3FKIK

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3fkiK00
4XSZA 2VUMK 4A3JC 1R9TC 3S1RC 3FKIC 2WAQL 3CQZK 5D4DA 2A69A 2CW0A 3GTJC 5M5XK 2PPBA 4QJVB 3HOZK 3I4NK 5C4JK 4Q5SA 1Y1VK 2NVXK 4OIOA 2R7ZK 4JK1A 3HOXC 4A93C 5IP7K 2YU9C 5C4XK 4A3DC 3M3YC 4X6AC 3S2DC 4A3IC 3HOWC 2PA8L 4C3HK 3RZDK 3S16K 1TWAK 4BXXC 2A6HA 3HOVK 3HOYC 4YFXA 2NVQK 1TWFK 4G7ZA 3S2HK 4BBSK 3M4OK 3WODA 1SFOC 1TWHK 3GTQK 2VUMC 1BDFA 2E2IK 2Y0SD 4LJZA 3S1MK 3HKZD 4C3IK 1I3QK 2JA7K 3HOZC 4NOIA 3I4NC 2NVXC 3K7AK 2R7ZC 4ZH4A 3GTMK 4Y52C 4YFNA 2O5IA 5IP7C 3S14K 4G7OA 5C4XC 1TWCC 5IYCK 4A3FK 3PO2C 4MQ9A 2B63C 3RZDC 2E2HK 3S16C 4YFKA 3PO3K 1TWAC 4XLPA 3HOVC 4BY1K 5FJ8K 2NVQC 5M3MK 1TWFC 3S2HC 4BBSC 3M4OC 4C2MK 1I6HC 2R93K 1TWHC 3GTQC 1I6HK 1ZYRA 4KN7A 4BBRK 5IP9K 5IYBK 2PMZD 2E2IC 2WB1D 5M5YK 1I3QC 2JA8C 4KN4A 2JA7C 2E2JC 5TMFA 3K7AC 3GTLK 4C3JK 3H0GK 4MEYA 4LK1A 5C44K 5IYCC 4Y7NK 4A3EK 4OIQA 4A3FC 4AYBD 2O5JA 1TWGK 1SMYA 3CQZC 5M5WK 4Q4ZA 1Y1WK 2E2HC 2R92K 3GTPK 5C4JC 3GTOK 4G7HA 1Y1VC 2Y0SL 2NVTK 2BE5A 5IYDK 4BY1C 3I4MK 3HKZL 4BY7K 1YNNA 3DXJA 2JA5K 1YNJA 3S17K 2R93C 3H3VD 1XPPA 1I50K 3GTKK 4BBRC 5IYBC 5IP9C 1R9TK 3HOUK 3S1RK 3S1NK 4OIPA 5C3EK 4A3LK 4A3MK 4OIRA 3GTJK 4A3BK 1IW7A 4A3KK 2JA6K 3GTGK 4QIWD 3H0GC 4Y7NC 2YU9K 2NVYK 3S1MC 4GZYA 1Y1WC 3EQLA 3S2DK 4A3IK 4KMUA 5IYDC 3HOWK 2NVTC 2PMZL 3I4MC 3RZOK 4BXXK 3GTMC 1K83K 2WB1L 3HOYK 2JA5C 2A6EA 3S17C 1HQMA 2WAQD 3GTKC 1I50C 4A3GK 1SFOK 4YG2A 1WCMK 4A3CK 3HOUC 3S15K 3PO3C 3S1NC 4LLGA 4AYBL 5C3EC 4A3MC 4A3LC 4LK0A 4A3BC 4A3KC 2JA6C 3GTGC 5FLMK 2A68A 4MEXA 3S1QK 4Y52K 2PA8D 2NVYC 5M3FK 1TWCK 4XSXA 4A3JK 3FKIK 3PO2K 3H3VL 2B63K 3GTLC 3RZOC 1K83C 3S14C 3HOXK 5C44C 4A3EC 4A93K 4QJVA 5TMCA 1TWGC 4OINA 4A3DK 3M3YK 1WCMC 4XLNA 4A3GC 4QIWL 4A3CC 2R92C 3GTPC 4X6AK 3S15C 3GTOC 1I6VA 4BY7C 2JA8K 2E2JK 5FLMC 3S1QC
chains in the Genus database with same CATH superfamily
4XSZA 3CQZA 2VUMK 1O24A 4KARA 1JVIA 2WAQL 1XXAA 2PPBA 3HOZK 5C4JK 2NVXK 2R93A 3M3YC 4A3IC 1WSRA 3HOWC 1WOPA 3RZDK 3ADAC 3S16K 2A6HA 3HOVK 4GTLA 3SZZA 2E2IK 4KATA 3GIRA 3T01A 1DD5A 2GAGC 3AQPA 4BKWA 3I4NC 2O5IA 3S14K 3GTKA 1TWCC 3PO2C 4RMFA 3AD9C 3PO3K 2RGRA 4XLPA 2P5MA 2RH6A 2V6TA 3OEPA 3S2HC 4BBSC 1DCHA 3M4OC 1I6HC 2R93K 4BBRK 4LR2A 5IP9K 4C3IC 5IOQA 1I3QC 2JA8C 4AYBD 3GTPA 1SMYA 2GAHC 5M5WK 1IE0A 4P9SA 4GT9A 3TFJA 2Y0SL 4BY1C 3I4MK 3HKZL 4BY7K 1BJTA 4GTBA 3N0CA 3DXJA 1YNJA 1I50A 4C2MC 3GTKK 4M1XA 5IYBC 2Y3PA 3GTJA 4A3MK 1USOA 4C3JC 4QIWD 5CJ9A 4Y7NC 2XCQA 2NVYK 3OREA 1Y1WC 3GSIA 3S2DK 5IYDC 2NVTC 2JH3A 3GTMC 3S17C 1BS2A 1I50C 3VA7A 1SFOK 3HOUC 3LAPA 1UV7A 3GTGC 1VLOA 2B63A 3TFHA 4DDQA 3RZOC 1K83C 1TWHA 4A93K 3GTQA 1VJEA 3V4GA 1TWGC 4A3DK 1WCMC 4X6AK 3BUEA 2R92C 3GTOC 2JA7A 3LAJA 4AH6A 5FLMC 1IBAA 5E68A 4A3JC 1R9TC 3S1RC 1PJ6A 2E2HA 4PABA 3CAGA 2CW0A 3IPJA 4Q5SA 4QJVB 1Y1VK 2YU9C 1WQFA 4KASA 2PA8L 1TWAK 3Q3QA 3N3YA 4YFXA 3H0GA 1WQHA 4P5AA 2NVQK 3WODA 1TWHK 3GTQK 2VUMC 4XCHA 3S1MK 5TJ3A 4GTEA 2JA7K 3HOZC 1O2FB 1ISEA 2NVXC 1J6VA 2JA5A 4Y52C 5IYCK 4A3FK 1RU0A 3JSTA 3G4CA 1X31C 3BP8C 4KB4A 3RZDC 2E2HK 3S16C 4KB2A 3HOVC 4J3NA 5FJ8K 5IOSA 4WJ3M 2V6UA 2E2IC 4BLBA 1USMA 2FQOA 2E2JC 3GTLK 2CFAB 3H0GK 4MEYA 5C44K 4A3EK 3S14C 2KWAA 3CQZC 1INNA 3GEHA 2BE5A 3TTGA 1BGWA 1YNNA 2JA5K 2R93C 1WIHA 3H3VD 1XPPA 4BBRC 5IP9C 3FKIA 1EFWA 5C3EK 4A3LK 2NVYA 1C0AA 4FM9A 1WQGA 1YX2A 3EQLA 4A3IK 4G0UA 3HOWK 3I4MC 1XZPB 2W7VA 1O2AA 1SFOA 3AQOA 3GTKC 4A3GK 4A3CK 3S15K 3LPXA 2FQTA 4LLGA 4AYBL 4A3MC 2R7ZA 3FOEA 1O25A 3L4JA 3OPFA 1IL2A 2NVYC 5M3FK 1TWCK 1EI6A 4LQYA 1O27A 2GSOA 3FKIK 3PO2K 4BLAA 1WSVA 1TWFA 3HOXK 1V5VA 1I6HK 3FHZA 4QIWL 3GTPC 2ZUFA 5L46A 2JA8K 1F93A 3NUHA 1O26A 3A8JA 1Y1VA 3GTJC 4OIOA 2R7ZK 4JK1A 1PJ7A 4A93C 5IP7K 1O29A 5C4XK 4A3DC 4KMHA 1EQRA 4X6AC 1TWAA 4C3HK 3GDZA 4BXXC 3HOYC 1TWFK 4G7ZA 2ZUEA 4LJZA 1B4BA 1O2BA 1J98A 3K7AK 2GSNA 3GTMK 1XXCA 4MQ9A 4GTCA 2B63C 1JQWA 4YFKA 1TWAC 2JA6A 2NVQC 5EGHA 1TWHC 3GTQC 2PMZD 5JVOA 2WB1D 5M5YK 3GTLA 2JA7C 1HI9A 4KN4A 4KMDA 1DCOA 5CHPA 4LK1A 2O5JA 5IYCC 4KM8A 4A3FC 1TWGK 3GEEA 4Q4ZA 2E2HC 2R92K 5C4JC 3GTOK 1ZBSA 5EGEA 1IQ0A 4KM9A 1R9TK 3S1RK 3AD8C 4OIPA 1VH2A 3S1NK 4A3BK 2XCOA 4A3KK 2JA6K 3H0GC 2YU9K 4GZYA 4KMUA 1ZQ1C 3GEIA 2JA5C 3S0XA 2WAQD 4GTDA 1JOEA 5HL8A 3PO3C 1EH1A 5C3EC 4A3LC 3L4KA 2A68A 4MEXA 3S1QK 1TWCA 4Y52K 4PAAA 3H3VL 2XCRB 2P8TA 1PJ5A 3T02A 4C45A 1WORA 4QJVA 4G0WA 3TFIA 4A3GC 3M3YK 4A3CC 4WILA 3S15C 1I3QA 4BY7C 2E2JK 1F9NA 3N0BA 4LOWA 1ZXOA 3FKIC 5D4DA 3CQZK 2A69A 5M5XK 3I4NK 3HOXC 3AH5A 1WOOA 3S2DC 1J6WA 4O2DA 3HXAA 3QX3A 3S2HK 4BBSK 3M4OK 1SFOC 4GFQA 1Y1WA 1BDFA 2Y0SD 3HKZD 4C3IK 1I3QK 4NOIA 4P5BA 1F7UA 3GTMA 2R7ZC 1VGXA 4ZH4A 4YFNA 4G7OA 5IP7C 5C4XC 4C3HC 2CFAA 1L0WA 4GTAA 3GTGA 4BY1K 4KC6A 5M3MK 1TWFC 1XZQB 4C2MK 4KMAA 1ZYRA 4KN7A 5IYBK 2EBBA 1K83A 5TMFA 3K7AC 4C3JK 1DCPA 4Y7NK 4OIQA 1TWGA 4G0VA 1WCMA 2R92A 3MMLB 1Y1WK 3GTOA 3GTPK 5IYDK 4G7HA 1Y1VC 2NVTK 1J6XA 1EK8A 3S17K 1R9TA 1XZPA 1I50K 3HOUK 3AD7C 4OIRA 3T00A 2ZFZA 3GTJK 3ERED 1IW7A 3GTGK 2YU9A 3FOFA 4KDDA 3G4AA 1F7VA 3S1MC 2V6SA 1YCLA 1B4AA 4FZBA 1VRQC 2PMZL 3RZOK 4BXXK 1K83K 2WB1L 3HOYK 2A6EA 1IS1A 1HQMA 3BP3A 2VUMA 1G51A 4GTFA 1WCMK 4YG2A 5JFEA 4WJ4A 2GSUA 3S1NC 1O28A 2NVXA 4LK0A 4A3BC 4A3KC 2JA6C 5FLMK 5IORA 2PA8D 3A8IA 1WOSA 4ILDA 4XSXA 4A3JK 1KQ4A 2B63K 3GTLC 2D6FC 1AB4A 5C44C 4A3EC 1XXBA 5TMCA 4OINA 2E2IA 1ZVUA 1GE9A 4XLNA 3SZYA 1XZQA 1I6VA 3A8KA 2PHCB 3S1QC 5IOTA 4KAWX
chains in the Genus database with same CATH topology
4XSZA 2VUMK 4A3JC 1R9TC 3S1RC 3FKIC 2WAQL 3CQZK 5D4DA 2A69A 2CW0A 3GTJC 5M5XK 2PPBA 4QJVB 3HOZK 3I4NK 5C4JK 4Q5SA 1Y1VK 2NVXK 4OIOA 2R7ZK 4JK1A 3HOXC 4A93C 5IP7K 2YU9C 5C4XK 4A3DC 3M3YC 4X6AC 3S2DC 4A3IC 3HOWC 2PA8L 4C3HK 3RZDK 3S16K 1TWAK 4BXXC 2A6HA 3HOVK 3HOYC 4YFXA 2NVQK 1TWFK 4G7ZA 3S2HK 4BBSK 3M4OK 3WODA 1SFOC 1TWHK 3GTQK 2VUMC 1BDFA 2E2IK 2Y0SD 4LJZA 3S1MK 3HKZD 4C3IK 1I3QK 2JA7K 3HOZC 4NOIA 3I4NC 2NVXC 3K7AK 2R7ZC 4ZH4A 3GTMK 4Y52C 4YFNA 2O5IA 5IP7C 3S14K 4G7OA 5C4XC 1TWCC 5IYCK 4A3FK 3PO2C 4MQ9A 2B63C 3RZDC 2E2HK 3S16C 4YFKA 3PO3K 1TWAC 4XLPA 3HOVC 4BY1K 5FJ8K 2NVQC 5M3MK 1TWFC 3S2HC 4BBSC 3M4OC 4C2MK 1I6HC 2R93K 1TWHC 3GTQC 1I6HK 1ZYRA 4KN7A 4BBRK 5IP9K 5IYBK 2PMZD 2E2IC 2WB1D 5M5YK 1I3QC 2JA8C 4KN4A 2JA7C 2E2JC 5TMFA 3K7AC 3GTLK 4C3JK 3H0GK 4MEYA 4LK1A 5C44K 5IYCC 4Y7NK 4A3EK 4OIQA 4A3FC 4AYBD 2O5JA 1TWGK 1SMYA 3CQZC 5M5WK 4Q4ZA 1Y1WK 2E2HC 2R92K 3GTPK 5C4JC 3GTOK 4G7HA 1Y1VC 2Y0SL 2NVTK 2BE5A 5IYDK 4BY1C 3I4MK 3HKZL 4BY7K 1YNNA 3DXJA 2JA5K 1YNJA 3S17K 2R93C 3H3VD 1XPPA 1I50K 3GTKK 4BBRC 5IYBC 5IP9C 1R9TK 3HOUK 3S1RK 3S1NK 4OIPA 5C3EK 4A3LK 4A3MK 4OIRA 3GTJK 4A3BK 1IW7A 4A3KK 2JA6K 3GTGK 4QIWD 3H0GC 4Y7NC 2YU9K 2NVYK 3S1MC 4GZYA 1Y1WC 3EQLA 3S2DK 4A3IK 4KMUA 5IYDC 3HOWK 2NVTC 2PMZL 3I4MC 3RZOK 4BXXK 3GTMC 1K83K 2WB1L 3HOYK 2JA5C 2A6EA 3S17C 1HQMA 2WAQD 3GTKC 1I50C 4A3GK 1SFOK 4YG2A 1WCMK 4A3CK 3HOUC 3S15K 3PO3C 3S1NC 4LLGA 4AYBL 5C3EC 4A3MC 4A3LC 4LK0A 4A3BC 4A3KC 2JA6C 3GTGC 5FLMK 2A68A 4MEXA 3S1QK 4Y52K 2PA8D 2NVYC 5M3FK 1TWCK 4XSXA 4A3JK 3FKIK 3PO2K 3H3VL 2B63K 3GTLC 3RZOC 1K83C 3S14C 3HOXK 5C44C 4A3EC 4A93K 4QJVA 5TMCA 1TWGC 4OINA 4A3DK 3M3YK 1WCMC 4XLNA 4A3GC 4QIWL 4A3CC 2R92C 3GTPC 4X6AK 3S15C 3GTOC 1I6VA 4BY7C 2JA8K 2E2JK 5FLMC 3S1QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSZ A;  2VUM K;  4A3J C;  1R9T C;  3S1R C;  3FKI C;  2WAQ L;  3CQZ K;  5D4D A;  2A69 A;  2CW0 A;  3GTJ C;  5M5X K;  2PPB A;  4QJV B;  3HOZ K;  3I4N K;  5C4J K;  4Q5S A;  1Y1V K;  2NVX K;  4OIO A;  2R7Z K;  4JK1 A;  3HOX C;  4A93 C;  5IP7 K;  2YU9 C;  5C4X K;  4A3D C;  3M3Y C;  4X6A C;  3S2D C;  4A3I C;  3HOW C;  2PA8 L;  4C3H K;  3RZD K;  3S16 K;  1TWA K;  4BXX C;  2A6H A;  3HOV K;  3HOY C;  4YFX A;  2NVQ K;  1TWF K;  4G7Z A;  3S2H K;  4BBS K;  3M4O K;  3WOD A;  1SFO C;  1TWH K;  3GTQ K;  2VUM C;  1BDF A;  2E2I K;  2Y0S D;  4LJZ A;  3S1M K;  3HKZ D;  4C3I K;  1I3Q K;  2JA7 K;  3HOZ C;  4NOI A;  3I4N C;  2NVX C;  3K7A K;  2R7Z C;  4ZH4 A;  3GTM K;  4Y52 C;  4YFN A;  2O5I A;  5IP7 C;  3S14 K;  4G7O A;  5C4X C;  1TWC C;  5IYC K;  4A3F K;  3PO2 C;  4MQ9 A;  2B63 C;  3RZD C;  2E2H K;  3S16 C;  4YFK A;  3PO3 K;  1TWA C;  4XLP A;  3HOV C;  4BY1 K;  5FJ8 K;  2NVQ C;  5M3M K;  1TWF C;  3S2H C;  4BBS C;  3M4O C;  4C2M K;  1I6H C;  2R93 K;  1TWH C;  3GTQ C;  1I6H K;  1ZYR A;  4KN7 A;  4BBR K;  5IP9 K;  5IYB K;  2PMZ D;  2E2I C;  2WB1 D;  5M5Y K;  1I3Q C;  2JA8 C;  4KN4 A;  2JA7 C;  2E2J C;  5TMF A;  3K7A C;  3GTL K;  4C3J K;  3H0G K;  4MEY A;  4LK1 A;  5C44 K;  5IYC C;  4Y7N K;  4A3E K;  4OIQ A;  4A3F C;  4AYB D;  2O5J A;  1TWG K;  1SMY A;  3CQZ C;  5M5W K;  4Q4Z A;  1Y1W K;  2E2H C;  2R92 K;  3GTP K;  5C4J C;  3GTO K;  4G7H A;  1Y1V C;  2Y0S L;  2NVT K;  2BE5 A;  5IYD K;  4BY1 C;  3I4M K;  3HKZ L;  4BY7 K;  1YNN A;  3DXJ A;  2JA5 K;  1YNJ A;  3S17 K;  2R93 C;  3H3V D;  1XPP A;  1I50 K;  3GTK K;  4BBR C;  5IYB C;  5IP9 C;  1R9T K;  3HOU K;  3S1R K;  3S1N K;  4OIP A;  5C3E K;  4A3L K;  4A3M K;  4OIR A;  3GTJ K;  4A3B K;  1IW7 A;  4A3K K;  2JA6 K;  3GTG K;  4QIW D;  3H0G C;  4Y7N C;  2YU9 K;  2NVY K;  3S1M C;  4GZY A;  1Y1W C;  3EQL A;  3S2D K;  4A3I K;  4KMU A;  5IYD C;  3HOW K;  2NVT C;  2PMZ L;  3I4M C;  3RZO K;  4BXX K;  3GTM C;  1K83 K;  2WB1 L;  3HOY K;  2JA5 C;  2A6E A;  3S17 C;  1HQM A;  2WAQ D;  3GTK C;  1I50 C;  4A3G K;  1SFO K;  4YG2 A;  1WCM K;  4A3C K;  3HOU C;  3S15 K;  3PO3 C;  3S1N C;  4LLG A;  4AYB L;  5C3E C;  4A3M C;  4A3L C;  4LK0 A;  4A3B C;  4A3K C;  2JA6 C;  3GTG C;  5FLM K;  2A68 A;  4MEX A;  3S1Q K;  4Y52 K;  2PA8 D;  2NVY C;  5M3F K;  1TWC K;  4XSX A;  4A3J K;  3FKI K;  3PO2 K;  3H3V L;  2B63 K;  3GTL C;  3RZO C;  1K83 C;  3S14 C;  3HOX K;  5C44 C;  4A3E C;  4A93 K;  4QJV A;  5TMC A;  1TWG C;  4OIN A;  4A3D K;  3M3Y K;  1WCM C;  4XLN A;  4A3G C;  4QIW L;  4A3C C;  2R92 C;  3GTP C;  4X6A K;  3S15 C;  3GTO C;  1I6V A;  4BY7 C;  2JA8 K;  2E2J K;  5FLM C;  3S1Q C; 
#chains in the Genus database with same CATH topology
 4XSZ A;  3CQZ A;  2VUM K;  1O24 A;  4KAR A;  1JVI A;  2WAQ L;  1XXA A;  2PPB A;  3HOZ K;  5C4J K;  2NVX K;  2R93 A;  3M3Y C;  4A3I C;  1WSR A;  3HOW C;  1WOP A;  3RZD K;  3ADA C;  3S16 K;  2A6H A;  3HOV K;  4GTL A;  3SZZ A;  2E2I K;  4KAT A;  3GIR A;  3T01 A;  1DD5 A;  2GAG C;  3AQP A;  4BKW A;  3I4N C;  2O5I A;  3S14 K;  3GTK A;  1TWC C;  3PO2 C;  4RMF A;  3AD9 C;  3PO3 K;  2RGR A;  4XLP A;  2P5M A;  2RH6 A;  2V6T A;  3OEP A;  3S2H C;  4BBS C;  1DCH A;  3M4O C;  1I6H C;  2R93 K;  4BBR K;  4LR2 A;  5IP9 K;  4C3I C;  5IOQ A;  1I3Q C;  2JA8 C;  4AYB D;  3GTP A;  1SMY A;  2GAH C;  5M5W K;  1IE0 A;  4P9S A;  4GT9 A;  3TFJ A;  2Y0S L;  4BY1 C;  3I4M K;  3HKZ L;  4BY7 K;  1BJT A;  4GTB A;  3N0C A;  3DXJ A;  1YNJ A;  1I50 A;  4C2M C;  3GTK K;  4M1X A;  5IYB C;  2Y3P A;  3GTJ A;  4A3M K;  1USO A;  4C3J C;  4QIW D;  5CJ9 A;  4Y7N C;  2XCQ A;  2NVY K;  3ORE A;  1Y1W C;  3GSI A;  3S2D K;  5IYD C;  2NVT C;  2JH3 A;  3GTM C;  3S17 C;  1BS2 A;  1I50 C;  3VA7 A;  1SFO K;  3HOU C;  3LAP A;  1UV7 A;  3GTG C;  1VLO A;  2B63 A;  3TFH A;  4DDQ A;  3RZO C;  1K83 C;  1TWH A;  4A93 K;  3GTQ A;  1VJE A;  3V4G A;  1TWG C;  4A3D K;  1WCM C;  4X6A K;  3BUE A;  2R92 C;  3GTO C;  2JA7 A;  3LAJ A;  4AH6 A;  5FLM C;  1IBA A;  5E68 A;  4A3J C;  1R9T C;  3S1R C;  1PJ6 A;  2E2H A;  4PAB A;  3CAG A;  2CW0 A;  3IPJ A;  4Q5S A;  4QJV B;  1Y1V K;  2YU9 C;  1WQF A;  4KAS A;  2PA8 L;  1TWA K;  3Q3Q A;  3N3Y A;  4YFX A;  3H0G A;  1WQH A;  4P5A A;  2NVQ K;  3WOD A;  1TWH K;  3GTQ K;  2VUM C;  4XCH A;  3S1M K;  5TJ3 A;  4GTE A;  2JA7 K;  3HOZ C;  1O2F B;  1ISE A;  2NVX C;  1J6V A;  2JA5 A;  4Y52 C;  5IYC K;  4A3F K;  1RU0 A;  3JST A;  3G4C A;  1X31 C;  3BP8 C;  4KB4 A;  3RZD C;  2E2H K;  3S16 C;  4KB2 A;  3HOV C;  4J3N A;  5FJ8 K;  5IOS A;  4WJ3 M;  2V6U A;  2E2I C;  4BLB A;  1USM A;  2FQO A;  2E2J C;  3GTL K;  2CFA B;  3H0G K;  4MEY A;  5C44 K;  4A3E K;  3S14 C;  2KWA A;  3CQZ C;  1INN A;  3GEH A;  2BE5 A;  3TTG A;  1BGW A;  1YNN A;  2JA5 K;  2R93 C;  1WIH A;  3H3V D;  1XPP A;  4BBR C;  5IP9 C;  3FKI A;  1EFW A;  5C3E K;  4A3L K;  2NVY A;  1C0A A;  4FM9 A;  1WQG A;  1YX2 A;  3EQL A;  4A3I K;  4G0U A;  3HOW K;  3I4M C;  1XZP B;  2W7V A;  1O2A A;  1SFO A;  3AQO A;  3GTK C;  4A3G K;  4A3C K;  3S15 K;  3LPX A;  2FQT A;  4LLG A;  4AYB L;  4A3M C;  2R7Z A;  3FOE A;  1O25 A;  3L4J A;  3OPF A;  1IL2 A;  2NVY C;  5M3F K;  1TWC K;  1EI6 A;  4LQY A;  1O27 A;  2GSO A;  3FKI K;  3PO2 K;  4BLA A;  1WSV A;  1TWF A;  3HOX K;  1V5V A;  1I6H K;  3FHZ A;  4QIW L;  3GTP C;  2ZUF A;  5L46 A;  2JA8 K;  1F93 A;  3NUH A;  1O26 A;  3A8J A;  1Y1V A;  3GTJ C;  4OIO A;  2R7Z K;  4JK1 A;  1PJ7 A;  4A93 C;  5IP7 K;  1O29 A;  5C4X K;  4A3D C;  4KMH A;  1EQR A;  4X6A C;  1TWA A;  4C3H K;  3GDZ A;  4BXX C;  3HOY C;  1TWF K;  4G7Z A;  2ZUE A;  4LJZ A;  1B4B A;  1O2B A;  1J98 A;  3K7A K;  2GSN A;  3GTM K;  1XXC A;  4MQ9 A;  4GTC A;  2B63 C;  1JQW A;  4YFK A;  1TWA C;  2JA6 A;  2NVQ C;  5EGH A;  1TWH C;  3GTQ C;  2PMZ D;  5JVO A;  2WB1 D;  5M5Y K;  3GTL A;  2JA7 C;  1HI9 A;  4KN4 A;  4KMD A;  1DCO A;  5CHP A;  4LK1 A;  2O5J A;  5IYC C;  4KM8 A;  4A3F C;  1TWG K;  3GEE A;  4Q4Z A;  2E2H C;  2R92 K;  5C4J C;  3GTO K;  1ZBS A;  5EGE A;  1IQ0 A;  4KM9 A;  1R9T K;  3S1R K;  3AD8 C;  4OIP A;  1VH2 A;  3S1N K;  4A3B K;  2XCO A;  4A3K K;  2JA6 K;  3H0G C;  2YU9 K;  4GZY A;  4KMU A;  1ZQ1 C;  3GEI A;  2JA5 C;  3S0X A;  2WAQ D;  4GTD A;  1JOE A;  5HL8 A;  3PO3 C;  1EH1 A;  5C3E C;  4A3L C;  3L4K A;  2A68 A;  4MEX A;  3S1Q K;  1TWC A;  4Y52 K;  4PAA A;  3H3V L;  2XCR B;  2P8T A;  1PJ5 A;  3T02 A;  4C45 A;  1WOR A;  4QJV A;  4G0W A;  3TFI A;  4A3G C;  3M3Y K;  4A3C C;  4WIL A;  3S15 C;  1I3Q A;  4BY7 C;  2E2J K;  1F9N A;  3N0B A;  4LOW A;  1ZXO A;  3FKI C;  5D4D A;  3CQZ K;  2A69 A;  5M5X K;  3I4N K;  3HOX C;  3AH5 A;  1WOO A;  3S2D C;  1J6W A;  4O2D A;  3HXA A;  3QX3 A;  3S2H K;  4BBS K;  3M4O K;  1SFO C;  4GFQ A;  1Y1W A;  1BDF A;  2Y0S D;  3HKZ D;  4C3I K;  1I3Q K;  4NOI A;  4P5B A;  1F7U A;  3GTM A;  2R7Z C;  1VGX A;  4ZH4 A;  4YFN A;  4G7O A;  5IP7 C;  5C4X C;  4C3H C;  2CFA A;  1L0W A;  4GTA A;  3GTG A;  4BY1 K;  4KC6 A;  5M3M K;  1TWF C;  1XZQ B;  4C2M K;  4KMA A;  1ZYR A;  4KN7 A;  5IYB K;  2EBB A;  1K83 A;  5TMF A;  3K7A C;  4C3J K;  1DCP A;  4Y7N K;  4OIQ A;  1TWG A;  4G0V A;  1WCM A;  2R92 A;  3MML B;  1Y1W K;  3GTO A;  3GTP K;  5IYD K;  4G7H A;  1Y1V C;  2NVT K;  1J6X A;  1EK8 A;  3S17 K;  1R9T A;  1XZP A;  1I50 K;  3HOU K;  3AD7 C;  4OIR A;  3T00 A;  2ZFZ A;  3GTJ K;  3ERE D;  1IW7 A;  3GTG K;  2YU9 A;  3FOF A;  4KDD A;  3G4A A;  1F7V A;  3S1M C;  2V6S A;  1YCL A;  1B4A A;  4FZB A;  1VRQ C;  2PMZ L;  3RZO K;  4BXX K;  1K83 K;  2WB1 L;  3HOY K;  2A6E A;  1IS1 A;  1HQM A;  3BP3 A;  2VUM A;  1G51 A;  4GTF A;  1WCM K;  4YG2 A;  5JFE A;  4WJ4 A;  2GSU A;  3S1N C;  1O28 A;  2NVX A;  4LK0 A;  4A3B C;  4A3K C;  2JA6 C;  5FLM K;  5IOR A;  2PA8 D;  3A8I A;  1WOS A;  4ILD A;  4XSX A;  4A3J K;  1KQ4 A;  2B63 K;  3GTL C;  2D6F C;  1AB4 A;  5C44 C;  4A3E C;  1XXB A;  5TMC A;  4OIN A;  2E2I A;  1ZVU A;  1GE9 A;  4XLN A;  3SZY A;  1XZQ A;  1I6V A;  3A8K A;  2PHC B;  3S1Q C;  5IOT A;  4KAW X; 
#chains in the Genus database with same CATH homology
 4XSZ A;  2VUM K;  4A3J C;  1R9T C;  3S1R C;  3FKI C;  2WAQ L;  3CQZ K;  5D4D A;  2A69 A;  2CW0 A;  3GTJ C;  5M5X K;  2PPB A;  4QJV B;  3HOZ K;  3I4N K;  5C4J K;  4Q5S A;  1Y1V K;  2NVX K;  4OIO A;  2R7Z K;  4JK1 A;  3HOX C;  4A93 C;  5IP7 K;  2YU9 C;  5C4X K;  4A3D C;  3M3Y C;  4X6A C;  3S2D C;  4A3I C;  3HOW C;  2PA8 L;  4C3H K;  3RZD K;  3S16 K;  1TWA K;  4BXX C;  2A6H A;  3HOV K;  3HOY C;  4YFX A;  2NVQ K;  1TWF K;  4G7Z A;  3S2H K;  4BBS K;  3M4O K;  3WOD A;  1SFO C;  1TWH K;  3GTQ K;  2VUM C;  1BDF A;  2E2I K;  2Y0S D;  4LJZ A;  3S1M K;  3HKZ D;  4C3I K;  1I3Q K;  2JA7 K;  3HOZ C;  4NOI A;  3I4N C;  2NVX C;  3K7A K;  2R7Z C;  4ZH4 A;  3GTM K;  4Y52 C;  4YFN A;  2O5I A;  5IP7 C;  3S14 K;  4G7O A;  5C4X C;  1TWC C;  5IYC K;  4A3F K;  3PO2 C;  4MQ9 A;  2B63 C;  3RZD C;  2E2H K;  3S16 C;  4YFK A;  3PO3 K;  1TWA C;  4XLP A;  3HOV C;  4BY1 K;  5FJ8 K;  2NVQ C;  5M3M K;  1TWF C;  3S2H C;  4BBS C;  3M4O C;  4C2M K;  1I6H C;  2R93 K;  1TWH C;  3GTQ C;  1I6H K;  1ZYR A;  4KN7 A;  4BBR K;  5IP9 K;  5IYB K;  2PMZ D;  2E2I C;  2WB1 D;  5M5Y K;  1I3Q C;  2JA8 C;  4KN4 A;  2JA7 C;  2E2J C;  5TMF A;  3K7A C;  3GTL K;  4C3J K;  3H0G K;  4MEY A;  4LK1 A;  5C44 K;  5IYC C;  4Y7N K;  4A3E K;  4OIQ A;  4A3F C;  4AYB D;  2O5J A;  1TWG K;  1SMY A;  3CQZ C;  5M5W K;  4Q4Z A;  1Y1W K;  2E2H C;  2R92 K;  3GTP K;  5C4J C;  3GTO K;  4G7H A;  1Y1V C;  2Y0S L;  2NVT K;  2BE5 A;  5IYD K;  4BY1 C;  3I4M K;  3HKZ L;  4BY7 K;  1YNN A;  3DXJ A;  2JA5 K;  1YNJ A;  3S17 K;  2R93 C;  3H3V D;  1XPP A;  1I50 K;  3GTK K;  4BBR C;  5IYB C;  5IP9 C;  1R9T K;  3HOU K;  3S1R K;  3S1N K;  4OIP A;  5C3E K;  4A3L K;  4A3M K;  4OIR A;  3GTJ K;  4A3B K;  1IW7 A;  4A3K K;  2JA6 K;  3GTG K;  4QIW D;  3H0G C;  4Y7N C;  2YU9 K;  2NVY K;  3S1M C;  4GZY A;  1Y1W C;  3EQL A;  3S2D K;  4A3I K;  4KMU A;  5IYD C;  3HOW K;  2NVT C;  2PMZ L;  3I4M C;  3RZO K;  4BXX K;  3GTM C;  1K83 K;  2WB1 L;  3HOY K;  2JA5 C;  2A6E A;  3S17 C;  1HQM A;  2WAQ D;  3GTK C;  1I50 C;  4A3G K;  1SFO K;  4YG2 A;  1WCM K;  4A3C K;  3HOU C;  3S15 K;  3PO3 C;  3S1N C;  4LLG A;  4AYB L;  5C3E C;  4A3M C;  4A3L C;  4LK0 A;  4A3B C;  4A3K C;  2JA6 C;  3GTG C;  5FLM K;  2A68 A;  4MEX A;  3S1Q K;  4Y52 K;  2PA8 D;  2NVY C;  5M3F K;  1TWC K;  4XSX A;  4A3J K;  3FKI K;  3PO2 K;  3H3V L;  2B63 K;  3GTL C;  3RZO C;  1K83 C;  3S14 C;  3HOX K;  5C44 C;  4A3E C;  4A93 K;  4QJV A;  5TMC A;  1TWG C;  4OIN A;  4A3D K;  3M3Y K;  1WCM C;  4XLN A;  4A3G C;  4QIW L;  4A3C C;  2R92 C;  3GTP C;  4X6A K;  3S15 C;  3GTO C;  1I6V A;  4BY7 C;  2JA8 K;  2E2J K;  5FLM C;  3S1Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...