3FKIK

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3fkiK00
4XSZA 4A3IC 3HOWC 3GTMK 1I6HK 2E2IC 3PO2C 2A68A 3K7AC 5TMFA 2R7ZK 2PPBA 3M3YC 4YG2A 3I4NC 4BBSK 2JA7C 4MQ9A 2E2HC 3GTQC 1HQMA 4XLPA 4Y7NK 3GTJK 2YU9C 3S15K 4C2MK 3HKZD 5M3MK 3DXJA 3FKIC 4A3KK 1WCMK 1TWFK 3RZOK 5C4JC 2NVYK 5IYCC 4A3DC 5IP9K 3GTOK 3S14K 2JA5C 1SFOC 3HOYC 3HKZL 4KMUA 2NVXK 3S1NC 2R92C 4GZYA 4X6AK 4QJVB 4KN7A 1K83K 5TMCA 3GTMC 1I6HC 2NVQK 2O5JA 5IYDK 4YFNA 2R7ZC 2JA8K 4BBSC 4OIRA 2Y0SD 3S2HK 3HOVK 4Y7NC 3H0GK 4BBRK 3GTJC 3S15C 3M4OK 4A93K 4G7OA 4A3EK 5C44K 4A3KC 1SMYA 1WCMC 4Y52K 1I3QK 1BDFA 1TWFC 2Y0SL 3S1MK 3S17K 1Y1WK 3S1QK 1YNNA 2NVYC 4OIQA 2O5IA 5IP9C 2R92K 3GTOC 1TWAC 4YFKA 3S14C 4X6AC 2NVXC 4BY1K 1TWHK 4G7ZA 1K83C 4A3JK 5IYDC 3GTPK 2JA8C 4QIWL 2A6HA 3I4MK 4C3JK 3S2HC 3S2DK 5FLMK 2A6EA 5M5WK 4OIPA 3H0GC 4BBRC 4XLNA 3HOVC 4JK1A 4A93C 4A3EC 3GTGK 2PMZD 5IP7K 5C44C 3CQZK 4Y52C 1I3QC 4ZH4A 3S1MC 3S1QC 3S17C 1Y1WC 4C3IK 3S16K 3GTKK 3HOUK 4C3HK 4A3FK 3WODA 1I6VA 4A3BK 4BY1C 1Y1VK 2PMZL 2VUMK 1TWHC 4A3JC 3GTLK 3RZOC 3GTPC 4Q4ZA 4NOIA 3I4MC 3K7AK 4QIWD 3S2DC 5FLMC 4MEXA 2PA8L 3RZDK 3HOXK 3PO3K 5IYBK 3GTQK 4AYBD 3GTGC 2WB1L 5IP7C 2R93K 5FJ8K 3CQZC 1R9TK 2NVQC 4QJVA 2B63K 4LJZA 3S16C 3EQLA 4LK1A 4BXXK 1TWCK 3GTKC 2BE5A 3HOUC 1TWGK 4A3FC 3S1RK 3HOZK 4OIOA 3H3VL 4A3BC 4AYBL 2A69A 3M4OC 2VUMC 1ZYRA 1SFOK 4A3GK 4BY7K 4A3MK 3GTLC 4LK0A 1I50K 5C4XK 4A3LK 4A3CK 2E2JK 4YFXA 2CW0A 4OINA 3RZDC 2WAQD 3HOXC 2NVTK 3PO3C 4G7HA 5IYBC 4Q5SA 2JA6K 2PA8D 5C3EK 2R93C 4A3IK 1R9TC 3HOWK 1YNJA 2WB1D 2B63C 2E2IK 3PO2K 4BXXC 1TWCC 3HOZC 2WAQL 5D4DA 1TWGC 3S1RC 3M3YK 5M5YK 3I4NK 5M3FK 2JA7K 2E2HK 5M5XK 1TWAK 3H3VD 4BY7C 4A3GC 4KN4A 4A3MC 2YU9K 1I50C 3FKIK 5C4XC 4MEYA 4A3CC 1XPPA 2E2JC 4A3LC 1IW7A 5C4JK 4LLGA 4XSXA 1Y1VC 5IYCK 4A3DK 2NVTC 2JA5K 3HOYK 2JA6C 3S1NK 5C3EC
chains in the Genus database with same CATH superfamily
2D6FC 4WJ3M 1I6HK 3K7AC 5TMFA 4GTCA 2R93A 4MQ9A 1JVIA 4FZBA 2GAGC 1R9TA 1HQMA 3S15K 3HKZD 5M3MK 3FKIC 1WCMK 3RZOK 1O26A 5IP9K 1SFOC 3HOYC 4KMUA 4GZYA 1XZPA 1I6HC 2JA8K 2JA6A 4OIRA 3S15C 3H0GK 3L4KA 1WCMC 1O27A 1I3QK 1IBAA 2Y0SL 3S1QK 2E2HA 1J98A 5IP9C 1J6XA 5L46A 1O2FB 1TWHK 1B4BA 1YCLA 3GTPK 2JA8C 4QIWL 2JA5A 4C3JK 3G4AA 4OIPA 3H0GC 1ZQ1C 3AH5A 2PMZD 1WQHA 5IP7K 1I3QC 3S1QC 3GTKK 4P5AA 4KAWX 1KQ4A 1TWHC 4GTDA 4M1XA 3GTPC 4Q4ZA 4NOIA 1BS2A 4C3JC 5EGHA 4MEXA 3HOXK 2FQTA 2ZUEA 3GTQK 2R93K 5IP7C 4KASA 1R9TK 2NVQC 1XXAA 3FOFA 1O24A 4LK1A 4XCHA 3GTKC 4AYBL 2GSNA 3SZZA 2CFAB 1ZYRA 4P9SA 4LK0A 5C4XK 4A3LK 4A3CK 1WQFA 2ZUFA 3OPFA 3HOXC 3LAPA 2PA8D 2JA6K 2R93C 4A3IK 1R9TC 3PO2K 5EGEA 3BP3A 3M3YK 2E2HK 1VLOA 3CQZA 1TWAK 3H3VD 4GFQA 3AQOA 4KMAA 4KDDA 3AQPA 5C4XC 1GE9A 4A3LC 4A3CC 1V5VA 2VUMA 1F93A 1DCPA 2JA5K 2JA6C 4XSZA 1DCOA 1WOSA 1JQWA 4A3IC 3PO2C 3M3YC 3BP8C 2E2HC 4RMFA 1ISEA 3GEIA 4XLPA 4Y7NK 1WOOA 4C2MK 1TWCA 3DXJA 1TWGA 3L4JA 1X31C 3ERED 1YX2A 3S14K 2JA5C 4X6AK 4KMHA 1BGWA 3GTKA 5TMCA 3N3YA 4GTAA 1AB4A 3ADAC 2O5JA 5E68A 2Y0SD 1DCHA 3HOVK 1WSRA 1ZXOA 4Y7NC 2E2IA 3M4OK 4C2MC 4G7OA 1BDFA 2JA7A 3S17K 3GTQA 2YU9A 3AD8C 4YFKA 3S14C 1WSVA 4X6AC 4BY1K 1O2BA 5TJ3A 4A3JK 1ZVUA 1G51A 3I4MK 3S2DK 5FLMK 2A6EA 3HOVC 1USOA 4XLNA 4JK1A 3GEHA 3CQZK 1EH1A 4G0VA 3S17C 1J6VA 3GTJA 4A3FK 3WODA 1I6VA 4KB2A 3V4GA 4BY1C 1Y1VK 3G4CA 2VUMK 2NVYA 4C45A 4A3JC 3RZOC 4KMDA 5IOTA 1TWAA 1PJ6A 3I4MC 4KATA 4BLBA 2NVXA 5JFEA 3S2DC 5FLMC 3RZDK 5IYBK 4AYBD 5FJ8K 3CQZC 1IS1A 4LJZA 3EQLA 1TWCK 2P5MA 2BE5A 3HOZK 1TWGK 4A3FC 2A69A 2VUMC 4A3GK 3TFIA 1Y1WA 1VH2A 4OINA 3RZDC 4G7HA 5IYBC 1B4AA 2WB1D 1EI6A 2E2IK 2RGRA 3QX3A 1TWCC 3HOZC 1TWGC 3GTGA 2JA7K 5M5XK 4A3GC 4KN4A 2YU9K 1XPPA 4GTBA 1O2AA 4XSXA 4A3DK 3GTLA 1F7UA 3GTMK 4BLAA 2E2IC 4J3NA 2R7ZK 2PPBA 4YG2A 2JA7C 4G0WA 3GTQC 1XXCA 3GTJK 2YU9C 3TFJA 4AH6A 2NVYK 4LQYA 4A3DC 3VA7A 4P5BA 1VJEA 1BJTA 4KM8A 2NVXK 4QJVB 2CFAA 4KN7A 3GTMC 1C0AA 2GSUA 1Y1VA 4PABA 4YFNA 2R7ZC 4BKWA 3FOEA 1WQGA 3S2HK 3GTJC 4A93K 3A8JA 4A3EK 5C44K 4Y52K 3S1MK 4GTLA 1Y1WK 1RU0A 2NVYC 5IOSA 4OIQA 1VRQC 2O5IA 1TWAC 2NVXC 1L0WA 2XCRB 4FM9A 2W7VA 1WOPA 2A6HA 5IOQA 3S2HC 3A8KA 4A93C 1EQRA 4A3EC 3GTGK 5C44C 4Y52C 3S1MC 1USMA 1Y1WC 4C3IK 3S16K 3N0CA 4WJ4A 1TWFA 3T02A 3GTLK 1WORA 4KC6A 3K7AK 4QIWD 1K83A 2PA8L 3GTGC 3T00A 2B63K 3S16C 4C3IC 4BXXK 3Q3QA 3GIRA 4OIOA 3H3VL 3GTMA 3GDZA 3M4OC 1SFOK 4BY7K 2R7ZA 2P8TA 4A3MK 3GTLC 4GT9A 2V6TA 1PJ7A 1DD5A 1F7VA 4KARA 2NVTK 4Q5SA 3JSTA 1EK8A 5C3EK 3HOWK 2B63C 4BXXC 2WAQL 5D4DA 5M5YK 3I4NK 3SZYA 2XCQA 3NUHA 4BY7C 1INNA 4A3MC 3CAGA 3GEEA 4MEYA 4DDQA 2ZFZA 5C4JK 1Y1VC 5IYCK 2NVTC 3FHZA 5CHPA 2KWAA 5IORA 5C3EC 2R92K 3S1NK 2FQOA 3T01A 3HOWC 1J6WA 2A68A 3S0XA 1PJ5A 1JOEA 4BBSK 1O29A 3I4NC 1IQ0A 2PHCB 3LAJA 4A3KK 1VGXA 1TWFK 5C4JC 5JVOA 5IYCC 3GTOK 1O28A 3HKZL 1I50A 3S1NC 2R92C 1F9NA 1UV7A 1K83K 2EBBA 1HI9A 2NVQK 5IYDK 4BBSC 4ILDA 4BBRK 4A3KC 1SMYA 2GSOA 1TWFC 1YNNA 3GTOC 2B63A 3FKIA 3IPJA 4G7ZA 1K83C 5HL8A 4KB4A 5IYDC 2V6SA 1SFOA 5CJ9A 3HXAA 5M5WK 4BBRC 1EFWA 3N0BA 4ZH4A 4WILA 4O2DA 3HOUK 1IE0A 4C3HK 4A3BK 1WIHA 2PMZL 1WCMA 3A8IA 2V6UA 3BUEA 4KM9A 1IL2A 3PO3K 2WB1L 3AD9C 4QJVA 4LR2A 2R92A 3H0GA 3HOUC 4C3HC 3MMLB 4GTEA 3S1RK 4A3BC 3TFHA 1O25A 1I3QA 4LOWA 1ZBSA 1I50K 1XZQB 2XCOA 4PAAA 3AD7C 2E2JK 4YFXA 4G0UA 1TWHA 2CW0A 2WAQD 3PO3C 2RH6A 3GTPA 2Y3PA 1YNJA 3GTOA 3OEPA 2JH3A 3S1RC 3TTGA 5M3FK 3GSIA 3LPXA 1I50C 4GTFA 3FKIK 2E2JC 2GAHC 1IW7A 1XZQA 4LLGA 1XXBA 1XZPB 3OREA 3HOYK
chains in the Genus database with same CATH topology
4XSZA 4A3IC 3HOWC 3GTMK 1I6HK 2E2IC 3PO2C 2A68A 3K7AC 5TMFA 2R7ZK 2PPBA 3M3YC 4YG2A 3I4NC 4BBSK 2JA7C 4MQ9A 2E2HC 3GTQC 1HQMA 4XLPA 4Y7NK 3GTJK 2YU9C 3S15K 4C2MK 3HKZD 5M3MK 3DXJA 3FKIC 4A3KK 1WCMK 1TWFK 3RZOK 5C4JC 2NVYK 5IYCC 4A3DC 5IP9K 3GTOK 3S14K 2JA5C 1SFOC 3HOYC 3HKZL 4KMUA 2NVXK 3S1NC 2R92C 4GZYA 4X6AK 4QJVB 4KN7A 1K83K 5TMCA 3GTMC 1I6HC 2NVQK 2O5JA 5IYDK 4YFNA 2R7ZC 2JA8K 4BBSC 4OIRA 2Y0SD 3S2HK 3HOVK 4Y7NC 3H0GK 4BBRK 3GTJC 3S15C 3M4OK 4A93K 4G7OA 4A3EK 5C44K 4A3KC 1SMYA 1WCMC 4Y52K 1I3QK 1BDFA 1TWFC 2Y0SL 3S1MK 3S17K 1Y1WK 3S1QK 1YNNA 2NVYC 4OIQA 2O5IA 5IP9C 2R92K 3GTOC 1TWAC 4YFKA 3S14C 4X6AC 2NVXC 4BY1K 1TWHK 4G7ZA 1K83C 4A3JK 5IYDC 3GTPK 2JA8C 4QIWL 2A6HA 3I4MK 4C3JK 3S2HC 3S2DK 5FLMK 2A6EA 5M5WK 4OIPA 3H0GC 4BBRC 4XLNA 3HOVC 4JK1A 4A93C 4A3EC 3GTGK 2PMZD 5IP7K 5C44C 3CQZK 4Y52C 1I3QC 4ZH4A 3S1MC 3S1QC 3S17C 1Y1WC 4C3IK 3S16K 3GTKK 3HOUK 4C3HK 4A3FK 3WODA 1I6VA 4A3BK 4BY1C 1Y1VK 2PMZL 2VUMK 1TWHC 4A3JC 3GTLK 3RZOC 3GTPC 4Q4ZA 4NOIA 3I4MC 3K7AK 4QIWD 3S2DC 5FLMC 4MEXA 2PA8L 3RZDK 3HOXK 3PO3K 5IYBK 3GTQK 4AYBD 3GTGC 2WB1L 5IP7C 2R93K 5FJ8K 3CQZC 1R9TK 2NVQC 4QJVA 2B63K 4LJZA 3S16C 3EQLA 4LK1A 4BXXK 1TWCK 3GTKC 2BE5A 3HOUC 1TWGK 4A3FC 3S1RK 3HOZK 4OIOA 3H3VL 4A3BC 4AYBL 2A69A 3M4OC 2VUMC 1ZYRA 1SFOK 4A3GK 4BY7K 4A3MK 3GTLC 4LK0A 1I50K 5C4XK 4A3LK 4A3CK 2E2JK 4YFXA 2CW0A 4OINA 3RZDC 2WAQD 3HOXC 2NVTK 3PO3C 4G7HA 5IYBC 4Q5SA 2JA6K 2PA8D 5C3EK 2R93C 4A3IK 1R9TC 3HOWK 1YNJA 2WB1D 2B63C 2E2IK 3PO2K 4BXXC 1TWCC 3HOZC 2WAQL 5D4DA 1TWGC 3S1RC 3M3YK 5M5YK 3I4NK 5M3FK 2JA7K 2E2HK 5M5XK 1TWAK 3H3VD 4BY7C 4A3GC 4KN4A 4A3MC 2YU9K 1I50C 3FKIK 5C4XC 4MEYA 4A3CC 1XPPA 2E2JC 4A3LC 1IW7A 5C4JK 4LLGA 4XSXA 1Y1VC 5IYCK 4A3DK 2NVTC 2JA5K 3HOYK 2JA6C 3S1NK 5C3EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSZ A;  4A3I C;  3HOW C;  3GTM K;  1I6H K;  2E2I C;  3PO2 C;  2A68 A;  3K7A C;  5TMF A;  2R7Z K;  2PPB A;  3M3Y C;  4YG2 A;  3I4N C;  4BBS K;  2JA7 C;  4MQ9 A;  2E2H C;  3GTQ C;  1HQM A;  4XLP A;  4Y7N K;  3GTJ K;  2YU9 C;  3S15 K;  4C2M K;  3HKZ D;  5M3M K;  3DXJ A;  3FKI C;  4A3K K;  1WCM K;  1TWF K;  3RZO K;  5C4J C;  2NVY K;  5IYC C;  4A3D C;  5IP9 K;  3GTO K;  3S14 K;  2JA5 C;  1SFO C;  3HOY C;  3HKZ L;  4KMU A;  2NVX K;  3S1N C;  2R92 C;  4GZY A;  4X6A K;  4QJV B;  4KN7 A;  1K83 K;  5TMC A;  3GTM C;  1I6H C;  2NVQ K;  2O5J A;  5IYD K;  4YFN A;  2R7Z C;  2JA8 K;  4BBS C;  4OIR A;  2Y0S D;  3S2H K;  3HOV K;  4Y7N C;  3H0G K;  4BBR K;  3GTJ C;  3S15 C;  3M4O K;  4A93 K;  4G7O A;  4A3E K;  5C44 K;  4A3K C;  1SMY A;  1WCM C;  4Y52 K;  1I3Q K;  1BDF A;  1TWF C;  2Y0S L;  3S1M K;  3S17 K;  1Y1W K;  3S1Q K;  1YNN A;  2NVY C;  4OIQ A;  2O5I A;  5IP9 C;  2R92 K;  3GTO C;  1TWA C;  4YFK A;  3S14 C;  4X6A C;  2NVX C;  4BY1 K;  1TWH K;  4G7Z A;  1K83 C;  4A3J K;  5IYD C;  3GTP K;  2JA8 C;  4QIW L;  2A6H A;  3I4M K;  4C3J K;  3S2H C;  3S2D K;  5FLM K;  2A6E A;  5M5W K;  4OIP A;  3H0G C;  4BBR C;  4XLN A;  3HOV C;  4JK1 A;  4A93 C;  4A3E C;  3GTG K;  2PMZ D;  5IP7 K;  5C44 C;  3CQZ K;  4Y52 C;  1I3Q C;  4ZH4 A;  3S1M C;  3S1Q C;  3S17 C;  1Y1W C;  4C3I K;  3S16 K;  3GTK K;  3HOU K;  4C3H K;  4A3F K;  3WOD A;  1I6V A;  4A3B K;  4BY1 C;  1Y1V K;  2PMZ L;  2VUM K;  1TWH C;  4A3J C;  3GTL K;  3RZO C;  3GTP C;  4Q4Z A;  4NOI A;  3I4M C;  3K7A K;  4QIW D;  3S2D C;  5FLM C;  4MEX A;  2PA8 L;  3RZD K;  3HOX K;  3PO3 K;  5IYB K;  3GTQ K;  4AYB D;  3GTG C;  2WB1 L;  5IP7 C;  2R93 K;  5FJ8 K;  3CQZ C;  1R9T K;  2NVQ C;  4QJV A;  2B63 K;  4LJZ A;  3S16 C;  3EQL A;  4LK1 A;  4BXX K;  1TWC K;  3GTK C;  2BE5 A;  3HOU C;  1TWG K;  4A3F C;  3S1R K;  3HOZ K;  4OIO A;  3H3V L;  4A3B C;  4AYB L;  2A69 A;  3M4O C;  2VUM C;  1ZYR A;  1SFO K;  4A3G K;  4BY7 K;  4A3M K;  3GTL C;  4LK0 A;  1I50 K;  5C4X K;  4A3L K;  4A3C K;  2E2J K;  4YFX A;  2CW0 A;  4OIN A;  3RZD C;  2WAQ D;  3HOX C;  2NVT K;  3PO3 C;  4G7H A;  5IYB C;  4Q5S A;  2JA6 K;  2PA8 D;  5C3E K;  2R93 C;  4A3I K;  1R9T C;  3HOW K;  1YNJ A;  2WB1 D;  2B63 C;  2E2I K;  3PO2 K;  4BXX C;  1TWC C;  3HOZ C;  2WAQ L;  5D4D A;  1TWG C;  3S1R C;  3M3Y K;  5M5Y K;  3I4N K;  5M3F K;  2JA7 K;  2E2H K;  5M5X K;  1TWA K;  3H3V D;  4BY7 C;  4A3G C;  4KN4 A;  4A3M C;  2YU9 K;  1I50 C;  3FKI K;  5C4X C;  4MEY A;  4A3C C;  1XPP A;  2E2J C;  4A3L C;  1IW7 A;  5C4J K;  4LLG A;  4XSX A;  1Y1V C;  5IYC K;  4A3D K;  2NVT C;  2JA5 K;  3HOY K;  2JA6 C;  3S1N K;  5C3E C; 
#chains in the Genus database with same CATH topology
 2D6F C;  4WJ3 M;  1I6H K;  3K7A C;  5TMF A;  4GTC A;  2R93 A;  4MQ9 A;  1JVI A;  4FZB A;  2GAG C;  1R9T A;  1HQM A;  3S15 K;  3HKZ D;  5M3M K;  3FKI C;  1WCM K;  3RZO K;  1O26 A;  5IP9 K;  1SFO C;  3HOY C;  4KMU A;  4GZY A;  1XZP A;  1I6H C;  2JA8 K;  2JA6 A;  4OIR A;  3S15 C;  3H0G K;  3L4K A;  1WCM C;  1O27 A;  1I3Q K;  1IBA A;  2Y0S L;  3S1Q K;  2E2H A;  1J98 A;  5IP9 C;  1J6X A;  5L46 A;  1O2F B;  1TWH K;  1B4B A;  1YCL A;  3GTP K;  2JA8 C;  4QIW L;  2JA5 A;  4C3J K;  3G4A A;  4OIP A;  3H0G C;  1ZQ1 C;  3AH5 A;  2PMZ D;  1WQH A;  5IP7 K;  1I3Q C;  3S1Q C;  3GTK K;  4P5A A;  4KAW X;  1KQ4 A;  1TWH C;  4GTD A;  4M1X A;  3GTP C;  4Q4Z A;  4NOI A;  1BS2 A;  4C3J C;  5EGH A;  4MEX A;  3HOX K;  2FQT A;  2ZUE A;  3GTQ K;  2R93 K;  5IP7 C;  4KAS A;  1R9T K;  2NVQ C;  1XXA A;  3FOF A;  1O24 A;  4LK1 A;  4XCH A;  3GTK C;  4AYB L;  2GSN A;  3SZZ A;  2CFA B;  1ZYR A;  4P9S A;  4LK0 A;  5C4X K;  4A3L K;  4A3C K;  1WQF A;  2ZUF A;  3OPF A;  3HOX C;  3LAP A;  2PA8 D;  2JA6 K;  2R93 C;  4A3I K;  1R9T C;  3PO2 K;  5EGE A;  3BP3 A;  3M3Y K;  2E2H K;  1VLO A;  3CQZ A;  1TWA K;  3H3V D;  4GFQ A;  3AQO A;  4KMA A;  4KDD A;  3AQP A;  5C4X C;  1GE9 A;  4A3L C;  4A3C C;  1V5V A;  2VUM A;  1F93 A;  1DCP A;  2JA5 K;  2JA6 C;  4XSZ A;  1DCO A;  1WOS A;  1JQW A;  4A3I C;  3PO2 C;  3M3Y C;  3BP8 C;  2E2H C;  4RMF A;  1ISE A;  3GEI A;  4XLP A;  4Y7N K;  1WOO A;  4C2M K;  1TWC A;  3DXJ A;  1TWG A;  3L4J A;  1X31 C;  3ERE D;  1YX2 A;  3S14 K;  2JA5 C;  4X6A K;  4KMH A;  1BGW A;  3GTK A;  5TMC A;  3N3Y A;  4GTA A;  1AB4 A;  3ADA C;  2O5J A;  5E68 A;  2Y0S D;  1DCH A;  3HOV K;  1WSR A;  1ZXO A;  4Y7N C;  2E2I A;  3M4O K;  4C2M C;  4G7O A;  1BDF A;  2JA7 A;  3S17 K;  3GTQ A;  2YU9 A;  3AD8 C;  4YFK A;  3S14 C;  1WSV A;  4X6A C;  4BY1 K;  1O2B A;  5TJ3 A;  4A3J K;  1ZVU A;  1G51 A;  3I4M K;  3S2D K;  5FLM K;  2A6E A;  3HOV C;  1USO A;  4XLN A;  4JK1 A;  3GEH A;  3CQZ K;  1EH1 A;  4G0V A;  3S17 C;  1J6V A;  3GTJ A;  4A3F K;  3WOD A;  1I6V A;  4KB2 A;  3V4G A;  4BY1 C;  1Y1V K;  3G4C A;  2VUM K;  2NVY A;  4C45 A;  4A3J C;  3RZO C;  4KMD A;  5IOT A;  1TWA A;  1PJ6 A;  3I4M C;  4KAT A;  4BLB A;  2NVX A;  5JFE A;  3S2D C;  5FLM C;  3RZD K;  5IYB K;  4AYB D;  5FJ8 K;  3CQZ C;  1IS1 A;  4LJZ A;  3EQL A;  1TWC K;  2P5M A;  2BE5 A;  3HOZ K;  1TWG K;  4A3F C;  2A69 A;  2VUM C;  4A3G K;  3TFI A;  1Y1W A;  1VH2 A;  4OIN A;  3RZD C;  4G7H A;  5IYB C;  1B4A A;  2WB1 D;  1EI6 A;  2E2I K;  2RGR A;  3QX3 A;  1TWC C;  3HOZ C;  1TWG C;  3GTG A;  2JA7 K;  5M5X K;  4A3G C;  4KN4 A;  2YU9 K;  1XPP A;  4GTB A;  1O2A A;  4XSX A;  4A3D K;  3GTL A;  1F7U A;  3GTM K;  4BLA A;  2E2I C;  4J3N A;  2R7Z K;  2PPB A;  4YG2 A;  2JA7 C;  4G0W A;  3GTQ C;  1XXC A;  3GTJ K;  2YU9 C;  3TFJ A;  4AH6 A;  2NVY K;  4LQY A;  4A3D C;  3VA7 A;  4P5B A;  1VJE A;  1BJT A;  4KM8 A;  2NVX K;  4QJV B;  2CFA A;  4KN7 A;  3GTM C;  1C0A A;  2GSU A;  1Y1V A;  4PAB A;  4YFN A;  2R7Z C;  4BKW A;  3FOE A;  1WQG A;  3S2H K;  3GTJ C;  4A93 K;  3A8J A;  4A3E K;  5C44 K;  4Y52 K;  3S1M K;  4GTL A;  1Y1W K;  1RU0 A;  2NVY C;  5IOS A;  4OIQ A;  1VRQ C;  2O5I A;  1TWA C;  2NVX C;  1L0W A;  2XCR B;  4FM9 A;  2W7V A;  1WOP A;  2A6H A;  5IOQ A;  3S2H C;  3A8K A;  4A93 C;  1EQR A;  4A3E C;  3GTG K;  5C44 C;  4Y52 C;  3S1M C;  1USM A;  1Y1W C;  4C3I K;  3S16 K;  3N0C A;  4WJ4 A;  1TWF A;  3T02 A;  3GTL K;  1WOR A;  4KC6 A;  3K7A K;  4QIW D;  1K83 A;  2PA8 L;  3GTG C;  3T00 A;  2B63 K;  3S16 C;  4C3I C;  4BXX K;  3Q3Q A;  3GIR A;  4OIO A;  3H3V L;  3GTM A;  3GDZ A;  3M4O C;  1SFO K;  4BY7 K;  2R7Z A;  2P8T A;  4A3M K;  3GTL C;  4GT9 A;  2V6T A;  1PJ7 A;  1DD5 A;  1F7V A;  4KAR A;  2NVT K;  4Q5S A;  3JST A;  1EK8 A;  5C3E K;  3HOW K;  2B63 C;  4BXX C;  2WAQ L;  5D4D A;  5M5Y K;  3I4N K;  3SZY A;  2XCQ A;  3NUH A;  4BY7 C;  1INN A;  4A3M C;  3CAG A;  3GEE A;  4MEY A;  4DDQ A;  2ZFZ A;  5C4J K;  1Y1V C;  5IYC K;  2NVT C;  3FHZ A;  5CHP A;  2KWA A;  5IOR A;  5C3E C;  2R92 K;  3S1N K;  2FQO A;  3T01 A;  3HOW C;  1J6W A;  2A68 A;  3S0X A;  1PJ5 A;  1JOE A;  4BBS K;  1O29 A;  3I4N C;  1IQ0 A;  2PHC B;  3LAJ A;  4A3K K;  1VGX A;  1TWF K;  5C4J C;  5JVO A;  5IYC C;  3GTO K;  1O28 A;  3HKZ L;  1I50 A;  3S1N C;  2R92 C;  1F9N A;  1UV7 A;  1K83 K;  2EBB A;  1HI9 A;  2NVQ K;  5IYD K;  4BBS C;  4ILD A;  4BBR K;  4A3K C;  1SMY A;  2GSO A;  1TWF C;  1YNN A;  3GTO C;  2B63 A;  3FKI A;  3IPJ A;  4G7Z A;  1K83 C;  5HL8 A;  4KB4 A;  5IYD C;  2V6S A;  1SFO A;  5CJ9 A;  3HXA A;  5M5W K;  4BBR C;  1EFW A;  3N0B A;  4ZH4 A;  4WIL A;  4O2D A;  3HOU K;  1IE0 A;  4C3H K;  4A3B K;  1WIH A;  2PMZ L;  1WCM A;  3A8I A;  2V6U A;  3BUE A;  4KM9 A;  1IL2 A;  3PO3 K;  2WB1 L;  3AD9 C;  4QJV A;  4LR2 A;  2R92 A;  3H0G A;  3HOU C;  4C3H C;  3MML B;  4GTE A;  3S1R K;  4A3B C;  3TFH A;  1O25 A;  1I3Q A;  4LOW A;  1ZBS A;  1I50 K;  1XZQ B;  2XCO A;  4PAA A;  3AD7 C;  2E2J K;  4YFX A;  4G0U A;  1TWH A;  2CW0 A;  2WAQ D;  3PO3 C;  2RH6 A;  3GTP A;  2Y3P A;  1YNJ A;  3GTO A;  3OEP A;  2JH3 A;  3S1R C;  3TTG A;  5M3F K;  3GSI A;  3LPX A;  1I50 C;  4GTF A;  3FKI K;  2E2J C;  2GAH C;  1IW7 A;  1XZQ A;  4LLG A;  1XXB A;  1XZP B;  3ORE A;  3HOY K; 
#chains in the Genus database with same CATH homology
 4XSZ A;  4A3I C;  3HOW C;  3GTM K;  1I6H K;  2E2I C;  3PO2 C;  2A68 A;  3K7A C;  5TMF A;  2R7Z K;  2PPB A;  3M3Y C;  4YG2 A;  3I4N C;  4BBS K;  2JA7 C;  4MQ9 A;  2E2H C;  3GTQ C;  1HQM A;  4XLP A;  4Y7N K;  3GTJ K;  2YU9 C;  3S15 K;  4C2M K;  3HKZ D;  5M3M K;  3DXJ A;  3FKI C;  4A3K K;  1WCM K;  1TWF K;  3RZO K;  5C4J C;  2NVY K;  5IYC C;  4A3D C;  5IP9 K;  3GTO K;  3S14 K;  2JA5 C;  1SFO C;  3HOY C;  3HKZ L;  4KMU A;  2NVX K;  3S1N C;  2R92 C;  4GZY A;  4X6A K;  4QJV B;  4KN7 A;  1K83 K;  5TMC A;  3GTM C;  1I6H C;  2NVQ K;  2O5J A;  5IYD K;  4YFN A;  2R7Z C;  2JA8 K;  4BBS C;  4OIR A;  2Y0S D;  3S2H K;  3HOV K;  4Y7N C;  3H0G K;  4BBR K;  3GTJ C;  3S15 C;  3M4O K;  4A93 K;  4G7O A;  4A3E K;  5C44 K;  4A3K C;  1SMY A;  1WCM C;  4Y52 K;  1I3Q K;  1BDF A;  1TWF C;  2Y0S L;  3S1M K;  3S17 K;  1Y1W K;  3S1Q K;  1YNN A;  2NVY C;  4OIQ A;  2O5I A;  5IP9 C;  2R92 K;  3GTO C;  1TWA C;  4YFK A;  3S14 C;  4X6A C;  2NVX C;  4BY1 K;  1TWH K;  4G7Z A;  1K83 C;  4A3J K;  5IYD C;  3GTP K;  2JA8 C;  4QIW L;  2A6H A;  3I4M K;  4C3J K;  3S2H C;  3S2D K;  5FLM K;  2A6E A;  5M5W K;  4OIP A;  3H0G C;  4BBR C;  4XLN A;  3HOV C;  4JK1 A;  4A93 C;  4A3E C;  3GTG K;  2PMZ D;  5IP7 K;  5C44 C;  3CQZ K;  4Y52 C;  1I3Q C;  4ZH4 A;  3S1M C;  3S1Q C;  3S17 C;  1Y1W C;  4C3I K;  3S16 K;  3GTK K;  3HOU K;  4C3H K;  4A3F K;  3WOD A;  1I6V A;  4A3B K;  4BY1 C;  1Y1V K;  2PMZ L;  2VUM K;  1TWH C;  4A3J C;  3GTL K;  3RZO C;  3GTP C;  4Q4Z A;  4NOI A;  3I4M C;  3K7A K;  4QIW D;  3S2D C;  5FLM C;  4MEX A;  2PA8 L;  3RZD K;  3HOX K;  3PO3 K;  5IYB K;  3GTQ K;  4AYB D;  3GTG C;  2WB1 L;  5IP7 C;  2R93 K;  5FJ8 K;  3CQZ C;  1R9T K;  2NVQ C;  4QJV A;  2B63 K;  4LJZ A;  3S16 C;  3EQL A;  4LK1 A;  4BXX K;  1TWC K;  3GTK C;  2BE5 A;  3HOU C;  1TWG K;  4A3F C;  3S1R K;  3HOZ K;  4OIO A;  3H3V L;  4A3B C;  4AYB L;  2A69 A;  3M4O C;  2VUM C;  1ZYR A;  1SFO K;  4A3G K;  4BY7 K;  4A3M K;  3GTL C;  4LK0 A;  1I50 K;  5C4X K;  4A3L K;  4A3C K;  2E2J K;  4YFX A;  2CW0 A;  4OIN A;  3RZD C;  2WAQ D;  3HOX C;  2NVT K;  3PO3 C;  4G7H A;  5IYB C;  4Q5S A;  2JA6 K;  2PA8 D;  5C3E K;  2R93 C;  4A3I K;  1R9T C;  3HOW K;  1YNJ A;  2WB1 D;  2B63 C;  2E2I K;  3PO2 K;  4BXX C;  1TWC C;  3HOZ C;  2WAQ L;  5D4D A;  1TWG C;  3S1R C;  3M3Y K;  5M5Y K;  3I4N K;  5M3F K;  2JA7 K;  2E2H K;  5M5X K;  1TWA K;  3H3V D;  4BY7 C;  4A3G C;  4KN4 A;  4A3M C;  2YU9 K;  1I50 C;  3FKI K;  5C4X C;  4MEY A;  4A3C C;  1XPP A;  2E2J C;  4A3L C;  1IW7 A;  5C4J K;  4LLG A;  4XSX A;  1Y1V C;  5IYC K;  4A3D K;  2NVT C;  2JA5 K;  3HOY K;  2JA6 C;  3S1N K;  5C3E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...