4BY7K

Elongating rna polymerase ii-bye1 tld complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by7K00
3CQZK 1I6HK 3S17C 2NVQK 4AYBD 4GZYA 4A3GC 3RZDK 5M5XK 3CQZC 1K83K 3HKZD 2NVQC 5C4XK 4A3DK 4A3GK 4LJZA 4KN4A 3I4MK 5IYDK 1XPPA 1Y1WK 3I4NC 3HOVC 2R93K 2Y0SL 4A3IK 4A3MK 3GTQC 1WCMK 3HOWC 5C4JC 3I4MC 1I3QK 2Y0SD 1TWFK 4JK1A 5C44C 2E2IK 4A3JK 3DXJA 3GTJK 1WCMC 3H3VL 3HOWK 3PO3K 5C4JK 4Q4ZA 1TWFC 4KMUA 4A3JC 5D4DA 4MEXA 4MQ9A 4A3EC 4A3FC 2NVTC 4Y7NC 4X6AK 4OIRA 2WB1L 2A69A 5M3FK 2VUMK 3S2HC 4A3CC 4LLGA 1TWGC 5M3MK 2A6HA 3RZOK 4BBSK 4G7HA 2R92K 4A3EK 2NVTK 4YFNA 5M5WK 2JA7K 2E2HC 2NVXC 2VUMC 3GTMC 4C3IK 3EQLA 3RZOC 3HOXC 2JA7C 4BBRC 3HOUC 4G7OA 1SFOK 3S1RK 3PO2C 1I6HC 2JA8C 4A3LK 4YFXA 1IW7A 2E2JC 4C2MK 1TWAC 3K7AK 3S1RC 5FJ8K 4MEYA 5IYCK 3HOZK 2JA8K 3S16C 3S1QC 4A3LC 4G7ZA 4A93K 5C4XC 3K7AC 3M3YC 3HOVK 2R93C 4A3IC 4A3MC 4QIWL 3S16K 4OIOA 4NOIA 3S1QK 2NVYK 4LK0A 5FLMC 4A3KK 4C3HK 3HKZL 2YU9C 3S15K 4QJVA 3S1NK 3M4OC 4XSXA 4A3BC 5C3EC 3S2DK 4XLNA 1Y1WC 3GTOK 4QJVB 3M4OK 4YFKA 2YU9K 3S15C 4A3BK 4Y7NK 3S1NC 3S2DC 4X6AC 5TMCA 2PMZL 3S2HK 3GTOC 2E2IC 4KN7A 3FKIK 4YG2A 2R92C 4Q5SA 2PMZD 5TMFA 3GTGK 3GTPC 2JA6C 3FKIC 2PA8L 3GTGC 5IYDC 3GTPK 4BBRK 3HOUK 3PO2K 2WAQD 2JA6K 2O5JA 3GTQK 3RZDC 4OIPA 1TWAK 2E2HK 1I3QC 5C44K 1K83C 2NVXK 5IP9C 2B63C 3S1MK 4OINA 4LK1A 4ZH4A 3HOXK 4BXXK 1I6VA 3H3VD 1TWHK 4XLPA 3GTKC 2A68A 1R9TC 4BY7C 4AYBL 1SMYA 3I4NK 4OIQA 2WB1D 5IP9K 1I50K 2B63K 3HOYK 5IYBK 4A3FK 3S1MC 4BXXC 2PPBA 4BY7K 1TWHC 3GTKK 4A3CK 1R9TK 4A3KC 1TWGK 1YNNA 1HQMA 5IYBC 3HOZC 1YNJA 1I50C 3GTJC 3HOYC 3PO3C 4A93C 4BBSC 5C3EK 2R7ZC 1Y1VK 5M5YK 3M3YK 4BY1C 3H0GK 1TWCC 3GTLK 4QIWD 2PA8D 3S14C 2NVYC 1Y1VC 5FLMK 2A6EA 2R7ZK 4Y52C 2JA5K 5IP7K 1SFOC 1TWCK 3GTLC 4A3DC 4BY1K 3WODA 3H0GC 2BE5A 4C3JK 2E2JK 3S14K 2WAQL 5IP7C 2JA5C 3GTMK 4Y52K 5IYCC 3S17K 4XSZA 1BDFA 2CW0A 2O5IA 1ZYRA
chains in the Genus database with same CATH superfamily
3CQZK 3ERED 4AYBD 1R9TA 1WOSA 3CQZC 1O2AA 2P8TA 3HKZD 2NVQC 1WOOA 5C4XK 3I4NC 3QX3A 2Y0SL 3FHZA 4A3IK 4J3NA 1WQGA 3HOWC 2CFAB 2Y0SD 1VGXA 1TWCA 3DXJA 4O2DA 1WCMC 5EGHA 3H3VL 1Y1WA 5C4JK 1TWFC 4A3JC 1XXCA 4MQ9A 4A3EC 2NVTC 2EBBA 3TFJA 4X6AK 2WB1L 4A3CC 4BKWA 2A6HA 4BBSK 4KMHA 2R92K 1USMA 4A3EK 2NVTK 4LQYA 2JA7K 2E2HC 4P9SA 3EQLA 4BBRC 1F93A 3AH5A 4YFXA 3JSTA 1PJ6A 1WSRA 5FJ8K 3S16C 4KMDA 4M1XA 3M3YC 3HOVK 1ISEA 2R93C 4A3MC 3S16K 4LK0A 4A3KK 4C3HK 1I50A 2YU9C 5IOQA 4XLNA 4QJVB 3S1NC 4P5BA 4WILA 4A3BK 1ZXOA 3S2DC 5TMCA 1EK8A 3GTOC 1O27A 4KMAA 4LOWA 2R92A 5TMFA 2JA6C 3GTPK 3GIRA 1INNA 4OIPA 1TWAK 5C44K 1K83C 5IP9C 3S1MK 4OINA 4LK1A 3CAGA 2A68A 3I4NK 3Q3QA 5IP9K 3S1MC 3A8JA 4GTAA 5IYBK 4BXXC 2NVYA 2PPBA 3AQPA 1R9TK 1TWGK 4G0UA 1YNJA 3BUEA 1XZQA 4A93C 4WJ4A 5M5YK 2FQOA 4GTCA 4FM9A 3S14C 2NVYC 5FLMK 2A6EA 4G0VA 4Y52C 1SFOC 1ZBSA 3GTLC 3WODA 1AB4A 2E2JK 2WAQL 4Y52K 3HXAA 4KM8A 2O5IA 1ZYRA 1SFOA 1I6HK 3S17C 1DCHA 2YU9A 3A8KA 5M5XK 2GSUA 1F9NA 1XZPA 2W7VA 4KN4A 4LJZA 1XPPA 3I4MK 3HOVC 2R93K 1BJTA 2GSOA 1EI6A 1VLOA 5C44C 1TWFK 4JK1A 2E2IK 1VH2A 1IL2A 1G51A 3GTJK 1ZVUA 4Q4ZA 3GEEA 1B4AA 5D4DA 1EFWA 4OIRA 2VUMK 5M3MK 2R93A 1F7UA 3HOXC 1IBAA 2PHCB 2XCRB 2JH3A 2JA7C 1SFOK 1O28A 2ZUEA 3TFHA 4A3LK 1IW7A 3GTGA 3LAJA 1XXBA 1TWAC 3K7AK 3S1RC 4MEYA 3HOZK 1YCLA 1XZQB 1DCPA 3N0BA 1J6WA 3IPJA 1EH1A 3SZZA 4QJVA 3M4OC 1TWHA 1PJ5A 3G4AA 4X6AC 1O2BA 4KAWX 3SZYA 4KDDA 3T01A 2E2IC 4KN7A 2R92C 2PMZD 1HI9A 4C3JC 4KC6A 3GTGK 3GTPC 1JQWA 2D6FC 1O24A 4WJ3M 3HOUK 1VRQC 1WQFA 1UV7A 4ZH4A 3HOXK 3H3VD 2Y3PA 1TWHK 3GTKC 2VUMA 5CJ9A 4BY7C 3CQZA 1SMYA 2RGRA 2B63K 4XCHA 3HOYK 4A3FK 4A3CK 1DCOA 4A3KC 5IYBC 4BBSC 3GTJC 2E2IA 1TWFA 3ADAC 3GDZA 3LPXA 1Y1VK 1RU0A 4BY1C 3FKIA 2R7ZK 3L4KA 2JA5K 5IP7K 1BGWA 1TWCK 4BY1K 1J6XA 2BE5A 4GTLA 1O25A 1WIHA 1WQHA 5IOSA 1BDFA 3S17K 3V4GA 2P5MA 3N3YA 1WSVA 4GZYA 4A3GC 1XZPB 2GAGC 5IOTA 1K83K 2V6TA 1O26A 4AH6A 3VA7A 4A3DK 4GTBA 4A3GK 5JFEA 1ZQ1C 3GTJA 5IYDK 1GE9A 4KM9A 5JVOA 3GTQC 4KB2A 3GSIA 1I3QK 1X31C 2JA6A 2FQTA 2RH6A 5IORA 4A3FC 2ZFZA 4Y7NC 3GTOA 3BP3A 5M3FK 3S2HC 4LLGA 1IS1A 1USOA 4GT9A 4G7HA 1TWAA 4C3IK 3L4JA 4LR2A 3HOUC 4G7OA 3S1RK 3PO2C 1I6HC 2JA8C 1XXAA 4C2MK 4PABA 5IYCK 3GTMA 2JA8K 3S1QC 4G7ZA 4A93K 4C2MC 1K83A 1TWGA 1L0WA 3S1QK 4OIOA 2NVYK 5FLMC 3HKZL 3AD8C 3LAPA 5TJ3A 4KB4A 2GAHC 3M4OK 4YFKA 2YU9K 3GTKA 2PMZL 1V5VA 2ZUFA 3FKIK 4BLBA 1IQ0A 1WCMA 2NVXA 3FKIC 4PAAA 3AD9C 3GTGC 2JA6K 2O5JA 1I3QA 5HL8A 2E2HK 3GEIA 4A3DC 1I6VA 4RMFA 1R9TC 3OREA 4AYBL 2WB1D 1I50K 3BP8C 5E68A 4BY7K 1VJEA 1EQRA 1YNNA 4GTDA 1HQMA 4GTFA 1I50C 4KARA 1JVIA 5C3EK 2XCQA 3M3YK 1TWCC 4QIWD 1Y1VC 3GTPA 1J6VA 2V6SA 4C3JK 1J98A 3S14K 5IP7C 2R7ZA 2KWAA 2JA7A 4KATA 2NVQK 3RZDK 3T02A 1JOEA 2B63A 4KASA 4C45A 1Y1WK 3GTLA 2GSNA 4A3MK 1WCMK 5C4JC 3I4MC 4A3JK 3PO3K 3HOWK 2CFAA 4KMUA 4MEXA 3AD7C 2A69A 4GFQA 1IE0A 1TWGC 4C3IC 3RZOK 4YFNA 5M5WK 3NUHA 3A8IA 2NVXC 3OEPA 2VUMC 3GTMC 3RZOC 1DD5A 3MMLB 2E2JC 3H0GA 4A3LC 5C4XC 3K7AC 2XCOA 5EGEA 4A3IC 4QIWL 4NOIA 3S0XA 4G0WA 1KQ4A 3S15K 4ILDA 3S1NK 4XSXA 4A3BC 5C3EC 3S2DK 1Y1WC 3TFIA 4P5AA 3T00A 4C3HC 3GTOK 3N0CA 3S15C 4Y7NK 1YX2A 3GTQA 3AQOA 3S2HK 1B4BA 4YG2A 4Q5SA 4FZBA 1BS2A 2E2HA 1F7VA 3TTGA 2PA8L 5IYDC 1O29A 4BBRK 3PO2K 2WAQD 3GTQK 3RZDC 2NVXK 1I3QC 3GEHA 2B63C 4GTEA 4BXXK 4XLPA 3OPFA 5CHPA 4OIQA 3G4CA 4DDQA 1TWHC 3GTKK 3HOZC 3HOYC 3PO3C 2V6UA 2R7ZC 2JA5A 3H0GK 3GTLK 1C0AA 2PA8D 1Y1VA 3FOFA 3FOEA 3H0GC 1WOPA 1O2FB 1WORA 5L46A 2JA5C 3GTMK 5IYCC 4XSZA 2CW0A 4BLAA 1PJ7A
chains in the Genus database with same CATH topology
3CQZK 1I6HK 3S17C 2NVQK 4AYBD 4GZYA 4A3GC 3RZDK 5M5XK 3CQZC 1K83K 3HKZD 2NVQC 5C4XK 4A3DK 4A3GK 4LJZA 4KN4A 3I4MK 5IYDK 1XPPA 1Y1WK 3I4NC 3HOVC 2R93K 2Y0SL 4A3IK 4A3MK 3GTQC 1WCMK 3HOWC 5C4JC 3I4MC 1I3QK 2Y0SD 1TWFK 4JK1A 5C44C 2E2IK 4A3JK 3DXJA 3GTJK 1WCMC 3H3VL 3HOWK 3PO3K 5C4JK 4Q4ZA 1TWFC 4KMUA 4A3JC 5D4DA 4MEXA 4MQ9A 4A3EC 4A3FC 2NVTC 4Y7NC 4X6AK 4OIRA 2WB1L 2A69A 5M3FK 2VUMK 3S2HC 4A3CC 4LLGA 1TWGC 5M3MK 2A6HA 3RZOK 4BBSK 4G7HA 2R92K 4A3EK 2NVTK 4YFNA 5M5WK 2JA7K 2E2HC 2NVXC 2VUMC 3GTMC 4C3IK 3EQLA 3RZOC 3HOXC 2JA7C 4BBRC 3HOUC 4G7OA 1SFOK 3S1RK 3PO2C 1I6HC 2JA8C 4A3LK 4YFXA 1IW7A 2E2JC 4C2MK 1TWAC 3K7AK 3S1RC 5FJ8K 4MEYA 5IYCK 3HOZK 2JA8K 3S16C 3S1QC 4A3LC 4G7ZA 4A93K 5C4XC 3K7AC 3M3YC 3HOVK 2R93C 4A3IC 4A3MC 4QIWL 3S16K 4OIOA 4NOIA 3S1QK 2NVYK 4LK0A 5FLMC 4A3KK 4C3HK 3HKZL 2YU9C 3S15K 4QJVA 3S1NK 3M4OC 4XSXA 4A3BC 5C3EC 3S2DK 4XLNA 1Y1WC 3GTOK 4QJVB 3M4OK 4YFKA 2YU9K 3S15C 4A3BK 4Y7NK 3S1NC 3S2DC 4X6AC 5TMCA 2PMZL 3S2HK 3GTOC 2E2IC 4KN7A 3FKIK 4YG2A 2R92C 4Q5SA 2PMZD 5TMFA 3GTGK 3GTPC 2JA6C 3FKIC 2PA8L 3GTGC 5IYDC 3GTPK 4BBRK 3HOUK 3PO2K 2WAQD 2JA6K 2O5JA 3GTQK 3RZDC 4OIPA 1TWAK 2E2HK 1I3QC 5C44K 1K83C 2NVXK 5IP9C 2B63C 3S1MK 4OINA 4LK1A 4ZH4A 3HOXK 4BXXK 1I6VA 3H3VD 1TWHK 4XLPA 3GTKC 2A68A 1R9TC 4BY7C 4AYBL 1SMYA 3I4NK 4OIQA 2WB1D 5IP9K 1I50K 2B63K 3HOYK 5IYBK 4A3FK 3S1MC 4BXXC 2PPBA 4BY7K 1TWHC 3GTKK 4A3CK 1R9TK 4A3KC 1TWGK 1YNNA 1HQMA 5IYBC 3HOZC 1YNJA 1I50C 3GTJC 3HOYC 3PO3C 4A93C 4BBSC 5C3EK 2R7ZC 1Y1VK 5M5YK 3M3YK 4BY1C 3H0GK 1TWCC 3GTLK 4QIWD 2PA8D 3S14C 2NVYC 1Y1VC 5FLMK 2A6EA 2R7ZK 4Y52C 2JA5K 5IP7K 1SFOC 1TWCK 3GTLC 4A3DC 4BY1K 3WODA 3H0GC 2BE5A 4C3JK 2E2JK 3S14K 2WAQL 5IP7C 2JA5C 3GTMK 4Y52K 5IYCC 3S17K 4XSZA 1BDFA 2CW0A 2O5IA 1ZYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ K;  1I6H K;  3S17 C;  2NVQ K;  4AYB D;  4GZY A;  4A3G C;  3RZD K;  5M5X K;  3CQZ C;  1K83 K;  3HKZ D;  2NVQ C;  5C4X K;  4A3D K;  4A3G K;  4LJZ A;  4KN4 A;  3I4M K;  5IYD K;  1XPP A;  1Y1W K;  3I4N C;  3HOV C;  2R93 K;  2Y0S L;  4A3I K;  4A3M K;  3GTQ C;  1WCM K;  3HOW C;  5C4J C;  3I4M C;  1I3Q K;  2Y0S D;  1TWF K;  4JK1 A;  5C44 C;  2E2I K;  4A3J K;  3DXJ A;  3GTJ K;  1WCM C;  3H3V L;  3HOW K;  3PO3 K;  5C4J K;  4Q4Z A;  1TWF C;  4KMU A;  4A3J C;  5D4D A;  4MEX A;  4MQ9 A;  4A3E C;  4A3F C;  2NVT C;  4Y7N C;  4X6A K;  4OIR A;  2WB1 L;  2A69 A;  5M3F K;  2VUM K;  3S2H C;  4A3C C;  4LLG A;  1TWG C;  5M3M K;  2A6H A;  3RZO K;  4BBS K;  4G7H A;  2R92 K;  4A3E K;  2NVT K;  4YFN A;  5M5W K;  2JA7 K;  2E2H C;  2NVX C;  2VUM C;  3GTM C;  4C3I K;  3EQL A;  3RZO C;  3HOX C;  2JA7 C;  4BBR C;  3HOU C;  4G7O A;  1SFO K;  3S1R K;  3PO2 C;  1I6H C;  2JA8 C;  4A3L K;  4YFX A;  1IW7 A;  2E2J C;  4C2M K;  1TWA C;  3K7A K;  3S1R C;  5FJ8 K;  4MEY A;  5IYC K;  3HOZ K;  2JA8 K;  3S16 C;  3S1Q C;  4A3L C;  4G7Z A;  4A93 K;  5C4X C;  3K7A C;  3M3Y C;  3HOV K;  2R93 C;  4A3I C;  4A3M C;  4QIW L;  3S16 K;  4OIO A;  4NOI A;  3S1Q K;  2NVY K;  4LK0 A;  5FLM C;  4A3K K;  4C3H K;  3HKZ L;  2YU9 C;  3S15 K;  4QJV A;  3S1N K;  3M4O C;  4XSX A;  4A3B C;  5C3E C;  3S2D K;  4XLN A;  1Y1W C;  3GTO K;  4QJV B;  3M4O K;  4YFK A;  2YU9 K;  3S15 C;  4A3B K;  4Y7N K;  3S1N C;  3S2D C;  4X6A C;  5TMC A;  2PMZ L;  3S2H K;  3GTO C;  2E2I C;  4KN7 A;  3FKI K;  4YG2 A;  2R92 C;  4Q5S A;  2PMZ D;  5TMF A;  3GTG K;  3GTP C;  2JA6 C;  3FKI C;  2PA8 L;  3GTG C;  5IYD C;  3GTP K;  4BBR K;  3HOU K;  3PO2 K;  2WAQ D;  2JA6 K;  2O5J A;  3GTQ K;  3RZD C;  4OIP A;  1TWA K;  2E2H K;  1I3Q C;  5C44 K;  1K83 C;  2NVX K;  5IP9 C;  2B63 C;  3S1M K;  4OIN A;  4LK1 A;  4ZH4 A;  3HOX K;  4BXX K;  1I6V A;  3H3V D;  1TWH K;  4XLP A;  3GTK C;  2A68 A;  1R9T C;  4BY7 C;  4AYB L;  1SMY A;  3I4N K;  4OIQ A;  2WB1 D;  5IP9 K;  1I50 K;  2B63 K;  3HOY K;  5IYB K;  4A3F K;  3S1M C;  4BXX C;  2PPB A;  4BY7 K;  1TWH C;  3GTK K;  4A3C K;  1R9T K;  4A3K C;  1TWG K;  1YNN A;  1HQM A;  5IYB C;  3HOZ C;  1YNJ A;  1I50 C;  3GTJ C;  3HOY C;  3PO3 C;  4A93 C;  4BBS C;  5C3E K;  2R7Z C;  1Y1V K;  5M5Y K;  3M3Y K;  4BY1 C;  3H0G K;  1TWC C;  3GTL K;  4QIW D;  2PA8 D;  3S14 C;  2NVY C;  1Y1V C;  5FLM K;  2A6E A;  2R7Z K;  4Y52 C;  2JA5 K;  5IP7 K;  1SFO C;  1TWC K;  3GTL C;  4A3D C;  4BY1 K;  3WOD A;  3H0G C;  2BE5 A;  4C3J K;  2E2J K;  3S14 K;  2WAQ L;  5IP7 C;  2JA5 C;  3GTM K;  4Y52 K;  5IYC C;  3S17 K;  4XSZ A;  1BDF A;  2CW0 A;  2O5I A;  1ZYR A; 
#chains in the Genus database with same CATH topology
 3CQZ K;  3ERE D;  4AYB D;  1R9T A;  1WOS A;  3CQZ C;  1O2A A;  2P8T A;  3HKZ D;  2NVQ C;  1WOO A;  5C4X K;  3I4N C;  3QX3 A;  2Y0S L;  3FHZ A;  4A3I K;  4J3N A;  1WQG A;  3HOW C;  2CFA B;  2Y0S D;  1VGX A;  1TWC A;  3DXJ A;  4O2D A;  1WCM C;  5EGH A;  3H3V L;  1Y1W A;  5C4J K;  1TWF C;  4A3J C;  1XXC A;  4MQ9 A;  4A3E C;  2NVT C;  2EBB A;  3TFJ A;  4X6A K;  2WB1 L;  4A3C C;  4BKW A;  2A6H A;  4BBS K;  4KMH A;  2R92 K;  1USM A;  4A3E K;  2NVT K;  4LQY A;  2JA7 K;  2E2H C;  4P9S A;  3EQL A;  4BBR C;  1F93 A;  3AH5 A;  4YFX A;  3JST A;  1PJ6 A;  1WSR A;  5FJ8 K;  3S16 C;  4KMD A;  4M1X A;  3M3Y C;  3HOV K;  1ISE A;  2R93 C;  4A3M C;  3S16 K;  4LK0 A;  4A3K K;  4C3H K;  1I50 A;  2YU9 C;  5IOQ A;  4XLN A;  4QJV B;  3S1N C;  4P5B A;  4WIL A;  4A3B K;  1ZXO A;  3S2D C;  5TMC A;  1EK8 A;  3GTO C;  1O27 A;  4KMA A;  4LOW A;  2R92 A;  5TMF A;  2JA6 C;  3GTP K;  3GIR A;  1INN A;  4OIP A;  1TWA K;  5C44 K;  1K83 C;  5IP9 C;  3S1M K;  4OIN A;  4LK1 A;  3CAG A;  2A68 A;  3I4N K;  3Q3Q A;  5IP9 K;  3S1M C;  3A8J A;  4GTA A;  5IYB K;  4BXX C;  2NVY A;  2PPB A;  3AQP A;  1R9T K;  1TWG K;  4G0U A;  1YNJ A;  3BUE A;  1XZQ A;  4A93 C;  4WJ4 A;  5M5Y K;  2FQO A;  4GTC A;  4FM9 A;  3S14 C;  2NVY C;  5FLM K;  2A6E A;  4G0V A;  4Y52 C;  1SFO C;  1ZBS A;  3GTL C;  3WOD A;  1AB4 A;  2E2J K;  2WAQ L;  4Y52 K;  3HXA A;  4KM8 A;  2O5I A;  1ZYR A;  1SFO A;  1I6H K;  3S17 C;  1DCH A;  2YU9 A;  3A8K A;  5M5X K;  2GSU A;  1F9N A;  1XZP A;  2W7V A;  4KN4 A;  4LJZ A;  1XPP A;  3I4M K;  3HOV C;  2R93 K;  1BJT A;  2GSO A;  1EI6 A;  1VLO A;  5C44 C;  1TWF K;  4JK1 A;  2E2I K;  1VH2 A;  1IL2 A;  1G51 A;  3GTJ K;  1ZVU A;  4Q4Z A;  3GEE A;  1B4A A;  5D4D A;  1EFW A;  4OIR A;  2VUM K;  5M3M K;  2R93 A;  1F7U A;  3HOX C;  1IBA A;  2PHC B;  2XCR B;  2JH3 A;  2JA7 C;  1SFO K;  1O28 A;  2ZUE A;  3TFH A;  4A3L K;  1IW7 A;  3GTG A;  3LAJ A;  1XXB A;  1TWA C;  3K7A K;  3S1R C;  4MEY A;  3HOZ K;  1YCL A;  1XZQ B;  1DCP A;  3N0B A;  1J6W A;  3IPJ A;  1EH1 A;  3SZZ A;  4QJV A;  3M4O C;  1TWH A;  1PJ5 A;  3G4A A;  4X6A C;  1O2B A;  4KAW X;  3SZY A;  4KDD A;  3T01 A;  2E2I C;  4KN7 A;  2R92 C;  2PMZ D;  1HI9 A;  4C3J C;  4KC6 A;  3GTG K;  3GTP C;  1JQW A;  2D6F C;  1O24 A;  4WJ3 M;  3HOU K;  1VRQ C;  1WQF A;  1UV7 A;  4ZH4 A;  3HOX K;  3H3V D;  2Y3P A;  1TWH K;  3GTK C;  2VUM A;  5CJ9 A;  4BY7 C;  3CQZ A;  1SMY A;  2RGR A;  2B63 K;  4XCH A;  3HOY K;  4A3F K;  4A3C K;  1DCO A;  4A3K C;  5IYB C;  4BBS C;  3GTJ C;  2E2I A;  1TWF A;  3ADA C;  3GDZ A;  3LPX A;  1Y1V K;  1RU0 A;  4BY1 C;  3FKI A;  2R7Z K;  3L4K A;  2JA5 K;  5IP7 K;  1BGW A;  1TWC K;  4BY1 K;  1J6X A;  2BE5 A;  4GTL A;  1O25 A;  1WIH A;  1WQH A;  5IOS A;  1BDF A;  3S17 K;  3V4G A;  2P5M A;  3N3Y A;  1WSV A;  4GZY A;  4A3G C;  1XZP B;  2GAG C;  5IOT A;  1K83 K;  2V6T A;  1O26 A;  4AH6 A;  3VA7 A;  4A3D K;  4GTB A;  4A3G K;  5JFE A;  1ZQ1 C;  3GTJ A;  5IYD K;  1GE9 A;  4KM9 A;  5JVO A;  3GTQ C;  4KB2 A;  3GSI A;  1I3Q K;  1X31 C;  2JA6 A;  2FQT A;  2RH6 A;  5IOR A;  4A3F C;  2ZFZ A;  4Y7N C;  3GTO A;  3BP3 A;  5M3F K;  3S2H C;  4LLG A;  1IS1 A;  1USO A;  4GT9 A;  4G7H A;  1TWA A;  4C3I K;  3L4J A;  4LR2 A;  3HOU C;  4G7O A;  3S1R K;  3PO2 C;  1I6H C;  2JA8 C;  1XXA A;  4C2M K;  4PAB A;  5IYC K;  3GTM A;  2JA8 K;  3S1Q C;  4G7Z A;  4A93 K;  4C2M C;  1K83 A;  1TWG A;  1L0W A;  3S1Q K;  4OIO A;  2NVY K;  5FLM C;  3HKZ L;  3AD8 C;  3LAP A;  5TJ3 A;  4KB4 A;  2GAH C;  3M4O K;  4YFK A;  2YU9 K;  3GTK A;  2PMZ L;  1V5V A;  2ZUF A;  3FKI K;  4BLB A;  1IQ0 A;  1WCM A;  2NVX A;  3FKI C;  4PAA A;  3AD9 C;  3GTG C;  2JA6 K;  2O5J A;  1I3Q A;  5HL8 A;  2E2H K;  3GEI A;  4A3D C;  1I6V A;  4RMF A;  1R9T C;  3ORE A;  4AYB L;  2WB1 D;  1I50 K;  3BP8 C;  5E68 A;  4BY7 K;  1VJE A;  1EQR A;  1YNN A;  4GTD A;  1HQM A;  4GTF A;  1I50 C;  4KAR A;  1JVI A;  5C3E K;  2XCQ A;  3M3Y K;  1TWC C;  4QIW D;  1Y1V C;  3GTP A;  1J6V A;  2V6S A;  4C3J K;  1J98 A;  3S14 K;  5IP7 C;  2R7Z A;  2KWA A;  2JA7 A;  4KAT A;  2NVQ K;  3RZD K;  3T02 A;  1JOE A;  2B63 A;  4KAS A;  4C45 A;  1Y1W K;  3GTL A;  2GSN A;  4A3M K;  1WCM K;  5C4J C;  3I4M C;  4A3J K;  3PO3 K;  3HOW K;  2CFA A;  4KMU A;  4MEX A;  3AD7 C;  2A69 A;  4GFQ A;  1IE0 A;  1TWG C;  4C3I C;  3RZO K;  4YFN A;  5M5W K;  3NUH A;  3A8I A;  2NVX C;  3OEP A;  2VUM C;  3GTM C;  3RZO C;  1DD5 A;  3MML B;  2E2J C;  3H0G A;  4A3L C;  5C4X C;  3K7A C;  2XCO A;  5EGE A;  4A3I C;  4QIW L;  4NOI A;  3S0X A;  4G0W A;  1KQ4 A;  3S15 K;  4ILD A;  3S1N K;  4XSX A;  4A3B C;  5C3E C;  3S2D K;  1Y1W C;  3TFI A;  4P5A A;  3T00 A;  4C3H C;  3GTO K;  3N0C A;  3S15 C;  4Y7N K;  1YX2 A;  3GTQ A;  3AQO A;  3S2H K;  1B4B A;  4YG2 A;  4Q5S A;  4FZB A;  1BS2 A;  2E2H A;  1F7V A;  3TTG A;  2PA8 L;  5IYD C;  1O29 A;  4BBR K;  3PO2 K;  2WAQ D;  3GTQ K;  3RZD C;  2NVX K;  1I3Q C;  3GEH A;  2B63 C;  4GTE A;  4BXX K;  4XLP A;  3OPF A;  5CHP A;  4OIQ A;  3G4C A;  4DDQ A;  1TWH C;  3GTK K;  3HOZ C;  3HOY C;  3PO3 C;  2V6U A;  2R7Z C;  2JA5 A;  3H0G K;  3GTL K;  1C0A A;  2PA8 D;  1Y1V A;  3FOF A;  3FOE A;  3H0G C;  1WOP A;  1O2F B;  1WOR A;  5L46 A;  2JA5 C;  3GTM K;  5IYC C;  4XSZ A;  2CW0 A;  4BLA A;  1PJ7 A; 
#chains in the Genus database with same CATH homology
 3CQZ K;  1I6H K;  3S17 C;  2NVQ K;  4AYB D;  4GZY A;  4A3G C;  3RZD K;  5M5X K;  3CQZ C;  1K83 K;  3HKZ D;  2NVQ C;  5C4X K;  4A3D K;  4A3G K;  4LJZ A;  4KN4 A;  3I4M K;  5IYD K;  1XPP A;  1Y1W K;  3I4N C;  3HOV C;  2R93 K;  2Y0S L;  4A3I K;  4A3M K;  3GTQ C;  1WCM K;  3HOW C;  5C4J C;  3I4M C;  1I3Q K;  2Y0S D;  1TWF K;  4JK1 A;  5C44 C;  2E2I K;  4A3J K;  3DXJ A;  3GTJ K;  1WCM C;  3H3V L;  3HOW K;  3PO3 K;  5C4J K;  4Q4Z A;  1TWF C;  4KMU A;  4A3J C;  5D4D A;  4MEX A;  4MQ9 A;  4A3E C;  4A3F C;  2NVT C;  4Y7N C;  4X6A K;  4OIR A;  2WB1 L;  2A69 A;  5M3F K;  2VUM K;  3S2H C;  4A3C C;  4LLG A;  1TWG C;  5M3M K;  2A6H A;  3RZO K;  4BBS K;  4G7H A;  2R92 K;  4A3E K;  2NVT K;  4YFN A;  5M5W K;  2JA7 K;  2E2H C;  2NVX C;  2VUM C;  3GTM C;  4C3I K;  3EQL A;  3RZO C;  3HOX C;  2JA7 C;  4BBR C;  3HOU C;  4G7O A;  1SFO K;  3S1R K;  3PO2 C;  1I6H C;  2JA8 C;  4A3L K;  4YFX A;  1IW7 A;  2E2J C;  4C2M K;  1TWA C;  3K7A K;  3S1R C;  5FJ8 K;  4MEY A;  5IYC K;  3HOZ K;  2JA8 K;  3S16 C;  3S1Q C;  4A3L C;  4G7Z A;  4A93 K;  5C4X C;  3K7A C;  3M3Y C;  3HOV K;  2R93 C;  4A3I C;  4A3M C;  4QIW L;  3S16 K;  4OIO A;  4NOI A;  3S1Q K;  2NVY K;  4LK0 A;  5FLM C;  4A3K K;  4C3H K;  3HKZ L;  2YU9 C;  3S15 K;  4QJV A;  3S1N K;  3M4O C;  4XSX A;  4A3B C;  5C3E C;  3S2D K;  4XLN A;  1Y1W C;  3GTO K;  4QJV B;  3M4O K;  4YFK A;  2YU9 K;  3S15 C;  4A3B K;  4Y7N K;  3S1N C;  3S2D C;  4X6A C;  5TMC A;  2PMZ L;  3S2H K;  3GTO C;  2E2I C;  4KN7 A;  3FKI K;  4YG2 A;  2R92 C;  4Q5S A;  2PMZ D;  5TMF A;  3GTG K;  3GTP C;  2JA6 C;  3FKI C;  2PA8 L;  3GTG C;  5IYD C;  3GTP K;  4BBR K;  3HOU K;  3PO2 K;  2WAQ D;  2JA6 K;  2O5J A;  3GTQ K;  3RZD C;  4OIP A;  1TWA K;  2E2H K;  1I3Q C;  5C44 K;  1K83 C;  2NVX K;  5IP9 C;  2B63 C;  3S1M K;  4OIN A;  4LK1 A;  4ZH4 A;  3HOX K;  4BXX K;  1I6V A;  3H3V D;  1TWH K;  4XLP A;  3GTK C;  2A68 A;  1R9T C;  4BY7 C;  4AYB L;  1SMY A;  3I4N K;  4OIQ A;  2WB1 D;  5IP9 K;  1I50 K;  2B63 K;  3HOY K;  5IYB K;  4A3F K;  3S1M C;  4BXX C;  2PPB A;  4BY7 K;  1TWH C;  3GTK K;  4A3C K;  1R9T K;  4A3K C;  1TWG K;  1YNN A;  1HQM A;  5IYB C;  3HOZ C;  1YNJ A;  1I50 C;  3GTJ C;  3HOY C;  3PO3 C;  4A93 C;  4BBS C;  5C3E K;  2R7Z C;  1Y1V K;  5M5Y K;  3M3Y K;  4BY1 C;  3H0G K;  1TWC C;  3GTL K;  4QIW D;  2PA8 D;  3S14 C;  2NVY C;  1Y1V C;  5FLM K;  2A6E A;  2R7Z K;  4Y52 C;  2JA5 K;  5IP7 K;  1SFO C;  1TWC K;  3GTL C;  4A3D C;  4BY1 K;  3WOD A;  3H0G C;  2BE5 A;  4C3J K;  2E2J K;  3S14 K;  2WAQ L;  5IP7 C;  2JA5 C;  3GTM K;  4Y52 K;  5IYC C;  3S17 K;  4XSZ A;  1BDF A;  2CW0 A;  2O5I A;  1ZYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...