3FKIK

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3fkiK00
3M3YK 3H0GK 4A93C 3FKIK 4LK0A 4A3BC 1K83K 4BXXC 3S16C 3PO2K 2NVQC 3HOXC 3HKZD 3GTOK 4A3MC 4A3IC 1Y1VC 4KMUA 3GTJK 3HOVC 2PA8L 3I4NC 1I3QC 4G7ZA 2WB1D 4YFXA 4BBSC 1TWHC 2O5JA 5IP7K 4X6AC 3HOWK 4Q5SA 1I6HK 4A3DC 1YNNA 3S1MK 2E2JC 5IYCK 3S1RK 3S2DK 4QIWD 2R7ZK 3HOUK 4JK1A 4AYBL 3H3VL 2NVXC 2WAQD 4A3KC 3S2HK 3S17C 2YU9C 1BDFA 5C3EK 1TWCC 2R93K 2A6EA 2E2IC 2E2HC 5FJ8K 5M3FK 4A3EK 2JA6K 3GTMC 3S14C 4A3LC 4C3JK 3M3YC 4Y7NC 4BY7C 4GZYA 5TMFA 2JA5K 4A3GC 5D4DA 4A3BK 3K7AK 1TWHK 5M5WK 4Y52K 3PO2C 1TWGC 1IW7A 4OIQA 2R92C 3S1QC 4A3DK 4LK1A 4QJVA 3HOZK 4LLGA 3GTJC 1YNJA 2PMZD 3I4NK 5C44C 5C4XC 4BY1C 1TWAK 4BXXK 1TWFK 1WCMK 3GTPC 1ZYRA 1I6HC 2Y0SL 4KN4A 3HOXK 4NOIA 3S15K 4MEYA 5IYBK 3WODA 5TMCA 3H0GC 2R7ZC 1R9TC 3I4MC 4XSZA 1SMYA 4BBRC 4C3IK 5M5YK 4A3FC 2NVTC 4MQ9A 2VUMK 4QJVB 3S2HC 4XSXA 4A3JC 3GTQC 1TWCK 4X6AK 3PO3K 4YFKA 4C3HK 4OIOA 4YFNA 4A3EC 2JA8C 2B63C 2CW0A 3S1QK 5IYDK 4A3IK 1SFOC 2JA5C 3S2DC 4BY1K 2BE5A 4OINA 2NVYC 3HOYC 1TWAC 2PPBA 4YG2A 4A3CC 3HKZL 1I6VA 3GTPK 4BBSK 3CQZC 3RZDK 2JA7K 5C3EC 5IP7C 5FLMK 3GTKC 2PA8D 4A3LK 1Y1WC 2WB1L 5IYBC 4XLNA 4Y7NK 4A3MK 3S1NC 3S1RC 1Y1VK 3HOVK 4BBRK 2A69A 5IP9K 2VUMC 3FKIC 3M4OC 4Y52C 4A3KK 1K83C 2JA8K 3S16K 4QIWL 5IYDC 2B63K 2E2HK 4AYBD 3GTMK 3H3VD 4MEXA 3GTLK 2WAQL 3HOZC 2E2JK 3RZOC 4LJZA 1R9TK 4OIPA 4A3GK 3GTGK 3GTGC 3HOUC 2NVTK 5M3MK 1I3QK 2NVXK 2JA7C 5FLMC 3GTKK 1TWGK 2A6HA 2R93C 1I50K 2NVQK 5C4JK 5M5XK 3GTOC 5IYCC 5IP9C 3HOYK 5C44K 5C4XK 4A93K 3M4OK 4A3FK 3K7AC 4G7HA 4G7OA 3CQZK 4A3JK 1TWFC 1WCMC 3RZDC 4OIRA 3EQLA 3GTQK 2A68A 4ZH4A 2PMZL 4Q4ZA 2YU9K 2R92K 3GTLC 4XLPA 3S14K 1SFOK 1XPPA 3S15C 3S1MC 4C2MK 3I4MK 4BY7K 2NVYK 2Y0SD 2O5IA 4A3CK 1I50C 3PO3C 1HQMA 3S17K 5C4JC 3DXJA 1Y1WK 4KN7A 2E2IK 3HOWC 2JA6C 3RZOK 3S1NK
chains in the Genus database with same CATH superfamily
3M3YK 1WSVA 3H0GK 4A93C 4BXXC 1O2AA 1XZPB 3GIRA 1DCOA 4A3MC 2E2IA 4KMHA 1WIHA 4C45A 2WB1D 5IORA 1G51A 5IOQA 4KDDA 3S1MK 5JVOA 3S2DK 4QIWD 2ZUFA 3HOUK 4AYBL 3H3VL 1JOEA 4A3KC 2R93K 5EGHA 1TWCC 3A8IA 4BY7C 1F9NA 1TWHK 4Y52K 2XCQA 2R93A 4GFQA 5L46A 3GTJC 2PMZD 4M1XA 5C4XC 4BY1C 2CFAA 1I6HC 1USMA 2V6UA 2Y0SL 3S15K 3WODA 3H0GC 1R9TC 3GDZA 4G0VA 4C3IK 4BBRC 3GTQC 4X6AK 4YFKA 1AB4A 1Y1VA 3T01A 1WSRA 3BP8C 2PPBA 4YG2A 4KC6A 4A3CC 2PHCB 1O25A 2E2HA 3CQZC 4GTCA 3N0BA 3AQPA 1Y1WC 1R9TA 5IYBC 3HOVK 1I3QA 3GTKA 1C0AA 3M4OC 4A3KK 1VRQC 1XZPA 4BLAA 3GTLK 2WAQL 4LJZA 4WJ3M 1I3QK 5FLMC 4O2DA 5CJ9A 3GTOC 4PAAA 5IP9C 5C4XK 4A93K 4A3FK 4G7OA 4G7HA 3RZDC 4A3JK 1O27A 4OIRA 4KASA 4ZH4A 4Q4ZA 3AQOA 1SFOK 3S15C 3AD9C 3SZYA 3T00A 2O5IA 1I50C 5IOTA 3FOFA 4KN7A 2E2IK 3RZOK 3G4AA 4KMDA 1BGWA 3FKIK 4A3BC 1K83K 4KMAA 3VA7A 3QX3A 3PO2K 3S16C 2NVQC 5CHPA 4KMUA 3HOVC 3I4NC 3OEPA 1TWHC 2JA6A 1JQWA 3HOWK 3NUHA 2JA5A 1YNNA 3AH5A 1ZQ1C 4LR2A 2R7ZK 3GTOA 4JK1A 5EGEA 3A8JA 3FHZA 3MMLB 3S17C 1O29A 5TJ3A 5M3FK 2E2HC 2JA6K 3S14C 4C3JK 4Y7NC 4A3GC 1IW7A 4OIQA 4A3DK 4G0UA 4QJVA 3HOZK 4BXXK 2XCOA 1J6XA 1ZYRA 1F7VA 4KN4A 5IYBK 5TMCA 1SMYA 1JVIA 2NVTC 4MQ9A 3S2HC 4KB2A 4XSXA 3S1QK 4OIOA 4A3EC 2CW0A 2JA5C 3S2DC 2BE5A 2NVYC 3GTPK 4WILA 3GTGA 5FLMK 4GTFA 4XLNA 1WQFA 3S1NC 2ZUEA 1Y1VK 1VLOA 2A69A 5IP9K 2VUMC 1BS2A 1I50A 4Y52C 2FQTA 2JA8K 2E2HK 4AYBD 4RMFA 4KB4A 2JH3A 1PJ6A 3GEHA 4A3GK 3N0CA 2W7VA 3GTGC 2JA7C 4KM8A 2A6HA 1I50K 3G4CA 5M5XK 2NVYA 5IYCC 2V6TA 5E68A 3HOYK 3GTQK 1IL2A 2RH6A 2YU9K 2PMZL 1F7UA 2NVXA 1TWGA 1XPPA 3S1MC 1EK8A 4A3CK 1EH1A 4LOWA 3DXJA 1Y1WK 4P5BA 3HOWC 2EBBA 2YU9A 3GSIA 4J3NA 4KM9A 1DCHA 1O26A 1XZQB 3HKZD 4KAWX 3HOXC 2D6FC 1GE9A 1Y1VC 3OREA 3GTJK 3ERED 2PA8L 1I3QC 3H0GA 4G7ZA 4YFXA 5IP7K 1K83A 4Q5SA 4LQYA 1KQ4A 3SZZA 1I6HK 4A3DC 3S1RK 1TWHA 1DCPA 4GTBA 3GTJA 2WAQD 4KARA 1BDFA 1L0WA 5C3EK 5FJ8K 4A3LC 3M3YC 4GZYA 1DD5A 1XXAA 5D4DA 3S0XA 3S1QC 4LK1A 3LPXA 2KWAA 4XCHA 1O2FB 1TWCA 2P8TA 1IQ0A 3GTPC 3OPFA 4NOIA 4GTEA 4MEYA 4GT9A 3GTPA 4XSZA 2VUMK 5IOSA 4QJVB 2XCRB 1TWCK 3PO3K 1TWAA 4C3HK 2JA8C 2CFAB 4YFNA 3TTGA 1O24A 3T02A 1WOPA 3L4JA 4OINA 1TWAC 1UV7A 1INNA 1WQHA 3GTMA 3RZDK 2JA7K 5IP7C 2Y3PA 1B4BA 2VUMA 2GSNA 3AD8C 4WJ4A 2WB1L 4Y7NK 3N3YA 3S1RC 2ZFZA 1RU0A 1XZQA 1VH2A 5JFEA 1EI6A 4QIWL 5IYDC 2B63K 3H3VD 2JA7A 4MEXA 3HOZC 1ISEA 2E2JK 3RZOC 1R9TK 4OIPA 3CQZA 4C3IC 2GAHC 2NVXK 1X31C 3GTKK 4AH6A 2V6SA 4BKWA 2NVQK 3GTLA 1O2BA 3K7AC 3CQZK 2A68A 1ZBSA 2R92K 1HI9A 1VJEA 1WORA 3FKIA 4BY7K 1J6VA 2NVYK 2Y0SD 3PO3C 1HQMA 4ILDA 5C4JC 3S17K 2FQOA 2JA6C 3S1NK 4C3JC 1B4AA 4G0WA 4LK0A 1ZXOA 3GEEA 4DDQA 3GTOK 4GTDA 1J98A 4A3IC 3ADAC 3LAPA 4PABA 3HXAA 4BBSC 2O5JA 1XXCA 4X6AC 4FM9A 2E2JC 5IYCK 1VGXA 2NVXC 3S2HK 2YU9C 2A6EA 2E2IC 4BLBA 3TFJA 4A3EK 4GTAA 3GTMC 4P5AA 5TMFA 2JA5K 3BP3A 4A3BK 3K7AK 2R7ZA 5M5WK 3PO2C 1TWGC 2R92C 4GTLA 1YX2A 4C3HC 1PJ5A 1USOA 1WOOA 4LLGA 1PJ7A 1YNJA 3I4NK 5C44C 1TWAK 1WQGA 3BUEA 1TWFK 1WCMK 3GEIA 3HOXK 3TFIA 4KATA 2R7ZC 1EFWA 4C2MC 3I4MC 3GTGK 5M5YK 3V4GA 4A3FC 3JSTA 4A3JC 1V5VA 2P5MA 1EQRA 1TWFA 1J6WA 1WCMA 2B63C 5IYDK 4A3IK 1SFOC 3AD7C 4BY1K 3HOYC 3HKZL 1I6VA 4BBSK 5C3EC 3GTKC 2PA8D 4A3LK 2GSOA 4A3MK 1O28A 4BBRK 3FKIC 1K83C 4FZBA 3S16K 3GTMK 2RGRA 4P9SA 3HOUC 2NVTK 5M3MK 3LAJA 3L4KA 1TWGK 1IS1A 2R93C 1IBAA 3TFHA 1SFOA 5C4JK 2B63A 5C44K 3M4OK 1WOSA 1TWFC 1WCMC 1Y1WA 3EQLA 3CAGA 1XXBA 3GTLC 5HL8A 4XLPA 3S14K 2GSUA 3A8KA 3IPJA 4C2MK 3I4MK 1IE0A 3FOEA 1F93A 1ZVUA 1BJTA 3Q3QA 3GTQA 2GAGC 1YCLA 2R92A
chains in the Genus database with same CATH topology
3M3YK 3H0GK 4A93C 3FKIK 4LK0A 4A3BC 1K83K 4BXXC 3S16C 3PO2K 2NVQC 3HOXC 3HKZD 3GTOK 4A3MC 4A3IC 1Y1VC 4KMUA 3GTJK 3HOVC 2PA8L 3I4NC 1I3QC 4G7ZA 2WB1D 4YFXA 4BBSC 1TWHC 2O5JA 5IP7K 4X6AC 3HOWK 4Q5SA 1I6HK 4A3DC 1YNNA 3S1MK 2E2JC 5IYCK 3S1RK 3S2DK 4QIWD 2R7ZK 3HOUK 4JK1A 4AYBL 3H3VL 2NVXC 2WAQD 4A3KC 3S2HK 3S17C 2YU9C 1BDFA 5C3EK 1TWCC 2R93K 2A6EA 2E2IC 2E2HC 5FJ8K 5M3FK 4A3EK 2JA6K 3GTMC 3S14C 4A3LC 4C3JK 3M3YC 4Y7NC 4BY7C 4GZYA 5TMFA 2JA5K 4A3GC 5D4DA 4A3BK 3K7AK 1TWHK 5M5WK 4Y52K 3PO2C 1TWGC 1IW7A 4OIQA 2R92C 3S1QC 4A3DK 4LK1A 4QJVA 3HOZK 4LLGA 3GTJC 1YNJA 2PMZD 3I4NK 5C44C 5C4XC 4BY1C 1TWAK 4BXXK 1TWFK 1WCMK 3GTPC 1ZYRA 1I6HC 2Y0SL 4KN4A 3HOXK 4NOIA 3S15K 4MEYA 5IYBK 3WODA 5TMCA 3H0GC 2R7ZC 1R9TC 3I4MC 4XSZA 1SMYA 4BBRC 4C3IK 5M5YK 4A3FC 2NVTC 4MQ9A 2VUMK 4QJVB 3S2HC 4XSXA 4A3JC 3GTQC 1TWCK 4X6AK 3PO3K 4YFKA 4C3HK 4OIOA 4YFNA 4A3EC 2JA8C 2B63C 2CW0A 3S1QK 5IYDK 4A3IK 1SFOC 2JA5C 3S2DC 4BY1K 2BE5A 4OINA 2NVYC 3HOYC 1TWAC 2PPBA 4YG2A 4A3CC 3HKZL 1I6VA 3GTPK 4BBSK 3CQZC 3RZDK 2JA7K 5C3EC 5IP7C 5FLMK 3GTKC 2PA8D 4A3LK 1Y1WC 2WB1L 5IYBC 4XLNA 4Y7NK 4A3MK 3S1NC 3S1RC 1Y1VK 3HOVK 4BBRK 2A69A 5IP9K 2VUMC 3FKIC 3M4OC 4Y52C 4A3KK 1K83C 2JA8K 3S16K 4QIWL 5IYDC 2B63K 2E2HK 4AYBD 3GTMK 3H3VD 4MEXA 3GTLK 2WAQL 3HOZC 2E2JK 3RZOC 4LJZA 1R9TK 4OIPA 4A3GK 3GTGK 3GTGC 3HOUC 2NVTK 5M3MK 1I3QK 2NVXK 2JA7C 5FLMC 3GTKK 1TWGK 2A6HA 2R93C 1I50K 2NVQK 5C4JK 5M5XK 3GTOC 5IYCC 5IP9C 3HOYK 5C44K 5C4XK 4A93K 3M4OK 4A3FK 3K7AC 4G7HA 4G7OA 3CQZK 4A3JK 1TWFC 1WCMC 3RZDC 4OIRA 3EQLA 3GTQK 2A68A 4ZH4A 2PMZL 4Q4ZA 2YU9K 2R92K 3GTLC 4XLPA 3S14K 1SFOK 1XPPA 3S15C 3S1MC 4C2MK 3I4MK 4BY7K 2NVYK 2Y0SD 2O5IA 4A3CK 1I50C 3PO3C 1HQMA 3S17K 5C4JC 3DXJA 1Y1WK 4KN7A 2E2IK 3HOWC 2JA6C 3RZOK 3S1NK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y K;  3H0G K;  4A93 C;  3FKI K;  4LK0 A;  4A3B C;  1K83 K;  4BXX C;  3S16 C;  3PO2 K;  2NVQ C;  3HOX C;  3HKZ D;  3GTO K;  4A3M C;  4A3I C;  1Y1V C;  4KMU A;  3GTJ K;  3HOV C;  2PA8 L;  3I4N C;  1I3Q C;  4G7Z A;  2WB1 D;  4YFX A;  4BBS C;  1TWH C;  2O5J A;  5IP7 K;  4X6A C;  3HOW K;  4Q5S A;  1I6H K;  4A3D C;  1YNN A;  3S1M K;  2E2J C;  5IYC K;  3S1R K;  3S2D K;  4QIW D;  2R7Z K;  3HOU K;  4JK1 A;  4AYB L;  3H3V L;  2NVX C;  2WAQ D;  4A3K C;  3S2H K;  3S17 C;  2YU9 C;  1BDF A;  5C3E K;  1TWC C;  2R93 K;  2A6E A;  2E2I C;  2E2H C;  5FJ8 K;  5M3F K;  4A3E K;  2JA6 K;  3GTM C;  3S14 C;  4A3L C;  4C3J K;  3M3Y C;  4Y7N C;  4BY7 C;  4GZY A;  5TMF A;  2JA5 K;  4A3G C;  5D4D A;  4A3B K;  3K7A K;  1TWH K;  5M5W K;  4Y52 K;  3PO2 C;  1TWG C;  1IW7 A;  4OIQ A;  2R92 C;  3S1Q C;  4A3D K;  4LK1 A;  4QJV A;  3HOZ K;  4LLG A;  3GTJ C;  1YNJ A;  2PMZ D;  3I4N K;  5C44 C;  5C4X C;  4BY1 C;  1TWA K;  4BXX K;  1TWF K;  1WCM K;  3GTP C;  1ZYR A;  1I6H C;  2Y0S L;  4KN4 A;  3HOX K;  4NOI A;  3S15 K;  4MEY A;  5IYB K;  3WOD A;  5TMC A;  3H0G C;  2R7Z C;  1R9T C;  3I4M C;  4XSZ A;  1SMY A;  4BBR C;  4C3I K;  5M5Y K;  4A3F C;  2NVT C;  4MQ9 A;  2VUM K;  4QJV B;  3S2H C;  4XSX A;  4A3J C;  3GTQ C;  1TWC K;  4X6A K;  3PO3 K;  4YFK A;  4C3H K;  4OIO A;  4YFN A;  4A3E C;  2JA8 C;  2B63 C;  2CW0 A;  3S1Q K;  5IYD K;  4A3I K;  1SFO C;  2JA5 C;  3S2D C;  4BY1 K;  2BE5 A;  4OIN A;  2NVY C;  3HOY C;  1TWA C;  2PPB A;  4YG2 A;  4A3C C;  3HKZ L;  1I6V A;  3GTP K;  4BBS K;  3CQZ C;  3RZD K;  2JA7 K;  5C3E C;  5IP7 C;  5FLM K;  3GTK C;  2PA8 D;  4A3L K;  1Y1W C;  2WB1 L;  5IYB C;  4XLN A;  4Y7N K;  4A3M K;  3S1N C;  3S1R C;  1Y1V K;  3HOV K;  4BBR K;  2A69 A;  5IP9 K;  2VUM C;  3FKI C;  3M4O C;  4Y52 C;  4A3K K;  1K83 C;  2JA8 K;  3S16 K;  4QIW L;  5IYD C;  2B63 K;  2E2H K;  4AYB D;  3GTM K;  3H3V D;  4MEX A;  3GTL K;  2WAQ L;  3HOZ C;  2E2J K;  3RZO C;  4LJZ A;  1R9T K;  4OIP A;  4A3G K;  3GTG K;  3GTG C;  3HOU C;  2NVT K;  5M3M K;  1I3Q K;  2NVX K;  2JA7 C;  5FLM C;  3GTK K;  1TWG K;  2A6H A;  2R93 C;  1I50 K;  2NVQ K;  5C4J K;  5M5X K;  3GTO C;  5IYC C;  5IP9 C;  3HOY K;  5C44 K;  5C4X K;  4A93 K;  3M4O K;  4A3F K;  3K7A C;  4G7H A;  4G7O A;  3CQZ K;  4A3J K;  1TWF C;  1WCM C;  3RZD C;  4OIR A;  3EQL A;  3GTQ K;  2A68 A;  4ZH4 A;  2PMZ L;  4Q4Z A;  2YU9 K;  2R92 K;  3GTL C;  4XLP A;  3S14 K;  1SFO K;  1XPP A;  3S15 C;  3S1M C;  4C2M K;  3I4M K;  4BY7 K;  2NVY K;  2Y0S D;  2O5I A;  4A3C K;  1I50 C;  3PO3 C;  1HQM A;  3S17 K;  5C4J C;  3DXJ A;  1Y1W K;  4KN7 A;  2E2I K;  3HOW C;  2JA6 C;  3RZO K;  3S1N K; 
#chains in the Genus database with same CATH topology
 3M3Y K;  1WSV A;  3H0G K;  4A93 C;  4BXX C;  1O2A A;  1XZP B;  3GIR A;  1DCO A;  4A3M C;  2E2I A;  4KMH A;  1WIH A;  4C45 A;  2WB1 D;  5IOR A;  1G51 A;  5IOQ A;  4KDD A;  3S1M K;  5JVO A;  3S2D K;  4QIW D;  2ZUF A;  3HOU K;  4AYB L;  3H3V L;  1JOE A;  4A3K C;  2R93 K;  5EGH A;  1TWC C;  3A8I A;  4BY7 C;  1F9N A;  1TWH K;  4Y52 K;  2XCQ A;  2R93 A;  4GFQ A;  5L46 A;  3GTJ C;  2PMZ D;  4M1X A;  5C4X C;  4BY1 C;  2CFA A;  1I6H C;  1USM A;  2V6U A;  2Y0S L;  3S15 K;  3WOD A;  3H0G C;  1R9T C;  3GDZ A;  4G0V A;  4C3I K;  4BBR C;  3GTQ C;  4X6A K;  4YFK A;  1AB4 A;  1Y1V A;  3T01 A;  1WSR A;  3BP8 C;  2PPB A;  4YG2 A;  4KC6 A;  4A3C C;  2PHC B;  1O25 A;  2E2H A;  3CQZ C;  4GTC A;  3N0B A;  3AQP A;  1Y1W C;  1R9T A;  5IYB C;  3HOV K;  1I3Q A;  3GTK A;  1C0A A;  3M4O C;  4A3K K;  1VRQ C;  1XZP A;  4BLA A;  3GTL K;  2WAQ L;  4LJZ A;  4WJ3 M;  1I3Q K;  5FLM C;  4O2D A;  5CJ9 A;  3GTO C;  4PAA A;  5IP9 C;  5C4X K;  4A93 K;  4A3F K;  4G7O A;  4G7H A;  3RZD C;  4A3J K;  1O27 A;  4OIR A;  4KAS A;  4ZH4 A;  4Q4Z A;  3AQO A;  1SFO K;  3S15 C;  3AD9 C;  3SZY A;  3T00 A;  2O5I A;  1I50 C;  5IOT A;  3FOF A;  4KN7 A;  2E2I K;  3RZO K;  3G4A A;  4KMD A;  1BGW A;  3FKI K;  4A3B C;  1K83 K;  4KMA A;  3VA7 A;  3QX3 A;  3PO2 K;  3S16 C;  2NVQ C;  5CHP A;  4KMU A;  3HOV C;  3I4N C;  3OEP A;  1TWH C;  2JA6 A;  1JQW A;  3HOW K;  3NUH A;  2JA5 A;  1YNN A;  3AH5 A;  1ZQ1 C;  4LR2 A;  2R7Z K;  3GTO A;  4JK1 A;  5EGE A;  3A8J A;  3FHZ A;  3MML B;  3S17 C;  1O29 A;  5TJ3 A;  5M3F K;  2E2H C;  2JA6 K;  3S14 C;  4C3J K;  4Y7N C;  4A3G C;  1IW7 A;  4OIQ A;  4A3D K;  4G0U A;  4QJV A;  3HOZ K;  4BXX K;  2XCO A;  1J6X A;  1ZYR A;  1F7V A;  4KN4 A;  5IYB K;  5TMC A;  1SMY A;  1JVI A;  2NVT C;  4MQ9 A;  3S2H C;  4KB2 A;  4XSX A;  3S1Q K;  4OIO A;  4A3E C;  2CW0 A;  2JA5 C;  3S2D C;  2BE5 A;  2NVY C;  3GTP K;  4WIL A;  3GTG A;  5FLM K;  4GTF A;  4XLN A;  1WQF A;  3S1N C;  2ZUE A;  1Y1V K;  1VLO A;  2A69 A;  5IP9 K;  2VUM C;  1BS2 A;  1I50 A;  4Y52 C;  2FQT A;  2JA8 K;  2E2H K;  4AYB D;  4RMF A;  4KB4 A;  2JH3 A;  1PJ6 A;  3GEH A;  4A3G K;  3N0C A;  2W7V A;  3GTG C;  2JA7 C;  4KM8 A;  2A6H A;  1I50 K;  3G4C A;  5M5X K;  2NVY A;  5IYC C;  2V6T A;  5E68 A;  3HOY K;  3GTQ K;  1IL2 A;  2RH6 A;  2YU9 K;  2PMZ L;  1F7U A;  2NVX A;  1TWG A;  1XPP A;  3S1M C;  1EK8 A;  4A3C K;  1EH1 A;  4LOW A;  3DXJ A;  1Y1W K;  4P5B A;  3HOW C;  2EBB A;  2YU9 A;  3GSI A;  4J3N A;  4KM9 A;  1DCH A;  1O26 A;  1XZQ B;  3HKZ D;  4KAW X;  3HOX C;  2D6F C;  1GE9 A;  1Y1V C;  3ORE A;  3GTJ K;  3ERE D;  2PA8 L;  1I3Q C;  3H0G A;  4G7Z A;  4YFX A;  5IP7 K;  1K83 A;  4Q5S A;  4LQY A;  1KQ4 A;  3SZZ A;  1I6H K;  4A3D C;  3S1R K;  1TWH A;  1DCP A;  4GTB A;  3GTJ A;  2WAQ D;  4KAR A;  1BDF A;  1L0W A;  5C3E K;  5FJ8 K;  4A3L C;  3M3Y C;  4GZY A;  1DD5 A;  1XXA A;  5D4D A;  3S0X A;  3S1Q C;  4LK1 A;  3LPX A;  2KWA A;  4XCH A;  1O2F B;  1TWC A;  2P8T A;  1IQ0 A;  3GTP C;  3OPF A;  4NOI A;  4GTE A;  4MEY A;  4GT9 A;  3GTP A;  4XSZ A;  2VUM K;  5IOS A;  4QJV B;  2XCR B;  1TWC K;  3PO3 K;  1TWA A;  4C3H K;  2JA8 C;  2CFA B;  4YFN A;  3TTG A;  1O24 A;  3T02 A;  1WOP A;  3L4J A;  4OIN A;  1TWA C;  1UV7 A;  1INN A;  1WQH A;  3GTM A;  3RZD K;  2JA7 K;  5IP7 C;  2Y3P A;  1B4B A;  2VUM A;  2GSN A;  3AD8 C;  4WJ4 A;  2WB1 L;  4Y7N K;  3N3Y A;  3S1R C;  2ZFZ A;  1RU0 A;  1XZQ A;  1VH2 A;  5JFE A;  1EI6 A;  4QIW L;  5IYD C;  2B63 K;  3H3V D;  2JA7 A;  4MEX A;  3HOZ C;  1ISE A;  2E2J K;  3RZO C;  1R9T K;  4OIP A;  3CQZ A;  4C3I C;  2GAH C;  2NVX K;  1X31 C;  3GTK K;  4AH6 A;  2V6S A;  4BKW A;  2NVQ K;  3GTL A;  1O2B A;  3K7A C;  3CQZ K;  2A68 A;  1ZBS A;  2R92 K;  1HI9 A;  1VJE A;  1WOR A;  3FKI A;  4BY7 K;  1J6V A;  2NVY K;  2Y0S D;  3PO3 C;  1HQM A;  4ILD A;  5C4J C;  3S17 K;  2FQO A;  2JA6 C;  3S1N K;  4C3J C;  1B4A A;  4G0W A;  4LK0 A;  1ZXO A;  3GEE A;  4DDQ A;  3GTO K;  4GTD A;  1J98 A;  4A3I C;  3ADA C;  3LAP A;  4PAB A;  3HXA A;  4BBS C;  2O5J A;  1XXC A;  4X6A C;  4FM9 A;  2E2J C;  5IYC K;  1VGX A;  2NVX C;  3S2H K;  2YU9 C;  2A6E A;  2E2I C;  4BLB A;  3TFJ A;  4A3E K;  4GTA A;  3GTM C;  4P5A A;  5TMF A;  2JA5 K;  3BP3 A;  4A3B K;  3K7A K;  2R7Z A;  5M5W K;  3PO2 C;  1TWG C;  2R92 C;  4GTL A;  1YX2 A;  4C3H C;  1PJ5 A;  1USO A;  1WOO A;  4LLG A;  1PJ7 A;  1YNJ A;  3I4N K;  5C44 C;  1TWA K;  1WQG A;  3BUE A;  1TWF K;  1WCM K;  3GEI A;  3HOX K;  3TFI A;  4KAT A;  2R7Z C;  1EFW A;  4C2M C;  3I4M C;  3GTG K;  5M5Y K;  3V4G A;  4A3F C;  3JST A;  4A3J C;  1V5V A;  2P5M A;  1EQR A;  1TWF A;  1J6W A;  1WCM A;  2B63 C;  5IYD K;  4A3I K;  1SFO C;  3AD7 C;  4BY1 K;  3HOY C;  3HKZ L;  1I6V A;  4BBS K;  5C3E C;  3GTK C;  2PA8 D;  4A3L K;  2GSO A;  4A3M K;  1O28 A;  4BBR K;  3FKI C;  1K83 C;  4FZB A;  3S16 K;  3GTM K;  2RGR A;  4P9S A;  3HOU C;  2NVT K;  5M3M K;  3LAJ A;  3L4K A;  1TWG K;  1IS1 A;  2R93 C;  1IBA A;  3TFH A;  1SFO A;  5C4J K;  2B63 A;  5C44 K;  3M4O K;  1WOS A;  1TWF C;  1WCM C;  1Y1W A;  3EQL A;  3CAG A;  1XXB A;  3GTL C;  5HL8 A;  4XLP A;  3S14 K;  2GSU A;  3A8K A;  3IPJ A;  4C2M K;  3I4M K;  1IE0 A;  3FOE A;  1F93 A;  1ZVU A;  1BJT A;  3Q3Q A;  3GTQ A;  2GAG C;  1YCL A;  2R92 A; 
#chains in the Genus database with same CATH homology
 3M3Y K;  3H0G K;  4A93 C;  3FKI K;  4LK0 A;  4A3B C;  1K83 K;  4BXX C;  3S16 C;  3PO2 K;  2NVQ C;  3HOX C;  3HKZ D;  3GTO K;  4A3M C;  4A3I C;  1Y1V C;  4KMU A;  3GTJ K;  3HOV C;  2PA8 L;  3I4N C;  1I3Q C;  4G7Z A;  2WB1 D;  4YFX A;  4BBS C;  1TWH C;  2O5J A;  5IP7 K;  4X6A C;  3HOW K;  4Q5S A;  1I6H K;  4A3D C;  1YNN A;  3S1M K;  2E2J C;  5IYC K;  3S1R K;  3S2D K;  4QIW D;  2R7Z K;  3HOU K;  4JK1 A;  4AYB L;  3H3V L;  2NVX C;  2WAQ D;  4A3K C;  3S2H K;  3S17 C;  2YU9 C;  1BDF A;  5C3E K;  1TWC C;  2R93 K;  2A6E A;  2E2I C;  2E2H C;  5FJ8 K;  5M3F K;  4A3E K;  2JA6 K;  3GTM C;  3S14 C;  4A3L C;  4C3J K;  3M3Y C;  4Y7N C;  4BY7 C;  4GZY A;  5TMF A;  2JA5 K;  4A3G C;  5D4D A;  4A3B K;  3K7A K;  1TWH K;  5M5W K;  4Y52 K;  3PO2 C;  1TWG C;  1IW7 A;  4OIQ A;  2R92 C;  3S1Q C;  4A3D K;  4LK1 A;  4QJV A;  3HOZ K;  4LLG A;  3GTJ C;  1YNJ A;  2PMZ D;  3I4N K;  5C44 C;  5C4X C;  4BY1 C;  1TWA K;  4BXX K;  1TWF K;  1WCM K;  3GTP C;  1ZYR A;  1I6H C;  2Y0S L;  4KN4 A;  3HOX K;  4NOI A;  3S15 K;  4MEY A;  5IYB K;  3WOD A;  5TMC A;  3H0G C;  2R7Z C;  1R9T C;  3I4M C;  4XSZ A;  1SMY A;  4BBR C;  4C3I K;  5M5Y K;  4A3F C;  2NVT C;  4MQ9 A;  2VUM K;  4QJV B;  3S2H C;  4XSX A;  4A3J C;  3GTQ C;  1TWC K;  4X6A K;  3PO3 K;  4YFK A;  4C3H K;  4OIO A;  4YFN A;  4A3E C;  2JA8 C;  2B63 C;  2CW0 A;  3S1Q K;  5IYD K;  4A3I K;  1SFO C;  2JA5 C;  3S2D C;  4BY1 K;  2BE5 A;  4OIN A;  2NVY C;  3HOY C;  1TWA C;  2PPB A;  4YG2 A;  4A3C C;  3HKZ L;  1I6V A;  3GTP K;  4BBS K;  3CQZ C;  3RZD K;  2JA7 K;  5C3E C;  5IP7 C;  5FLM K;  3GTK C;  2PA8 D;  4A3L K;  1Y1W C;  2WB1 L;  5IYB C;  4XLN A;  4Y7N K;  4A3M K;  3S1N C;  3S1R C;  1Y1V K;  3HOV K;  4BBR K;  2A69 A;  5IP9 K;  2VUM C;  3FKI C;  3M4O C;  4Y52 C;  4A3K K;  1K83 C;  2JA8 K;  3S16 K;  4QIW L;  5IYD C;  2B63 K;  2E2H K;  4AYB D;  3GTM K;  3H3V D;  4MEX A;  3GTL K;  2WAQ L;  3HOZ C;  2E2J K;  3RZO C;  4LJZ A;  1R9T K;  4OIP A;  4A3G K;  3GTG K;  3GTG C;  3HOU C;  2NVT K;  5M3M K;  1I3Q K;  2NVX K;  2JA7 C;  5FLM C;  3GTK K;  1TWG K;  2A6H A;  2R93 C;  1I50 K;  2NVQ K;  5C4J K;  5M5X K;  3GTO C;  5IYC C;  5IP9 C;  3HOY K;  5C44 K;  5C4X K;  4A93 K;  3M4O K;  4A3F K;  3K7A C;  4G7H A;  4G7O A;  3CQZ K;  4A3J K;  1TWF C;  1WCM C;  3RZD C;  4OIR A;  3EQL A;  3GTQ K;  2A68 A;  4ZH4 A;  2PMZ L;  4Q4Z A;  2YU9 K;  2R92 K;  3GTL C;  4XLP A;  3S14 K;  1SFO K;  1XPP A;  3S15 C;  3S1M C;  4C2M K;  3I4M K;  4BY7 K;  2NVY K;  2Y0S D;  2O5I A;  4A3C K;  1I50 C;  3PO3 C;  1HQM A;  3S17 K;  5C4J C;  3DXJ A;  1Y1W K;  4KN7 A;  2E2I K;  3HOW C;  2JA6 C;  3RZO K;  3S1N K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...