTJK 4QIWL 4AYBD 1TWGK 3PO2K 4A93K 4A93C 3GTKK 1BDFA 5FLMK 4OIQA 3CQZC 3HOXC 4OINA 2NVTK 1I50K 1XPPA 2JA7K 2NVTC 3S2DK 3CQZK 4BXXK 5IP7C 3FKIC 4NOIA 2E2HC 4A3DK 3S1NK 4A3BC 5IP9K 1IW7A 2VUMK 3HOYK 2B63C 3S17K 5IYDK 4JK1A 5C44C 1SMYA 4ZH4A 2JA6K 3GTQK 3S2HK 2A69A 4A3FK 3GTPC 3RZDK 2JA5K 1Y1VC 3RZDC 4C2MK 3S1QC 4Q4ZA 2YU9K 4GZYA 4A3EC 4A3LC 2YU9C 2E2JK 1I6HC 5M5XK 3PO3C 4YFXA 3PO3K 1TWCC 4BY1K 4C3IK 1WCMK 2NVQK 4Y7NC 5IYCK 3S16K 4A3BK 5IYCC 5C4XC 2WAQD 1WCMC 5IYBK 3HOWK 3S1MC 1TWHK 3GTJC 1TWHC 2R93C 4BBSK 3HOWC 5FJ8K 3S1RC 4QJVA 3H0GC 2R92C 3HOXK 3S2HC 4BXXC 5FLMC 2R7ZK 2R93K 2A68A 4X6AK 4MEYA 2A6HA 3EQLA 5M3FK 3M3YK 1ZYRA 4G7ZA 2JA8K 4YG2A 2E2IK 4C3JK 4BBRC 5C4JC 4OIRA 3GTMC 4KN4A 3S16C 4LJZA 2JA6C 4OIPA 4A3KK 2NVXC 4XLPA 2JA5C 4A3MK 3S14C 1Y1WK 4QJVB 4A3JC 5M3MK 4A3JK 1Y1WC 3GTKC 4A3LK 3FKIK 1I3QC 2BE5A 5IP7K 2E2HK 2O5IA 2PA8L 3GTLC 3S2DC 5IP9C 3GTLK 3S1NC 3HOUK 1TWFC 3M4OK 1TWFK 5M5YK 2PMZL 5IYDC 3HOYC 3S17C 2R92K 3GTMK 5D4DA 4YFKA 1SFOC 4OIOA 2NVXK 2PPBA 3S15C 3HOVC 4LK1A 3WODA 2Y0SD 3HOZC 4C3HK 1I6HK 2E2IC 2O5JA 2E2JC 4LLGA 1R9TC 3RZOC 4Y7NK 5C4XK 3I4MC 2NVYC 4LK0A 3M4OC 5IYBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G K;  3GTO K;  3GTG K;  1YNJ A;  3H0G K;  3S1R K;  4YFN A;  4BBS C;  4G7O A;  2R7Z C;  4X6A C;  4A3D C;  4XLN A;  2WB1 L;  2WB1 D;  3HKZ L;  4A3C K;  4A3C C;  4MQ9 A;  2B63 K;  5C3E C;  2Y0S L;  5M5W K;  4KN7 A;  5C3E K;  3GTQ C;  5C44 K;  5TMF A;  3DXJ A;  2NVY K;  4QIW D;  4AYB L;  2A6E A;  4BY7 K;  4A3F C;  2WAQ L;  3GTO C;  3S15 K;  1TWG C;  3PO2 C;  3K7A C;  3I4N C;  3K7A K;  3I4N K;  4KMU A;  1I50 C;  4A3E K;  1YNN A;  2NVQ C;  1I3Q K;  1I6V A;  1TWC K;  4BY1 C;  3HOU C;  3S1M K;  4MEX A;  2VUM C;  3GTG C;  2PMZ D;  4A3G C;  4Q5S A;  1SFO K;  4XSZ A;  3H3V L;  2JA7 C;  2PA8 D;  4Y52 C;  3GTP K;  4Y52 K;  3HOV K;  1HQM A;  4XSX A;  1Y1V K;  3S1Q K;  2JA8 C;  3HOZ K;  3M3Y C;  4G7H A;  3RZO K;  1TWA C;  1R9T K;  4BBR K;  5C4J K;  4A3K C;  1TWA K;  5TMC A;  3H3V D;  1K83 K;  3HKZ D;  4A3I C;  3I4M K;  2CW0 A;  4BY7 C;  1K83 C;  4A3I K;  4A3M C;  3S14 K;  3GTJ K;  4QIW L;  4AYB D;  1TWG K;  3PO2 K;  4A93 K;  4A93 C;  3GTK K;  1BDF A;  5FLM K;  4OIQ A;  3CQZ C;  3HOX C;  4OIN A;  2NVT K;  1I50 K;  1XPP A;  2JA7 K;  2NVT C;  3S2D K;  3CQZ K;  4BXX K;  5IP7 C;  3FKI C;  4NOI A;  2E2H C;  4A3D K;  3S1N K;  4A3B C;  5IP9 K;  1IW7 A;  2VUM K;  3HOY K;  2B63 C;  3S17 K;  5IYD K;  4JK1 A;  5C44 C;  1SMY A;  4ZH4 A;  2JA6 K;  3GTQ K;  3S2H K;  2A69 A;  4A3F K;  3GTP C;  3RZD K;  2JA5 K;  1Y1V C;  3RZD C;  4C2M K;  3S1Q C;  4Q4Z A;  2YU9 K;  4GZY A;  4A3E C;  4A3L C;  2YU9 C;  2E2J K;  1I6H C;  5M5X K;  3PO3 C;  4YFX A;  3PO3 K;  1TWC C;  4BY1 K;  4C3I K;  1WCM K;  2NVQ K;  4Y7N C;  5IYC K;  3S16 K;  4A3B K;  5IYC C;  5C4X C;  2WAQ D;  1WCM C;  5IYB K;  3HOW K;  3S1M C;  1TWH K;  3GTJ C;  1TWH C;  2R93 C;  4BBS K;  3HOW C;  5FJ8 K;  3S1R C;  4QJV A;  3H0G C;  2R92 C;  3HOX K;  3S2H C;  4BXX C;  5FLM C;  2R7Z K;  2R93 K;  2A68 A;  4X6A K;  4MEY A;  2A6H A;  3EQL A;  5M3F K;  3M3Y K;  1ZYR A;  4G7Z A;  2JA8 K;  4YG2 A;  2E2I K;  4C3J K;  4BBR C;  5C4J C;  4OIR A;  3GTM C;  4KN4 A;  3S16 C;  4LJZ A;  2JA6 C;  4OIP A;  4A3K K;  2NVX C;  4XLP A;  2JA5 C;  4A3M K;  3S14 C;  1Y1W K;  4QJV B;  4A3J C;  5M3M K;  4A3J K;  1Y1W C;  3GTK C;  4A3L K;  3FKI K;  1I3Q C;  2BE5 A;  5IP7 K;  2E2H K;  2O5I A;  2PA8 L;  3GTL C;  3S2D C;  5IP9 C;  3GTL K;  3S1N C;  3HOU K;  1TWF C;  3M4O K;  1TWF K;  5M5Y K;  2PMZ L;  5IYD C;  3HOY C;  3S17 C;  2R92 K;  3GTM K;  5D4D A;  4YFK A;  1SFO C;  4OIO A;  2NVX K;  2PPB A;  3S15 C;  3HOV C;  4LK1 A;  3WOD A;  2Y0S D;  3HOZ C;  4C3H K;  1I6H K;  2E2I C;  2O5J A;  2E2J C;  4LLG A;  1R9T C;  3RZO C;  4Y7N K;  5C4X K;  3I4M C;  2NVY C;  4LK0 A;  3M4O C;  5IYB C; 
#chains in the Genus database with same CATH topology
 2V6S A;  3GTO K;  1YNJ A;  3FOE A;  3AQO A;  2JH3 A;  3BUE A;  2R7Z C;  2XCO A;  2WB1 D;  5C3E C;  3GTQ C;  5TMF A;  3MML B;  2NVY K;  3A8K A;  2JA6 A;  4BKW A;  4AYB L;  4BY7 K;  2WAQ L;  2JA5 A;  3K7A K;  4KMU A;  4GTC A;  3GDZ A;  4A3E K;  1IL2 A;  2NVQ C;  1I6V A;  2P8T A;  3S1M K;  4MEX A;  4GT9 A;  1EH1 A;  3GTG C;  2PMZ D;  2R92 A;  1DCP A;  1ZXO A;  5JFE A;  2R7Z A;  3GTP K;  3TTG A;  4Y52 K;  2EBB A;  4XSX A;  3S1Q K;  2JA8 C;  4LR2 A;  3TFH A;  1TWA C;  1R9T K;  4BBR K;  1J6X A;  1K83 K;  3AH5 A;  2CW0 A;  1K83 C;  3S14 K;  5IOS A;  4A93 K;  2CFA A;  4OIN A;  3HOX C;  1XPP A;  3A8J A;  3G4A A;  3S1N K;  3AD7 C;  4JK1 A;  4ZH4 A;  3GTQ K;  1J98 A;  1ZBS A;  1O26 A;  3QX3 A;  2NVX A;  1F7V A;  4C2M K;  4Q4Z A;  2FQT A;  2E2J K;  1I6H C;  1INN A;  1J6V A;  1I3Q A;  4G0W A;  1TWC C;  3BP8 C;  2NVQ K;  2WAQ D;  1BGW A;  4M1X A;  3HOW K;  1TWH C;  2R93 C;  4P9S A;  3HOW C;  3H0G A;  3OEP A;  4BXX C;  2KWA A;  4X6A K;  1F9N A;  3M3Y K;  2JA8 K;  4YG2 A;  2E2I K;  5C4J C;  5IOR A;  1TWA A;  4KN4 A;  3S16 C;  1WQH A;  2NVY A;  3GEI A;  4XLP A;  1EFW A;  2JA5 C;  4A3M K;  1DD5 A;  1TWG A;  4GTE A;  4XCH A;  3FKI K;  2E2H K;  5IP7 K;  4G0U A;  5JVO A;  1TWF K;  2PMZ L;  5IYD C;  2R92 K;  3T00 A;  1SFO C;  2V6U A;  2PPB A;  3S15 C;  3GTP A;  4LK1 A;  1Y1V A;  3HOZ C;  4KAW X;  3RZO C;  1O2B A;  5C4X K;  4BLB A;  2GAG C;  3M4O C;  3GTG K;  3V4G A;  3S1R K;  4GTB A;  4G7O A;  4X6A C;  1EK8 A;  3AD9 C;  4XLN A;  4A3D C;  4KMH A;  1WOR A;  4KM8 A;  1O29 A;  4A3C C;  2B63 K;  2Y0S L;  3GIR A;  1XXC A;  5C3E K;  3DXJ A;  4QIW D;  1C0A A;  3L4K A;  1TWG C;  3I4N K;  4GTF A;  3LAJ A;  1I3Q K;  5IOQ A;  4BY1 C;  1WOS A;  3AQP A;  1WQF A;  1TWH A;  1EQR A;  1UV7 A;  4BLA A;  4P5A A;  1XXA A;  4C3H C;  4KAR A;  3GEH A;  3TFJ A;  4G7H A;  2E2I A;  2ZUF A;  4A3K C;  1TWA K;  3ORE A;  1EI6 A;  1WOP A;  4BY7 C;  3GTO A;  1VH2 A;  4AYB D;  3PO2 K;  4KB2 A;  4A3L C;  1BDF A;  3CQZ C;  1I50 K;  3ADA C;  4WJ3 M;  4A3B C;  1X31 C;  4PAA A;  3S17 K;  2B63 C;  5C44 C;  3S2H K;  4A3F K;  3RZD K;  2JA5 K;  1Y1V C;  3RZD C;  4G0V A;  1USO A;  4C3I K;  5IYC K;  1B4B A;  3S1M C;  3GTJ C;  4BBS K;  3GTG A;  5FJ8 K;  4QJV A;  5FLM C;  1DCO A;  2A6H A;  1ZYR A;  4P5B A;  1R9T A;  2JA6 C;  3S14 C;  1Y1W K;  5IOT A;  4A3L K;  3CQZ A;  1IS1 A;  2PA8 L;  3T02 A;  2V6T A;  3S1N C;  1WSR A;  1ISE A;  1HI9 A;  4FZB A;  5M5Y K;  2W7V A;  3GTQ A;  1ZVU A;  5D4D A;  1SFO A;  2NVX K;  2ZUE A;  3HOV C;  3WOD A;  2Y0S D;  4C3H K;  2O5J A;  4LLG A;  1O28 A;  3I4M C;  2NVY C;  4LK0 A;  3CAG A;  4A3G K;  3H0G K;  3GTJ A;  4BBS C;  3SZZ A;  2JA7 A;  3IPJ A;  4KDD A;  3L4J A;  2WB1 L;  3HKZ L;  4KM9 A;  4C3J C;  3VA7 A;  5M5W K;  3GSI A;  1PJ7 A;  2A6E A;  4A3F C;  3GTO C;  3S15 K;  3FHZ A;  3K7A C;  4WIL A;  1F93 A;  3GTL A;  1TWC K;  1WCM A;  1TWF A;  2VUM C;  4RMF A;  3HXA A;  1L0W A;  2JA7 C;  3H3V L;  4Y52 C;  1XZP A;  1F7U A;  1Y1V K;  3JST A;  3HOZ K;  3LAP A;  3M3Y C;  5HL8 A;  5C4J K;  5TJ3 A;  5TMC A;  3HKZ D;  3I4M K;  2R93 K;  4QIW L;  4ILD A;  1JOE A;  1Y1W A;  4A93 C;  3GTK K;  4BXX K;  2NVT K;  3S2D K;  3CQZ K;  5IP7 C;  3FKI C;  4NOI A;  2E2H C;  4A3D K;  1IQ0 A;  1DCH A;  3HOY K;  3BP3 A;  3GTM A;  1J6W A;  4LOW A;  3GTP C;  2YU9 K;  4A3E C;  5M5X K;  3PO3 C;  4YFX A;  1XZQ B;  4J3N A;  5IYB K;  1TWH K;  4GTA A;  3S1R C;  1YX2 A;  2R92 C;  3HOX K;  3S2H C;  4KMA A;  1XZP B;  2A68 A;  3EQL A;  3GEE A;  4G7Z A;  4C3J K;  4BBR C;  4OIR A;  2GSN A;  3GTM C;  4A3K K;  4QJV B;  4A3J C;  3SZY A;  5M3M K;  1Y1W C;  1I50 A;  3GTK C;  2RH6 A;  3GTL C;  3S2D C;  3FOF A;  5IP9 C;  3GTL K;  1TWF C;  3M4O K;  2VUM A;  4LQY A;  3S17 C;  4YFK A;  2GSO A;  4OIO A;  2XCQ A;  1BJT A;  1O24 A;  4KC6 A;  1O2A A;  1I6H K;  2E2I C;  2E2J C;  2RGR A;  4GFQ A;  4Y7N K;  3NUH A;  2PHC B;  4C3I C;  2FQO A;  1K83 A;  3OPF A;  2R93 A;  4YFN A;  3GTK A;  3G4C A;  4O2D A;  5CHP A;  1VGX A;  4A3C K;  3N0C A;  4MQ9 A;  1PJ6 A;  1IBA A;  4KN7 A;  5E68 A;  3S0X A;  5C44 K;  1ZQ1 C;  4PAB A;  4FM9 A;  1JQW A;  1B4A A;  4C2M C;  2Y3P A;  3PO2 C;  4KMD A;  2YU9 A;  3I4N C;  1I50 C;  3TFI A;  1O25 A;  1BS2 A;  1YNN A;  1WSV A;  1RU0 A;  3HOU C;  3LPX A;  4A3G C;  4Q5S A;  1SFO K;  4XSZ A;  3N0B A;  5L46 A;  5EGE A;  2PA8 D;  2D6F C;  3HOV K;  1HQM A;  1VRQ C;  3N3Y A;  3RZO K;  1VJE A;  4KAS A;  3H3V D;  4A3I C;  1O27 A;  4A3I K;  4A3M C;  3GTJ K;  1TWG K;  1XXB A;  5FLM K;  4OIQ A;  2JA7 K;  2NVT C;  3FKI A;  1G51 A;  2E2H A;  3Q3Q A;  5IP9 K;  1IW7 A;  2VUM K;  5IYD K;  2GAH C;  1GE9 A;  1SMY A;  1WIH A;  2JA6 K;  2A69 A;  4GTD A;  1YCL A;  1USM A;  1KQ4 A;  3A8I A;  2CFA B;  3ERE D;  3S1Q C;  4GZY A;  2YU9 C;  3PO3 K;  4BY1 K;  1TWC A;  5C4X C;  1WCM K;  4Y7N C;  3S16 K;  4A3B K;  5IYC C;  1WCM C;  1JVI A;  3H0G C;  4GTL A;  2R7Z K;  4KB4 A;  4MEY A;  4KAT A;  5M3F K;  4AH6 A;  2B63 A;  1V5V A;  1XZQ A;  1WOO A;  4WJ4 A;  4LJZ A;  4OIP A;  4DDQ A;  2NVX C;  1VLO A;  5EGH A;  2P5M A;  4A3J K;  5CJ9 A;  2O5I A;  1I3Q C;  2BE5 A;  3HOU K;  1WQG A;  2ZFZ A;  1O2F B;  1IE0 A;  3HOY C;  3GTM K;  3AD8 C;  2XCR B;  1PJ5 A;  4C45 A;  3T01 A;  1R9T C;  1AB4 A;  2GSU A;  5IYB C; 
#chains in the Genus database with same CATH homology
 4A3G K;  3GTO K;  3GTG K;  1YNJ A;  3H0G K;  3S1R K;  4YFN A;  4BBS C;  4G7O A;  2R7Z C;  4X6A C;  4A3D C;  4XLN A;  2WB1 L;  2WB1 D;  3HKZ L;  4A3C K;  4A3C C;  4MQ9 A;  2B63 K;  5C3E C;  2Y0S L;  5M5W K;  4KN7 A;  5C3E K;  3GTQ C;  5C44 K;  5TMF A;  3DXJ A;  2NVY K;  4QIW D;  4AYB L;  2A6E A;  4BY7 K;  4A3F C;  2WAQ L;  3GTO C;  3S15 K;  1TWG C;  3PO2 C;  3K7A C;  3I4N C;  3K7A K;  3I4N K;  4KMU A;  1I50 C;  4A3E K;  1YNN A;  2NVQ C;  1I3Q K;  1I6V A;  1TWC K;  4BY1 C;  3HOU C;  3S1M K;  4MEX A;  2VUM C;  3GTG C;  2PMZ D;  4A3G C;  4Q5S A;  1SFO K;  4XSZ A;  3H3V L;  2JA7 C;  2PA8 D;  4Y52 C;  3GTP K;  4Y52 K;  3HOV K;  1HQM A;  4XSX A;  1Y1V K;  3S1Q K;  2JA8 C;  3HOZ K;  3M3Y C;  4G7H A;  3RZO K;  1TWA C;  1R9T K;  4BBR K;  5C4J K;  4A3K C;  1TWA K;  5TMC A;  3H3V D;  1K83 K;  3HKZ D;  4A3I C;  3I4M K;  2CW0 A;  4BY7 C;  1K83 C;  4A3I K;  4A3M C;  3S14 K;  3GTJ K;  4QIW L;  4AYB D;  1TWG K;  3PO2 K;  4A93 K;  4A93 C;  3GTK K;  1BDF A;  5FLM K;  4OIQ A;  3CQZ C;  3HOX C;  4OIN A;  2NVT K;  1I50 K;  1XPP A;  2JA7 K;  2NVT C;  3S2D K;  3CQZ K;  4BXX K;  5IP7 C;  3FKI C;  4NOI A;  2E2H C;  4A3D K;  3S1N K;  4A3B C;  5IP9 K;  1IW7 A;  2VUM K;  3HOY K;  2B63 C;  3S17 K;  5IYD K;  4JK1 A;  5C44 C;  1SMY A;  4ZH4 A;  2JA6 K;  3GTQ K;  3S2H K;  2A69 A;  4A3F K;  3GTP C;  3RZD K;  2JA5 K;  1Y1V C;  3RZD C;  4C2M K;  3S1Q C;  4Q4Z A;  2YU9 K;  4GZY A;  4A3E C;  4A3L C;  2YU9 C;  2E2J K;  1I6H C;  5M5X K;  3PO3 C;  4YFX A;  3PO3 K;  1TWC C;  4BY1 K;  4C3I K;  1WCM K;  2NVQ K;  4Y7N C;  5IYC K;  3S16 K;  4A3B K;  5IYC C;  5C4X C;  2WAQ D;  1WCM C;  5IYB K;  3HOW K;  3S1M C;  1TWH K;  3GTJ C;  1TWH C;  2R93 C;  4BBS K;  3HOW C;  5FJ8 K;  3S1R C;  4QJV A;  3H0G C;  2R92 C;  3HOX K;  3S2H C;  4BXX C;  5FLM C;  2R7Z K;  2R93 K;  2A68 A;  4X6A K;  4MEY A;  2A6H A;  3EQL A;  5M3F K;  3M3Y K;  1ZYR A;  4G7Z A;  2JA8 K;  4YG2 A;  2E2I K;  4C3J K;  4BBR C;  5C4J C;  4OIR A;  3GTM C;  4KN4 A;  3S16 C;  4LJZ A;  2JA6 C;  4OIP A;  4A3K K;  2NVX C;  4XLP A;  2JA5 C;  4A3M K;  3S14 C;  1Y1W K;  4QJV B;  4A3J C;  5M3M K;  4A3J K;  1Y1W C;  3GTK C;  4A3L K;  3FKI K;  1I3Q C;  2BE5 A;  5IP7 K;  2E2H K;  2O5I A;  2PA8 L;  3GTL C;  3S2D C;  5IP9 C;  3GTL K;  3S1N C;  3HOU K;  1TWF C;  3M4O K;  1TWF K;  5M5Y K;  2PMZ L;  5IYD C;  3HOY C;  3S17 C;  2R92 K;  3GTM K;  5D4D A;  4YFK A;  1SFO C;  4OIO A;  2NVX K;  2PPB A;  3S15 C;  3HOV C;  4LK1 A;  3WOD A;  2Y0S D;  3HOZ C;  4C3H K;  1I6H K;  2E2I C;  2O5J A;  2E2J C;  4LLG A;  1R9T C;  3RZO C;  4Y7N K;  5C4X K;  3I4M C;  2NVY C;  4LK0 A;  3M4O C;  5IYB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...