5IP9K

Structure of rna polymerase ii-tfiif complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5ip9K00
1BDFA 5C3EC 3CQZC 4QJVB 2JA7K 1HQMA 5FJ8K 3GTMC 2PPBA 4A3BK 3HOXC 3M4OK 5FLMK 2JA8C 4BBSC 3I4MK 4A3DC 1I3QK 4A3CK 1XPPA 2O5JA 4QIWD 2Y0SL 4OIPA 1I6HC 2JA6C 1YNJA 2PA8L 3I4NC 1K83C 4A3GC 3S1NC 2R93C 2BE5A 3S15K 5TMFA 4Q4ZA 3S2HK 1I50C 1TWGK 1TWFC 3HKZD 2A69A 4BBRK 3GTGC 4A3IC 4KN7A 3S14C 5C3EK 3CQZK 2WB1D 3HOZC 3GTMK 2B63C 3GTPC 1Y1VC 3M3YC 3HOXK 4Y7NC 5C4XC 4MEYA 2JA5C 4G7OA 4A3EC 3HOUC 4BXXC 4A3KC 4BBSK 2CW0A 4A3DK 4C3HK 1TWHC 3FKIC 4KN4A 2PMZD 1SFOK 3GTKK 1SMYA 5IP7C 1R9TC 4Y52C 5C4JC 4X6AK 3K7AC 4AYBD 2JA6K 3WODA 3I4NK 3S1QK 4A3GK 2NVXK 3S1NK 1IW7A 2R93K 3S1RC 5D4DA 3H3VD 2E2HC 1Y1WC 3GTQC 2R92C 3HOWC 1WCMK 1I50K 4XSZA 4Q5SA 3RZOK 1TWFK 4A3MC 4MEXA 2YU9C 3H0GC 5M3MK 2A6HA 3GTLC 4QJVA 4LJZA 4A3IK 3S14K 4OINA 3S1MC 3HOZK 4BY1C 3GTOC 2VUMC 2B63K 3M3YK 1Y1VK 2WAQD 3S1RK 4Y7NK 5IYBC 5C44C 4A3FC 2JA5K 3HOYC 4A3JC 2NVTC 2R7ZC 4A93C 1TWAC 2Y0SD 5IYCC 3PO2C 4BXXK 4KMUA 1TWCC 3DXJA 4YFNA 1TWHK 3FKIK 5IYDC 2JA8K 5IP7K 2O5IA 3S2DC 4LLGA 5C4JK 3K7AK 4BY7C 3EQLA 2A6EA 5M5YK 2WB1L 3PO3C 3HOWK 3S17C 2E2HK 1Y1WK 3GTQK 2R92K 4GZYA 1I6HK 1I3QC 4A3CC 1K83K 4A3MK 4A3LC 5IP9C 2YU9K 1ZYRA 3H0GK 3GTLK 3GTJC 4C3JK 3RZDC 2PMZL 4ZH4A 3S1MK 3S15C 4BY1K 4NOIA 3GTOK 4AYBL 3GTGK 4C3IK 4G7HA 5IYBK 4A3FK 5TMCA 3HOYK 4QIWL 4XSXA 2NVTK 2E2JC 1YNNA 2R7ZK 5IYCK 3PO2K 5M3FK 2NVYC 2NVQC 3GTPK 5C4XK 3HOVC 3S16C 5IYDK 2E2IC 4A3EK 3HOUK 3S2DK 4XLNA 4A3KK 4BY7K 2PA8D 2A68A 3HKZL 1R9TK 2JA7C 3PO3K 3S17K 4Y52K 4A3BC 2WAQL 3M4OC 5FLMC 4A3LK 4C2MK 1I6VA 1SFOC 3GTKC 5IP9K 5M5XK 4X6AC 3S1QC 4LK0A 4OIOA 3GTJK 4G7ZA 3I4MC 4MQ9A 3RZDK 2NVXC 4OIRA 4YFKA 4OIQA 4A93K 1WCMC 4XLPA 4LK1A 4JK1A 3RZOC 5M5WK 4YFXA 2E2JK 4YG2A 2NVYK 2NVQK 2VUMK 3S2HC 3HOVK 3S16K 5C44K 1TWGC 2E2IK 4A3JK 1TWAK 3H3VL 4BBRC 1TWCK
chains in the Genus database with same CATH superfamily
1I50A 1BDFA 1V5VA 3CQZC 1JVIA 1HQMA 1F7UA 3A8KA 4AH6A 3LPXA 3A8IA 4A3DC 2O5JA 4QIWD 3QX3A 1XZPB 4GTFA 3GDZA 1YNJA 3VA7A 4G0UA 1K83C 1DD5A 4A3GC 4Q4ZA 1I50C 1TWFC 3TFIA 2A69A 3L4KA 4KN7A 3JSTA 3HOZC 3GTMK 2GAHC 4GTLA 3AH5A 1ISEA 4G7OA 3MMLB 4BBSK 2D6FC 3GTGA 1TWHC 4KN4A 2PMZD 1EK8A 1SFOK 3GTKK 2GSOA 1VLOA 2B63A 3I4NK 3GTPA 2NVXK 5D4DA 2R92C 1BJTA 4C45A 5TJ3A 5EGHA 5M3MK 4QJVA 1PJ7A 1XXAA 4BLAA 2VUMC 3AD9C 3S1RK 4Y7NK 4A3FC 1TWAC 2Y0SD 4BXXK 3DXJA 3FKIK 2JA8K 1PJ5A 5IORA 3K7AK 3EQLA 3S0XA 3PO3C 1INNA 1EQRA 1Y1WK 2E2HK 3GTQK 1I6HK 1J6XA 1O27A 4A3LC 1G51A 1IBAA 3GTJC 3OEPA 4BKWA 1DCHA 3GTOK 4A93C 3CAGA 1AB4A 3HOYK 4WILA 3GSIA 4G0WA 2EBBA 5M3FK 3T00A 5C4XK 5IYDK 3GIRA 3HKZL 1R9TK 4Y52K 1RU0A 4C2MK 1SFOC 3GTKC 5IP9K 3BP8C 4OIOA 3IPJA 2NVXC 1VH2A 3BP3A 4YFKA 4OIQA 5IOTA 4XLPA 5M5WK 2E2JK 4YG2A 2E2IK 3H3VL 2R93A 4BBRC 4KMAA 1TWCK 4XLNA 3S1RC 1WCMA 5C3EC 1J6VA 5IOSA 5FJ8K 2PPBA 3HXAA 5FLMK 4GTCA 2JA8C 1TWGA 3AD8C 4XCHA 3I4MK 4KB2A 1ZBSA 4GTBA 4KC6A 3CQZA 4OIPA 1I6HC 2JA6C 2PA8L 2R93C 3S15K 1O2FB 4J3NA 3S2HK 1JQWA 1IS1A 4G0VA 2XCRB 1K83A 1EFWA 1DCPA 1XXBA 3M3YC 1Y1VC 3HOXK 5C4XC 2JA5C 2P5MA 1TWFA 4P9SA 2CFAA 2KWAA 5IP7C 1R9TC 4Y52C 1B4BA 3WODA 4C2MC 3S1NK 1IW7A 3FHZA 3HOWC 1TWHA 4MEXA 2YU9C 4KARA 3H0GC 3GTLC 2A6HA 5L46A 4A3IK 3S14K 3TFJA 3S1MC 4BY1C 1WSVA 2B63K 1O26A 5IYBC 1F7VA 2R92A 2NVTC 2R7ZC 5IYCC 4KMUA 1TWCC 5CHPA 1XZPA 2O5IA 5C4JK 1X31C 2VUMA 4BY7C 5M5YK 5JVOA 3S17C 1TWAA 2GAGC 1USMA 4A3MK 2FQOA 1UV7A 1ZYRA 3RZDC 2PMZL 3S15C 4C3IK 1WQHA 5TMCA 3A8JA 1IQ0A 3PO2K 2NVYC 2NVQC 2XCOA 3HOVC 3S16C 3GTJA 3S2DK 4FM9A 4PABA 4RMFA 1HI9A 1I6VA 3FOEA 5M5XK 3T02A 4GT9A 4G7ZA 2RGRA 2W7VA 4MQ9A 4KB4A 1USOA 4JK1A 1IL2A 4YFXA 3GTKA 1SFOA 1B4AA 5C44K 4LQYA 4A3JK 2NVXA 5JFEA 2JA7K 4GFQA 3GTMC 4A3BK 1JOEA 3M4OK 3TFHA 1O2BA 1O24A 4BBSC 1I3QK 3SZYA 1XPPA 1O29A 4GTEA 3I4NC 1J98A 5TMFA 1C0AA 4FZBA 4BLBA 1TWGK 3HKZD 1WOSA 3LAPA 2JA6A 1EH1A 3CQZK 2WB1D 4Y7NC 4M1XA 2GSUA 4BXXC 3GTOA 4A3DK 1ZVUA 4C3HK 3FKIC 1BGWA 3K7AC 4AYBD 3S1QK 1Y1VA 4A3GK 2JA5A 3AD7C 1GE9A 3H3VD 2E2HC 1Y1WC 3GTQC 3OREA 1I50K 4GTAA 3ADAC 3RZOK 1TWFK 1R9TA 3TTGA 4O2DA 4OINA 3HOZK 3GTOC 2WAQD 3NUHA 3HOYC 5C44C 3GEIA 4A3JC 2YU9A 1VJEA 3H0GA 3GTLA 1TWHK 5IYDC 1VGXA 1ZXOA 2A6EA 2ZFZA 2R7ZA 1WOPA 4GZYA 2R92K 5HL8A 1I3QC 1TWCA 4KASA 5IP9C 2PHCB 1F9NA 4LR2A 4ILDA 4C3JK 1XZQA 4ZH4A 4NOIA 5CJ9A 3GTGK 4G7HA 4A3FK 4XSXA 4QIWL 2E2JC 2V6TA 3GTPK 1ZQ1C 2E2IC 4A3EK 3HOUK 3GEHA 3BUEA 2XCQA 3N0BA 4A3KK 3FOFA 1J6WA 4WJ4A 3PO3K 2NVYA 1O28A 4C3HC 5FLMC 4A3LK 1L0WA 3S1QC 2V6SA 4LK0A 3GTJK 3I4MC 1WQGA 4A93K 4LK1A 3RZOC 5IOQA 1KQ4A 3S2HC 5EGEA 2ZUFA 1XXCA 4QJVB 4P5BA 4KMDA 3HOXC 3G4CA 2RH6A 3LAJA 1WQFA 4GTDA 4A3CK 1PJ6A 2Y0SL 3GTMA 3S1NC 2BE5A 4C3JC 4DDQA 4BBRK 3GTGC 4A3IC 3S14C 4KAWX 5C3EK 4KATA 2B63C 3GTPC 2Y3PA 4MEYA 4A3EC 3HOUC 1F93A 1O25A 4A3KC 2CW0A 3T01A 1SMYA 5C4JC 4X6AK 2JA6K 1DCOA 4WJ3M 2FQTA 1IE0A 2JH3A 2R93K 3L4JA 2ZUEA 3G4AA 4KMHA 4Q5SA 1WCMK 4XSZA 4A3MC 3SZZA 3FKIA 3ERED 4LJZA 4PAAA 1Y1VK 3M3YK 3GTQA 4C3IC 2E2HA 1Y1WA 2JA5K 3Q3QA 3PO2C 1BS2A 4YFNA 5IP7K 3S2DC 4LLGA 4KM8A 3OPFA 4KM9A 2WB1L 3HOWK 4A3CC 1K83K 2V6UA 2YU9K 2JA7A 3H0GK 3GTLK 3V4GA 3S1MK 4BY1K 4AYBL 5IYBK 1I3QA 1O2AA 2NVTK 3GEEA 1YNNA 2R7ZK 5IYCK 3N3YA 3AQPA 5E68A 4BY7K 2PA8D 1EI6A 2A68A 2JA7C 4KDDA 1WIHA 3S17K 4A3BC 2WAQL 4LOWA 3M4OC 1VRQC 2E2IA 1WSRA 2P8TA 4X6AC 4OIRA 2CFAB 3RZDK 2GSNA 1WCMC 1WORA 3AQOA 4P5AA 1YCLA 2NVYK 2NVQK 3N0CA 2VUMK 3HOVK 3S16K 1TWGC 1YX2A 1XZQB 1TWAK 1WOOA
chains in the Genus database with same CATH topology
1BDFA 5C3EC 3CQZC 4QJVB 2JA7K 1HQMA 5FJ8K 3GTMC 2PPBA 4A3BK 3HOXC 3M4OK 5FLMK 2JA8C 4BBSC 3I4MK 4A3DC 1I3QK 4A3CK 1XPPA 2O5JA 4QIWD 2Y0SL 4OIPA 1I6HC 2JA6C 1YNJA 2PA8L 3I4NC 1K83C 4A3GC 3S1NC 2R93C 2BE5A 3S15K 5TMFA 4Q4ZA 3S2HK 1I50C 1TWGK 1TWFC 3HKZD 2A69A 4BBRK 3GTGC 4A3IC 4KN7A 3S14C 5C3EK 3CQZK 2WB1D 3HOZC 3GTMK 2B63C 3GTPC 1Y1VC 3M3YC 3HOXK 4Y7NC 5C4XC 4MEYA 2JA5C 4G7OA 4A3EC 3HOUC 4BXXC 4A3KC 4BBSK 2CW0A 4A3DK 4C3HK 1TWHC 3FKIC 4KN4A 2PMZD 1SFOK 3GTKK 1SMYA 5IP7C 1R9TC 4Y52C 5C4JC 4X6AK 3K7AC 4AYBD 2JA6K 3WODA 3I4NK 3S1QK 4A3GK 2NVXK 3S1NK 1IW7A 2R93K 3S1RC 5D4DA 3H3VD 2E2HC 1Y1WC 3GTQC 2R92C 3HOWC 1WCMK 1I50K 4XSZA 4Q5SA 3RZOK 1TWFK 4A3MC 4MEXA 2YU9C 3H0GC 5M3MK 2A6HA 3GTLC 4QJVA 4LJZA 4A3IK 3S14K 4OINA 3S1MC 3HOZK 4BY1C 3GTOC 2VUMC 2B63K 3M3YK 1Y1VK 2WAQD 3S1RK 4Y7NK 5IYBC 5C44C 4A3FC 2JA5K 3HOYC 4A3JC 2NVTC 2R7ZC 4A93C 1TWAC 2Y0SD 5IYCC 3PO2C 4BXXK 4KMUA 1TWCC 3DXJA 4YFNA 1TWHK 3FKIK 5IYDC 2JA8K 5IP7K 2O5IA 3S2DC 4LLGA 5C4JK 3K7AK 4BY7C 3EQLA 2A6EA 5M5YK 2WB1L 3PO3C 3HOWK 3S17C 2E2HK 1Y1WK 3GTQK 2R92K 4GZYA 1I6HK 1I3QC 4A3CC 1K83K 4A3MK 4A3LC 5IP9C 2YU9K 1ZYRA 3H0GK 3GTLK 3GTJC 4C3JK 3RZDC 2PMZL 4ZH4A 3S1MK 3S15C 4BY1K 4NOIA 3GTOK 4AYBL 3GTGK 4C3IK 4G7HA 5IYBK 4A3FK 5TMCA 3HOYK 4QIWL 4XSXA 2NVTK 2E2JC 1YNNA 2R7ZK 5IYCK 3PO2K 5M3FK 2NVYC 2NVQC 3GTPK 5C4XK 3HOVC 3S16C 5IYDK 2E2IC 4A3EK 3HOUK 3S2DK 4XLNA 4A3KK 4BY7K 2PA8D 2A68A 3HKZL 1R9TK 2JA7C 3PO3K 3S17K 4Y52K 4A3BC 2WAQL 3M4OC 5FLMC 4A3LK 4C2MK 1I6VA 1SFOC 3GTKC 5IP9K 5M5XK 4X6AC 3S1QC 4LK0A 4OIOA 3GTJK 4G7ZA 3I4MC 4MQ9A 3RZDK 2NVXC 4OIRA 4YFKA 4OIQA 4A93K 1WCMC 4XLPA 4LK1A 4JK1A 3RZOC 5M5WK 4YFXA 2E2JK 4YG2A 2NVYK 2NVQK 2VUMK 3S2HC 3HOVK 3S16K 5C44K 1TWGC 2E2IK 4A3JK 1TWAK 3H3VL 4BBRC 1TWCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDF A;  5C3E C;  3CQZ C;  4QJV B;  2JA7 K;  1HQM A;  5FJ8 K;  3GTM C;  2PPB A;  4A3B K;  3HOX C;  3M4O K;  5FLM K;  2JA8 C;  4BBS C;  3I4M K;  4A3D C;  1I3Q K;  4A3C K;  1XPP A;  2O5J A;  4QIW D;  2Y0S L;  4OIP A;  1I6H C;  2JA6 C;  1YNJ A;  2PA8 L;  3I4N C;  1K83 C;  4A3G C;  3S1N C;  2R93 C;  2BE5 A;  3S15 K;  5TMF A;  4Q4Z A;  3S2H K;  1I50 C;  1TWG K;  1TWF C;  3HKZ D;  2A69 A;  4BBR K;  3GTG C;  4A3I C;  4KN7 A;  3S14 C;  5C3E K;  3CQZ K;  2WB1 D;  3HOZ C;  3GTM K;  2B63 C;  3GTP C;  1Y1V C;  3M3Y C;  3HOX K;  4Y7N C;  5C4X C;  4MEY A;  2JA5 C;  4G7O A;  4A3E C;  3HOU C;  4BXX C;  4A3K C;  4BBS K;  2CW0 A;  4A3D K;  4C3H K;  1TWH C;  3FKI C;  4KN4 A;  2PMZ D;  1SFO K;  3GTK K;  1SMY A;  5IP7 C;  1R9T C;  4Y52 C;  5C4J C;  4X6A K;  3K7A C;  4AYB D;  2JA6 K;  3WOD A;  3I4N K;  3S1Q K;  4A3G K;  2NVX K;  3S1N K;  1IW7 A;  2R93 K;  3S1R C;  5D4D A;  3H3V D;  2E2H C;  1Y1W C;  3GTQ C;  2R92 C;  3HOW C;  1WCM K;  1I50 K;  4XSZ A;  4Q5S A;  3RZO K;  1TWF K;  4A3M C;  4MEX A;  2YU9 C;  3H0G C;  5M3M K;  2A6H A;  3GTL C;  4QJV A;  4LJZ A;  4A3I K;  3S14 K;  4OIN A;  3S1M C;  3HOZ K;  4BY1 C;  3GTO C;  2VUM C;  2B63 K;  3M3Y K;  1Y1V K;  2WAQ D;  3S1R K;  4Y7N K;  5IYB C;  5C44 C;  4A3F C;  2JA5 K;  3HOY C;  4A3J C;  2NVT C;  2R7Z C;  4A93 C;  1TWA C;  2Y0S D;  5IYC C;  3PO2 C;  4BXX K;  4KMU A;  1TWC C;  3DXJ A;  4YFN A;  1TWH K;  3FKI K;  5IYD C;  2JA8 K;  5IP7 K;  2O5I A;  3S2D C;  4LLG A;  5C4J K;  3K7A K;  4BY7 C;  3EQL A;  2A6E A;  5M5Y K;  2WB1 L;  3PO3 C;  3HOW K;  3S17 C;  2E2H K;  1Y1W K;  3GTQ K;  2R92 K;  4GZY A;  1I6H K;  1I3Q C;  4A3C C;  1K83 K;  4A3M K;  4A3L C;  5IP9 C;  2YU9 K;  1ZYR A;  3H0G K;  3GTL K;  3GTJ C;  4C3J K;  3RZD C;  2PMZ L;  4ZH4 A;  3S1M K;  3S15 C;  4BY1 K;  4NOI A;  3GTO K;  4AYB L;  3GTG K;  4C3I K;  4G7H A;  5IYB K;  4A3F K;  5TMC A;  3HOY K;  4QIW L;  4XSX A;  2NVT K;  2E2J C;  1YNN A;  2R7Z K;  5IYC K;  3PO2 K;  5M3F K;  2NVY C;  2NVQ C;  3GTP K;  5C4X K;  3HOV C;  3S16 C;  5IYD K;  2E2I C;  4A3E K;  3HOU K;  3S2D K;  4XLN A;  4A3K K;  4BY7 K;  2PA8 D;  2A68 A;  3HKZ L;  1R9T K;  2JA7 C;  3PO3 K;  3S17 K;  4Y52 K;  4A3B C;  2WAQ L;  3M4O C;  5FLM C;  4A3L K;  4C2M K;  1I6V A;  1SFO C;  3GTK C;  5IP9 K;  5M5X K;  4X6A C;  3S1Q C;  4LK0 A;  4OIO A;  3GTJ K;  4G7Z A;  3I4M C;  4MQ9 A;  3RZD K;  2NVX C;  4OIR A;  4YFK A;  4OIQ A;  4A93 K;  1WCM C;  4XLP A;  4LK1 A;  4JK1 A;  3RZO C;  5M5W K;  4YFX A;  2E2J K;  4YG2 A;  2NVY K;  2NVQ K;  2VUM K;  3S2H C;  3HOV K;  3S16 K;  5C44 K;  1TWG C;  2E2I K;  4A3J K;  1TWA K;  3H3V L;  4BBR C;  1TWC K; 
#chains in the Genus database with same CATH topology
 1I50 A;  1BDF A;  1V5V A;  3CQZ C;  1JVI A;  1HQM A;  1F7U A;  3A8K A;  4AH6 A;  3LPX A;  3A8I A;  4A3D C;  2O5J A;  4QIW D;  3QX3 A;  1XZP B;  4GTF A;  3GDZ A;  1YNJ A;  3VA7 A;  4G0U A;  1K83 C;  1DD5 A;  4A3G C;  4Q4Z A;  1I50 C;  1TWF C;  3TFI A;  2A69 A;  3L4K A;  4KN7 A;  3JST A;  3HOZ C;  3GTM K;  2GAH C;  4GTL A;  3AH5 A;  1ISE A;  4G7O A;  3MML B;  4BBS K;  2D6F C;  3GTG A;  1TWH C;  4KN4 A;  2PMZ D;  1EK8 A;  1SFO K;  3GTK K;  2GSO A;  1VLO A;  2B63 A;  3I4N K;  3GTP A;  2NVX K;  5D4D A;  2R92 C;  1BJT A;  4C45 A;  5TJ3 A;  5EGH A;  5M3M K;  4QJV A;  1PJ7 A;  1XXA A;  4BLA A;  2VUM C;  3AD9 C;  3S1R K;  4Y7N K;  4A3F C;  1TWA C;  2Y0S D;  4BXX K;  3DXJ A;  3FKI K;  2JA8 K;  1PJ5 A;  5IOR A;  3K7A K;  3EQL A;  3S0X A;  3PO3 C;  1INN A;  1EQR A;  1Y1W K;  2E2H K;  3GTQ K;  1I6H K;  1J6X A;  1O27 A;  4A3L C;  1G51 A;  1IBA A;  3GTJ C;  3OEP A;  4BKW A;  1DCH A;  3GTO K;  4A93 C;  3CAG A;  1AB4 A;  3HOY K;  4WIL A;  3GSI A;  4G0W A;  2EBB A;  5M3F K;  3T00 A;  5C4X K;  5IYD K;  3GIR A;  3HKZ L;  1R9T K;  4Y52 K;  1RU0 A;  4C2M K;  1SFO C;  3GTK C;  5IP9 K;  3BP8 C;  4OIO A;  3IPJ A;  2NVX C;  1VH2 A;  3BP3 A;  4YFK A;  4OIQ A;  5IOT A;  4XLP A;  5M5W K;  2E2J K;  4YG2 A;  2E2I K;  3H3V L;  2R93 A;  4BBR C;  4KMA A;  1TWC K;  4XLN A;  3S1R C;  1WCM A;  5C3E C;  1J6V A;  5IOS A;  5FJ8 K;  2PPB A;  3HXA A;  5FLM K;  4GTC A;  2JA8 C;  1TWG A;  3AD8 C;  4XCH A;  3I4M K;  4KB2 A;  1ZBS A;  4GTB A;  4KC6 A;  3CQZ A;  4OIP A;  1I6H C;  2JA6 C;  2PA8 L;  2R93 C;  3S15 K;  1O2F B;  4J3N A;  3S2H K;  1JQW A;  1IS1 A;  4G0V A;  2XCR B;  1K83 A;  1EFW A;  1DCP A;  1XXB A;  3M3Y C;  1Y1V C;  3HOX K;  5C4X C;  2JA5 C;  2P5M A;  1TWF A;  4P9S A;  2CFA A;  2KWA A;  5IP7 C;  1R9T C;  4Y52 C;  1B4B A;  3WOD A;  4C2M C;  3S1N K;  1IW7 A;  3FHZ A;  3HOW C;  1TWH A;  4MEX A;  2YU9 C;  4KAR A;  3H0G C;  3GTL C;  2A6H A;  5L46 A;  4A3I K;  3S14 K;  3TFJ A;  3S1M C;  4BY1 C;  1WSV A;  2B63 K;  1O26 A;  5IYB C;  1F7V A;  2R92 A;  2NVT C;  2R7Z C;  5IYC C;  4KMU A;  1TWC C;  5CHP A;  1XZP A;  2O5I A;  5C4J K;  1X31 C;  2VUM A;  4BY7 C;  5M5Y K;  5JVO A;  3S17 C;  1TWA A;  2GAG C;  1USM A;  4A3M K;  2FQO A;  1UV7 A;  1ZYR A;  3RZD C;  2PMZ L;  3S15 C;  4C3I K;  1WQH A;  5TMC A;  3A8J A;  1IQ0 A;  3PO2 K;  2NVY C;  2NVQ C;  2XCO A;  3HOV C;  3S16 C;  3GTJ A;  3S2D K;  4FM9 A;  4PAB A;  4RMF A;  1HI9 A;  1I6V A;  3FOE A;  5M5X K;  3T02 A;  4GT9 A;  4G7Z A;  2RGR A;  2W7V A;  4MQ9 A;  4KB4 A;  1USO A;  4JK1 A;  1IL2 A;  4YFX A;  3GTK A;  1SFO A;  1B4A A;  5C44 K;  4LQY A;  4A3J K;  2NVX A;  5JFE A;  2JA7 K;  4GFQ A;  3GTM C;  4A3B K;  1JOE A;  3M4O K;  3TFH A;  1O2B A;  1O24 A;  4BBS C;  1I3Q K;  3SZY A;  1XPP A;  1O29 A;  4GTE A;  3I4N C;  1J98 A;  5TMF A;  1C0A A;  4FZB A;  4BLB A;  1TWG K;  3HKZ D;  1WOS A;  3LAP A;  2JA6 A;  1EH1 A;  3CQZ K;  2WB1 D;  4Y7N C;  4M1X A;  2GSU A;  4BXX C;  3GTO A;  4A3D K;  1ZVU A;  4C3H K;  3FKI C;  1BGW A;  3K7A C;  4AYB D;  3S1Q K;  1Y1V A;  4A3G K;  2JA5 A;  3AD7 C;  1GE9 A;  3H3V D;  2E2H C;  1Y1W C;  3GTQ C;  3ORE A;  1I50 K;  4GTA A;  3ADA C;  3RZO K;  1TWF K;  1R9T A;  3TTG A;  4O2D A;  4OIN A;  3HOZ K;  3GTO C;  2WAQ D;  3NUH A;  3HOY C;  5C44 C;  3GEI A;  4A3J C;  2YU9 A;  1VJE A;  3H0G A;  3GTL A;  1TWH K;  5IYD C;  1VGX A;  1ZXO A;  2A6E A;  2ZFZ A;  2R7Z A;  1WOP A;  4GZY A;  2R92 K;  5HL8 A;  1I3Q C;  1TWC A;  4KAS A;  5IP9 C;  2PHC B;  1F9N A;  4LR2 A;  4ILD A;  4C3J K;  1XZQ A;  4ZH4 A;  4NOI A;  5CJ9 A;  3GTG K;  4G7H A;  4A3F K;  4XSX A;  4QIW L;  2E2J C;  2V6T A;  3GTP K;  1ZQ1 C;  2E2I C;  4A3E K;  3HOU K;  3GEH A;  3BUE A;  2XCQ A;  3N0B A;  4A3K K;  3FOF A;  1J6W A;  4WJ4 A;  3PO3 K;  2NVY A;  1O28 A;  4C3H C;  5FLM C;  4A3L K;  1L0W A;  3S1Q C;  2V6S A;  4LK0 A;  3GTJ K;  3I4M C;  1WQG A;  4A93 K;  4LK1 A;  3RZO C;  5IOQ A;  1KQ4 A;  3S2H C;  5EGE A;  2ZUF A;  1XXC A;  4QJV B;  4P5B A;  4KMD A;  3HOX C;  3G4C A;  2RH6 A;  3LAJ A;  1WQF A;  4GTD A;  4A3C K;  1PJ6 A;  2Y0S L;  3GTM A;  3S1N C;  2BE5 A;  4C3J C;  4DDQ A;  4BBR K;  3GTG C;  4A3I C;  3S14 C;  4KAW X;  5C3E K;  4KAT A;  2B63 C;  3GTP C;  2Y3P A;  4MEY A;  4A3E C;  3HOU C;  1F93 A;  1O25 A;  4A3K C;  2CW0 A;  3T01 A;  1SMY A;  5C4J C;  4X6A K;  2JA6 K;  1DCO A;  4WJ3 M;  2FQT A;  1IE0 A;  2JH3 A;  2R93 K;  3L4J A;  2ZUE A;  3G4A A;  4KMH A;  4Q5S A;  1WCM K;  4XSZ A;  4A3M C;  3SZZ A;  3FKI A;  3ERE D;  4LJZ A;  4PAA A;  1Y1V K;  3M3Y K;  3GTQ A;  4C3I C;  2E2H A;  1Y1W A;  2JA5 K;  3Q3Q A;  3PO2 C;  1BS2 A;  4YFN A;  5IP7 K;  3S2D C;  4LLG A;  4KM8 A;  3OPF A;  4KM9 A;  2WB1 L;  3HOW K;  4A3C C;  1K83 K;  2V6U A;  2YU9 K;  2JA7 A;  3H0G K;  3GTL K;  3V4G A;  3S1M K;  4BY1 K;  4AYB L;  5IYB K;  1I3Q A;  1O2A A;  2NVT K;  3GEE A;  1YNN A;  2R7Z K;  5IYC K;  3N3Y A;  3AQP A;  5E68 A;  4BY7 K;  2PA8 D;  1EI6 A;  2A68 A;  2JA7 C;  4KDD A;  1WIH A;  3S17 K;  4A3B C;  2WAQ L;  4LOW A;  3M4O C;  1VRQ C;  2E2I A;  1WSR A;  2P8T A;  4X6A C;  4OIR A;  2CFA B;  3RZD K;  2GSN A;  1WCM C;  1WOR A;  3AQO A;  4P5A A;  1YCL A;  2NVY K;  2NVQ K;  3N0C A;  2VUM K;  3HOV K;  3S16 K;  1TWG C;  1YX2 A;  1XZQ B;  1TWA K;  1WOO A; 
#chains in the Genus database with same CATH homology
 1BDF A;  5C3E C;  3CQZ C;  4QJV B;  2JA7 K;  1HQM A;  5FJ8 K;  3GTM C;  2PPB A;  4A3B K;  3HOX C;  3M4O K;  5FLM K;  2JA8 C;  4BBS C;  3I4M K;  4A3D C;  1I3Q K;  4A3C K;  1XPP A;  2O5J A;  4QIW D;  2Y0S L;  4OIP A;  1I6H C;  2JA6 C;  1YNJ A;  2PA8 L;  3I4N C;  1K83 C;  4A3G C;  3S1N C;  2R93 C;  2BE5 A;  3S15 K;  5TMF A;  4Q4Z A;  3S2H K;  1I50 C;  1TWG K;  1TWF C;  3HKZ D;  2A69 A;  4BBR K;  3GTG C;  4A3I C;  4KN7 A;  3S14 C;  5C3E K;  3CQZ K;  2WB1 D;  3HOZ C;  3GTM K;  2B63 C;  3GTP C;  1Y1V C;  3M3Y C;  3HOX K;  4Y7N C;  5C4X C;  4MEY A;  2JA5 C;  4G7O A;  4A3E C;  3HOU C;  4BXX C;  4A3K C;  4BBS K;  2CW0 A;  4A3D K;  4C3H K;  1TWH C;  3FKI C;  4KN4 A;  2PMZ D;  1SFO K;  3GTK K;  1SMY A;  5IP7 C;  1R9T C;  4Y52 C;  5C4J C;  4X6A K;  3K7A C;  4AYB D;  2JA6 K;  3WOD A;  3I4N K;  3S1Q K;  4A3G K;  2NVX K;  3S1N K;  1IW7 A;  2R93 K;  3S1R C;  5D4D A;  3H3V D;  2E2H C;  1Y1W C;  3GTQ C;  2R92 C;  3HOW C;  1WCM K;  1I50 K;  4XSZ A;  4Q5S A;  3RZO K;  1TWF K;  4A3M C;  4MEX A;  2YU9 C;  3H0G C;  5M3M K;  2A6H A;  3GTL C;  4QJV A;  4LJZ A;  4A3I K;  3S14 K;  4OIN A;  3S1M C;  3HOZ K;  4BY1 C;  3GTO C;  2VUM C;  2B63 K;  3M3Y K;  1Y1V K;  2WAQ D;  3S1R K;  4Y7N K;  5IYB C;  5C44 C;  4A3F C;  2JA5 K;  3HOY C;  4A3J C;  2NVT C;  2R7Z C;  4A93 C;  1TWA C;  2Y0S D;  5IYC C;  3PO2 C;  4BXX K;  4KMU A;  1TWC C;  3DXJ A;  4YFN A;  1TWH K;  3FKI K;  5IYD C;  2JA8 K;  5IP7 K;  2O5I A;  3S2D C;  4LLG A;  5C4J K;  3K7A K;  4BY7 C;  3EQL A;  2A6E A;  5M5Y K;  2WB1 L;  3PO3 C;  3HOW K;  3S17 C;  2E2H K;  1Y1W K;  3GTQ K;  2R92 K;  4GZY A;  1I6H K;  1I3Q C;  4A3C C;  1K83 K;  4A3M K;  4A3L C;  5IP9 C;  2YU9 K;  1ZYR A;  3H0G K;  3GTL K;  3GTJ C;  4C3J K;  3RZD C;  2PMZ L;  4ZH4 A;  3S1M K;  3S15 C;  4BY1 K;  4NOI A;  3GTO K;  4AYB L;  3GTG K;  4C3I K;  4G7H A;  5IYB K;  4A3F K;  5TMC A;  3HOY K;  4QIW L;  4XSX A;  2NVT K;  2E2J C;  1YNN A;  2R7Z K;  5IYC K;  3PO2 K;  5M3F K;  2NVY C;  2NVQ C;  3GTP K;  5C4X K;  3HOV C;  3S16 C;  5IYD K;  2E2I C;  4A3E K;  3HOU K;  3S2D K;  4XLN A;  4A3K K;  4BY7 K;  2PA8 D;  2A68 A;  3HKZ L;  1R9T K;  2JA7 C;  3PO3 K;  3S17 K;  4Y52 K;  4A3B C;  2WAQ L;  3M4O C;  5FLM C;  4A3L K;  4C2M K;  1I6V A;  1SFO C;  3GTK C;  5IP9 K;  5M5X K;  4X6A C;  3S1Q C;  4LK0 A;  4OIO A;  3GTJ K;  4G7Z A;  3I4M C;  4MQ9 A;  3RZD K;  2NVX C;  4OIR A;  4YFK A;  4OIQ A;  4A93 K;  1WCM C;  4XLP A;  4LK1 A;  4JK1 A;  3RZO C;  5M5W K;  4YFX A;  2E2J K;  4YG2 A;  2NVY K;  2NVQ K;  2VUM K;  3S2H C;  3HOV K;  3S16 K;  5C44 K;  1TWG C;  2E2I K;  4A3J K;  1TWA K;  3H3V L;  4BBR C;  1TWC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...