4BY7K

Elongating rna polymerase ii-bye1 tld complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by7K00
3GTPC 2PA8L 4OIPA 3S1NK 1TWHK 3S1NC 2JA6K 1TWHC 2VUMK 5M5YK 2VUMC 2BE5A 4QJVA 4OINA 2NVTK 2R92K 4YFKA 4QJVB 3HOYK 2NVTC 4OIQA 2R92C 2E2HK 3HOYC 2E2HC 4G7OA 4C3IK 1WCMK 4GZYA 1SMYA 4YFNA 5FLMK 5C4JK 3S16K 5FLMC 3S16C 5C4JC 3S2HK 3S2HC 4XSXA 5C4XK 5FJ8K 2WB1L 2E2IC 1IW7A 4A3DK 4A3DC 4Q5SA 3HKZD 4BXXK 1SFOK 4BXXC 1SFOC 1Y1VK 2A68A 1YNJA 4C3HK 1Y1VC 4LK1A 4Y52K 4KN7A 4A3IK 4OIRA 4Y52C 4A3IC 2WAQD 4NOIA 3GTLK 4KN4A 4X6AK 4AYBD 2JA6C 4X6AC 3K7AK 3K7AC 5IP9K 3S17K 2A6EA 5IP9C 3S17C 1Y1WK 4BBRK 4MEYA 3HOUK 1Y1WC 4BBRC 4BBSK 3HOUC 2NVQK 3S1RK 4BBSC 4G7ZA 5M3FK 2NVQC 3S1RC 1XPPA 5TMFA 4XSZA 4KMUA 1TWCK 4G7HA 3GTOK 3HOVK 3HOVC 1TWGK 1WCMC 3GTOC 3I4NK 1TWGC 2NVYK 2JA5K 3I4NC 2NVYC 2JA5C 3GTMK 3HKZL 5C4XC 3GTMC 4MEXA 1HQMA 3HOWK 3HOWC 3S1QK 2PA8D 4XLPA 5M5WK 2NVXK 3RZOK 3S1QC 2NVXC 2WAQL 3FKIK 4OIOA 4A3BK 3FKIC 2O5IA 3PO2K 2CW0A 3PO2C 4AYBL 2A6HA 5IYCK 5M5XK 3HOXK 1I50K 3GTLC 5IYCC 4LJZA 3HOXC 4A3CK 1I50C 1K83K 1ZYRA 1K83C 3GTJK 3HOZK 3DXJA 3GTJC 3HOZC 3GTGK 4Y7NK 5C3EK 3GTGC 3GTQK 3H3VD 3I4MK 4Y7NC 3GTQC 4BY7K 2PPBA 4BY7C 3RZDK 4C3JK 4A3GK 3RZDC 1TWCC 2E2JK 1TWAK 4A3GC 4A3JK 2E2JC 3S15K 2JA7K 4Q4ZA 4A3JC 5IYDK 3S15C 2JA7C 4QIWD 3S2DK 5IYDC 4A3MK 4YG2A 3WODA 3S2DC 5M3MK 4A3MC 2R7ZK 2PMZD 5IP7K 3PO3K 4XLNA 2R7ZC 5IP7C 3PO3C 2Y0SD 2R93K 3EQLA 2JA8K 4JK1A 4YFXA 1I3QK 5IYBK 2JA8C 2R93C 1I3QC 5C44K 1YNNA 5IYBC 4A3FK 3RZOC 5C44C 4A93K 4A3FC 4A3BC 4A93C 2A69A 5TMCA 4A3CC 4A3LK 3M3YK 4LK0A 4BY1K 2B63K 4ZH4A 4A3LC 4LLGA 3M3YC 4BY1C 2B63C 2YU9K 3H3VL 3S1MK 3S1MC 5D4DA 3CQZK 2YU9C 3GTKK 3CQZC 5C3EC 1BDFA 2E2IK 3GTKC 4A3KK 3I4MC 3H0GK 3H0GC 2O5JA 3M4OK 2WB1D 3S14K 3M4OC 4QIWL 3S14C 1TWAC 1R9TK 1I6VA 4A3EK 4C2MK 1R9TC 1TWFK 4MQ9A 4A3EC 2PMZL 1I6HK 1TWFC 3GTPK 4A3KC 1I6HC 2Y0SL
chains in the Genus database with same CATH superfamily
1WQFA 2PA8L 3GTPC 3S1NK 1TWHK 3S1NC 2JA6K 1TWHC 1WOOA 1WSRA 3GTLA 2KWAA 1F7VA 4QJVA 4OINA 4KM8A 2XCRB 4GTDA 4QJVB 1DCOA 4OIQA 2E2HK 1O2BA 2E2HC 4GZYA 3S16K 1TWCA 3S16C 1WIHA 1WOSA 1WSVA 1GE9A 4BXXK 4BXXC 4C3HK 4LK1A 1O29A 4C3HC 3GEIA 1B4BA 3BUEA 3S17K 3S17C 2B63A 4DDQA 5M3FK 3HOVK 2FQOA 5IOQA 3GTOK 3HOVC 2PMZL 1TWGK 1WCMC 3GTOC 3I4NK 1TWGC 3I4NC 1TWAA 3GTMK 3GTMC 3T01A 4MEXA 1ZXOA 4XLPA 3LPXA 2RGRA 1EH1A 2WAQL 4LR2A 4A3BK 2VUMA 4KASA 4AYBL 2A6HA 1XZQA 5IOSA 3GTLC 4A3CK 1XZQB 3HOZK 3HOZC 1ZVUA 3H3VD 1BS2A 2ZUEA 4BY7K 4BY7C 2E2IA 3AQOA 4A3GK 1TWCC 3GEEA 4A3GC 4GTLA 3S15K 3SZZA 4Q4ZA 5CHPA 3S15C 5M3MK 3GTPA 4XLNA 2Y0SD 3EQLA 5HL8A 3IPJA 3RZOC 2JA6A 4A93K 4A93C 4C45A 1USMA 1Y1WA 1F93A 2GAGC 2B63K 4ZH4A 4LLGA 2B63C 4GTCA 2O5JA 2Y3PA 5IORA 4QIWL 1TWAC 1I6VA 2NVXA 1ZBSA 3G4AA 3FKIA 4KDDA 4OIPA 1USOA 4XCHA 2VUMK 3FHZA 2VUMC 1IL2A 2BE5A 1VRQC 2R92K 2R92C 3GTQA 2GSNA 4G7OA 4C3IK 4C3IC 5FLMK 3GTOA 4GTAA 4KC6A 5FLMC 5C4XK 2E2IC 5FJ8K 2WB1L 4GT9A 1IW7A 1O26A 3HKZD 2W7VA 2R93A 2A68A 1RU0A 1I3QA 4A3IK 3TFIA 4A3IC 4NOIA 1BJTA 2EBBA 3TFJA 3AD9C 3K7AK 4GTEA 2JA6C 3K7AC 1Y1WK 4GFQA 1Y1WC 4FZBA 4BBSK 4BBSC 3N0CA 4G7HA 4XSZA 4KMUA 3BP3A 4PAAA 1IQ0A 1X31C 1VJEA 3HOWK 3HOWC 2PA8D 2NVXK 5M5WK 2NVXC 4ILDA 3FKIK 1EFWA 2P5MA 4G0WA 1BGWA 3FKIC 5L46A 2O5IA 2CW0A 4PABA 1J98A 5IYCK 3Q3QA 5IYCC 2RH6A 4KMDA 4LOWA 3GTQK 4P5AA 3GTQC 3NUHA 2PPBA 4C3JK 4C3JC 1G51A 3JSTA 2XCOA 3LAPA 4WILA 1VLOA 1INNA 3HXAA 4YG2A 3WODA 2FQTA 1V5VA 3CAGA 5IP7K 5IP7C 2R93K 2R93C 1I3QK 1I3QC 5JFEA 1YNNA 1O2AA 4KATA 3FOEA 4G0UA 4A3BC 1EQRA 2A69A 4KB2A 4M1XA 3TTGA 4A3CC 4A3LK 1WOPA 1UV7A 3T00A 3M3YK 4A3LC 2R92A 3M3YC 3H3VL 3S1MK 3S1MC 1BDFA 1B4AA 3OEPA 2JA5A 3S14K 4AH6A 3S14C 1TWFK 3N3YA 4MQ9A 1TWFC 3OPFA 2Y0SL 1C0AA 5M5YK 4FM9A 1I50A 2GSOA 3GSIA 3AD8C 3GTJA 4KM9A 2V6TA 2NVTK 4YFKA 2NVTC 4LQYA 1XZPA 1XZPB 2GSUA 1PJ7A 1HI9A 4KB4A 2R7ZA 3V4GA 1YNJA 1JVIA 4Y52K 4KN7A 4Y52C 1J6WA 3AD7C 1XXAA 2PHCB 1IBAA 4KN4A 4X6AK 3ADAC 5EGEA 4X6AC 1KQ4A 2A6EA 4BBRK 4MEYA 4BBRC 3S1RK 4G7ZA 3S1RC 3BP8C 3L4KA 3A8JA 3H0GA 3TFHA 2JA5K 4WJ4A 4KARA 2JA5C 3HKZL 5C4XC 1JOEA 1HQMA 1PJ6A 1XXCA 3MMLB 5CJ9A 4OIOA 3ERED 3PO2K 3PO2C 5M5XK 3AQPA 1I50K 4LJZA 1I50C 1K83K 1ZYRA 1K83C 3GTJK 3AH5A 3GTJC 5C3EK 3I4MK 3T02A 2E2JK 1YX2A 4A3JK 3GIRA 2E2JC 4GTBA 4A3JC 5IYDK 4WJ3M 1IS1A 3S2DK 5IYDC 1SFOA 3S2DC 1TWFA 1Y1VA 3OREA 2R7ZK 2PMZD 1EI6A 2R7ZC 1IE0A 2JA8K 2JA8C 4BKWA 2V6SA 4BY1K 4BY1C 1JQWA 4P5BA 4A3KK 3H0GK 3FOFA 2NVYA 3H0GC 3GDZA 3L4JA 4KAWX 1R9TK 1R9TC 1DD5A 1I6HK 1I6HC 1O2FB 5JVOA 1WQGA 1O24A 5TJ3A 3GTGA 3HOYK 4P9SA 3HOYC 1ISEA 1WCMK 1SMYA 4YFNA 5C4JK 5C4JC 3S2HK 3S2HC 4XSXA 2JA7A 1F9NA 4A3DK 4A3DC 4Q5SA 1L0WA 3G4CA 1XXBA 1SFOK 3QX3A 3A8IA 1SFOC 1Y1VK 1Y1VC 1PJ5A 4OIRA 2WAQD 2XCQA 3GTLK 3SZYA 4AYBD 1K83A 1O25A 5IP9K 5IP9C 1WQHA 1J6XA 3HOUK 2YU9A 3A8KA 3HOUC 3CQZA 2NVQK 3GTKA 2NVQC 1XPPA 5TMFA 1TWCK 2ZFZA 4RMFA 2JH3A 2NVYK 2ZUFA 2NVYC 1VH2A 1ZQ1C 3S1QK 3N0BA 3RZOK 3S1QC 1TWHA 3HOXK 1O28A 3HOXC 4G0VA 5IOTA 2V6UA 3DXJA 2E2HA 3GTGK 4Y7NK 4J3NA 3GTGC 4Y7NC 3RZDK 1AB4A 3RZDC 3S0XA 5E68A 1TWAK 1J6VA 2JA7K 3VA7A 2JA7C 4QIWD 1R9TA 2P8TA 4A3MK 4A3MC 3PO3K 3GEHA 3PO3C 4JK1A 4YFXA 5EGHA 5IYBK 2CFAA 5C44K 5IYBC 4A3FK 5C44C 1YCLA 4A3FC 2CFAB 1EK8A 5TMCA 4KMHA 4BLBA 4LK0A 1WORA 2YU9K 1F7UA 1VGXA 3LAJA 5D4DA 3CQZK 2YU9C 2GAHC 3GTKK 1WCMA 3CQZC 5C3EC 1TWGA 2E2IK 3GTKC 1O27A 3I4MC 1DCPA 4KMAA 4O2DA 3M4OK 2WB1D 3GTMA 3M4OC 4A3EK 2D6FC 1DCHA 4C2MK 4A3EC 4C2MC 4GTFA 3GTPK 4A3KC 4BLAA
chains in the Genus database with same CATH topology
3GTPC 2PA8L 4OIPA 3S1NK 1TWHK 3S1NC 2JA6K 1TWHC 2VUMK 5M5YK 2VUMC 2BE5A 4QJVA 4OINA 2NVTK 2R92K 4YFKA 4QJVB 3HOYK 2NVTC 4OIQA 2R92C 2E2HK 3HOYC 2E2HC 4G7OA 4C3IK 1WCMK 4GZYA 1SMYA 4YFNA 5FLMK 5C4JK 3S16K 5FLMC 3S16C 5C4JC 3S2HK 3S2HC 4XSXA 5C4XK 5FJ8K 2WB1L 2E2IC 1IW7A 4A3DK 4A3DC 4Q5SA 3HKZD 4BXXK 1SFOK 4BXXC 1SFOC 1Y1VK 2A68A 1YNJA 4C3HK 1Y1VC 4LK1A 4Y52K 4KN7A 4A3IK 4OIRA 4Y52C 4A3IC 2WAQD 4NOIA 3GTLK 4KN4A 4X6AK 4AYBD 2JA6C 4X6AC 3K7AK 3K7AC 5IP9K 3S17K 2A6EA 5IP9C 3S17C 1Y1WK 4BBRK 4MEYA 3HOUK 1Y1WC 4BBRC 4BBSK 3HOUC 2NVQK 3S1RK 4BBSC 4G7ZA 5M3FK 2NVQC 3S1RC 1XPPA 5TMFA 4XSZA 4KMUA 1TWCK 4G7HA 3GTOK 3HOVK 3HOVC 1TWGK 1WCMC 3GTOC 3I4NK 1TWGC 2NVYK 2JA5K 3I4NC 2NVYC 2JA5C 3GTMK 3HKZL 5C4XC 3GTMC 4MEXA 1HQMA 3HOWK 3HOWC 3S1QK 2PA8D 4XLPA 5M5WK 2NVXK 3RZOK 3S1QC 2NVXC 2WAQL 3FKIK 4OIOA 4A3BK 3FKIC 2O5IA 3PO2K 2CW0A 3PO2C 4AYBL 2A6HA 5IYCK 5M5XK 3HOXK 1I50K 3GTLC 5IYCC 4LJZA 3HOXC 4A3CK 1I50C 1K83K 1ZYRA 1K83C 3GTJK 3HOZK 3DXJA 3GTJC 3HOZC 3GTGK 4Y7NK 5C3EK 3GTGC 3GTQK 3H3VD 3I4MK 4Y7NC 3GTQC 4BY7K 2PPBA 4BY7C 3RZDK 4C3JK 4A3GK 3RZDC 1TWCC 2E2JK 1TWAK 4A3GC 4A3JK 2E2JC 3S15K 2JA7K 4Q4ZA 4A3JC 5IYDK 3S15C 2JA7C 4QIWD 3S2DK 5IYDC 4A3MK 4YG2A 3WODA 3S2DC 5M3MK 4A3MC 2R7ZK 2PMZD 5IP7K 3PO3K 4XLNA 2R7ZC 5IP7C 3PO3C 2Y0SD 2R93K 3EQLA 2JA8K 4JK1A 4YFXA 1I3QK 5IYBK 2JA8C 2R93C 1I3QC 5C44K 1YNNA 5IYBC 4A3FK 3RZOC 5C44C 4A93K 4A3FC 4A3BC 4A93C 2A69A 5TMCA 4A3CC 4A3LK 3M3YK 4LK0A 4BY1K 2B63K 4ZH4A 4A3LC 4LLGA 3M3YC 4BY1C 2B63C 2YU9K 3H3VL 3S1MK 3S1MC 5D4DA 3CQZK 2YU9C 3GTKK 3CQZC 5C3EC 1BDFA 2E2IK 3GTKC 4A3KK 3I4MC 3H0GK 3H0GC 2O5JA 3M4OK 2WB1D 3S14K 3M4OC 4QIWL 3S14C 1TWAC 1R9TK 1I6VA 4A3EK 4C2MK 1R9TC 1TWFK 4MQ9A 4A3EC 2PMZL 1I6HK 1TWFC 3GTPK 4A3KC 1I6HC 2Y0SL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTP C;  2PA8 L;  4OIP A;  3S1N K;  1TWH K;  3S1N C;  2JA6 K;  1TWH C;  2VUM K;  5M5Y K;  2VUM C;  2BE5 A;  4QJV A;  4OIN A;  2NVT K;  2R92 K;  4YFK A;  4QJV B;  3HOY K;  2NVT C;  4OIQ A;  2R92 C;  2E2H K;  3HOY C;  2E2H C;  4G7O A;  4C3I K;  1WCM K;  4GZY A;  1SMY A;  4YFN A;  5FLM K;  5C4J K;  3S16 K;  5FLM C;  3S16 C;  5C4J C;  3S2H K;  3S2H C;  4XSX A;  5C4X K;  5FJ8 K;  2WB1 L;  2E2I C;  1IW7 A;  4A3D K;  4A3D C;  4Q5S A;  3HKZ D;  4BXX K;  1SFO K;  4BXX C;  1SFO C;  1Y1V K;  2A68 A;  1YNJ A;  4C3H K;  1Y1V C;  4LK1 A;  4Y52 K;  4KN7 A;  4A3I K;  4OIR A;  4Y52 C;  4A3I C;  2WAQ D;  4NOI A;  3GTL K;  4KN4 A;  4X6A K;  4AYB D;  2JA6 C;  4X6A C;  3K7A K;  3K7A C;  5IP9 K;  3S17 K;  2A6E A;  5IP9 C;  3S17 C;  1Y1W K;  4BBR K;  4MEY A;  3HOU K;  1Y1W C;  4BBR C;  4BBS K;  3HOU C;  2NVQ K;  3S1R K;  4BBS C;  4G7Z A;  5M3F K;  2NVQ C;  3S1R C;  1XPP A;  5TMF A;  4XSZ A;  4KMU A;  1TWC K;  4G7H A;  3GTO K;  3HOV K;  3HOV C;  1TWG K;  1WCM C;  3GTO C;  3I4N K;  1TWG C;  2NVY K;  2JA5 K;  3I4N C;  2NVY C;  2JA5 C;  3GTM K;  3HKZ L;  5C4X C;  3GTM C;  4MEX A;  1HQM A;  3HOW K;  3HOW C;  3S1Q K;  2PA8 D;  4XLP A;  5M5W K;  2NVX K;  3RZO K;  3S1Q C;  2NVX C;  2WAQ L;  3FKI K;  4OIO A;  4A3B K;  3FKI C;  2O5I A;  3PO2 K;  2CW0 A;  3PO2 C;  4AYB L;  2A6H A;  5IYC K;  5M5X K;  3HOX K;  1I50 K;  3GTL C;  5IYC C;  4LJZ A;  3HOX C;  4A3C K;  1I50 C;  1K83 K;  1ZYR A;  1K83 C;  3GTJ K;  3HOZ K;  3DXJ A;  3GTJ C;  3HOZ C;  3GTG K;  4Y7N K;  5C3E K;  3GTG C;  3GTQ K;  3H3V D;  3I4M K;  4Y7N C;  3GTQ C;  4BY7 K;  2PPB A;  4BY7 C;  3RZD K;  4C3J K;  4A3G K;  3RZD C;  1TWC C;  2E2J K;  1TWA K;  4A3G C;  4A3J K;  2E2J C;  3S15 K;  2JA7 K;  4Q4Z A;  4A3J C;  5IYD K;  3S15 C;  2JA7 C;  4QIW D;  3S2D K;  5IYD C;  4A3M K;  4YG2 A;  3WOD A;  3S2D C;  5M3M K;  4A3M C;  2R7Z K;  2PMZ D;  5IP7 K;  3PO3 K;  4XLN A;  2R7Z C;  5IP7 C;  3PO3 C;  2Y0S D;  2R93 K;  3EQL A;  2JA8 K;  4JK1 A;  4YFX A;  1I3Q K;  5IYB K;  2JA8 C;  2R93 C;  1I3Q C;  5C44 K;  1YNN A;  5IYB C;  4A3F K;  3RZO C;  5C44 C;  4A93 K;  4A3F C;  4A3B C;  4A93 C;  2A69 A;  5TMC A;  4A3C C;  4A3L K;  3M3Y K;  4LK0 A;  4BY1 K;  2B63 K;  4ZH4 A;  4A3L C;  4LLG A;  3M3Y C;  4BY1 C;  2B63 C;  2YU9 K;  3H3V L;  3S1M K;  3S1M C;  5D4D A;  3CQZ K;  2YU9 C;  3GTK K;  3CQZ C;  5C3E C;  1BDF A;  2E2I K;  3GTK C;  4A3K K;  3I4M C;  3H0G K;  3H0G C;  2O5J A;  3M4O K;  2WB1 D;  3S14 K;  3M4O C;  4QIW L;  3S14 C;  1TWA C;  1R9T K;  1I6V A;  4A3E K;  4C2M K;  1R9T C;  1TWF K;  4MQ9 A;  4A3E C;  2PMZ L;  1I6H K;  1TWF C;  3GTP K;  4A3K C;  1I6H C;  2Y0S L; 
#chains in the Genus database with same CATH topology
 1WQF A;  2PA8 L;  3GTP C;  3S1N K;  1TWH K;  3S1N C;  2JA6 K;  1TWH C;  1WOO A;  1WSR A;  3GTL A;  2KWA A;  1F7V A;  4QJV A;  4OIN A;  4KM8 A;  2XCR B;  4GTD A;  4QJV B;  1DCO A;  4OIQ A;  2E2H K;  1O2B A;  2E2H C;  4GZY A;  3S16 K;  1TWC A;  3S16 C;  1WIH A;  1WOS A;  1WSV A;  1GE9 A;  4BXX K;  4BXX C;  4C3H K;  4LK1 A;  1O29 A;  4C3H C;  3GEI A;  1B4B A;  3BUE A;  3S17 K;  3S17 C;  2B63 A;  4DDQ A;  5M3F K;  3HOV K;  2FQO A;  5IOQ A;  3GTO K;  3HOV C;  2PMZ L;  1TWG K;  1WCM C;  3GTO C;  3I4N K;  1TWG C;  3I4N C;  1TWA A;  3GTM K;  3GTM C;  3T01 A;  4MEX A;  1ZXO A;  4XLP A;  3LPX A;  2RGR A;  1EH1 A;  2WAQ L;  4LR2 A;  4A3B K;  2VUM A;  4KAS A;  4AYB L;  2A6H A;  1XZQ A;  5IOS A;  3GTL C;  4A3C K;  1XZQ B;  3HOZ K;  3HOZ C;  1ZVU A;  3H3V D;  1BS2 A;  2ZUE A;  4BY7 K;  4BY7 C;  2E2I A;  3AQO A;  4A3G K;  1TWC C;  3GEE A;  4A3G C;  4GTL A;  3S15 K;  3SZZ A;  4Q4Z A;  5CHP A;  3S15 C;  5M3M K;  3GTP A;  4XLN A;  2Y0S D;  3EQL A;  5HL8 A;  3IPJ A;  3RZO C;  2JA6 A;  4A93 K;  4A93 C;  4C45 A;  1USM A;  1Y1W A;  1F93 A;  2GAG C;  2B63 K;  4ZH4 A;  4LLG A;  2B63 C;  4GTC A;  2O5J A;  2Y3P A;  5IOR A;  4QIW L;  1TWA C;  1I6V A;  2NVX A;  1ZBS A;  3G4A A;  3FKI A;  4KDD A;  4OIP A;  1USO A;  4XCH A;  2VUM K;  3FHZ A;  2VUM C;  1IL2 A;  2BE5 A;  1VRQ C;  2R92 K;  2R92 C;  3GTQ A;  2GSN A;  4G7O A;  4C3I K;  4C3I C;  5FLM K;  3GTO A;  4GTA A;  4KC6 A;  5FLM C;  5C4X K;  2E2I C;  5FJ8 K;  2WB1 L;  4GT9 A;  1IW7 A;  1O26 A;  3HKZ D;  2W7V A;  2R93 A;  2A68 A;  1RU0 A;  1I3Q A;  4A3I K;  3TFI A;  4A3I C;  4NOI A;  1BJT A;  2EBB A;  3TFJ A;  3AD9 C;  3K7A K;  4GTE A;  2JA6 C;  3K7A C;  1Y1W K;  4GFQ A;  1Y1W C;  4FZB A;  4BBS K;  4BBS C;  3N0C A;  4G7H A;  4XSZ A;  4KMU A;  3BP3 A;  4PAA A;  1IQ0 A;  1X31 C;  1VJE A;  3HOW K;  3HOW C;  2PA8 D;  2NVX K;  5M5W K;  2NVX C;  4ILD A;  3FKI K;  1EFW A;  2P5M A;  4G0W A;  1BGW A;  3FKI C;  5L46 A;  2O5I A;  2CW0 A;  4PAB A;  1J98 A;  5IYC K;  3Q3Q A;  5IYC C;  2RH6 A;  4KMD A;  4LOW A;  3GTQ K;  4P5A A;  3GTQ C;  3NUH A;  2PPB A;  4C3J K;  4C3J C;  1G51 A;  3JST A;  2XCO A;  3LAP A;  4WIL A;  1VLO A;  1INN A;  3HXA A;  4YG2 A;  3WOD A;  2FQT A;  1V5V A;  3CAG A;  5IP7 K;  5IP7 C;  2R93 K;  2R93 C;  1I3Q K;  1I3Q C;  5JFE A;  1YNN A;  1O2A A;  4KAT A;  3FOE A;  4G0U A;  4A3B C;  1EQR A;  2A69 A;  4KB2 A;  4M1X A;  3TTG A;  4A3C C;  4A3L K;  1WOP A;  1UV7 A;  3T00 A;  3M3Y K;  4A3L C;  2R92 A;  3M3Y C;  3H3V L;  3S1M K;  3S1M C;  1BDF A;  1B4A A;  3OEP A;  2JA5 A;  3S14 K;  4AH6 A;  3S14 C;  1TWF K;  3N3Y A;  4MQ9 A;  1TWF C;  3OPF A;  2Y0S L;  1C0A A;  5M5Y K;  4FM9 A;  1I50 A;  2GSO A;  3GSI A;  3AD8 C;  3GTJ A;  4KM9 A;  2V6T A;  2NVT K;  4YFK A;  2NVT C;  4LQY A;  1XZP A;  1XZP B;  2GSU A;  1PJ7 A;  1HI9 A;  4KB4 A;  2R7Z A;  3V4G A;  1YNJ A;  1JVI A;  4Y52 K;  4KN7 A;  4Y52 C;  1J6W A;  3AD7 C;  1XXA A;  2PHC B;  1IBA A;  4KN4 A;  4X6A K;  3ADA C;  5EGE A;  4X6A C;  1KQ4 A;  2A6E A;  4BBR K;  4MEY A;  4BBR C;  3S1R K;  4G7Z A;  3S1R C;  3BP8 C;  3L4K A;  3A8J A;  3H0G A;  3TFH A;  2JA5 K;  4WJ4 A;  4KAR A;  2JA5 C;  3HKZ L;  5C4X C;  1JOE A;  1HQM A;  1PJ6 A;  1XXC A;  3MML B;  5CJ9 A;  4OIO A;  3ERE D;  3PO2 K;  3PO2 C;  5M5X K;  3AQP A;  1I50 K;  4LJZ A;  1I50 C;  1K83 K;  1ZYR A;  1K83 C;  3GTJ K;  3AH5 A;  3GTJ C;  5C3E K;  3I4M K;  3T02 A;  2E2J K;  1YX2 A;  4A3J K;  3GIR A;  2E2J C;  4GTB A;  4A3J C;  5IYD K;  4WJ3 M;  1IS1 A;  3S2D K;  5IYD C;  1SFO A;  3S2D C;  1TWF A;  1Y1V A;  3ORE A;  2R7Z K;  2PMZ D;  1EI6 A;  2R7Z C;  1IE0 A;  2JA8 K;  2JA8 C;  4BKW A;  2V6S A;  4BY1 K;  4BY1 C;  1JQW A;  4P5B A;  4A3K K;  3H0G K;  3FOF A;  2NVY A;  3H0G C;  3GDZ A;  3L4J A;  4KAW X;  1R9T K;  1R9T C;  1DD5 A;  1I6H K;  1I6H C;  1O2F B;  5JVO A;  1WQG A;  1O24 A;  5TJ3 A;  3GTG A;  3HOY K;  4P9S A;  3HOY C;  1ISE A;  1WCM K;  1SMY A;  4YFN A;  5C4J K;  5C4J C;  3S2H K;  3S2H C;  4XSX A;  2JA7 A;  1F9N A;  4A3D K;  4A3D C;  4Q5S A;  1L0W A;  3G4C A;  1XXB A;  1SFO K;  3QX3 A;  3A8I A;  1SFO C;  1Y1V K;  1Y1V C;  1PJ5 A;  4OIR A;  2WAQ D;  2XCQ A;  3GTL K;  3SZY A;  4AYB D;  1K83 A;  1O25 A;  5IP9 K;  5IP9 C;  1WQH A;  1J6X A;  3HOU K;  2YU9 A;  3A8K A;  3HOU C;  3CQZ A;  2NVQ K;  3GTK A;  2NVQ C;  1XPP A;  5TMF A;  1TWC K;  2ZFZ A;  4RMF A;  2JH3 A;  2NVY K;  2ZUF A;  2NVY C;  1VH2 A;  1ZQ1 C;  3S1Q K;  3N0B A;  3RZO K;  3S1Q C;  1TWH A;  3HOX K;  1O28 A;  3HOX C;  4G0V A;  5IOT A;  2V6U A;  3DXJ A;  2E2H A;  3GTG K;  4Y7N K;  4J3N A;  3GTG C;  4Y7N C;  3RZD K;  1AB4 A;  3RZD C;  3S0X A;  5E68 A;  1TWA K;  1J6V A;  2JA7 K;  3VA7 A;  2JA7 C;  4QIW D;  1R9T A;  2P8T A;  4A3M K;  4A3M C;  3PO3 K;  3GEH A;  3PO3 C;  4JK1 A;  4YFX A;  5EGH A;  5IYB K;  2CFA A;  5C44 K;  5IYB C;  4A3F K;  5C44 C;  1YCL A;  4A3F C;  2CFA B;  1EK8 A;  5TMC A;  4KMH A;  4BLB A;  4LK0 A;  1WOR A;  2YU9 K;  1F7U A;  1VGX A;  3LAJ A;  5D4D A;  3CQZ K;  2YU9 C;  2GAH C;  3GTK K;  1WCM A;  3CQZ C;  5C3E C;  1TWG A;  2E2I K;  3GTK C;  1O27 A;  3I4M C;  1DCP A;  4KMA A;  4O2D A;  3M4O K;  2WB1 D;  3GTM A;  3M4O C;  4A3E K;  2D6F C;  1DCH A;  4C2M K;  4A3E C;  4C2M C;  4GTF A;  3GTP K;  4A3K C;  4BLA A; 
#chains in the Genus database with same CATH homology
 3GTP C;  2PA8 L;  4OIP A;  3S1N K;  1TWH K;  3S1N C;  2JA6 K;  1TWH C;  2VUM K;  5M5Y K;  2VUM C;  2BE5 A;  4QJV A;  4OIN A;  2NVT K;  2R92 K;  4YFK A;  4QJV B;  3HOY K;  2NVT C;  4OIQ A;  2R92 C;  2E2H K;  3HOY C;  2E2H C;  4G7O A;  4C3I K;  1WCM K;  4GZY A;  1SMY A;  4YFN A;  5FLM K;  5C4J K;  3S16 K;  5FLM C;  3S16 C;  5C4J C;  3S2H K;  3S2H C;  4XSX A;  5C4X K;  5FJ8 K;  2WB1 L;  2E2I C;  1IW7 A;  4A3D K;  4A3D C;  4Q5S A;  3HKZ D;  4BXX K;  1SFO K;  4BXX C;  1SFO C;  1Y1V K;  2A68 A;  1YNJ A;  4C3H K;  1Y1V C;  4LK1 A;  4Y52 K;  4KN7 A;  4A3I K;  4OIR A;  4Y52 C;  4A3I C;  2WAQ D;  4NOI A;  3GTL K;  4KN4 A;  4X6A K;  4AYB D;  2JA6 C;  4X6A C;  3K7A K;  3K7A C;  5IP9 K;  3S17 K;  2A6E A;  5IP9 C;  3S17 C;  1Y1W K;  4BBR K;  4MEY A;  3HOU K;  1Y1W C;  4BBR C;  4BBS K;  3HOU C;  2NVQ K;  3S1R K;  4BBS C;  4G7Z A;  5M3F K;  2NVQ C;  3S1R C;  1XPP A;  5TMF A;  4XSZ A;  4KMU A;  1TWC K;  4G7H A;  3GTO K;  3HOV K;  3HOV C;  1TWG K;  1WCM C;  3GTO C;  3I4N K;  1TWG C;  2NVY K;  2JA5 K;  3I4N C;  2NVY C;  2JA5 C;  3GTM K;  3HKZ L;  5C4X C;  3GTM C;  4MEX A;  1HQM A;  3HOW K;  3HOW C;  3S1Q K;  2PA8 D;  4XLP A;  5M5W K;  2NVX K;  3RZO K;  3S1Q C;  2NVX C;  2WAQ L;  3FKI K;  4OIO A;  4A3B K;  3FKI C;  2O5I A;  3PO2 K;  2CW0 A;  3PO2 C;  4AYB L;  2A6H A;  5IYC K;  5M5X K;  3HOX K;  1I50 K;  3GTL C;  5IYC C;  4LJZ A;  3HOX C;  4A3C K;  1I50 C;  1K83 K;  1ZYR A;  1K83 C;  3GTJ K;  3HOZ K;  3DXJ A;  3GTJ C;  3HOZ C;  3GTG K;  4Y7N K;  5C3E K;  3GTG C;  3GTQ K;  3H3V D;  3I4M K;  4Y7N C;  3GTQ C;  4BY7 K;  2PPB A;  4BY7 C;  3RZD K;  4C3J K;  4A3G K;  3RZD C;  1TWC C;  2E2J K;  1TWA K;  4A3G C;  4A3J K;  2E2J C;  3S15 K;  2JA7 K;  4Q4Z A;  4A3J C;  5IYD K;  3S15 C;  2JA7 C;  4QIW D;  3S2D K;  5IYD C;  4A3M K;  4YG2 A;  3WOD A;  3S2D C;  5M3M K;  4A3M C;  2R7Z K;  2PMZ D;  5IP7 K;  3PO3 K;  4XLN A;  2R7Z C;  5IP7 C;  3PO3 C;  2Y0S D;  2R93 K;  3EQL A;  2JA8 K;  4JK1 A;  4YFX A;  1I3Q K;  5IYB K;  2JA8 C;  2R93 C;  1I3Q C;  5C44 K;  1YNN A;  5IYB C;  4A3F K;  3RZO C;  5C44 C;  4A93 K;  4A3F C;  4A3B C;  4A93 C;  2A69 A;  5TMC A;  4A3C C;  4A3L K;  3M3Y K;  4LK0 A;  4BY1 K;  2B63 K;  4ZH4 A;  4A3L C;  4LLG A;  3M3Y C;  4BY1 C;  2B63 C;  2YU9 K;  3H3V L;  3S1M K;  3S1M C;  5D4D A;  3CQZ K;  2YU9 C;  3GTK K;  3CQZ C;  5C3E C;  1BDF A;  2E2I K;  3GTK C;  4A3K K;  3I4M C;  3H0G K;  3H0G C;  2O5J A;  3M4O K;  2WB1 D;  3S14 K;  3M4O C;  4QIW L;  3S14 C;  1TWA C;  1R9T K;  1I6V A;  4A3E K;  4C2M K;  1R9T C;  1TWF K;  4MQ9 A;  4A3E C;  2PMZ L;  1I6H K;  1TWF C;  3GTP K;  4A3K C;  1I6H C;  2Y0S L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...