5IP9K

Structure of rna polymerase ii-tfiif complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5ip9K00
3HOXK 5FJ8K 4G7HA 3GTPK 3HOWK 3HOVC 4MEYA 2B63C 2E2HK 3S14C 2NVQC 2R7ZK 4Y52C 3S15K 4BXXK 1WCMC 4ZH4A 2A69A 3GTQC 3M3YK 1I6VA 4LJZA 3HOZK 3S1MC 1Y1WC 4A93K 2JA8C 4A3EK 1YNNA 3RZDC 3GTPC 3HOWC 2Y0SD 5IYDK 1HQMA 2E2HC 4YFNA 4A3MK 1SFOC 5TMFA 2JA8K 4C3IK 2CW0A 3HOVK 2PA8D 2B63K 2R93K 4YG2A 3S17K 3GTOK 4G7ZA 2NVQK 3S14K 4Y52K 5M3MK 4YFXA 2E2JK 3CQZK 4OIQA 3GTQK 2JA6K 4A93C 3S1MK 3M4OK 4XLNA 4A3DC 3S2HK 3HOUK 5IYDC 4AYBD 4A3MC 2WAQD 4XSZA 4XLPA 3S1QK 2R93C 5TMCA 2PMZL 1SFOK 3HKZL 2YU9K 3GTOC 3S17C 2E2JC 4OIOA 1TWFC 3CQZC 1ZYRA 2JA6C 4GZYA 1R9TK 4BBRK 3M4OC 3HOYK 4LK1A 4A3JC 4LK0A 3GTMK 3HOUC 5IP9K 3DXJA 3S2HC 4A3BK 4A3DK 3PO3C 3S1QC 1I3QK 3GTGK 1Y1VK 3H3VL 2YU9C 3GTKK 5C3EC 3H3VD 3I4MC 4QJVA 4BBRC 1R9TC 1TWFK 3PO2C 4Y7NK 1TWHK 4X6AK 2A6HA 2E2IC 3HOYC 5IP7C 4A3CC 3GTMC 5IP9C 4A3BC 2O5IA 4A3JK 2WB1L 5M5XK 4G7OA 4Q5SA 3S2DK 1I3QC 3EQLA 4A3LK 2NVTK 1Y1VC 1YNJA 4OIPA 4Q4ZA 3PO3K 2JA5K 3GTKC 2O5JA 4A3KC 3RZOC 4KMUA 3S16K 5C3EK 2PMZD 4X6AC 3HKZD 1TWHC 4Y7NC 3I4MK 1TWGK 1K83K 4YFKA 4A3FK 4OIRA 1IW7A 3PO2K 2E2IK 2A6EA 5IP7K 4A3CK 4OINA 3S2DC 4BBSK 4MQ9A 4A3LC 2NVTC 4A3IK 2JA5C 5C44K 3H0GK 2R92K 1XPPA 4MEXA 3GTJC 4XSXA 5C4JC 4BY1C 4JK1A 3S16C 4A3KK 3RZOK 2VUMC 3S1NC 1TWGC 1K83C 4A3FC 3K7AK 2NVYC 4QIWL 3FKIC 1TWAK 5M3FK 4QIWD 5C4XK 3I4NK 4BBSC 2JA7K 1I50K 3S1RK 5IYCK 5FLMK 2NVXK 4A3IC 3GTLK 5C44C 1SMYA 1TWCK 3H0GC 4C3JK 2R92C 2WB1D 4QJVB 2PPBA 2A68A 4LLGA 4BY7K 3GTJK 3GTGC 5C4JK 4BY1K 1I6HC 5IYBK 2Y0SL 3K7AC 3WODA 2VUMK 1TWAC 4A3GK 3HOXC 1BDFA 3S1NK 1I6HK 2NVYK 3FKIK 2PA8L 5D4DA 3I4NC 5C4XC 2JA7C 1I50C 3S1RC 5IYCC 5FLMC 2NVXC 2R7ZC 3GTLC 3S15C 1TWCC 2BE5A 4BXXC 5M5WK 1WCMK 4KN4A 3M3YC 3HOZC 4BY7C 5IYBC 4A3EC 4NOIA 4A3GC 5M5YK 4AYBL 4C2MK 1Y1WK 4KN7A 2WAQL 4C3HK 3RZDK
chains in the Genus database with same CATH superfamily
4G0VA 2B63C 1TWHA 2NVQC 2R7ZK 4Y52C 3S15K 4BLBA 3GTQC 1I6VA 3S1MC 4C3HC 1YNNA 2JA5A 3ERED 4G0UA 1SFOC 4C3IK 2CW0A 2P5MA 2R93K 2XCOA 3CQZK 1VLOA 4WJ3M 4XLNA 3LAPA 3HOUK 1J98A 4AYBD 1DD5A 1C0AA 4C3IC 2PHCB 1EFWA 2R93C 2FQOA 2YU9K 2XCQA 3CQZC 3N0BA 3HOYK 4LK1A 3HOUC 5IP9K 4A3DK 3FOEA 1KQ4A 5EGHA 1ZBSA 2YU9C 3GTKK 2NVYA 3H3VD 1TWFK 4AH6A 3HOYC 4GT9A 5IP9C 1WOSA 3EQLA 1AB4A 2NVTK 1YNJA 3GTGA 3GTKC 1WSRA 5C3EK 2PMZD 3HKZD 3I4MK 1TWGK 4ILDA 2R7ZA 1IW7A 5CJ9A 4A3CK 4BBSK 2NVTC 3H0GK 3A8KA 1EH1A 3GTJC 2GSUA 1PJ6A 4A3KK 3RZOK 2VUMC 1O2BA 3AD9C 3S1NC 1TWGC 3GEIA 3K7AK 3FKIC 4QIWL 2R93A 5M3FK 3AQPA 1VGXA 3IPJA 3L4KA 4BBSC 1F7VA 3CQZA 2JA7K 1I50K 3S1RK 3SZYA 3H0GC 3ADAC 2WB1D 1F7UA 3AH5A 2PPBA 1RU0A 1I6HC 4O2DA 4BY1K 2Y0SL 3K7AC 4KM9A 2P8TA 2YU9A 5D4DA 2JA7C 1I50C 2RH6A 3S1RC 2BE5A 3T00A 1O2AA 4A3EC 4NOIA 4PABA 4J3NA 5M5YK 4KN7A 4C45A 3QX3A 3RZDK 2V6SA 4GTCA 3GTKA 3OPFA 3HOXK 5FJ8K 4G7HA 3GTPK 3HOVC 1TWFA 3S14C 4BXXK 1XXAA 3RZDC 3GTPC 3SZZA 1EI6A 5IYDK 2FQTA 1TWGA 2B63K 4G0WA 1X31C 3GTOK 3S17K 5IORA 4G7ZA 2NVQK 4Y52K 2E2JK 4KB2A 4LQYA 3GTQK 1J6VA 3T02A 3S1MK 1O24A 3S2HK 5IYDC 4BKWA 4XSZA 4XLPA 3S1QK 3S17C 3N0CA 1SFOK 3GTOC 1XXBA 2E2JC 2JA7A 1R9TK 4FZBA 3TFHA 4KMDA 1WQFA 3S2HC 1GE9A 3S1QC 5HL8A 1XXCA 1YCLA 1PJ7A 1Y1VK 4KASA 4GTEA 1R9TC 1O2FB 3PO2C 4GTFA 4X6AK 2E2IC 3GSIA 4Q5SA 3FOFA 4A3LK 1WQHA 1Y1VC 1USOA 3GTPA 3CAGA 4KMUA 4KMAA 4X6AC 1G51A 4A3FK 1DCPA 1O29A 1ISEA 1UV7A 1JVIA 4A3LC 4C3JC 4A3IK 2R92K 4MEXA 4WILA 4XCHA 4JK1A 4A3FC 1F9NA 4WJ4A 1TWAK 3A8IA 2B63A 2ZUFA 4GTLA 4QIWD 5TJ3A 5C4XK 2NVXK 3GTQA 4A3IC 3T01A 1TWCK 2R92C 5EGEA 2A68A 1BS2A 3BP3A 1WQGA 3GTJK 5IOQA 1USMA 5IYBK 3WODA 4LR2A 2VUMK 1TWAC 4A3GK 3S1NK 1SFOA 3FKIK 3AD8C 5C4XC 2NVXC 3V4GA 2W7VA 1R9TA 4FM9A 1TWCC 1IL2A 2GSNA 3MMLB 5M5WK 3TTGA 1WCMK 4KN4A 3M3YC 3HOZC 1O26A 5IYBC 4A3GC 4AYBL 4C2MK 1Y1WK 1Y1VA 1EK8A 4GFQA 4MEYA 3LPXA 3G4AA 1WCMC 4ZH4A 2A69A 4LJZA 2GAGC 4C2MC 1Y1WC 4A93K 4A3EK 1B4BA 3GIRA 1ZXOA 1XZPA 2V6UA 3HOVK 2PA8D 2Y3PA 2EBBA 3S14K 4KB4A 5M3MK 2JA6K 4A93C 2R92A 4KC6A 1O25A 4M1XA 2WAQD 2PMZL 1TWAA 3HKZL 1B4AA 1IE0A 4OIOA 2JA6C 2NVXA 4BBRK 1TWCA 4A3JC 4LK0A 4P9SA 3GTJA 3PO3C 1I3QK 2VUMA 2GAHC 4KMHA 3Q3QA 4RMFA 3AQOA 3FKIA 4QJVA 4BBRC 1XZPB 3OREA 4Y7NK 2A6HA 3NUHA 1F93A 5IP7C 1WCMA 3H0GA 2WB1L 5M5XK 4KAWX 4PAAA 1I3QC 1ZQ1C 1Y1WA 4KM8A 3S16K 4Y7NC 3GDZA 1K83K 1I50A 4OIRA 3PO2K 4BLAA 2E2IK 1VJEA 4OINA 1WSVA 5CHPA 1L0WA 3BUEA 5C44K 1XPPA 3AD7C 5C4JC 3S16C 4GTBA 1K83C 2NVYC 2RGRA 1IBAA 4P5BA 1WIHA 3GTLK 5FLMK 2JA6A 5C44C 1O28A 2GSOA 4C3JK 1BGWA 4QJVB 2CFAA 3VA7A 4BY7K 4P5AA 3GTGC 5L46A 1V5VA 4KDDA 3GTLC 1DCHA 1HI9A 5FLMC 2R7ZC 3S15C 3GEHA 4BY7C 1INNA 3HXAA 1I3QA 1VRQC 2JA8K 4DDQA 3HOWK 3GTOA 2E2HK 1JOEA 3M3YK 3HOZK 2JA8C 2KWAA 3HOWC 2Y0SD 1HQMA 5JVOA 2CFAB 4YFNA 4A3MK 5TMFA 2E2HC 1K83A 4YG2A 2E2IA 3S0XA 4YFXA 5IOTA 4OIQA 1XZQA 1BJTA 3M4OK 4A3DC 3TFIA 4A3MC 4GTAA 2JH3A 5E68A 5TMCA 1TWFC 1ZYRA 3GTLA 4GZYA 3M4OC 1JQWA 3LAJA 3GTMK 4A3BK 3DXJA 1IS1A 1YX2A 1DCOA 3H3VL 1VH2A 5C3EC 1IQ0A 3I4MC 3N3YA 1TWHK 3FHZA 4A3CC 3GTMC 4A3BC 2O5IA 4KARA 2ZUEA 4A3JK 4G7OA 3S2DK 3TFJA 3OEPA 4Q4ZA 4OIPA 3PO3K 2O5JA 2JA5K 1XZQB 4A3KC 3RZOC 2D6FC 1WOOA 1J6WA 1PJ5A 1ZVUA 1TWHC 2E2HA 1WORA 4YFKA 2A6EA 1EQRA 5IP7K 3G4CA 3S2DC 4MQ9A 4GTDA 2JA5C 1WOPA 1O27A 4XSXA 4BY1C 5JFEA 2XCRB 2V6TA 3I4NK 4KATA 5IYCK 1SMYA 3GEEA 4LLGA 5C4JK 3BP8C 3JSTA 2ZFZA 4LOWA 3HOXC 1BDFA 1I6HK 2NVYK 3A8JA 2PA8L 3I4NC 5IYCC 1J6XA 4BXXC 3L4JA 3GTMA 3GTGK 5IOSA 2WAQL 4C3HK
chains in the Genus database with same CATH topology
3HOXK 5FJ8K 4G7HA 3GTPK 3HOWK 3HOVC 4MEYA 2B63C 2E2HK 3S14C 2NVQC 2R7ZK 4Y52C 3S15K 4BXXK 1WCMC 4ZH4A 2A69A 3GTQC 3M3YK 1I6VA 4LJZA 3HOZK 3S1MC 1Y1WC 4A93K 2JA8C 4A3EK 1YNNA 3RZDC 3GTPC 3HOWC 2Y0SD 5IYDK 1HQMA 2E2HC 4YFNA 4A3MK 1SFOC 5TMFA 2JA8K 4C3IK 2CW0A 3HOVK 2PA8D 2B63K 2R93K 4YG2A 3S17K 3GTOK 4G7ZA 2NVQK 3S14K 4Y52K 5M3MK 4YFXA 2E2JK 3CQZK 4OIQA 3GTQK 2JA6K 4A93C 3S1MK 3M4OK 4XLNA 4A3DC 3S2HK 3HOUK 5IYDC 4AYBD 4A3MC 2WAQD 4XSZA 4XLPA 3S1QK 2R93C 5TMCA 2PMZL 1SFOK 3HKZL 2YU9K 3GTOC 3S17C 2E2JC 4OIOA 1TWFC 3CQZC 1ZYRA 2JA6C 4GZYA 1R9TK 4BBRK 3M4OC 3HOYK 4LK1A 4A3JC 4LK0A 3GTMK 3HOUC 5IP9K 3DXJA 3S2HC 4A3BK 4A3DK 3PO3C 3S1QC 1I3QK 3GTGK 1Y1VK 3H3VL 2YU9C 3GTKK 5C3EC 3H3VD 3I4MC 4QJVA 4BBRC 1R9TC 1TWFK 3PO2C 4Y7NK 1TWHK 4X6AK 2A6HA 2E2IC 3HOYC 5IP7C 4A3CC 3GTMC 5IP9C 4A3BC 2O5IA 4A3JK 2WB1L 5M5XK 4G7OA 4Q5SA 3S2DK 1I3QC 3EQLA 4A3LK 2NVTK 1Y1VC 1YNJA 4OIPA 4Q4ZA 3PO3K 2JA5K 3GTKC 2O5JA 4A3KC 3RZOC 4KMUA 3S16K 5C3EK 2PMZD 4X6AC 3HKZD 1TWHC 4Y7NC 3I4MK 1TWGK 1K83K 4YFKA 4A3FK 4OIRA 1IW7A 3PO2K 2E2IK 2A6EA 5IP7K 4A3CK 4OINA 3S2DC 4BBSK 4MQ9A 4A3LC 2NVTC 4A3IK 2JA5C 5C44K 3H0GK 2R92K 1XPPA 4MEXA 3GTJC 4XSXA 5C4JC 4BY1C 4JK1A 3S16C 4A3KK 3RZOK 2VUMC 3S1NC 1TWGC 1K83C 4A3FC 3K7AK 2NVYC 4QIWL 3FKIC 1TWAK 5M3FK 4QIWD 5C4XK 3I4NK 4BBSC 2JA7K 1I50K 3S1RK 5IYCK 5FLMK 2NVXK 4A3IC 3GTLK 5C44C 1SMYA 1TWCK 3H0GC 4C3JK 2R92C 2WB1D 4QJVB 2PPBA 2A68A 4LLGA 4BY7K 3GTJK 3GTGC 5C4JK 4BY1K 1I6HC 5IYBK 2Y0SL 3K7AC 3WODA 2VUMK 1TWAC 4A3GK 3HOXC 1BDFA 3S1NK 1I6HK 2NVYK 3FKIK 2PA8L 5D4DA 3I4NC 5C4XC 2JA7C 1I50C 3S1RC 5IYCC 5FLMC 2NVXC 2R7ZC 3GTLC 3S15C 1TWCC 2BE5A 4BXXC 5M5WK 1WCMK 4KN4A 3M3YC 3HOZC 4BY7C 5IYBC 4A3EC 4NOIA 4A3GC 5M5YK 4AYBL 4C2MK 1Y1WK 4KN7A 2WAQL 4C3HK 3RZDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOX K;  5FJ8 K;  4G7H A;  3GTP K;  3HOW K;  3HOV C;  4MEY A;  2B63 C;  2E2H K;  3S14 C;  2NVQ C;  2R7Z K;  4Y52 C;  3S15 K;  4BXX K;  1WCM C;  4ZH4 A;  2A69 A;  3GTQ C;  3M3Y K;  1I6V A;  4LJZ A;  3HOZ K;  3S1M C;  1Y1W C;  4A93 K;  2JA8 C;  4A3E K;  1YNN A;  3RZD C;  3GTP C;  3HOW C;  2Y0S D;  5IYD K;  1HQM A;  2E2H C;  4YFN A;  4A3M K;  1SFO C;  5TMF A;  2JA8 K;  4C3I K;  2CW0 A;  3HOV K;  2PA8 D;  2B63 K;  2R93 K;  4YG2 A;  3S17 K;  3GTO K;  4G7Z A;  2NVQ K;  3S14 K;  4Y52 K;  5M3M K;  4YFX A;  2E2J K;  3CQZ K;  4OIQ A;  3GTQ K;  2JA6 K;  4A93 C;  3S1M K;  3M4O K;  4XLN A;  4A3D C;  3S2H K;  3HOU K;  5IYD C;  4AYB D;  4A3M C;  2WAQ D;  4XSZ A;  4XLP A;  3S1Q K;  2R93 C;  5TMC A;  2PMZ L;  1SFO K;  3HKZ L;  2YU9 K;  3GTO C;  3S17 C;  2E2J C;  4OIO A;  1TWF C;  3CQZ C;  1ZYR A;  2JA6 C;  4GZY A;  1R9T K;  4BBR K;  3M4O C;  3HOY K;  4LK1 A;  4A3J C;  4LK0 A;  3GTM K;  3HOU C;  5IP9 K;  3DXJ A;  3S2H C;  4A3B K;  4A3D K;  3PO3 C;  3S1Q C;  1I3Q K;  3GTG K;  1Y1V K;  3H3V L;  2YU9 C;  3GTK K;  5C3E C;  3H3V D;  3I4M C;  4QJV A;  4BBR C;  1R9T C;  1TWF K;  3PO2 C;  4Y7N K;  1TWH K;  4X6A K;  2A6H A;  2E2I C;  3HOY C;  5IP7 C;  4A3C C;  3GTM C;  5IP9 C;  4A3B C;  2O5I A;  4A3J K;  2WB1 L;  5M5X K;  4G7O A;  4Q5S A;  3S2D K;  1I3Q C;  3EQL A;  4A3L K;  2NVT K;  1Y1V C;  1YNJ A;  4OIP A;  4Q4Z A;  3PO3 K;  2JA5 K;  3GTK C;  2O5J A;  4A3K C;  3RZO C;  4KMU A;  3S16 K;  5C3E K;  2PMZ D;  4X6A C;  3HKZ D;  1TWH C;  4Y7N C;  3I4M K;  1TWG K;  1K83 K;  4YFK A;  4A3F K;  4OIR A;  1IW7 A;  3PO2 K;  2E2I K;  2A6E A;  5IP7 K;  4A3C K;  4OIN A;  3S2D C;  4BBS K;  4MQ9 A;  4A3L C;  2NVT C;  4A3I K;  2JA5 C;  5C44 K;  3H0G K;  2R92 K;  1XPP A;  4MEX A;  3GTJ C;  4XSX A;  5C4J C;  4BY1 C;  4JK1 A;  3S16 C;  4A3K K;  3RZO K;  2VUM C;  3S1N C;  1TWG C;  1K83 C;  4A3F C;  3K7A K;  2NVY C;  4QIW L;  3FKI C;  1TWA K;  5M3F K;  4QIW D;  5C4X K;  3I4N K;  4BBS C;  2JA7 K;  1I50 K;  3S1R K;  5IYC K;  5FLM K;  2NVX K;  4A3I C;  3GTL K;  5C44 C;  1SMY A;  1TWC K;  3H0G C;  4C3J K;  2R92 C;  2WB1 D;  4QJV B;  2PPB A;  2A68 A;  4LLG A;  4BY7 K;  3GTJ K;  3GTG C;  5C4J K;  4BY1 K;  1I6H C;  5IYB K;  2Y0S L;  3K7A C;  3WOD A;  2VUM K;  1TWA C;  4A3G K;  3HOX C;  1BDF A;  3S1N K;  1I6H K;  2NVY K;  3FKI K;  2PA8 L;  5D4D A;  3I4N C;  5C4X C;  2JA7 C;  1I50 C;  3S1R C;  5IYC C;  5FLM C;  2NVX C;  2R7Z C;  3GTL C;  3S15 C;  1TWC C;  2BE5 A;  4BXX C;  5M5W K;  1WCM K;  4KN4 A;  3M3Y C;  3HOZ C;  4BY7 C;  5IYB C;  4A3E C;  4NOI A;  4A3G C;  5M5Y K;  4AYB L;  4C2M K;  1Y1W K;  4KN7 A;  2WAQ L;  4C3H K;  3RZD K; 
#chains in the Genus database with same CATH topology
 4G0V A;  2B63 C;  1TWH A;  2NVQ C;  2R7Z K;  4Y52 C;  3S15 K;  4BLB A;  3GTQ C;  1I6V A;  3S1M C;  4C3H C;  1YNN A;  2JA5 A;  3ERE D;  4G0U A;  1SFO C;  4C3I K;  2CW0 A;  2P5M A;  2R93 K;  2XCO A;  3CQZ K;  1VLO A;  4WJ3 M;  4XLN A;  3LAP A;  3HOU K;  1J98 A;  4AYB D;  1DD5 A;  1C0A A;  4C3I C;  2PHC B;  1EFW A;  2R93 C;  2FQO A;  2YU9 K;  2XCQ A;  3CQZ C;  3N0B A;  3HOY K;  4LK1 A;  3HOU C;  5IP9 K;  4A3D K;  3FOE A;  1KQ4 A;  5EGH A;  1ZBS A;  2YU9 C;  3GTK K;  2NVY A;  3H3V D;  1TWF K;  4AH6 A;  3HOY C;  4GT9 A;  5IP9 C;  1WOS A;  3EQL A;  1AB4 A;  2NVT K;  1YNJ A;  3GTG A;  3GTK C;  1WSR A;  5C3E K;  2PMZ D;  3HKZ D;  3I4M K;  1TWG K;  4ILD A;  2R7Z A;  1IW7 A;  5CJ9 A;  4A3C K;  4BBS K;  2NVT C;  3H0G K;  3A8K A;  1EH1 A;  3GTJ C;  2GSU A;  1PJ6 A;  4A3K K;  3RZO K;  2VUM C;  1O2B A;  3AD9 C;  3S1N C;  1TWG C;  3GEI A;  3K7A K;  3FKI C;  4QIW L;  2R93 A;  5M3F K;  3AQP A;  1VGX A;  3IPJ A;  3L4K A;  4BBS C;  1F7V A;  3CQZ A;  2JA7 K;  1I50 K;  3S1R K;  3SZY A;  3H0G C;  3ADA C;  2WB1 D;  1F7U A;  3AH5 A;  2PPB A;  1RU0 A;  1I6H C;  4O2D A;  4BY1 K;  2Y0S L;  3K7A C;  4KM9 A;  2P8T A;  2YU9 A;  5D4D A;  2JA7 C;  1I50 C;  2RH6 A;  3S1R C;  2BE5 A;  3T00 A;  1O2A A;  4A3E C;  4NOI A;  4PAB A;  4J3N A;  5M5Y K;  4KN7 A;  4C45 A;  3QX3 A;  3RZD K;  2V6S A;  4GTC A;  3GTK A;  3OPF A;  3HOX K;  5FJ8 K;  4G7H A;  3GTP K;  3HOV C;  1TWF A;  3S14 C;  4BXX K;  1XXA A;  3RZD C;  3GTP C;  3SZZ A;  1EI6 A;  5IYD K;  2FQT A;  1TWG A;  2B63 K;  4G0W A;  1X31 C;  3GTO K;  3S17 K;  5IOR A;  4G7Z A;  2NVQ K;  4Y52 K;  2E2J K;  4KB2 A;  4LQY A;  3GTQ K;  1J6V A;  3T02 A;  3S1M K;  1O24 A;  3S2H K;  5IYD C;  4BKW A;  4XSZ A;  4XLP A;  3S1Q K;  3S17 C;  3N0C A;  1SFO K;  3GTO C;  1XXB A;  2E2J C;  2JA7 A;  1R9T K;  4FZB A;  3TFH A;  4KMD A;  1WQF A;  3S2H C;  1GE9 A;  3S1Q C;  5HL8 A;  1XXC A;  1YCL A;  1PJ7 A;  1Y1V K;  4KAS A;  4GTE A;  1R9T C;  1O2F B;  3PO2 C;  4GTF A;  4X6A K;  2E2I C;  3GSI A;  4Q5S A;  3FOF A;  4A3L K;  1WQH A;  1Y1V C;  1USO A;  3GTP A;  3CAG A;  4KMU A;  4KMA A;  4X6A C;  1G51 A;  4A3F K;  1DCP A;  1O29 A;  1ISE A;  1UV7 A;  1JVI A;  4A3L C;  4C3J C;  4A3I K;  2R92 K;  4MEX A;  4WIL A;  4XCH A;  4JK1 A;  4A3F C;  1F9N A;  4WJ4 A;  1TWA K;  3A8I A;  2B63 A;  2ZUF A;  4GTL A;  4QIW D;  5TJ3 A;  5C4X K;  2NVX K;  3GTQ A;  4A3I C;  3T01 A;  1TWC K;  2R92 C;  5EGE A;  2A68 A;  1BS2 A;  3BP3 A;  1WQG A;  3GTJ K;  5IOQ A;  1USM A;  5IYB K;  3WOD A;  4LR2 A;  2VUM K;  1TWA C;  4A3G K;  3S1N K;  1SFO A;  3FKI K;  3AD8 C;  5C4X C;  2NVX C;  3V4G A;  2W7V A;  1R9T A;  4FM9 A;  1TWC C;  1IL2 A;  2GSN A;  3MML B;  5M5W K;  3TTG A;  1WCM K;  4KN4 A;  3M3Y C;  3HOZ C;  1O26 A;  5IYB C;  4A3G C;  4AYB L;  4C2M K;  1Y1W K;  1Y1V A;  1EK8 A;  4GFQ A;  4MEY A;  3LPX A;  3G4A A;  1WCM C;  4ZH4 A;  2A69 A;  4LJZ A;  2GAG C;  4C2M C;  1Y1W C;  4A93 K;  4A3E K;  1B4B A;  3GIR A;  1ZXO A;  1XZP A;  2V6U A;  3HOV K;  2PA8 D;  2Y3P A;  2EBB A;  3S14 K;  4KB4 A;  5M3M K;  2JA6 K;  4A93 C;  2R92 A;  4KC6 A;  1O25 A;  4M1X A;  2WAQ D;  2PMZ L;  1TWA A;  3HKZ L;  1B4A A;  1IE0 A;  4OIO A;  2JA6 C;  2NVX A;  4BBR K;  1TWC A;  4A3J C;  4LK0 A;  4P9S A;  3GTJ A;  3PO3 C;  1I3Q K;  2VUM A;  2GAH C;  4KMH A;  3Q3Q A;  4RMF A;  3AQO A;  3FKI A;  4QJV A;  4BBR C;  1XZP B;  3ORE A;  4Y7N K;  2A6H A;  3NUH A;  1F93 A;  5IP7 C;  1WCM A;  3H0G A;  2WB1 L;  5M5X K;  4KAW X;  4PAA A;  1I3Q C;  1ZQ1 C;  1Y1W A;  4KM8 A;  3S16 K;  4Y7N C;  3GDZ A;  1K83 K;  1I50 A;  4OIR A;  3PO2 K;  4BLA A;  2E2I K;  1VJE A;  4OIN A;  1WSV A;  5CHP A;  1L0W A;  3BUE A;  5C44 K;  1XPP A;  3AD7 C;  5C4J C;  3S16 C;  4GTB A;  1K83 C;  2NVY C;  2RGR A;  1IBA A;  4P5B A;  1WIH A;  3GTL K;  5FLM K;  2JA6 A;  5C44 C;  1O28 A;  2GSO A;  4C3J K;  1BGW A;  4QJV B;  2CFA A;  3VA7 A;  4BY7 K;  4P5A A;  3GTG C;  5L46 A;  1V5V A;  4KDD A;  3GTL C;  1DCH A;  1HI9 A;  5FLM C;  2R7Z C;  3S15 C;  3GEH A;  4BY7 C;  1INN A;  3HXA A;  1I3Q A;  1VRQ C;  2JA8 K;  4DDQ A;  3HOW K;  3GTO A;  2E2H K;  1JOE A;  3M3Y K;  3HOZ K;  2JA8 C;  2KWA A;  3HOW C;  2Y0S D;  1HQM A;  5JVO A;  2CFA B;  4YFN A;  4A3M K;  5TMF A;  2E2H C;  1K83 A;  4YG2 A;  2E2I A;  3S0X A;  4YFX A;  5IOT A;  4OIQ A;  1XZQ A;  1BJT A;  3M4O K;  4A3D C;  3TFI A;  4A3M C;  4GTA A;  2JH3 A;  5E68 A;  5TMC A;  1TWF C;  1ZYR A;  3GTL A;  4GZY A;  3M4O C;  1JQW A;  3LAJ A;  3GTM K;  4A3B K;  3DXJ A;  1IS1 A;  1YX2 A;  1DCO A;  3H3V L;  1VH2 A;  5C3E C;  1IQ0 A;  3I4M C;  3N3Y A;  1TWH K;  3FHZ A;  4A3C C;  3GTM C;  4A3B C;  2O5I A;  4KAR A;  2ZUE A;  4A3J K;  4G7O A;  3S2D K;  3TFJ A;  3OEP A;  4Q4Z A;  4OIP A;  3PO3 K;  2O5J A;  2JA5 K;  1XZQ B;  4A3K C;  3RZO C;  2D6F C;  1WOO A;  1J6W A;  1PJ5 A;  1ZVU A;  1TWH C;  2E2H A;  1WOR A;  4YFK A;  2A6E A;  1EQR A;  5IP7 K;  3G4C A;  3S2D C;  4MQ9 A;  4GTD A;  2JA5 C;  1WOP A;  1O27 A;  4XSX A;  4BY1 C;  5JFE A;  2XCR B;  2V6T A;  3I4N K;  4KAT A;  5IYC K;  1SMY A;  3GEE A;  4LLG A;  5C4J K;  3BP8 C;  3JST A;  2ZFZ A;  4LOW A;  3HOX C;  1BDF A;  1I6H K;  2NVY K;  3A8J A;  2PA8 L;  3I4N C;  5IYC C;  1J6X A;  4BXX C;  3L4J A;  3GTM A;  3GTG K;  5IOS A;  2WAQ L;  4C3H K; 
#chains in the Genus database with same CATH homology
 3HOX K;  5FJ8 K;  4G7H A;  3GTP K;  3HOW K;  3HOV C;  4MEY A;  2B63 C;  2E2H K;  3S14 C;  2NVQ C;  2R7Z K;  4Y52 C;  3S15 K;  4BXX K;  1WCM C;  4ZH4 A;  2A69 A;  3GTQ C;  3M3Y K;  1I6V A;  4LJZ A;  3HOZ K;  3S1M C;  1Y1W C;  4A93 K;  2JA8 C;  4A3E K;  1YNN A;  3RZD C;  3GTP C;  3HOW C;  2Y0S D;  5IYD K;  1HQM A;  2E2H C;  4YFN A;  4A3M K;  1SFO C;  5TMF A;  2JA8 K;  4C3I K;  2CW0 A;  3HOV K;  2PA8 D;  2B63 K;  2R93 K;  4YG2 A;  3S17 K;  3GTO K;  4G7Z A;  2NVQ K;  3S14 K;  4Y52 K;  5M3M K;  4YFX A;  2E2J K;  3CQZ K;  4OIQ A;  3GTQ K;  2JA6 K;  4A93 C;  3S1M K;  3M4O K;  4XLN A;  4A3D C;  3S2H K;  3HOU K;  5IYD C;  4AYB D;  4A3M C;  2WAQ D;  4XSZ A;  4XLP A;  3S1Q K;  2R93 C;  5TMC A;  2PMZ L;  1SFO K;  3HKZ L;  2YU9 K;  3GTO C;  3S17 C;  2E2J C;  4OIO A;  1TWF C;  3CQZ C;  1ZYR A;  2JA6 C;  4GZY A;  1R9T K;  4BBR K;  3M4O C;  3HOY K;  4LK1 A;  4A3J C;  4LK0 A;  3GTM K;  3HOU C;  5IP9 K;  3DXJ A;  3S2H C;  4A3B K;  4A3D K;  3PO3 C;  3S1Q C;  1I3Q K;  3GTG K;  1Y1V K;  3H3V L;  2YU9 C;  3GTK K;  5C3E C;  3H3V D;  3I4M C;  4QJV A;  4BBR C;  1R9T C;  1TWF K;  3PO2 C;  4Y7N K;  1TWH K;  4X6A K;  2A6H A;  2E2I C;  3HOY C;  5IP7 C;  4A3C C;  3GTM C;  5IP9 C;  4A3B C;  2O5I A;  4A3J K;  2WB1 L;  5M5X K;  4G7O A;  4Q5S A;  3S2D K;  1I3Q C;  3EQL A;  4A3L K;  2NVT K;  1Y1V C;  1YNJ A;  4OIP A;  4Q4Z A;  3PO3 K;  2JA5 K;  3GTK C;  2O5J A;  4A3K C;  3RZO C;  4KMU A;  3S16 K;  5C3E K;  2PMZ D;  4X6A C;  3HKZ D;  1TWH C;  4Y7N C;  3I4M K;  1TWG K;  1K83 K;  4YFK A;  4A3F K;  4OIR A;  1IW7 A;  3PO2 K;  2E2I K;  2A6E A;  5IP7 K;  4A3C K;  4OIN A;  3S2D C;  4BBS K;  4MQ9 A;  4A3L C;  2NVT C;  4A3I K;  2JA5 C;  5C44 K;  3H0G K;  2R92 K;  1XPP A;  4MEX A;  3GTJ C;  4XSX A;  5C4J C;  4BY1 C;  4JK1 A;  3S16 C;  4A3K K;  3RZO K;  2VUM C;  3S1N C;  1TWG C;  1K83 C;  4A3F C;  3K7A K;  2NVY C;  4QIW L;  3FKI C;  1TWA K;  5M3F K;  4QIW D;  5C4X K;  3I4N K;  4BBS C;  2JA7 K;  1I50 K;  3S1R K;  5IYC K;  5FLM K;  2NVX K;  4A3I C;  3GTL K;  5C44 C;  1SMY A;  1TWC K;  3H0G C;  4C3J K;  2R92 C;  2WB1 D;  4QJV B;  2PPB A;  2A68 A;  4LLG A;  4BY7 K;  3GTJ K;  3GTG C;  5C4J K;  4BY1 K;  1I6H C;  5IYB K;  2Y0S L;  3K7A C;  3WOD A;  2VUM K;  1TWA C;  4A3G K;  3HOX C;  1BDF A;  3S1N K;  1I6H K;  2NVY K;  3FKI K;  2PA8 L;  5D4D A;  3I4N C;  5C4X C;  2JA7 C;  1I50 C;  3S1R C;  5IYC C;  5FLM C;  2NVX C;  2R7Z C;  3GTL C;  3S15 C;  1TWC C;  2BE5 A;  4BXX C;  5M5W K;  1WCM K;  4KN4 A;  3M3Y C;  3HOZ C;  4BY7 C;  5IYB C;  4A3E C;  4NOI A;  4A3G C;  5M5Y K;  4AYB L;  4C2M K;  1Y1W K;  4KN7 A;  2WAQ L;  4C3H K;  3RZD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...