5IP9K

Structure of rna polymerase ii-tfiif complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5ip9K00
2NVYK 1I6VA 4OINA 3M4OK 4LLGA 4KN4A 4YFKA 3HKZL 4XSXA 1SFOK 2YU9C 3I4NC 4LK0A 3H3VL 4BXXC 4A3CC 3HKZD 4A3MC 5IP9C 3GTQK 3H3VD 4GZYA 3S15C 3M3YK 4A3EC 4MQ9A 3HOVK 3PO2C 4LJZA 5M5YK 3HOYK 3GTLC 1TWAC 4OIPA 4QJVB 4YFXA 3S1QC 5FLMC 1TWHC 5C4XC 1I6HC 4C3JK 1XPPA 3HOZK 4BBSK 2E2IC 1Y1WC 3GTGC 4Y52C 3GTMC 4A3EK 1Y1VK 4A3FK 1HQMA 4AYBD 3HOUC 5M3FK 3S16K 5IYBC 4QJVA 4Y7NK 3PO3C 1I3QC 2JA5C 2R92C 4A93C 2JA6K 4BY1C 4MEXA 4BBRC 1TWGC 1I50K 5C4XK 2JA8C 4OIRA 3S2HK 2R93K 5IYDC 4QIWL 2NVTC 3GTKK 4G7ZA 3GTOC 1TWFC 5IYCC 3WODA 5IP7K 3RZDC 2E2JC 2NVQC 2VUMC 4A3IC 4QIWD 3HOWK 2WAQL 2NVXC 3S14K 4A3DK 2A68A 4YG2A 4ZH4A 1WCMK 4C3IK 2O5IA 3GTJC 3EQLA 3S17C 1TWCC 2WAQD 4XSZA 5C44C 4BBRK 4BY1K 3H0GC 4MEYA 3RZOC 4A3KC 2YU9K 2NVQK 2VUMK 3I4NK 1BDFA 2A69A 3S2DC 4BXXK 4A3CK 4A3MK 5IP9K 3DXJA 3FKIC 1SMYA 4OIOA 3S15K 2BE5A 3PO2K 5M5XK 4A3BC 5C44K 3S1MC 3GTLK 1ZYRA 1TWAK 3K7AC 2B63C 3S1NC 3S1QK 3I4MC 5FLMK 1TWHK 4A3KK 1I6HK 3HOXC 5C4JC 1R9TC 2E2HC 4BY7C 4A3JC 4X6AC 4A3LC 2E2IK 1K83C 1Y1WK 3GTGK 3GTMK 3CQZC 3S1RC 4KMUA 4Y52K 2JA7C 3GTPC 3HOUK 2NVYC 5TMFA 5IYBK 3M4OC 3PO3K 1I3QK 2JA5K 2R92K 2A6HA 3S1NK 4A93K 1TWGK 2JA8K 4JK1A 1SFOC 5IYDK 2PMZL 4OIQA 2NVTK 3GTOK 1TWFK 5IYCK 3RZDK 2E2JK 4Q4ZA 4A3IK 2PMZD 4XLNA 3GTQC 2NVXK 2JA7K 3M3YC 4G7OA 3HOVC 3S17K 3GTJK 4YFNA 1TWCK 3HOYC 1YNJA 4C2MK 4XLPA 3H0GK 4A3GC 5TMCA 5D4DA 1YNNA 2R7ZC 3RZOK 2CW0A 1IW7A 3HOZC 4BBSC 5M3MK 2WB1L 2PPBA 3S2DK 4G7HA 2PA8L 5C3EC 1Y1VC 3FKIK 4NOIA 4A3FC 2WB1D 3S16C 2PA8D 4Q5SA 5FJ8K 4Y7NC 4A3BK 3S1MK 2JA6C 2R93C 3K7AK 2B63K 1I50C 5M5WK 4A3GK 3S2HC 2R7ZK 3I4MK 2A6EA 3GTKC 3HOXK 5C4JK 1R9TK 2E2HK 2Y0SL 4KN7A 5IP7C 4BY7K 4AYBL 4A3JK 4X6AK 5C3EK 3HOWC 3S14C 1K83K 4A3LK 2O5JA 2Y0SD 4A3DC 3CQZK 3S1RK 1WCMC 4C3HK 3GTPK 4LK1A
chains in the Genus database with same CATH superfamily
1I6VA 4LLGA 1B4AA 4RMFA 4XSXA 1BJTA 3GDZA 1DCPA 2CFAB 3PO2C 5IORA 2V6TA 5EGHA 5M5YK 3HOYK 1TWAC 4QJVB 4YFXA 1TWHC 5C4XC 1I6HC 4C3JK 1XPPA 4M1XA 4G0UA 4BBSK 1F7UA 3GTMC 4FZBA 4A3EK 2JA7A 3GTPA 4AYBD 1O2FB 3HOUC 3S16K 3PO3C 1I3QC 4BY1C 3TFHA 3L4KA 4QIWL 1L0WA 5IYCC 3WODA 3GIRA 5IP7K 2NVQC 3HOWK 3S14K 4A3DK 4C3IK 4YG2A 4ZH4A 1WCMK 3GTJC 2RGRA 2WAQD 1J98A 5C44C 4GTDA 3H0GC 4MEYA 2R7ZA 1WQFA 3S2DC 4BXXK 1ZQ1C 1Y1VA 5IP9K 3FOEA 3ADAC 3S1MC 2R93A 3K7AC 4C45A 3T02A 3S1QK 3AQPA 2RH6A 5C4JC 2GSNA 2XCQA 4KASA 2V6SA 1XXAA 4A3LC 1K83C 3GTGK 4Y52K 2JA5K 3TFIA 4A93K 1TWGK 4JK1A 2PMZL 4Q4ZA 1J6WA 2V6UA 4XLNA 2NVXK 1F93A 1J6VA 4YFNA 4KM8A 3HOYC 1TWAA 4KARA 1TWHA 1XXCA 4A3GC 5TMCA 1PJ6A 4BBSC 5M3MK 2PPBA 3GTMA 1INNA 5C3EC 3S16C 1I3QA 4A3BK 1BS2A 2GAHC 3HOXK 5IP7C 4BY7K 4AYBL 3N0BA 3HOWC 3S14C 2O5JA 1WSRA 2XCOA 4A3DC 3S1RK 2GSOA 1WCMC 2GSUA 4FM9A 3GTJA 1O28A 4KAWX 1WQHA 4G0WA 4OINA 3H0GA 1XXBA 4KATA 4YFKA 5JVOA 3HKZL 1SFOK 3HXAA 3H3VL 5E68A 4J3NA 4BXXC 5IP9C 4MQ9A 5TJ3A 1C0AA 4LJZA 3CAGA 4DDQA 3S1QC 4KMAA 1K83A 3GTGC 4Y52C 4LR2A 3Q3QA 5M3FK 4GTLA 2JA5C 4A93C 1F7VA 4BBRC 1TWGC 1EQRA 1I50K 3S2HK 5L46A 1IQ0A 3GTKK 4G7ZA 3GEHA 1EFWA 2NVXC 4BKWA 1EK8A 1GE9A 4KC6A 3SZYA 4A3KC 2VUMK 2A69A 3FHZA 4A3CK 4PABA 4A3MK 1X31C 1JOEA 4OIOA 3S15K 2GAGC 3OREA 4A3BC 3MMLB 3HOXC 2ZUFA 4BY7C 1V5VA 1PJ7A 3JSTA 1Y1WK 1AB4A 1WCMA 3S1RC 1IS1A 3GEIA 5TMFA 2R92K 2A6HA 3S1NK 1XZPA 5EGEA 1SFOC 4GTBA 3GTOK 2E2JK 1J6XA 4A3IK 2JA7K 3S17K 1TWCK 4C2MK 3OEPA 5D4DA 1YNNA 4KM9A 3GEEA 3GTGA 4G7HA 3BP3A 3FKIK 2FQTA 1JVIA 2WB1D 2PA8D 3LAPA 1ZVUA 4KB2A 4Q5SA 2JA5A 1TWGA 4KMDA 2B63K 1I50C 3S2HC 2R7ZK 3I4MK 3G4AA 3GTKC 1R9TK 2E2HK 2Y0SL 4A3JK 4X6AK 2NVXA 3CQZK 2P5MA 2NVYK 2KWAA 4LQYA 4LK0A 1O27A 4C3JC 4A3CC 4A3MC 3GTQK 3S15C 4A3EC 1XZQB 1PJ5A 4WJ3M 5IOSA 3A8JA 1EI6A 2EBBA 3ERED 1Y1WC 1JQWA 3OPFA 1HQMA 4C3IC 3FOFA 2R92C 1IBAA 2JA6K 4MEXA 5C4XK 1SFOA 1VJEA 3GTOC 1ZBSA 2E2JC 1DCHA 1HI9A 4A3IC 4QIWD 2WAQL 1EH1A 1BGWA 1O2AA 2A68A 2D6FC 3S17C 1TWCC 4GTCA 4XSZA 4BY1K 4C2MC 2ZUEA 1DCOA 1VLOA 2YU9K 2NVQK 3I4NK 1BDFA 1WOSA 4G0VA 3DXJA 3FKIC 1XZQA 5C44K 3TTGA 3GTLK 1ZYRA 1I50A 2B63C 1VRQC 5IOTA 3I4MC 3GTKA 5FLMK 1R9TC 1RU0A 1XZPB 2E2HC 4A3JC 4X6AC 2E2IK 1F9NA 3CQZC 1O26A 2NVYC 5IYBK 3V4GA 4GTEA 2JA8K 3BUEA 1YCLA 5IYDK 2NVTK 1TWFK 3RZDK 1IE0A 2PMZD 5IOQA 3GTQC 4G7OA 3VA7A 1B4BA 4XLPA 4GTFA 1O29A 3RZOK 1IW7A 4WJ4A 1Y1WA 5HL8A 4BLAA 4NOIA 3T01A 1UV7A 2ZFZA 5FJ8K 1WOPA 2R92A 2JA6C 3IPJA 4A3GK 3L4JA 3GTOA 4P5AA 3LPXA 2XCRB 3AD7C 4KN7A 5JFEA 1KQ4A 5C3EK 4GFQA 4C3HK 1TWCA 3GTPK 3M4OK 4KN4A 4KB4A 2YU9C 3I4NC 1G51A 2PHCB 3HKZD 3FKIA 3H3VD 3GSIA 4GZYA 3M3YK 3HOVK 2W7VA 2B63A 3GTLC 4OIPA 1WIHA 4O2DA 5FLMC 4AH6A 1R9TA 2E2HA 4KMHA 3G4CA 3HOZK 2E2IC 2CFAA 3CQZA 4P9SA 1Y1VK 4A3FK 1VGXA 2NVYA 5IYBC 4QJVA 4Y7NK 4GTAA 4GT9A 3SZZA 2R93K 2JA8C 4OIRA 5IYDC 4PAAA 1ZXOA 2NVTC 3NUHA 1TWFC 3RZDC 2VUMC 3GTQA 3AD9C 3N0CA 5CJ9A 1O24A 2O5IA 3EQLA 1WOOA 3AQOA 4BBRK 4LOWA 3RZOC 3N3YA 1SMYA 2BE5A 3PO2K 5M5XK 2JA6A 1TWAK 2Y3PA 4WILA 3S1NC 2FQOA 1TWHK 1USOA 4A3KK 1I6HK 4XCHA 4P5BA 3GTMK 1WSVA 4KMUA 4ILDA 4C3HC 2JA7C 3GTPC 3HOUK 3M4OC 1DD5A 3PO3K 1I3QK 3BP8C 4KDDA 2YU9A 3QX3A 4BLBA 1O25A 1VH2A 3AD8C 4OIQA 5IYCK 1YX2A 3A8KA 3M3YC 3TFJA 3HOVC 3GTJK 3GTLA 1YNJA 3LAJA 2JH3A 3H0GK 3S0XA 1WORA 2R7ZC 2CW0A 3HOZC 2E2IA 2WB1L 3S2DK 2PA8L 3AH5A 1Y1VC 4A3FC 1ISEA 4Y7NC 5CHPA 1USMA 3S1MK 2R93C 3K7AK 1WQGA 5M5WK 2A6EA 1TWFA 5C4JK 2VUMA 3A8IA 3T00A 4A3LK 1K83K 2Y0SD 1IL2A 1O2BA 2P8TA 4LK1A
chains in the Genus database with same CATH topology
2NVYK 1I6VA 4OINA 3M4OK 4LLGA 4KN4A 4YFKA 3HKZL 4XSXA 1SFOK 2YU9C 3I4NC 4LK0A 3H3VL 4BXXC 4A3CC 3HKZD 4A3MC 5IP9C 3GTQK 3H3VD 4GZYA 3S15C 3M3YK 4A3EC 4MQ9A 3HOVK 3PO2C 4LJZA 5M5YK 3HOYK 3GTLC 1TWAC 4OIPA 4QJVB 4YFXA 3S1QC 5FLMC 1TWHC 5C4XC 1I6HC 4C3JK 1XPPA 3HOZK 4BBSK 2E2IC 1Y1WC 3GTGC 4Y52C 3GTMC 4A3EK 1Y1VK 4A3FK 1HQMA 4AYBD 3HOUC 5M3FK 3S16K 5IYBC 4QJVA 4Y7NK 3PO3C 1I3QC 2JA5C 2R92C 4A93C 2JA6K 4BY1C 4MEXA 4BBRC 1TWGC 1I50K 5C4XK 2JA8C 4OIRA 3S2HK 2R93K 5IYDC 4QIWL 2NVTC 3GTKK 4G7ZA 3GTOC 1TWFC 5IYCC 3WODA 5IP7K 3RZDC 2E2JC 2NVQC 2VUMC 4A3IC 4QIWD 3HOWK 2WAQL 2NVXC 3S14K 4A3DK 2A68A 4YG2A 4ZH4A 1WCMK 4C3IK 2O5IA 3GTJC 3EQLA 3S17C 1TWCC 2WAQD 4XSZA 5C44C 4BBRK 4BY1K 3H0GC 4MEYA 3RZOC 4A3KC 2YU9K 2NVQK 2VUMK 3I4NK 1BDFA 2A69A 3S2DC 4BXXK 4A3CK 4A3MK 5IP9K 3DXJA 3FKIC 1SMYA 4OIOA 3S15K 2BE5A 3PO2K 5M5XK 4A3BC 5C44K 3S1MC 3GTLK 1ZYRA 1TWAK 3K7AC 2B63C 3S1NC 3S1QK 3I4MC 5FLMK 1TWHK 4A3KK 1I6HK 3HOXC 5C4JC 1R9TC 2E2HC 4BY7C 4A3JC 4X6AC 4A3LC 2E2IK 1K83C 1Y1WK 3GTGK 3GTMK 3CQZC 3S1RC 4KMUA 4Y52K 2JA7C 3GTPC 3HOUK 2NVYC 5TMFA 5IYBK 3M4OC 3PO3K 1I3QK 2JA5K 2R92K 2A6HA 3S1NK 4A93K 1TWGK 2JA8K 4JK1A 1SFOC 5IYDK 2PMZL 4OIQA 2NVTK 3GTOK 1TWFK 5IYCK 3RZDK 2E2JK 4Q4ZA 4A3IK 2PMZD 4XLNA 3GTQC 2NVXK 2JA7K 3M3YC 4G7OA 3HOVC 3S17K 3GTJK 4YFNA 1TWCK 3HOYC 1YNJA 4C2MK 4XLPA 3H0GK 4A3GC 5TMCA 5D4DA 1YNNA 2R7ZC 3RZOK 2CW0A 1IW7A 3HOZC 4BBSC 5M3MK 2WB1L 2PPBA 3S2DK 4G7HA 2PA8L 5C3EC 1Y1VC 3FKIK 4NOIA 4A3FC 2WB1D 3S16C 2PA8D 4Q5SA 5FJ8K 4Y7NC 4A3BK 3S1MK 2JA6C 2R93C 3K7AK 2B63K 1I50C 5M5WK 4A3GK 3S2HC 2R7ZK 3I4MK 2A6EA 3GTKC 3HOXK 5C4JK 1R9TK 2E2HK 2Y0SL 4KN7A 5IP7C 4BY7K 4AYBL 4A3JK 4X6AK 5C3EK 3HOWC 3S14C 1K83K 4A3LK 2O5JA 2Y0SD 4A3DC 3CQZK 3S1RK 1WCMC 4C3HK 3GTPK 4LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY K;  1I6V A;  4OIN A;  3M4O K;  4LLG A;  4KN4 A;  4YFK A;  3HKZ L;  4XSX A;  1SFO K;  2YU9 C;  3I4N C;  4LK0 A;  3H3V L;  4BXX C;  4A3C C;  3HKZ D;  4A3M C;  5IP9 C;  3GTQ K;  3H3V D;  4GZY A;  3S15 C;  3M3Y K;  4A3E C;  4MQ9 A;  3HOV K;  3PO2 C;  4LJZ A;  5M5Y K;  3HOY K;  3GTL C;  1TWA C;  4OIP A;  4QJV B;  4YFX A;  3S1Q C;  5FLM C;  1TWH C;  5C4X C;  1I6H C;  4C3J K;  1XPP A;  3HOZ K;  4BBS K;  2E2I C;  1Y1W C;  3GTG C;  4Y52 C;  3GTM C;  4A3E K;  1Y1V K;  4A3F K;  1HQM A;  4AYB D;  3HOU C;  5M3F K;  3S16 K;  5IYB C;  4QJV A;  4Y7N K;  3PO3 C;  1I3Q C;  2JA5 C;  2R92 C;  4A93 C;  2JA6 K;  4BY1 C;  4MEX A;  4BBR C;  1TWG C;  1I50 K;  5C4X K;  2JA8 C;  4OIR A;  3S2H K;  2R93 K;  5IYD C;  4QIW L;  2NVT C;  3GTK K;  4G7Z A;  3GTO C;  1TWF C;  5IYC C;  3WOD A;  5IP7 K;  3RZD C;  2E2J C;  2NVQ C;  2VUM C;  4A3I C;  4QIW D;  3HOW K;  2WAQ L;  2NVX C;  3S14 K;  4A3D K;  2A68 A;  4YG2 A;  4ZH4 A;  1WCM K;  4C3I K;  2O5I A;  3GTJ C;  3EQL A;  3S17 C;  1TWC C;  2WAQ D;  4XSZ A;  5C44 C;  4BBR K;  4BY1 K;  3H0G C;  4MEY A;  3RZO C;  4A3K C;  2YU9 K;  2NVQ K;  2VUM K;  3I4N K;  1BDF A;  2A69 A;  3S2D C;  4BXX K;  4A3C K;  4A3M K;  5IP9 K;  3DXJ A;  3FKI C;  1SMY A;  4OIO A;  3S15 K;  2BE5 A;  3PO2 K;  5M5X K;  4A3B C;  5C44 K;  3S1M C;  3GTL K;  1ZYR A;  1TWA K;  3K7A C;  2B63 C;  3S1N C;  3S1Q K;  3I4M C;  5FLM K;  1TWH K;  4A3K K;  1I6H K;  3HOX C;  5C4J C;  1R9T C;  2E2H C;  4BY7 C;  4A3J C;  4X6A C;  4A3L C;  2E2I K;  1K83 C;  1Y1W K;  3GTG K;  3GTM K;  3CQZ C;  3S1R C;  4KMU A;  4Y52 K;  2JA7 C;  3GTP C;  3HOU K;  2NVY C;  5TMF A;  5IYB K;  3M4O C;  3PO3 K;  1I3Q K;  2JA5 K;  2R92 K;  2A6H A;  3S1N K;  4A93 K;  1TWG K;  2JA8 K;  4JK1 A;  1SFO C;  5IYD K;  2PMZ L;  4OIQ A;  2NVT K;  3GTO K;  1TWF K;  5IYC K;  3RZD K;  2E2J K;  4Q4Z A;  4A3I K;  2PMZ D;  4XLN A;  3GTQ C;  2NVX K;  2JA7 K;  3M3Y C;  4G7O A;  3HOV C;  3S17 K;  3GTJ K;  4YFN A;  1TWC K;  3HOY C;  1YNJ A;  4C2M K;  4XLP A;  3H0G K;  4A3G C;  5TMC A;  5D4D A;  1YNN A;  2R7Z C;  3RZO K;  2CW0 A;  1IW7 A;  3HOZ C;  4BBS C;  5M3M K;  2WB1 L;  2PPB A;  3S2D K;  4G7H A;  2PA8 L;  5C3E C;  1Y1V C;  3FKI K;  4NOI A;  4A3F C;  2WB1 D;  3S16 C;  2PA8 D;  4Q5S A;  5FJ8 K;  4Y7N C;  4A3B K;  3S1M K;  2JA6 C;  2R93 C;  3K7A K;  2B63 K;  1I50 C;  5M5W K;  4A3G K;  3S2H C;  2R7Z K;  3I4M K;  2A6E A;  3GTK C;  3HOX K;  5C4J K;  1R9T K;  2E2H K;  2Y0S L;  4KN7 A;  5IP7 C;  4BY7 K;  4AYB L;  4A3J K;  4X6A K;  5C3E K;  3HOW C;  3S14 C;  1K83 K;  4A3L K;  2O5J A;  2Y0S D;  4A3D C;  3CQZ K;  3S1R K;  1WCM C;  4C3H K;  3GTP K;  4LK1 A; 
#chains in the Genus database with same CATH topology
 1I6V A;  4LLG A;  1B4A A;  4RMF A;  4XSX A;  1BJT A;  3GDZ A;  1DCP A;  2CFA B;  3PO2 C;  5IOR A;  2V6T A;  5EGH A;  5M5Y K;  3HOY K;  1TWA C;  4QJV B;  4YFX A;  1TWH C;  5C4X C;  1I6H C;  4C3J K;  1XPP A;  4M1X A;  4G0U A;  4BBS K;  1F7U A;  3GTM C;  4FZB A;  4A3E K;  2JA7 A;  3GTP A;  4AYB D;  1O2F B;  3HOU C;  3S16 K;  3PO3 C;  1I3Q C;  4BY1 C;  3TFH A;  3L4K A;  4QIW L;  1L0W A;  5IYC C;  3WOD A;  3GIR A;  5IP7 K;  2NVQ C;  3HOW K;  3S14 K;  4A3D K;  4C3I K;  4YG2 A;  4ZH4 A;  1WCM K;  3GTJ C;  2RGR A;  2WAQ D;  1J98 A;  5C44 C;  4GTD A;  3H0G C;  4MEY A;  2R7Z A;  1WQF A;  3S2D C;  4BXX K;  1ZQ1 C;  1Y1V A;  5IP9 K;  3FOE A;  3ADA C;  3S1M C;  2R93 A;  3K7A C;  4C45 A;  3T02 A;  3S1Q K;  3AQP A;  2RH6 A;  5C4J C;  2GSN A;  2XCQ A;  4KAS A;  2V6S A;  1XXA A;  4A3L C;  1K83 C;  3GTG K;  4Y52 K;  2JA5 K;  3TFI A;  4A93 K;  1TWG K;  4JK1 A;  2PMZ L;  4Q4Z A;  1J6W A;  2V6U A;  4XLN A;  2NVX K;  1F93 A;  1J6V A;  4YFN A;  4KM8 A;  3HOY C;  1TWA A;  4KAR A;  1TWH A;  1XXC A;  4A3G C;  5TMC A;  1PJ6 A;  4BBS C;  5M3M K;  2PPB A;  3GTM A;  1INN A;  5C3E C;  3S16 C;  1I3Q A;  4A3B K;  1BS2 A;  2GAH C;  3HOX K;  5IP7 C;  4BY7 K;  4AYB L;  3N0B A;  3HOW C;  3S14 C;  2O5J A;  1WSR A;  2XCO A;  4A3D C;  3S1R K;  2GSO A;  1WCM C;  2GSU A;  4FM9 A;  3GTJ A;  1O28 A;  4KAW X;  1WQH A;  4G0W A;  4OIN A;  3H0G A;  1XXB A;  4KAT A;  4YFK A;  5JVO A;  3HKZ L;  1SFO K;  3HXA A;  3H3V L;  5E68 A;  4J3N A;  4BXX C;  5IP9 C;  4MQ9 A;  5TJ3 A;  1C0A A;  4LJZ A;  3CAG A;  4DDQ A;  3S1Q C;  4KMA A;  1K83 A;  3GTG C;  4Y52 C;  4LR2 A;  3Q3Q A;  5M3F K;  4GTL A;  2JA5 C;  4A93 C;  1F7V A;  4BBR C;  1TWG C;  1EQR A;  1I50 K;  3S2H K;  5L46 A;  1IQ0 A;  3GTK K;  4G7Z A;  3GEH A;  1EFW A;  2NVX C;  4BKW A;  1EK8 A;  1GE9 A;  4KC6 A;  3SZY A;  4A3K C;  2VUM K;  2A69 A;  3FHZ A;  4A3C K;  4PAB A;  4A3M K;  1X31 C;  1JOE A;  4OIO A;  3S15 K;  2GAG C;  3ORE A;  4A3B C;  3MML B;  3HOX C;  2ZUF A;  4BY7 C;  1V5V A;  1PJ7 A;  3JST A;  1Y1W K;  1AB4 A;  1WCM A;  3S1R C;  1IS1 A;  3GEI A;  5TMF A;  2R92 K;  2A6H A;  3S1N K;  1XZP A;  5EGE A;  1SFO C;  4GTB A;  3GTO K;  2E2J K;  1J6X A;  4A3I K;  2JA7 K;  3S17 K;  1TWC K;  4C2M K;  3OEP A;  5D4D A;  1YNN A;  4KM9 A;  3GEE A;  3GTG A;  4G7H A;  3BP3 A;  3FKI K;  2FQT A;  1JVI A;  2WB1 D;  2PA8 D;  3LAP A;  1ZVU A;  4KB2 A;  4Q5S A;  2JA5 A;  1TWG A;  4KMD A;  2B63 K;  1I50 C;  3S2H C;  2R7Z K;  3I4M K;  3G4A A;  3GTK C;  1R9T K;  2E2H K;  2Y0S L;  4A3J K;  4X6A K;  2NVX A;  3CQZ K;  2P5M A;  2NVY K;  2KWA A;  4LQY A;  4LK0 A;  1O27 A;  4C3J C;  4A3C C;  4A3M C;  3GTQ K;  3S15 C;  4A3E C;  1XZQ B;  1PJ5 A;  4WJ3 M;  5IOS A;  3A8J A;  1EI6 A;  2EBB A;  3ERE D;  1Y1W C;  1JQW A;  3OPF A;  1HQM A;  4C3I C;  3FOF A;  2R92 C;  1IBA A;  2JA6 K;  4MEX A;  5C4X K;  1SFO A;  1VJE A;  3GTO C;  1ZBS A;  2E2J C;  1DCH A;  1HI9 A;  4A3I C;  4QIW D;  2WAQ L;  1EH1 A;  1BGW A;  1O2A A;  2A68 A;  2D6F C;  3S17 C;  1TWC C;  4GTC A;  4XSZ A;  4BY1 K;  4C2M C;  2ZUE A;  1DCO A;  1VLO A;  2YU9 K;  2NVQ K;  3I4N K;  1BDF A;  1WOS A;  4G0V A;  3DXJ A;  3FKI C;  1XZQ A;  5C44 K;  3TTG A;  3GTL K;  1ZYR A;  1I50 A;  2B63 C;  1VRQ C;  5IOT A;  3I4M C;  3GTK A;  5FLM K;  1R9T C;  1RU0 A;  1XZP B;  2E2H C;  4A3J C;  4X6A C;  2E2I K;  1F9N A;  3CQZ C;  1O26 A;  2NVY C;  5IYB K;  3V4G A;  4GTE A;  2JA8 K;  3BUE A;  1YCL A;  5IYD K;  2NVT K;  1TWF K;  3RZD K;  1IE0 A;  2PMZ D;  5IOQ A;  3GTQ C;  4G7O A;  3VA7 A;  1B4B A;  4XLP A;  4GTF A;  1O29 A;  3RZO K;  1IW7 A;  4WJ4 A;  1Y1W A;  5HL8 A;  4BLA A;  4NOI A;  3T01 A;  1UV7 A;  2ZFZ A;  5FJ8 K;  1WOP A;  2R92 A;  2JA6 C;  3IPJ A;  4A3G K;  3L4J A;  3GTO A;  4P5A A;  3LPX A;  2XCR B;  3AD7 C;  4KN7 A;  5JFE A;  1KQ4 A;  5C3E K;  4GFQ A;  4C3H K;  1TWC A;  3GTP K;  3M4O K;  4KN4 A;  4KB4 A;  2YU9 C;  3I4N C;  1G51 A;  2PHC B;  3HKZ D;  3FKI A;  3H3V D;  3GSI A;  4GZY A;  3M3Y K;  3HOV K;  2W7V A;  2B63 A;  3GTL C;  4OIP A;  1WIH A;  4O2D A;  5FLM C;  4AH6 A;  1R9T A;  2E2H A;  4KMH A;  3G4C A;  3HOZ K;  2E2I C;  2CFA A;  3CQZ A;  4P9S A;  1Y1V K;  4A3F K;  1VGX A;  2NVY A;  5IYB C;  4QJV A;  4Y7N K;  4GTA A;  4GT9 A;  3SZZ A;  2R93 K;  2JA8 C;  4OIR A;  5IYD C;  4PAA A;  1ZXO A;  2NVT C;  3NUH A;  1TWF C;  3RZD C;  2VUM C;  3GTQ A;  3AD9 C;  3N0C A;  5CJ9 A;  1O24 A;  2O5I A;  3EQL A;  1WOO A;  3AQO A;  4BBR K;  4LOW A;  3RZO C;  3N3Y A;  1SMY A;  2BE5 A;  3PO2 K;  5M5X K;  2JA6 A;  1TWA K;  2Y3P A;  4WIL A;  3S1N C;  2FQO A;  1TWH K;  1USO A;  4A3K K;  1I6H K;  4XCH A;  4P5B A;  3GTM K;  1WSV A;  4KMU A;  4ILD A;  4C3H C;  2JA7 C;  3GTP C;  3HOU K;  3M4O C;  1DD5 A;  3PO3 K;  1I3Q K;  3BP8 C;  4KDD A;  2YU9 A;  3QX3 A;  4BLB A;  1O25 A;  1VH2 A;  3AD8 C;  4OIQ A;  5IYC K;  1YX2 A;  3A8K A;  3M3Y C;  3TFJ A;  3HOV C;  3GTJ K;  3GTL A;  1YNJ A;  3LAJ A;  2JH3 A;  3H0G K;  3S0X A;  1WOR A;  2R7Z C;  2CW0 A;  3HOZ C;  2E2I A;  2WB1 L;  3S2D K;  2PA8 L;  3AH5 A;  1Y1V C;  4A3F C;  1ISE A;  4Y7N C;  5CHP A;  1USM A;  3S1M K;  2R93 C;  3K7A K;  1WQG A;  5M5W K;  2A6E A;  1TWF A;  5C4J K;  2VUM A;  3A8I A;  3T00 A;  4A3L K;  1K83 K;  2Y0S D;  1IL2 A;  1O2B A;  2P8T A;  4LK1 A; 
#chains in the Genus database with same CATH homology
 2NVY K;  1I6V A;  4OIN A;  3M4O K;  4LLG A;  4KN4 A;  4YFK A;  3HKZ L;  4XSX A;  1SFO K;  2YU9 C;  3I4N C;  4LK0 A;  3H3V L;  4BXX C;  4A3C C;  3HKZ D;  4A3M C;  5IP9 C;  3GTQ K;  3H3V D;  4GZY A;  3S15 C;  3M3Y K;  4A3E C;  4MQ9 A;  3HOV K;  3PO2 C;  4LJZ A;  5M5Y K;  3HOY K;  3GTL C;  1TWA C;  4OIP A;  4QJV B;  4YFX A;  3S1Q C;  5FLM C;  1TWH C;  5C4X C;  1I6H C;  4C3J K;  1XPP A;  3HOZ K;  4BBS K;  2E2I C;  1Y1W C;  3GTG C;  4Y52 C;  3GTM C;  4A3E K;  1Y1V K;  4A3F K;  1HQM A;  4AYB D;  3HOU C;  5M3F K;  3S16 K;  5IYB C;  4QJV A;  4Y7N K;  3PO3 C;  1I3Q C;  2JA5 C;  2R92 C;  4A93 C;  2JA6 K;  4BY1 C;  4MEX A;  4BBR C;  1TWG C;  1I50 K;  5C4X K;  2JA8 C;  4OIR A;  3S2H K;  2R93 K;  5IYD C;  4QIW L;  2NVT C;  3GTK K;  4G7Z A;  3GTO C;  1TWF C;  5IYC C;  3WOD A;  5IP7 K;  3RZD C;  2E2J C;  2NVQ C;  2VUM C;  4A3I C;  4QIW D;  3HOW K;  2WAQ L;  2NVX C;  3S14 K;  4A3D K;  2A68 A;  4YG2 A;  4ZH4 A;  1WCM K;  4C3I K;  2O5I A;  3GTJ C;  3EQL A;  3S17 C;  1TWC C;  2WAQ D;  4XSZ A;  5C44 C;  4BBR K;  4BY1 K;  3H0G C;  4MEY A;  3RZO C;  4A3K C;  2YU9 K;  2NVQ K;  2VUM K;  3I4N K;  1BDF A;  2A69 A;  3S2D C;  4BXX K;  4A3C K;  4A3M K;  5IP9 K;  3DXJ A;  3FKI C;  1SMY A;  4OIO A;  3S15 K;  2BE5 A;  3PO2 K;  5M5X K;  4A3B C;  5C44 K;  3S1M C;  3GTL K;  1ZYR A;  1TWA K;  3K7A C;  2B63 C;  3S1N C;  3S1Q K;  3I4M C;  5FLM K;  1TWH K;  4A3K K;  1I6H K;  3HOX C;  5C4J C;  1R9T C;  2E2H C;  4BY7 C;  4A3J C;  4X6A C;  4A3L C;  2E2I K;  1K83 C;  1Y1W K;  3GTG K;  3GTM K;  3CQZ C;  3S1R C;  4KMU A;  4Y52 K;  2JA7 C;  3GTP C;  3HOU K;  2NVY C;  5TMF A;  5IYB K;  3M4O C;  3PO3 K;  1I3Q K;  2JA5 K;  2R92 K;  2A6H A;  3S1N K;  4A93 K;  1TWG K;  2JA8 K;  4JK1 A;  1SFO C;  5IYD K;  2PMZ L;  4OIQ A;  2NVT K;  3GTO K;  1TWF K;  5IYC K;  3RZD K;  2E2J K;  4Q4Z A;  4A3I K;  2PMZ D;  4XLN A;  3GTQ C;  2NVX K;  2JA7 K;  3M3Y C;  4G7O A;  3HOV C;  3S17 K;  3GTJ K;  4YFN A;  1TWC K;  3HOY C;  1YNJ A;  4C2M K;  4XLP A;  3H0G K;  4A3G C;  5TMC A;  5D4D A;  1YNN A;  2R7Z C;  3RZO K;  2CW0 A;  1IW7 A;  3HOZ C;  4BBS C;  5M3M K;  2WB1 L;  2PPB A;  3S2D K;  4G7H A;  2PA8 L;  5C3E C;  1Y1V C;  3FKI K;  4NOI A;  4A3F C;  2WB1 D;  3S16 C;  2PA8 D;  4Q5S A;  5FJ8 K;  4Y7N C;  4A3B K;  3S1M K;  2JA6 C;  2R93 C;  3K7A K;  2B63 K;  1I50 C;  5M5W K;  4A3G K;  3S2H C;  2R7Z K;  3I4M K;  2A6E A;  3GTK C;  3HOX K;  5C4J K;  1R9T K;  2E2H K;  2Y0S L;  4KN7 A;  5IP7 C;  4BY7 K;  4AYB L;  4A3J K;  4X6A K;  5C3E K;  3HOW C;  3S14 C;  1K83 K;  4A3L K;  2O5J A;  2Y0S D;  4A3D C;  3CQZ K;  3S1R K;  1WCM C;  4C3H K;  3GTP K;  4LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...