3FKIK

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3fkiK00
5IYDK 5FJ8K 2JA5K 3GTJC 1I3QK 5C4XK 3GTKK 4MEXA 4LJZA 4C3HK 5FLMK 4A3DK 3S1RC 4XSZA 4BBSC 3M3YK 4LK0A 3H0GK 2E2IC 2R7ZK 3S1QK 2VUMC 4LK1A 2JA6K 5TMFA 1TWFK 4Y52K 3FKIC 4AYBL 4A3JC 3S14C 2NVYC 2E2JK 4YFKA 5IP7K 5IYBC 5M3FK 2R93C 4X6AK 5M5WK 5C4JK 2JA8C 4KN7A 5IP9K 5IYCC 1TWHK 3S1NC 5TMCA 4G7OA 3HOWC 4ZH4A 2JA7K 1TWGC 1TWCK 4OIOA 3HOXC 3GTQC 1SFOC 3I4MC 4BY7K 4Y7NC 3RZDK 4A3EK 4BY1K 4KN4A 4YFNA 3CQZC 3EQLA 2B63K 2NVTK 4MEYA 3GTOK 3S15C 4YG2A 5C3EK 1WCMC 4A3KK 4A3FC 1R9TC 4OINA 5C44K 3HOVC 4JK1A 5M5YK 4A3MC 3HOYC 2YU9C 4A93K 4A3IK 1Y1WC 4A3BK 1I6VA 4QIWD 3RZOC 2A6HA 3S2DC 4C3JK 1I6HK 5M3MK 3M4OC 2NVXK 4OIRA 4OIPA 3DXJA 3GTMK 1IW7A 1TWAC 4YFXA 1Y1VK 2O5IA 4A3LC 4G7ZA 4C2MK 5IYDC 4C3IK 2JA5C 3HOZK 1I3QC 5C4XC 3GTKC 3S17K 3GTLK 3PO2K 4A3DC 3I4NK 2R92K 3M3YC 2E2HK 4GZYA 2A6EA 1K83K 3S1QC 2PMZD 4QIWL 3HOUC 2R93K 3PO3K 2JA6C 1TWFC 4G7HA 3K7AC 3S2HK 4BXXK 3S1MK 1YNNA 2WB1D 2O5JA 2PPBA 2E2JC 3GTGK 2PA8D 3GTPK 4BBRK 4X6AC 1ZYRA 2A68A 5C4JC 1I50C 4A3CK 5IP9C 2NVQC 1TWHC 3GTJK 2JA7C 5D4DA 4XSXA 4XLNA 3S16C 4BY7C 3S1RK 3RZDC 4A3EC 4Q4ZA 4BY1C 3GTOC 2NVTC 4BBSK 2B63C 4A3GC 2PMZL 5C3EC 4OIQA 2WAQD 4A3KC 2E2IK 5C44C 3WODA 2VUMK 5FLMC 4A93C 2WB1L 4A3BC 3FKIK 2A69A 3HKZD 1I6HC 2PA8L 1YNJA 2NVXC 4A3JK 4KMUA 3H0GC 2NVYK 2R7ZC 3GTMC 3S14K 4A3GK 2Y0SD 5IYBK 1Y1VC 4LLGA 4MQ9A 4Y52C 3H3VD 2JA8K 5IYCK 3S1NK 3HOZC 1XPPA 3HOWK 3GTQK 1BDFA 1TWGK 5IP7C 3HOXK 3S17C 3GTLC 1HQMA 1SFOK 1SMYA 3HOUK 3I4MK 3PO2C 3I4NC 4Y7NK 2R92C 3K7AK 2WAQL 3CQZK 2CW0A 3S15K 4Q5SA 2E2HC 1R9TK 2BE5A 1WCMK 4A3FK 3HOVK 1K83C 1TWCC 3HKZL 4A3MK 4QJVA 3HOYK 2YU9K 4XLPA 3PO3C 1Y1WK 3S2HC 4BXXC 3RZOK 3S2DK 1I50K 2Y0SL 3M4OK 3S1MC 2NVQK 3GTPC 5M5XK 3GTGC 3H3VL 4BBRC 1TWAK 4AYBD 4A3LK 4A3IC 3S16K 4QJVB 4NOIA 4A3CC
chains in the Genus database with same CATH superfamily
5FJ8K 5JFEA 3GTJC 1XXBA 4GTEA 4LJZA 4XSZA 2GSOA 2CFAA 4XCHA 4KB2A 2E2IC 3FKIC 4KMHA 3S14C 2NVYC 1WSVA 4YFKA 2CFAB 5M3FK 3GEIA 2V6TA 1TWCK 3HOXC 3TTGA 3I4MC 3RZDK 4BY1K 3GTOK 4YFNA 3CQZC 3EQLA 2NVTK 1BJTA 4FM9A 1R9TC 1WCMC 4A3KK 4A3FC 1WQHA 3GEHA 4GTLA 3BP8C 1VGXA 4WILA 4P5BA 3AD8C 2YU9C 1TWCA 1Y1WC 1O2AA 1I6VA 1J98A 3AD9C 4QIWD 4A3BK 5M3MK 3M4OC 2NVXK 4OIRA 3GTOA 3N0CA 3DXJA 1VJEA 2ZUEA 1IW7A 1TWAC 1USOA 4LQYA 1I3QC 3S17K 2NVXA 4C3HC 1PJ5A 3FOEA 3M3YC 2FQOA 1K83K 1TWFC 4G7HA 1YNNA 4KATA 2E2JC 1PJ7A 4X6AC 1K83A 2P8TA 2A68A 5C4JC 1DCHA 1O2BA 5IP9C 2RGRA 3JSTA 2JA7C 3MMLB 4XSXA 3FHZA 3S1RK 4G0WA 4A3EC 4A3GC 3CAGA 2B63C 1O27A 1F7VA 5C3EC 3V4GA 2WAQD 5C44C 5FLMC 1EI6A 2WB1L 3T02A 1BS2A 1J6VA 2PA8L 1YNJA 1IS1A 4FZBA 3H0GC 4A3JK 3GTMC 2Y0SD 2GAGC 4Y52C 4C2MC 1JVIA 3S1NK 3HOZC 3HOWK 3GTLC 3PO2C 1WOPA 3S15K 4Q5SA 3HOVK 3HKZL 4A3MK 3GDZA 3PO3C 3S2HC 3RZOK 1VRQC 1WQFA 3H3VL 4BBRC 1O26A 2GAHC 1ZBSA 5IYDK 4RMFA 2JA5K 1USMA 2ZUFA 4MEXA 4KM9A 5FLMK 3TFIA 4C3IC 3H0GK 1INNA 2PHCB 3ADAC 3TFJA 4LK1A 2JA5A 5TMFA 4Y52K 3SZYA 3H0GA 4AH6A 5M5WK 2JA8C 5IYCC 1TWHK 4P5AA 3LAPA 4ZH4A 4G7OA 1XZPA 1SFOC 4BY7K 4Y7NC 4MEYA 4OINA 1TWHA 1WORA 4A93K 1XZPB 1I6HK 3QX3A 2XCOA 4KMDA 4A3LC 3GIRA 4G7ZA 4C3IK 2V6SA 3FOFA 1O2FB 5C4XC 3GTKC 4A3DC 3T01A 5EGEA 3I4NK 3A8JA 2E2HK 1VH2A 3S1QC 3HOUC 1F93A 4KASA 2JA6C 4GFQA 3K7AC 2Y3PA 2WB1D 2O5JA 2PPBA 3GTGK 3GTPK 2PA8D 2E2HA 1I50C 4WJ3M 2NVQC 3GTJK 4PABA 3GTGA 3GTPA 1O25A 2XCQA 2E2IK 3GTJA 4GTBA 5CHPA 3FKIK 2A69A 3HKZD 4C3JC 5JVOA 4KMUA 3S14K 2NVYK 1Y1VC 4MQ9A 2E2IA 3H3VD 4KDDA 3NUHA 3FKIA 1KQ4A 1WQGA 3HOXK 1HQMA 3HOUK 3I4MK 1G51A 2NVYA 2R92C 3K7AK 4G0UA 3CQZK 1XXCA 1ZQ1C 1O29A 4KB4A 1WCMK 5TJ3A 4A3FK 1R9TK 2YU9K 4XLPA 1Y1WK 4BXXC 4GTDA 2W7VA 2KWAA 1I50K 1EFWA 1IL2A 3M4OK 2NVQK 3S1MC 5M5XK 3CQZA 1TWAK 1R9TA 1WCMA 4A3CC 2YU9A 1VLOA 1Y1WA 1I3QK 1I50A 4C3HK 1DCOA 1TWAA 4BBSC 3M3YK 4LK0A 2XCRB 1XXAA 2VUMC 4GTAA 3Q3QA 1I3QA 1TWFK 1EK8A 4AYBL 5IOQA 2E2JK 5IYBC 2R93C 4X6AK 5C4JK 5IP9K 1TWFA 2JA7K 1TWGC 3GTQC 4A3EK 4KN4A 4A3GK 4KARA 2B63K 4YG2A 5C3EK 2EBBA 5C44K 4KC6A 4JK1A 3HOYC 4KAWX 2JA7A 1HI9A 3S2DC 3AQOA 4OIPA 3L4JA 3GTMK 2B63A 1IBAA 5IOTA 2O5IA 1J6XA 3G4AA 1F9NA 1PJ6A 1O24A 4C2MK 3HOZK 1YX2A 3GTLK 3PO2K 3GTMA 1C0AA 4P9SA 3A8IA 4GZYA 4BLAA 2A6EA 3HXAA 3GEEA 4G0VA 2R93K 4BKWA 3PO3K 3S2HK 1F7UA 2RH6A 3GTLA 3GSIA 1B4AA 1V5VA 4BBRK 3TFHA 4KM8A 1ZXOA 2R93A 4J3NA 1EH1A 5D4DA 1ZVUA 4XLNA 4GTCA 3RZDC 4Q4ZA 4BY1C 3GTOC 5HL8A 2NVTC 2PMZL 5E68A 4OIQA 4A3KC 3AD7C 1J6WA 3WODA 3S0XA 4A3BC 1UV7A 2NVXC 3OEPA 2R7ZC 4GTFA 3N0BA 2JA8K 5IYCK 1RU0A 1XPPA 5IP7C 3S17C 1SFOK 1SMYA 4Y7NK 3BUEA 3LPXA 2BE5A 1K83C 1SFOA 4GT9A 4AYBD 3AQPA 4M1XA 4A3LK 4A3IC 4NOIA 5EGHA 1L0WA 1DCPA 5C4XK 3GTKK 4A3DK 3S1RC 2GSNA 2V6UA 3ERED 1EQRA 2R7ZK 3S1QK 3BP3A 1DD5A 2JA6K 3A8KA 3GTKA 1O28A 1X31C 5IORA 4A3JC 3LAJA 5IP7K 1JOEA 1WIHA 2R7ZA 1JQWA 1IE0A 4KN7A 2JA6A 3S1NC 5TMCA 3HOWC 4OIOA 2D6FC 1GE9A 3S15C 3HOVC 1AB4A 1IQ0A 5M5YK 4A3MC 1YCLA 2FQTA 4LOWA 1WSRA 4A3IK 3RZOC 2A6HA 5CJ9A 4C3JK 3VA7A 4YFXA 1Y1VK 3L4KA 5IYDC 2JA5C 1WOOA 3N3YA 2R92K 1Y1VA 4LR2A 2PMZD 4QIWL 2ZFZA 4BXXK 3AH5A 3T00A 3S1MK 2R92A 4WJ4A 4BLBA 4KMAA 1ZYRA 4A3CK 1TWHC 2JH3A 4BY7C 3S16C 4BBSK 5L46A 5IOSA 1WOSA 2VUMK 3G4CA 4A93C 3OPFA 1I6HC 3OREA 1XZQA 5IYBK 4LLGA 1BGWA 2VUMA 2GSUA 4O2DA 3GTQK 1BDFA 1TWGK 3IPJA 1XZQB 4DDQA 3I4NC 2WAQL 3SZZA 2CW0A 1B4BA 2E2HC 1TWCC 3HOYK 4QJVA 3GTQA 1TWGA 4PAAA 4ILDA 3S2DK 2Y0SL 4C45A 1ISEA 2P5MA 3GTPC 3GTGC 3S16K 4QJVB
chains in the Genus database with same CATH topology
5IYDK 5FJ8K 2JA5K 3GTJC 1I3QK 5C4XK 3GTKK 4MEXA 4LJZA 4C3HK 5FLMK 4A3DK 3S1RC 4XSZA 4BBSC 3M3YK 4LK0A 3H0GK 2E2IC 2R7ZK 3S1QK 2VUMC 4LK1A 2JA6K 5TMFA 1TWFK 4Y52K 3FKIC 4AYBL 4A3JC 3S14C 2NVYC 2E2JK 4YFKA 5IP7K 5IYBC 5M3FK 2R93C 4X6AK 5M5WK 5C4JK 2JA8C 4KN7A 5IP9K 5IYCC 1TWHK 3S1NC 5TMCA 4G7OA 3HOWC 4ZH4A 2JA7K 1TWGC 1TWCK 4OIOA 3HOXC 3GTQC 1SFOC 3I4MC 4BY7K 4Y7NC 3RZDK 4A3EK 4BY1K 4KN4A 4YFNA 3CQZC 3EQLA 2B63K 2NVTK 4MEYA 3GTOK 3S15C 4YG2A 5C3EK 1WCMC 4A3KK 4A3FC 1R9TC 4OINA 5C44K 3HOVC 4JK1A 5M5YK 4A3MC 3HOYC 2YU9C 4A93K 4A3IK 1Y1WC 4A3BK 1I6VA 4QIWD 3RZOC 2A6HA 3S2DC 4C3JK 1I6HK 5M3MK 3M4OC 2NVXK 4OIRA 4OIPA 3DXJA 3GTMK 1IW7A 1TWAC 4YFXA 1Y1VK 2O5IA 4A3LC 4G7ZA 4C2MK 5IYDC 4C3IK 2JA5C 3HOZK 1I3QC 5C4XC 3GTKC 3S17K 3GTLK 3PO2K 4A3DC 3I4NK 2R92K 3M3YC 2E2HK 4GZYA 2A6EA 1K83K 3S1QC 2PMZD 4QIWL 3HOUC 2R93K 3PO3K 2JA6C 1TWFC 4G7HA 3K7AC 3S2HK 4BXXK 3S1MK 1YNNA 2WB1D 2O5JA 2PPBA 2E2JC 3GTGK 2PA8D 3GTPK 4BBRK 4X6AC 1ZYRA 2A68A 5C4JC 1I50C 4A3CK 5IP9C 2NVQC 1TWHC 3GTJK 2JA7C 5D4DA 4XSXA 4XLNA 3S16C 4BY7C 3S1RK 3RZDC 4A3EC 4Q4ZA 4BY1C 3GTOC 2NVTC 4BBSK 2B63C 4A3GC 2PMZL 5C3EC 4OIQA 2WAQD 4A3KC 2E2IK 5C44C 3WODA 2VUMK 5FLMC 4A93C 2WB1L 4A3BC 3FKIK 2A69A 3HKZD 1I6HC 2PA8L 1YNJA 2NVXC 4A3JK 4KMUA 3H0GC 2NVYK 2R7ZC 3GTMC 3S14K 4A3GK 2Y0SD 5IYBK 1Y1VC 4LLGA 4MQ9A 4Y52C 3H3VD 2JA8K 5IYCK 3S1NK 3HOZC 1XPPA 3HOWK 3GTQK 1BDFA 1TWGK 5IP7C 3HOXK 3S17C 3GTLC 1HQMA 1SFOK 1SMYA 3HOUK 3I4MK 3PO2C 3I4NC 4Y7NK 2R92C 3K7AK 2WAQL 3CQZK 2CW0A 3S15K 4Q5SA 2E2HC 1R9TK 2BE5A 1WCMK 4A3FK 3HOVK 1K83C 1TWCC 3HKZL 4A3MK 4QJVA 3HOYK 2YU9K 4XLPA 3PO3C 1Y1WK 3S2HC 4BXXC 3RZOK 3S2DK 1I50K 2Y0SL 3M4OK 3S1MC 2NVQK 3GTPC 5M5XK 3GTGC 3H3VL 4BBRC 1TWAK 4AYBD 4A3LK 4A3IC 3S16K 4QJVB 4NOIA 4A3CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD K;  5FJ8 K;  2JA5 K;  3GTJ C;  1I3Q K;  5C4X K;  3GTK K;  4MEX A;  4LJZ A;  4C3H K;  5FLM K;  4A3D K;  3S1R C;  4XSZ A;  4BBS C;  3M3Y K;  4LK0 A;  3H0G K;  2E2I C;  2R7Z K;  3S1Q K;  2VUM C;  4LK1 A;  2JA6 K;  5TMF A;  1TWF K;  4Y52 K;  3FKI C;  4AYB L;  4A3J C;  3S14 C;  2NVY C;  2E2J K;  4YFK A;  5IP7 K;  5IYB C;  5M3F K;  2R93 C;  4X6A K;  5M5W K;  5C4J K;  2JA8 C;  4KN7 A;  5IP9 K;  5IYC C;  1TWH K;  3S1N C;  5TMC A;  4G7O A;  3HOW C;  4ZH4 A;  2JA7 K;  1TWG C;  1TWC K;  4OIO A;  3HOX C;  3GTQ C;  1SFO C;  3I4M C;  4BY7 K;  4Y7N C;  3RZD K;  4A3E K;  4BY1 K;  4KN4 A;  4YFN A;  3CQZ C;  3EQL A;  2B63 K;  2NVT K;  4MEY A;  3GTO K;  3S15 C;  4YG2 A;  5C3E K;  1WCM C;  4A3K K;  4A3F C;  1R9T C;  4OIN A;  5C44 K;  3HOV C;  4JK1 A;  5M5Y K;  4A3M C;  3HOY C;  2YU9 C;  4A93 K;  4A3I K;  1Y1W C;  4A3B K;  1I6V A;  4QIW D;  3RZO C;  2A6H A;  3S2D C;  4C3J K;  1I6H K;  5M3M K;  3M4O C;  2NVX K;  4OIR A;  4OIP A;  3DXJ A;  3GTM K;  1IW7 A;  1TWA C;  4YFX A;  1Y1V K;  2O5I A;  4A3L C;  4G7Z A;  4C2M K;  5IYD C;  4C3I K;  2JA5 C;  3HOZ K;  1I3Q C;  5C4X C;  3GTK C;  3S17 K;  3GTL K;  3PO2 K;  4A3D C;  3I4N K;  2R92 K;  3M3Y C;  2E2H K;  4GZY A;  2A6E A;  1K83 K;  3S1Q C;  2PMZ D;  4QIW L;  3HOU C;  2R93 K;  3PO3 K;  2JA6 C;  1TWF C;  4G7H A;  3K7A C;  3S2H K;  4BXX K;  3S1M K;  1YNN A;  2WB1 D;  2O5J A;  2PPB A;  2E2J C;  3GTG K;  2PA8 D;  3GTP K;  4BBR K;  4X6A C;  1ZYR A;  2A68 A;  5C4J C;  1I50 C;  4A3C K;  5IP9 C;  2NVQ C;  1TWH C;  3GTJ K;  2JA7 C;  5D4D A;  4XSX A;  4XLN A;  3S16 C;  4BY7 C;  3S1R K;  3RZD C;  4A3E C;  4Q4Z A;  4BY1 C;  3GTO C;  2NVT C;  4BBS K;  2B63 C;  4A3G C;  2PMZ L;  5C3E C;  4OIQ A;  2WAQ D;  4A3K C;  2E2I K;  5C44 C;  3WOD A;  2VUM K;  5FLM C;  4A93 C;  2WB1 L;  4A3B C;  3FKI K;  2A69 A;  3HKZ D;  1I6H C;  2PA8 L;  1YNJ A;  2NVX C;  4A3J K;  4KMU A;  3H0G C;  2NVY K;  2R7Z C;  3GTM C;  3S14 K;  4A3G K;  2Y0S D;  5IYB K;  1Y1V C;  4LLG A;  4MQ9 A;  4Y52 C;  3H3V D;  2JA8 K;  5IYC K;  3S1N K;  3HOZ C;  1XPP A;  3HOW K;  3GTQ K;  1BDF A;  1TWG K;  5IP7 C;  3HOX K;  3S17 C;  3GTL C;  1HQM A;  1SFO K;  1SMY A;  3HOU K;  3I4M K;  3PO2 C;  3I4N C;  4Y7N K;  2R92 C;  3K7A K;  2WAQ L;  3CQZ K;  2CW0 A;  3S15 K;  4Q5S A;  2E2H C;  1R9T K;  2BE5 A;  1WCM K;  4A3F K;  3HOV K;  1K83 C;  1TWC C;  3HKZ L;  4A3M K;  4QJV A;  3HOY K;  2YU9 K;  4XLP A;  3PO3 C;  1Y1W K;  3S2H C;  4BXX C;  3RZO K;  3S2D K;  1I50 K;  2Y0S L;  3M4O K;  3S1M C;  2NVQ K;  3GTP C;  5M5X K;  3GTG C;  3H3V L;  4BBR C;  1TWA K;  4AYB D;  4A3L K;  4A3I C;  3S16 K;  4QJV B;  4NOI A;  4A3C C; 
#chains in the Genus database with same CATH topology
 5FJ8 K;  5JFE A;  3GTJ C;  1XXB A;  4GTE A;  4LJZ A;  4XSZ A;  2GSO A;  2CFA A;  4XCH A;  4KB2 A;  2E2I C;  3FKI C;  4KMH A;  3S14 C;  2NVY C;  1WSV A;  4YFK A;  2CFA B;  5M3F K;  3GEI A;  2V6T A;  1TWC K;  3HOX C;  3TTG A;  3I4M C;  3RZD K;  4BY1 K;  3GTO K;  4YFN A;  3CQZ C;  3EQL A;  2NVT K;  1BJT A;  4FM9 A;  1R9T C;  1WCM C;  4A3K K;  4A3F C;  1WQH A;  3GEH A;  4GTL A;  3BP8 C;  1VGX A;  4WIL A;  4P5B A;  3AD8 C;  2YU9 C;  1TWC A;  1Y1W C;  1O2A A;  1I6V A;  1J98 A;  3AD9 C;  4QIW D;  4A3B K;  5M3M K;  3M4O C;  2NVX K;  4OIR A;  3GTO A;  3N0C A;  3DXJ A;  1VJE A;  2ZUE A;  1IW7 A;  1TWA C;  1USO A;  4LQY A;  1I3Q C;  3S17 K;  2NVX A;  4C3H C;  1PJ5 A;  3FOE A;  3M3Y C;  2FQO A;  1K83 K;  1TWF C;  4G7H A;  1YNN A;  4KAT A;  2E2J C;  1PJ7 A;  4X6A C;  1K83 A;  2P8T A;  2A68 A;  5C4J C;  1DCH A;  1O2B A;  5IP9 C;  2RGR A;  3JST A;  2JA7 C;  3MML B;  4XSX A;  3FHZ A;  3S1R K;  4G0W A;  4A3E C;  4A3G C;  3CAG A;  2B63 C;  1O27 A;  1F7V A;  5C3E C;  3V4G A;  2WAQ D;  5C44 C;  5FLM C;  1EI6 A;  2WB1 L;  3T02 A;  1BS2 A;  1J6V A;  2PA8 L;  1YNJ A;  1IS1 A;  4FZB A;  3H0G C;  4A3J K;  3GTM C;  2Y0S D;  2GAG C;  4Y52 C;  4C2M C;  1JVI A;  3S1N K;  3HOZ C;  3HOW K;  3GTL C;  3PO2 C;  1WOP A;  3S15 K;  4Q5S A;  3HOV K;  3HKZ L;  4A3M K;  3GDZ A;  3PO3 C;  3S2H C;  3RZO K;  1VRQ C;  1WQF A;  3H3V L;  4BBR C;  1O26 A;  2GAH C;  1ZBS A;  5IYD K;  4RMF A;  2JA5 K;  1USM A;  2ZUF A;  4MEX A;  4KM9 A;  5FLM K;  3TFI A;  4C3I C;  3H0G K;  1INN A;  2PHC B;  3ADA C;  3TFJ A;  4LK1 A;  2JA5 A;  5TMF A;  4Y52 K;  3SZY A;  3H0G A;  4AH6 A;  5M5W K;  2JA8 C;  5IYC C;  1TWH K;  4P5A A;  3LAP A;  4ZH4 A;  4G7O A;  1XZP A;  1SFO C;  4BY7 K;  4Y7N C;  4MEY A;  4OIN A;  1TWH A;  1WOR A;  4A93 K;  1XZP B;  1I6H K;  3QX3 A;  2XCO A;  4KMD A;  4A3L C;  3GIR A;  4G7Z A;  4C3I K;  2V6S A;  3FOF A;  1O2F B;  5C4X C;  3GTK C;  4A3D C;  3T01 A;  5EGE A;  3I4N K;  3A8J A;  2E2H K;  1VH2 A;  3S1Q C;  3HOU C;  1F93 A;  4KAS A;  2JA6 C;  4GFQ A;  3K7A C;  2Y3P A;  2WB1 D;  2O5J A;  2PPB A;  3GTG K;  3GTP K;  2PA8 D;  2E2H A;  1I50 C;  4WJ3 M;  2NVQ C;  3GTJ K;  4PAB A;  3GTG A;  3GTP A;  1O25 A;  2XCQ A;  2E2I K;  3GTJ A;  4GTB A;  5CHP A;  3FKI K;  2A69 A;  3HKZ D;  4C3J C;  5JVO A;  4KMU A;  3S14 K;  2NVY K;  1Y1V C;  4MQ9 A;  2E2I A;  3H3V D;  4KDD A;  3NUH A;  3FKI A;  1KQ4 A;  1WQG A;  3HOX K;  1HQM A;  3HOU K;  3I4M K;  1G51 A;  2NVY A;  2R92 C;  3K7A K;  4G0U A;  3CQZ K;  1XXC A;  1ZQ1 C;  1O29 A;  4KB4 A;  1WCM K;  5TJ3 A;  4A3F K;  1R9T K;  2YU9 K;  4XLP A;  1Y1W K;  4BXX C;  4GTD A;  2W7V A;  2KWA A;  1I50 K;  1EFW A;  1IL2 A;  3M4O K;  2NVQ K;  3S1M C;  5M5X K;  3CQZ A;  1TWA K;  1R9T A;  1WCM A;  4A3C C;  2YU9 A;  1VLO A;  1Y1W A;  1I3Q K;  1I50 A;  4C3H K;  1DCO A;  1TWA A;  4BBS C;  3M3Y K;  4LK0 A;  2XCR B;  1XXA A;  2VUM C;  4GTA A;  3Q3Q A;  1I3Q A;  1TWF K;  1EK8 A;  4AYB L;  5IOQ A;  2E2J K;  5IYB C;  2R93 C;  4X6A K;  5C4J K;  5IP9 K;  1TWF A;  2JA7 K;  1TWG C;  3GTQ C;  4A3E K;  4KN4 A;  4A3G K;  4KAR A;  2B63 K;  4YG2 A;  5C3E K;  2EBB A;  5C44 K;  4KC6 A;  4JK1 A;  3HOY C;  4KAW X;  2JA7 A;  1HI9 A;  3S2D C;  3AQO A;  4OIP A;  3L4J A;  3GTM K;  2B63 A;  1IBA A;  5IOT A;  2O5I A;  1J6X A;  3G4A A;  1F9N A;  1PJ6 A;  1O24 A;  4C2M K;  3HOZ K;  1YX2 A;  3GTL K;  3PO2 K;  3GTM A;  1C0A A;  4P9S A;  3A8I A;  4GZY A;  4BLA A;  2A6E A;  3HXA A;  3GEE A;  4G0V A;  2R93 K;  4BKW A;  3PO3 K;  3S2H K;  1F7U A;  2RH6 A;  3GTL A;  3GSI A;  1B4A A;  1V5V A;  4BBR K;  3TFH A;  4KM8 A;  1ZXO A;  2R93 A;  4J3N A;  1EH1 A;  5D4D A;  1ZVU A;  4XLN A;  4GTC A;  3RZD C;  4Q4Z A;  4BY1 C;  3GTO C;  5HL8 A;  2NVT C;  2PMZ L;  5E68 A;  4OIQ A;  4A3K C;  3AD7 C;  1J6W A;  3WOD A;  3S0X A;  4A3B C;  1UV7 A;  2NVX C;  3OEP A;  2R7Z C;  4GTF A;  3N0B A;  2JA8 K;  5IYC K;  1RU0 A;  1XPP A;  5IP7 C;  3S17 C;  1SFO K;  1SMY A;  4Y7N K;  3BUE A;  3LPX A;  2BE5 A;  1K83 C;  1SFO A;  4GT9 A;  4AYB D;  3AQP A;  4M1X A;  4A3L K;  4A3I C;  4NOI A;  5EGH A;  1L0W A;  1DCP A;  5C4X K;  3GTK K;  4A3D K;  3S1R C;  2GSN A;  2V6U A;  3ERE D;  1EQR A;  2R7Z K;  3S1Q K;  3BP3 A;  1DD5 A;  2JA6 K;  3A8K A;  3GTK A;  1O28 A;  1X31 C;  5IOR A;  4A3J C;  3LAJ A;  5IP7 K;  1JOE A;  1WIH A;  2R7Z A;  1JQW A;  1IE0 A;  4KN7 A;  2JA6 A;  3S1N C;  5TMC A;  3HOW C;  4OIO A;  2D6F C;  1GE9 A;  3S15 C;  3HOV C;  1AB4 A;  1IQ0 A;  5M5Y K;  4A3M C;  1YCL A;  2FQT A;  4LOW A;  1WSR A;  4A3I K;  3RZO C;  2A6H A;  5CJ9 A;  4C3J K;  3VA7 A;  4YFX A;  1Y1V K;  3L4K A;  5IYD C;  2JA5 C;  1WOO A;  3N3Y A;  2R92 K;  1Y1V A;  4LR2 A;  2PMZ D;  4QIW L;  2ZFZ A;  4BXX K;  3AH5 A;  3T00 A;  3S1M K;  2R92 A;  4WJ4 A;  4BLB A;  4KMA A;  1ZYR A;  4A3C K;  1TWH C;  2JH3 A;  4BY7 C;  3S16 C;  4BBS K;  5L46 A;  5IOS A;  1WOS A;  2VUM K;  3G4C A;  4A93 C;  3OPF A;  1I6H C;  3ORE A;  1XZQ A;  5IYB K;  4LLG A;  1BGW A;  2VUM A;  2GSU A;  4O2D A;  3GTQ K;  1BDF A;  1TWG K;  3IPJ A;  1XZQ B;  4DDQ A;  3I4N C;  2WAQ L;  3SZZ A;  2CW0 A;  1B4B A;  2E2H C;  1TWC C;  3HOY K;  4QJV A;  3GTQ A;  1TWG A;  4PAA A;  4ILD A;  3S2D K;  2Y0S L;  4C45 A;  1ISE A;  2P5M A;  3GTP C;  3GTG C;  3S16 K;  4QJV B; 
#chains in the Genus database with same CATH homology
 5IYD K;  5FJ8 K;  2JA5 K;  3GTJ C;  1I3Q K;  5C4X K;  3GTK K;  4MEX A;  4LJZ A;  4C3H K;  5FLM K;  4A3D K;  3S1R C;  4XSZ A;  4BBS C;  3M3Y K;  4LK0 A;  3H0G K;  2E2I C;  2R7Z K;  3S1Q K;  2VUM C;  4LK1 A;  2JA6 K;  5TMF A;  1TWF K;  4Y52 K;  3FKI C;  4AYB L;  4A3J C;  3S14 C;  2NVY C;  2E2J K;  4YFK A;  5IP7 K;  5IYB C;  5M3F K;  2R93 C;  4X6A K;  5M5W K;  5C4J K;  2JA8 C;  4KN7 A;  5IP9 K;  5IYC C;  1TWH K;  3S1N C;  5TMC A;  4G7O A;  3HOW C;  4ZH4 A;  2JA7 K;  1TWG C;  1TWC K;  4OIO A;  3HOX C;  3GTQ C;  1SFO C;  3I4M C;  4BY7 K;  4Y7N C;  3RZD K;  4A3E K;  4BY1 K;  4KN4 A;  4YFN A;  3CQZ C;  3EQL A;  2B63 K;  2NVT K;  4MEY A;  3GTO K;  3S15 C;  4YG2 A;  5C3E K;  1WCM C;  4A3K K;  4A3F C;  1R9T C;  4OIN A;  5C44 K;  3HOV C;  4JK1 A;  5M5Y K;  4A3M C;  3HOY C;  2YU9 C;  4A93 K;  4A3I K;  1Y1W C;  4A3B K;  1I6V A;  4QIW D;  3RZO C;  2A6H A;  3S2D C;  4C3J K;  1I6H K;  5M3M K;  3M4O C;  2NVX K;  4OIR A;  4OIP A;  3DXJ A;  3GTM K;  1IW7 A;  1TWA C;  4YFX A;  1Y1V K;  2O5I A;  4A3L C;  4G7Z A;  4C2M K;  5IYD C;  4C3I K;  2JA5 C;  3HOZ K;  1I3Q C;  5C4X C;  3GTK C;  3S17 K;  3GTL K;  3PO2 K;  4A3D C;  3I4N K;  2R92 K;  3M3Y C;  2E2H K;  4GZY A;  2A6E A;  1K83 K;  3S1Q C;  2PMZ D;  4QIW L;  3HOU C;  2R93 K;  3PO3 K;  2JA6 C;  1TWF C;  4G7H A;  3K7A C;  3S2H K;  4BXX K;  3S1M K;  1YNN A;  2WB1 D;  2O5J A;  2PPB A;  2E2J C;  3GTG K;  2PA8 D;  3GTP K;  4BBR K;  4X6A C;  1ZYR A;  2A68 A;  5C4J C;  1I50 C;  4A3C K;  5IP9 C;  2NVQ C;  1TWH C;  3GTJ K;  2JA7 C;  5D4D A;  4XSX A;  4XLN A;  3S16 C;  4BY7 C;  3S1R K;  3RZD C;  4A3E C;  4Q4Z A;  4BY1 C;  3GTO C;  2NVT C;  4BBS K;  2B63 C;  4A3G C;  2PMZ L;  5C3E C;  4OIQ A;  2WAQ D;  4A3K C;  2E2I K;  5C44 C;  3WOD A;  2VUM K;  5FLM C;  4A93 C;  2WB1 L;  4A3B C;  3FKI K;  2A69 A;  3HKZ D;  1I6H C;  2PA8 L;  1YNJ A;  2NVX C;  4A3J K;  4KMU A;  3H0G C;  2NVY K;  2R7Z C;  3GTM C;  3S14 K;  4A3G K;  2Y0S D;  5IYB K;  1Y1V C;  4LLG A;  4MQ9 A;  4Y52 C;  3H3V D;  2JA8 K;  5IYC K;  3S1N K;  3HOZ C;  1XPP A;  3HOW K;  3GTQ K;  1BDF A;  1TWG K;  5IP7 C;  3HOX K;  3S17 C;  3GTL C;  1HQM A;  1SFO K;  1SMY A;  3HOU K;  3I4M K;  3PO2 C;  3I4N C;  4Y7N K;  2R92 C;  3K7A K;  2WAQ L;  3CQZ K;  2CW0 A;  3S15 K;  4Q5S A;  2E2H C;  1R9T K;  2BE5 A;  1WCM K;  4A3F K;  3HOV K;  1K83 C;  1TWC C;  3HKZ L;  4A3M K;  4QJV A;  3HOY K;  2YU9 K;  4XLP A;  3PO3 C;  1Y1W K;  3S2H C;  4BXX C;  3RZO K;  3S2D K;  1I50 K;  2Y0S L;  3M4O K;  3S1M C;  2NVQ K;  3GTP C;  5M5X K;  3GTG C;  3H3V L;  4BBR C;  1TWA K;  4AYB D;  4A3L K;  4A3I C;  3S16 K;  4QJV B;  4NOI A;  4A3C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...