3FKIK

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3fkiK00
1I6VA 3FKIK 2A6HA 4QJVB 4XSXA 3H3VL 4A3IC 3RZDK 2VUMK 2PA8D 3K7AC 2NVXC 4OIRA 2PA8L 4XLNA 2B63K 2NVQK 3S17C 2YU9C 4YFNA 5D4DA 4A3KC 3I4NK 1I3QC 2E2JK 4A3BK 1K83C 4A3FK 5IP9K 4A3EC 4A3MK 2BE5A 3S2HK 1I50C 3HOVK 3M3YC 1R9TK 3HOUK 1TWFK 5M5WK 3RZOC 3M4OK 4Y7NK 4A3DC 3CQZC 2WAQD 2E2HC 4KN4A 4BY1C 3S15C 1Y1WC 2JA6C 4A3CC 1TWGC 2WAQL 2NVTK 2O5IA 3S1RK 3GTMK 3HOXK 5IYBC 5C4JC 3GTJK 1SFOK 3GTKC 3GTLK 3HOYC 4QJVA 4C3JK 3H0GK 3HKZL 4JK1A 5C3EK 4A3LC 5C4XC 1XPPA 4BBRK 4YFXA 3PO2C 3S1QK 5IYCC 4G7OA 4A3JC 1TWHC 4X6AC 3GTPK 4BXXC 4Y52K 1YNNA 1ZYRA 4XLPA 4BY7C 4Q5SA 5M5XK 1WCMC 4G7ZA 4A3GK 1I6HK 2PMZD 3I4MC 2A6EA 2E2IK 3S2DK 2YU9K 2O5JA 4ZH4A 2A68A 4OIOA 4A3KK 2Y0SD 1I3QK 3HOWK 3HOZC 3S1NC 1K83K 3S14C 5FLMK 3PO3K 4A93C 5IP7C 2JA7C 2R93C 2Y0SL 2R7ZK 2NVYK 4G7HA 2R92C 3CQZK 1HQMA 3FKIC 4LK1A 2E2HK 1Y1VK 1SMYA 5M3FK 2JA5K 2VUMC 1TWAK 4A3CK 4BBSC 4MQ9A 5IYBK 5C4XK 3S16C 2NVQC 4YG2A 3S1MC 1TWCC 4C3IK 4AYBD 4A3IK 3I4NC 4A3BC 2E2JC 4C2MK 5IP9C 3K7AK 4A3FC 2CW0A 4A3MC 2JA8C 3S2HC 4BXXK 4AYBL 2NVXK 3DXJA 4LK0A 5TMFA 1TWFC 1YNJA 1IW7A 1R9TC 4Y7NC 3HOUC 5IYDC 3S17K 3GTGC 4QIWD 2PMZL 3WODA 2NVTC 3S1RC 3HOXC 4A3EK 1SFOC 3GTJC 3GTOC 1I50K 4QIWL 5C44C 4Q4ZA 3GTQC 3S14K 3M3YK 3H0GC 2WB1D 3RZOK 5C3EC 1BDFA 4A3DK 4BBRC 4OIPA 3H3VD 3S1QC 5M3MK 4KMUA 4OIQA 2WB1L 4BY1K 3RZDC 1Y1WK 3S15K 2JA6K 4Y52C 3GTPC 1TWGK 4C3HK 2PPBA 4BBSK 5C4JK 3GTKK 5M5YK 3HOYK 4A3GC 4XSZA 5TMCA 2B63C 4A3LK 1I6HC 3PO2K 3S16K 3S1MK 5IYCK 1TWCK 2E2IC 3S2DC 4A3JK 1TWHK 4X6AK 3HOWC 3HOVC 2JA8K 5FLMC 3PO3C 4BY7K 4MEXA 4LLGA 1WCMK 3M4OC 2R7ZC 2NVYC 4GZYA 4MEYA 3I4MK 4NOIA 5IYDK 3GTGK 1Y1VC 4KN7A 3EQLA 2JA5C 4YFKA 3GTMC 1TWAC 4A93K 3HOZK 3HKZD 3S1NK 3GTLC 5FJ8K 2A69A 5IP7K 3GTOK 5C44K 4OINA 2JA7K 3GTQK 2R93K 4LJZA 2R92K
chains in the Genus database with same CATH superfamily
1C0AA 3FKIK 4P5AA 2NVYA 4KM9A 1GE9A 2GAHC 2D6FC 3GEHA 4KB2A 3Q3QA 3GEIA 2CFAB 1V5VA 4A3KC 2FQOA 1K83C 5IP9K 4A3EC 5E68A 1ISEA 4KASA 3GEEA 4A3DC 1YCLA 1DCOA 4Y7NK 2NVXA 1IL2A 2E2HC 3GTJK 3GTKC 4KDDA 5L46A 4QJVA 3HKZL 5C3EK 4A3LC 1XPPA 3S1QK 1IBAA 1XXBA 4A3JC 4C2MC 4Y52K 4BXXC 3V4GA 4FZBA 4Q5SA 1O2AA 5M5XK 2RGRA 4G0WA 2PMZD 2YU9K 2O5JA 1INNA 4GTEA 3TFIA 1TWCA 3N0BA 1I3QK 4A93C 3S14C 1TWHA 5FLMK 5IP7C 1KQ4A 2GSOA 1B4BA 2R93C 2Y0SL 1WIHA 2R92C 3CQZK 1J6XA 5HL8A 3FOFA 2JA5K 2VUMC 1TWAK 4BBSC 1WQHA 5IYBK 4GTDA 1SFOA 3GDZA 1VH2A 1ZBSA 4AYBD 3FKIA 1WQFA 3K7AK 3S2HC 4LK0A 3HOUC 2ZUFA 5IYDC 3S17K 4M1XA 3WODA 2NVTC 1WQGA 1I50K 4QIWL 3H0GC 3LAJA 3H3VD 4OIPA 5JFEA 5M3MK 2WB1L 4BY1K 3RZDC 3GTPC 2PPBA 1Y1VA 2ZFZA 5M5YK 3HOYK 4A3GC 1B4AA 3GTJA 3PO2K 3S16K 3S1MK 2Y3PA 3FHZA 5IORA 4MEXA 1USMA 1ZXOA 2NVYC 4GZYA 1J98A 4MEYA 3I4MK 3GTGK 1J6VA 4G0UA 3EQLA 3GTMC 2GAGC 1WOSA 2YU9A 3S1NK 1F7VA 5C44K 1I3QA 2JA7K 3GTQK 1X31C 4QJVB 1VJEA 3CQZA 1XZPA 2NVXC 2RH6A 2JA5A 1TWAA 2GSUA 1O2BA 2NVQK 3I4NK 2GSNA 2BE5A 3M3YC 3T00A 1DCPA 4GFQA 1WSRA 2WAQD 5EGEA 2EBBA 3S15C 1TWGC 4C3HC 1WOPA 3HOXK 1SFOK 3GTLK 4C3JK 4YFXA 4PABA 4C3IC 5IYCC 1TWHC 1YNNA 1ZYRA 5JVOA 4BY7C 1XXCA 2A6EA 1J6WA 4LOWA 4A3KK 2V6UA 3HOWK 1K83K 3PO3K 1O2FB 4GTAA 2R7ZK 4G7HA 5TJ3A 1HQMA 3FKIC 1TWFA 3TFJA 2E2HK 1Y1VK 1AB4A 1SMYA 3GTGA 1XZQA 1EI6A 5C4XK 3OPFA 1IS1A 2JA7A 3GTQA 3AD9C 4A3IK 4C2MK 5IP9C 2JA8C 1IE0A 4BXXK 4AYBL 3DXJA 1O24A 4ILDA 4Y7NC 2E2IA 3GTJC 3GTOC 4Q4ZA 3S14K 3RZOK 5C3EC 3S1QC 1Y1WK 2JA6K 4Y52C 3SZZA 4BBSK 5C4JK 4GTFA 4FM9A 1WSVA 4XSZA 2B63C 3S0XA 3GTLA 4X6AK 3ERED 3HOVC 1O28A 5FLMC 3M4OC 1WCMK 5IYDK 4NOIA 3N0CA 1USOA 3MMLB 1DD5A 4YFKA 2JA5C 1TWAC 3HOZK 3HKZD 1O27A 1VRQC 2A69A 5IOSA 4BLBA 4P9SA 1K83A 4LJZA 3AQPA 1I6VA 2R7ZA 3RZDK 2PA8D 3K7AC 2E2HA 3AD7C 4PAAA 2CFAA 3GTKA 4BKWA 3S17C 5D4DA 1JOEA 4A3BK 2E2JK 4A3FK 1VGXA 4A3MK 1I50C 1R9TK 1TWFK 3TTGA 4KN4A 4BY1C 4A3CC 2WAQL 4O2DA 3S1RK 3GTMK 1O29A 3HOYC 4BBRK 1XZQB 3PO2C 4P5BA 1F9NA 2XCQA 2R92A 1Y1WA 2JA6A 3G4CA 2VUMA 1I6HK 1F93A 4KMHA 3I4MC 2E2IK 3S2DK 4OIOA 1VLOA 3S1NC 3G4AA 2JA7C 1WCMA 5EGHA 1ZQ1C 5M3FK 4WILA 4KB4A 2NVQC 4YG2A 1TWCC 4C3IK 3GSIA 3I4NC 3HXAA 1O25A 1JVIA 2V6TA 3OREA 3TFHA 1EK8A 3AQOA 1IW7A 5IOQA 4GTBA 1PJ6A 4J3NA 4KARA 2PMZL 4RMFA 1L0WA 3AH5A 3HOXC 4A3EK 1SFOC 2XCRB 4C3JC 4A3DK 4C45A 2KWAA 1R9TA 3BP3A 1F7UA 4KM8A 1HI9A 3GTKK 3GTMA 4A3LK 3NUHA 1BGWA 4A3JK 4AH6A 3HOWC 2JA8K 3PO3C 1EFWA 4WJ3M 2R7ZC 1Y1VC 4KN7A 3L4JA 4A93K 5FJ8K 3GIRA 5IP7K 3GTOK 2R93K 5C4XC 2R92K 2A6HA 4XSXA 3ADAC 3H3VL 4A3IC 2VUMK 3AD8C 4GTLA 4KATA 4OIRA 1TWGA 1XZPB 2PA8L 4XLNA 2B63K 2YU9C 4YFNA 3VA7A 4G0VA 1I3QC 3OEPA 1XXAA 3S2HK 3HOVK 1BJTA 3A8IA 3HOUK 5M5WK 3RZOC 3M4OK 4GT9A 3CQZC 3T02A 2V6SA 1Y1WC 2JA6C 2O5IA 2NVTK 1G51A 4DDQA 5IOTA 5IYBC 5C4JC 1WORA 4WJ4A 3H0GK 4JK1A 5CJ9A 4G7OA 3QX3A 4X6AC 3GTPK 3N3YA 4XLPA 1EQRA 1WCMC 4G7ZA 4A3GK 3A8KA 3L4KA 4ZH4A 2A68A 2Y0SD 3HOZC 1DCHA 2NVYK 4LK1A 1UV7A 4BLAA 2FQTA 3BP8C 3FOEA 4A3CK 3IPJA 4KMAA 4KMDA 4MQ9A 2P8TA 2XCOA 1YX2A 3LPXA 3S16C 3S1MC 3GTOA 2R93A 2W7VA 2JH3A 4A3BC 2E2JC 4A3FC 2CW0A 4A3MC 1EH1A 2NVXK 5TMFA 1R9TC 1TWFC 1YNJA 4LQYA 2PHCB 3GTGC 4XCHA 1IQ0A 4QIWD 2B63A 3CAGA 1PJ5A 4KC6A 3S1RC 4GTCA 5C44C 3GTQC 3M3YK 2WB1D 1BDFA 3SZYA 4BBRC 4KMUA 1JQWA 4OIQA 3S15K 1O26A 5CHPA 1TWGK 4KAWX 4C3HK 5TMCA 1I6HC 1BS2A 3H0GA 5IYCK 1TWCK 2E2IC 3S2DC 3LAPA 1TWHK 4BY7K 3GTPA 4LLGA 3JSTA 1WOOA 2ZUEA 1PJ7A 3A8JA 2P5MA 1RU0A 3T01A 3GTLC 4LR2A 1ZVUA 4OINA 3BUEA 1I50A
chains in the Genus database with same CATH topology
1I6VA 3FKIK 2A6HA 4QJVB 4XSXA 3H3VL 4A3IC 3RZDK 2VUMK 2PA8D 3K7AC 2NVXC 4OIRA 2PA8L 4XLNA 2B63K 2NVQK 3S17C 2YU9C 4YFNA 5D4DA 4A3KC 3I4NK 1I3QC 2E2JK 4A3BK 1K83C 4A3FK 5IP9K 4A3EC 4A3MK 2BE5A 3S2HK 1I50C 3HOVK 3M3YC 1R9TK 3HOUK 1TWFK 5M5WK 3RZOC 3M4OK 4Y7NK 4A3DC 3CQZC 2WAQD 2E2HC 4KN4A 4BY1C 3S15C 1Y1WC 2JA6C 4A3CC 1TWGC 2WAQL 2NVTK 2O5IA 3S1RK 3GTMK 3HOXK 5IYBC 5C4JC 3GTJK 1SFOK 3GTKC 3GTLK 3HOYC 4QJVA 4C3JK 3H0GK 3HKZL 4JK1A 5C3EK 4A3LC 5C4XC 1XPPA 4BBRK 4YFXA 3PO2C 3S1QK 5IYCC 4G7OA 4A3JC 1TWHC 4X6AC 3GTPK 4BXXC 4Y52K 1YNNA 1ZYRA 4XLPA 4BY7C 4Q5SA 5M5XK 1WCMC 4G7ZA 4A3GK 1I6HK 2PMZD 3I4MC 2A6EA 2E2IK 3S2DK 2YU9K 2O5JA 4ZH4A 2A68A 4OIOA 4A3KK 2Y0SD 1I3QK 3HOWK 3HOZC 3S1NC 1K83K 3S14C 5FLMK 3PO3K 4A93C 5IP7C 2JA7C 2R93C 2Y0SL 2R7ZK 2NVYK 4G7HA 2R92C 3CQZK 1HQMA 3FKIC 4LK1A 2E2HK 1Y1VK 1SMYA 5M3FK 2JA5K 2VUMC 1TWAK 4A3CK 4BBSC 4MQ9A 5IYBK 5C4XK 3S16C 2NVQC 4YG2A 3S1MC 1TWCC 4C3IK 4AYBD 4A3IK 3I4NC 4A3BC 2E2JC 4C2MK 5IP9C 3K7AK 4A3FC 2CW0A 4A3MC 2JA8C 3S2HC 4BXXK 4AYBL 2NVXK 3DXJA 4LK0A 5TMFA 1TWFC 1YNJA 1IW7A 1R9TC 4Y7NC 3HOUC 5IYDC 3S17K 3GTGC 4QIWD 2PMZL 3WODA 2NVTC 3S1RC 3HOXC 4A3EK 1SFOC 3GTJC 3GTOC 1I50K 4QIWL 5C44C 4Q4ZA 3GTQC 3S14K 3M3YK 3H0GC 2WB1D 3RZOK 5C3EC 1BDFA 4A3DK 4BBRC 4OIPA 3H3VD 3S1QC 5M3MK 4KMUA 4OIQA 2WB1L 4BY1K 3RZDC 1Y1WK 3S15K 2JA6K 4Y52C 3GTPC 1TWGK 4C3HK 2PPBA 4BBSK 5C4JK 3GTKK 5M5YK 3HOYK 4A3GC 4XSZA 5TMCA 2B63C 4A3LK 1I6HC 3PO2K 3S16K 3S1MK 5IYCK 1TWCK 2E2IC 3S2DC 4A3JK 1TWHK 4X6AK 3HOWC 3HOVC 2JA8K 5FLMC 3PO3C 4BY7K 4MEXA 4LLGA 1WCMK 3M4OC 2R7ZC 2NVYC 4GZYA 4MEYA 3I4MK 4NOIA 5IYDK 3GTGK 1Y1VC 4KN7A 3EQLA 2JA5C 4YFKA 3GTMC 1TWAC 4A93K 3HOZK 3HKZD 3S1NK 3GTLC 5FJ8K 2A69A 5IP7K 3GTOK 5C44K 4OINA 2JA7K 3GTQK 2R93K 4LJZA 2R92K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6V A;  3FKI K;  2A6H A;  4QJV B;  4XSX A;  3H3V L;  4A3I C;  3RZD K;  2VUM K;  2PA8 D;  3K7A C;  2NVX C;  4OIR A;  2PA8 L;  4XLN A;  2B63 K;  2NVQ K;  3S17 C;  2YU9 C;  4YFN A;  5D4D A;  4A3K C;  3I4N K;  1I3Q C;  2E2J K;  4A3B K;  1K83 C;  4A3F K;  5IP9 K;  4A3E C;  4A3M K;  2BE5 A;  3S2H K;  1I50 C;  3HOV K;  3M3Y C;  1R9T K;  3HOU K;  1TWF K;  5M5W K;  3RZO C;  3M4O K;  4Y7N K;  4A3D C;  3CQZ C;  2WAQ D;  2E2H C;  4KN4 A;  4BY1 C;  3S15 C;  1Y1W C;  2JA6 C;  4A3C C;  1TWG C;  2WAQ L;  2NVT K;  2O5I A;  3S1R K;  3GTM K;  3HOX K;  5IYB C;  5C4J C;  3GTJ K;  1SFO K;  3GTK C;  3GTL K;  3HOY C;  4QJV A;  4C3J K;  3H0G K;  3HKZ L;  4JK1 A;  5C3E K;  4A3L C;  5C4X C;  1XPP A;  4BBR K;  4YFX A;  3PO2 C;  3S1Q K;  5IYC C;  4G7O A;  4A3J C;  1TWH C;  4X6A C;  3GTP K;  4BXX C;  4Y52 K;  1YNN A;  1ZYR A;  4XLP A;  4BY7 C;  4Q5S A;  5M5X K;  1WCM C;  4G7Z A;  4A3G K;  1I6H K;  2PMZ D;  3I4M C;  2A6E A;  2E2I K;  3S2D K;  2YU9 K;  2O5J A;  4ZH4 A;  2A68 A;  4OIO A;  4A3K K;  2Y0S D;  1I3Q K;  3HOW K;  3HOZ C;  3S1N C;  1K83 K;  3S14 C;  5FLM K;  3PO3 K;  4A93 C;  5IP7 C;  2JA7 C;  2R93 C;  2Y0S L;  2R7Z K;  2NVY K;  4G7H A;  2R92 C;  3CQZ K;  1HQM A;  3FKI C;  4LK1 A;  2E2H K;  1Y1V K;  1SMY A;  5M3F K;  2JA5 K;  2VUM C;  1TWA K;  4A3C K;  4BBS C;  4MQ9 A;  5IYB K;  5C4X K;  3S16 C;  2NVQ C;  4YG2 A;  3S1M C;  1TWC C;  4C3I K;  4AYB D;  4A3I K;  3I4N C;  4A3B C;  2E2J C;  4C2M K;  5IP9 C;  3K7A K;  4A3F C;  2CW0 A;  4A3M C;  2JA8 C;  3S2H C;  4BXX K;  4AYB L;  2NVX K;  3DXJ A;  4LK0 A;  5TMF A;  1TWF C;  1YNJ A;  1IW7 A;  1R9T C;  4Y7N C;  3HOU C;  5IYD C;  3S17 K;  3GTG C;  4QIW D;  2PMZ L;  3WOD A;  2NVT C;  3S1R C;  3HOX C;  4A3E K;  1SFO C;  3GTJ C;  3GTO C;  1I50 K;  4QIW L;  5C44 C;  4Q4Z A;  3GTQ C;  3S14 K;  3M3Y K;  3H0G C;  2WB1 D;  3RZO K;  5C3E C;  1BDF A;  4A3D K;  4BBR C;  4OIP A;  3H3V D;  3S1Q C;  5M3M K;  4KMU A;  4OIQ A;  2WB1 L;  4BY1 K;  3RZD C;  1Y1W K;  3S15 K;  2JA6 K;  4Y52 C;  3GTP C;  1TWG K;  4C3H K;  2PPB A;  4BBS K;  5C4J K;  3GTK K;  5M5Y K;  3HOY K;  4A3G C;  4XSZ A;  5TMC A;  2B63 C;  4A3L K;  1I6H C;  3PO2 K;  3S16 K;  3S1M K;  5IYC K;  1TWC K;  2E2I C;  3S2D C;  4A3J K;  1TWH K;  4X6A K;  3HOW C;  3HOV C;  2JA8 K;  5FLM C;  3PO3 C;  4BY7 K;  4MEX A;  4LLG A;  1WCM K;  3M4O C;  2R7Z C;  2NVY C;  4GZY A;  4MEY A;  3I4M K;  4NOI A;  5IYD K;  3GTG K;  1Y1V C;  4KN7 A;  3EQL A;  2JA5 C;  4YFK A;  3GTM C;  1TWA C;  4A93 K;  3HOZ K;  3HKZ D;  3S1N K;  3GTL C;  5FJ8 K;  2A69 A;  5IP7 K;  3GTO K;  5C44 K;  4OIN A;  2JA7 K;  3GTQ K;  2R93 K;  4LJZ A;  2R92 K; 
#chains in the Genus database with same CATH topology
 1C0A A;  3FKI K;  4P5A A;  2NVY A;  4KM9 A;  1GE9 A;  2GAH C;  2D6F C;  3GEH A;  4KB2 A;  3Q3Q A;  3GEI A;  2CFA B;  1V5V A;  4A3K C;  2FQO A;  1K83 C;  5IP9 K;  4A3E C;  5E68 A;  1ISE A;  4KAS A;  3GEE A;  4A3D C;  1YCL A;  1DCO A;  4Y7N K;  2NVX A;  1IL2 A;  2E2H C;  3GTJ K;  3GTK C;  4KDD A;  5L46 A;  4QJV A;  3HKZ L;  5C3E K;  4A3L C;  1XPP A;  3S1Q K;  1IBA A;  1XXB A;  4A3J C;  4C2M C;  4Y52 K;  4BXX C;  3V4G A;  4FZB A;  4Q5S A;  1O2A A;  5M5X K;  2RGR A;  4G0W A;  2PMZ D;  2YU9 K;  2O5J A;  1INN A;  4GTE A;  3TFI A;  1TWC A;  3N0B A;  1I3Q K;  4A93 C;  3S14 C;  1TWH A;  5FLM K;  5IP7 C;  1KQ4 A;  2GSO A;  1B4B A;  2R93 C;  2Y0S L;  1WIH A;  2R92 C;  3CQZ K;  1J6X A;  5HL8 A;  3FOF A;  2JA5 K;  2VUM C;  1TWA K;  4BBS C;  1WQH A;  5IYB K;  4GTD A;  1SFO A;  3GDZ A;  1VH2 A;  1ZBS A;  4AYB D;  3FKI A;  1WQF A;  3K7A K;  3S2H C;  4LK0 A;  3HOU C;  2ZUF A;  5IYD C;  3S17 K;  4M1X A;  3WOD A;  2NVT C;  1WQG A;  1I50 K;  4QIW L;  3H0G C;  3LAJ A;  3H3V D;  4OIP A;  5JFE A;  5M3M K;  2WB1 L;  4BY1 K;  3RZD C;  3GTP C;  2PPB A;  1Y1V A;  2ZFZ A;  5M5Y K;  3HOY K;  4A3G C;  1B4A A;  3GTJ A;  3PO2 K;  3S16 K;  3S1M K;  2Y3P A;  3FHZ A;  5IOR A;  4MEX A;  1USM A;  1ZXO A;  2NVY C;  4GZY A;  1J98 A;  4MEY A;  3I4M K;  3GTG K;  1J6V A;  4G0U A;  3EQL A;  3GTM C;  2GAG C;  1WOS A;  2YU9 A;  3S1N K;  1F7V A;  5C44 K;  1I3Q A;  2JA7 K;  3GTQ K;  1X31 C;  4QJV B;  1VJE A;  3CQZ A;  1XZP A;  2NVX C;  2RH6 A;  2JA5 A;  1TWA A;  2GSU A;  1O2B A;  2NVQ K;  3I4N K;  2GSN A;  2BE5 A;  3M3Y C;  3T00 A;  1DCP A;  4GFQ A;  1WSR A;  2WAQ D;  5EGE A;  2EBB A;  3S15 C;  1TWG C;  4C3H C;  1WOP A;  3HOX K;  1SFO K;  3GTL K;  4C3J K;  4YFX A;  4PAB A;  4C3I C;  5IYC C;  1TWH C;  1YNN A;  1ZYR A;  5JVO A;  4BY7 C;  1XXC A;  2A6E A;  1J6W A;  4LOW A;  4A3K K;  2V6U A;  3HOW K;  1K83 K;  3PO3 K;  1O2F B;  4GTA A;  2R7Z K;  4G7H A;  5TJ3 A;  1HQM A;  3FKI C;  1TWF A;  3TFJ A;  2E2H K;  1Y1V K;  1AB4 A;  1SMY A;  3GTG A;  1XZQ A;  1EI6 A;  5C4X K;  3OPF A;  1IS1 A;  2JA7 A;  3GTQ A;  3AD9 C;  4A3I K;  4C2M K;  5IP9 C;  2JA8 C;  1IE0 A;  4BXX K;  4AYB L;  3DXJ A;  1O24 A;  4ILD A;  4Y7N C;  2E2I A;  3GTJ C;  3GTO C;  4Q4Z A;  3S14 K;  3RZO K;  5C3E C;  3S1Q C;  1Y1W K;  2JA6 K;  4Y52 C;  3SZZ A;  4BBS K;  5C4J K;  4GTF A;  4FM9 A;  1WSV A;  4XSZ A;  2B63 C;  3S0X A;  3GTL A;  4X6A K;  3ERE D;  3HOV C;  1O28 A;  5FLM C;  3M4O C;  1WCM K;  5IYD K;  4NOI A;  3N0C A;  1USO A;  3MML B;  1DD5 A;  4YFK A;  2JA5 C;  1TWA C;  3HOZ K;  3HKZ D;  1O27 A;  1VRQ C;  2A69 A;  5IOS A;  4BLB A;  4P9S A;  1K83 A;  4LJZ A;  3AQP A;  1I6V A;  2R7Z A;  3RZD K;  2PA8 D;  3K7A C;  2E2H A;  3AD7 C;  4PAA A;  2CFA A;  3GTK A;  4BKW A;  3S17 C;  5D4D A;  1JOE A;  4A3B K;  2E2J K;  4A3F K;  1VGX A;  4A3M K;  1I50 C;  1R9T K;  1TWF K;  3TTG A;  4KN4 A;  4BY1 C;  4A3C C;  2WAQ L;  4O2D A;  3S1R K;  3GTM K;  1O29 A;  3HOY C;  4BBR K;  1XZQ B;  3PO2 C;  4P5B A;  1F9N A;  2XCQ A;  2R92 A;  1Y1W A;  2JA6 A;  3G4C A;  2VUM A;  1I6H K;  1F93 A;  4KMH A;  3I4M C;  2E2I K;  3S2D K;  4OIO A;  1VLO A;  3S1N C;  3G4A A;  2JA7 C;  1WCM A;  5EGH A;  1ZQ1 C;  5M3F K;  4WIL A;  4KB4 A;  2NVQ C;  4YG2 A;  1TWC C;  4C3I K;  3GSI A;  3I4N C;  3HXA A;  1O25 A;  1JVI A;  2V6T A;  3ORE A;  3TFH A;  1EK8 A;  3AQO A;  1IW7 A;  5IOQ A;  4GTB A;  1PJ6 A;  4J3N A;  4KAR A;  2PMZ L;  4RMF A;  1L0W A;  3AH5 A;  3HOX C;  4A3E K;  1SFO C;  2XCR B;  4C3J C;  4A3D K;  4C45 A;  2KWA A;  1R9T A;  3BP3 A;  1F7U A;  4KM8 A;  1HI9 A;  3GTK K;  3GTM A;  4A3L K;  3NUH A;  1BGW A;  4A3J K;  4AH6 A;  3HOW C;  2JA8 K;  3PO3 C;  1EFW A;  4WJ3 M;  2R7Z C;  1Y1V C;  4KN7 A;  3L4J A;  4A93 K;  5FJ8 K;  3GIR A;  5IP7 K;  3GTO K;  2R93 K;  5C4X C;  2R92 K;  2A6H A;  4XSX A;  3ADA C;  3H3V L;  4A3I C;  2VUM K;  3AD8 C;  4GTL A;  4KAT A;  4OIR A;  1TWG A;  1XZP B;  2PA8 L;  4XLN A;  2B63 K;  2YU9 C;  4YFN A;  3VA7 A;  4G0V A;  1I3Q C;  3OEP A;  1XXA A;  3S2H K;  3HOV K;  1BJT A;  3A8I A;  3HOU K;  5M5W K;  3RZO C;  3M4O K;  4GT9 A;  3CQZ C;  3T02 A;  2V6S A;  1Y1W C;  2JA6 C;  2O5I A;  2NVT K;  1G51 A;  4DDQ A;  5IOT A;  5IYB C;  5C4J C;  1WOR A;  4WJ4 A;  3H0G K;  4JK1 A;  5CJ9 A;  4G7O A;  3QX3 A;  4X6A C;  3GTP K;  3N3Y A;  4XLP A;  1EQR A;  1WCM C;  4G7Z A;  4A3G K;  3A8K A;  3L4K A;  4ZH4 A;  2A68 A;  2Y0S D;  3HOZ C;  1DCH A;  2NVY K;  4LK1 A;  1UV7 A;  4BLA A;  2FQT A;  3BP8 C;  3FOE A;  4A3C K;  3IPJ A;  4KMA A;  4KMD A;  4MQ9 A;  2P8T A;  2XCO A;  1YX2 A;  3LPX A;  3S16 C;  3S1M C;  3GTO A;  2R93 A;  2W7V A;  2JH3 A;  4A3B C;  2E2J C;  4A3F C;  2CW0 A;  4A3M C;  1EH1 A;  2NVX K;  5TMF A;  1R9T C;  1TWF C;  1YNJ A;  4LQY A;  2PHC B;  3GTG C;  4XCH A;  1IQ0 A;  4QIW D;  2B63 A;  3CAG A;  1PJ5 A;  4KC6 A;  3S1R C;  4GTC A;  5C44 C;  3GTQ C;  3M3Y K;  2WB1 D;  1BDF A;  3SZY A;  4BBR C;  4KMU A;  1JQW A;  4OIQ A;  3S15 K;  1O26 A;  5CHP A;  1TWG K;  4KAW X;  4C3H K;  5TMC A;  1I6H C;  1BS2 A;  3H0G A;  5IYC K;  1TWC K;  2E2I C;  3S2D C;  3LAP A;  1TWH K;  4BY7 K;  3GTP A;  4LLG A;  3JST A;  1WOO A;  2ZUE A;  1PJ7 A;  3A8J A;  2P5M A;  1RU0 A;  3T01 A;  3GTL C;  4LR2 A;  1ZVU A;  4OIN A;  3BUE A;  1I50 A; 
#chains in the Genus database with same CATH homology
 1I6V A;  3FKI K;  2A6H A;  4QJV B;  4XSX A;  3H3V L;  4A3I C;  3RZD K;  2VUM K;  2PA8 D;  3K7A C;  2NVX C;  4OIR A;  2PA8 L;  4XLN A;  2B63 K;  2NVQ K;  3S17 C;  2YU9 C;  4YFN A;  5D4D A;  4A3K C;  3I4N K;  1I3Q C;  2E2J K;  4A3B K;  1K83 C;  4A3F K;  5IP9 K;  4A3E C;  4A3M K;  2BE5 A;  3S2H K;  1I50 C;  3HOV K;  3M3Y C;  1R9T K;  3HOU K;  1TWF K;  5M5W K;  3RZO C;  3M4O K;  4Y7N K;  4A3D C;  3CQZ C;  2WAQ D;  2E2H C;  4KN4 A;  4BY1 C;  3S15 C;  1Y1W C;  2JA6 C;  4A3C C;  1TWG C;  2WAQ L;  2NVT K;  2O5I A;  3S1R K;  3GTM K;  3HOX K;  5IYB C;  5C4J C;  3GTJ K;  1SFO K;  3GTK C;  3GTL K;  3HOY C;  4QJV A;  4C3J K;  3H0G K;  3HKZ L;  4JK1 A;  5C3E K;  4A3L C;  5C4X C;  1XPP A;  4BBR K;  4YFX A;  3PO2 C;  3S1Q K;  5IYC C;  4G7O A;  4A3J C;  1TWH C;  4X6A C;  3GTP K;  4BXX C;  4Y52 K;  1YNN A;  1ZYR A;  4XLP A;  4BY7 C;  4Q5S A;  5M5X K;  1WCM C;  4G7Z A;  4A3G K;  1I6H K;  2PMZ D;  3I4M C;  2A6E A;  2E2I K;  3S2D K;  2YU9 K;  2O5J A;  4ZH4 A;  2A68 A;  4OIO A;  4A3K K;  2Y0S D;  1I3Q K;  3HOW K;  3HOZ C;  3S1N C;  1K83 K;  3S14 C;  5FLM K;  3PO3 K;  4A93 C;  5IP7 C;  2JA7 C;  2R93 C;  2Y0S L;  2R7Z K;  2NVY K;  4G7H A;  2R92 C;  3CQZ K;  1HQM A;  3FKI C;  4LK1 A;  2E2H K;  1Y1V K;  1SMY A;  5M3F K;  2JA5 K;  2VUM C;  1TWA K;  4A3C K;  4BBS C;  4MQ9 A;  5IYB K;  5C4X K;  3S16 C;  2NVQ C;  4YG2 A;  3S1M C;  1TWC C;  4C3I K;  4AYB D;  4A3I K;  3I4N C;  4A3B C;  2E2J C;  4C2M K;  5IP9 C;  3K7A K;  4A3F C;  2CW0 A;  4A3M C;  2JA8 C;  3S2H C;  4BXX K;  4AYB L;  2NVX K;  3DXJ A;  4LK0 A;  5TMF A;  1TWF C;  1YNJ A;  1IW7 A;  1R9T C;  4Y7N C;  3HOU C;  5IYD C;  3S17 K;  3GTG C;  4QIW D;  2PMZ L;  3WOD A;  2NVT C;  3S1R C;  3HOX C;  4A3E K;  1SFO C;  3GTJ C;  3GTO C;  1I50 K;  4QIW L;  5C44 C;  4Q4Z A;  3GTQ C;  3S14 K;  3M3Y K;  3H0G C;  2WB1 D;  3RZO K;  5C3E C;  1BDF A;  4A3D K;  4BBR C;  4OIP A;  3H3V D;  3S1Q C;  5M3M K;  4KMU A;  4OIQ A;  2WB1 L;  4BY1 K;  3RZD C;  1Y1W K;  3S15 K;  2JA6 K;  4Y52 C;  3GTP C;  1TWG K;  4C3H K;  2PPB A;  4BBS K;  5C4J K;  3GTK K;  5M5Y K;  3HOY K;  4A3G C;  4XSZ A;  5TMC A;  2B63 C;  4A3L K;  1I6H C;  3PO2 K;  3S16 K;  3S1M K;  5IYC K;  1TWC K;  2E2I C;  3S2D C;  4A3J K;  1TWH K;  4X6A K;  3HOW C;  3HOV C;  2JA8 K;  5FLM C;  3PO3 C;  4BY7 K;  4MEX A;  4LLG A;  1WCM K;  3M4O C;  2R7Z C;  2NVY C;  4GZY A;  4MEY A;  3I4M K;  4NOI A;  5IYD K;  3GTG K;  1Y1V C;  4KN7 A;  3EQL A;  2JA5 C;  4YFK A;  3GTM C;  1TWA C;  4A93 K;  3HOZ K;  3HKZ D;  3S1N K;  3GTL C;  5FJ8 K;  2A69 A;  5IP7 K;  3GTO K;  5C44 K;  4OIN A;  2JA7 K;  3GTQ K;  2R93 K;  4LJZ A;  2R92 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...