4BY7K

Elongating rna polymerase ii-bye1 tld complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by7K00
2A6HA 4BXXC 1I3QC 5C3EC 2JA6C 1SFOC 3GTKC 3GTKK 2PA8L 3S16C 4LJZA 3K7AK 3GTGK 3GTMC 3EQLA 2A69A 1HQMA 1ZYRA 4LK1A 1TWFC 2JA5C 5IP7C 3GTOK 4XLPA 3HOVK 1Y1WK 2R92K 3HOZC 2R93C 1IW7A 3GTPC 3I4MK 1TWAK 2PA8D 4A3EK 4A3EC 2JA5K 2VUMC 2E2IK 4YFKA 5M5XK 4Y7NK 5C44C 4A3JC 2B63K 4BBRK 4BBRC 2NVTK 4Q4ZA 3WODA 2E2HK 3RZOK 3S2HC 2O5JA 3H0GC 5IYBC 4LLGA 3H3VL 5M3FK 4OIOA 4A3CC 3K7AC 1TWFK 4C3IK 4C3HK 4XLNA 2B63C 4G7HA 4Y52K 2E2JK 3S2HK 5M5YK 4YG2A 3H0GK 1XPPA 4KN7A 4MQ9A 3S16K 2WAQD 5C3EK 4QJVB 2JA6K 2NVTC 1YNJA 4GZYA 4OIQA 2VUMK 4A3CK 4OINA 3S1MC 4Y7NC 3S2DC 3S1QK 3CQZC 5IYDK 3PO3C 2PMZL 4QIWD 2JA8C 5IP7K 2PPBA 3HOVC 1Y1WC 2R92C 3PO2C 3HOYK 5C4JK 2NVXK 3HOWC 2WAQL 4JK1A 4MEXA 4A3FC 2NVQK 4A93C 1WCMK 5TMFA 4LK0A 2YU9K 2Y0SD 1K83K 4A3MC 4BXXK 1I50C 1SFOK 4AYBD 2JA8K 1TWHK 3I4NC 1TWCK 3HOWK 3CQZK 5IYDC 5M3MK 3HOYC 2O5IA 4X6AK 3S1RC 2PMZD 3S1MK 3GTJC 3GTJK 3GTQC 3HOXC 4OIPA 4MEYA 4YFNA 3GTPK 4A3FK 3I4MC 3M4OK 3HOUC 4Q5SA 5C4JC 2NVXC 1K83C 4A3MK 1I3QK 5FLMK 2YU9C 4AYBL 3S14C 1TWHC 5FJ8K 3PO2K 3GTQK 3HKZL 4BBSK 2WB1L 5C4XK 2R7ZC 1Y1VK 3M4OC 4A93K 2NVYK 3GTLC 4X6AC 4A3JK 4XSXA 2NVQC 3RZDC 4BY7C 3RZOC 3M3YK 3M3YC 4C3JK 5C44K 5IP9C 4A3KK 3S1NK 3HKZD 4A3LK 2R93K 3I4NK 3S1QC 3FKIK 3FKIC 1TWGK 3S14K 4A3DC 4A3IK 5FLMC 3DXJA 1I6HK 4BBSC 2BE5A 1BDFA 4QIWL 3HOUK 5IYCC 5IYCK 4OIRA 2CW0A 2A6EA 4KMUA 5IP9K 4Y52C 5TMCA 4A3KC 2NVYC 3GTLK 3S15K 4QJVA 2E2HC 4A3GC 4A3GK 4A3DK 2Y0SL 4C2MK 3S17C 4A3LC 3S2DK 1TWCC 3H3VD 3GTGC 1Y1VC 1YNNA 4BY1K 2JA7K 3GTMK 2A68A 2R7ZK 5C4XC 5D4DA 1I6HC 4NOIA 3GTOC 3RZDK 4A3IC 2E2JC 1WCMC 3HOZK 3HOXK 1I50K 3S1NC 1R9TK 1R9TC 4G7OA 5M5WK 1TWGC 4BY1C 2JA7C 5IYBK 3PO3K 4YFXA 3S17K 2WB1D 4A3BC 4A3BK 2E2IC 1SMYA 4G7ZA 3S1RK 4XSZA 4KN4A 1TWAC 3S15C 4BY7K 1I6VA 4ZH4A
chains in the Genus database with same CATH superfamily
2GAGC 4GTFA 2A6HA 2CFAA 4RMFA 2PHCB 4GTCA 1EH1A 3GTMC 3EQLA 2A69A 4BKWA 1HQMA 5CJ9A 3BP3A 3FOFA 2EBBA 3HOVK 1Y1WK 4GTDA 3GTQA 5JVOA 3HOZC 3I4MK 4WILA 3HOWC 2NVXA 4M1XA 5M5XK 2B63K 2NVTK 1DCOA 2O5JA 4G0WA 3H3VL 1WOOA 4OIOA 4A3CC 1TWCA 1WIHA 3K7AC 1Y1VA 1WQHA 3G4CA 3T02A 4C3HK 4KM8A 4Y52K 4G7HA 2GAHC 1KQ4A 1O2AA 4YG2A 4GZYA 2WAQD 5C3EK 2JA6K 2VUMK 3L4JA 3Q3QA 5IP7K 2PPBA 2R92C 3N3YA 1IE0A 2WAQL 2D6FC 4A3FC 4LK0A 2YU9K 2Y0SD 3SZZA 1K83K 3AH5A 2P5MA 1I3QA 4A3MC 2JA6A 5EGHA 3I4NC 3LPXA 1J6VA 2PMZD 3GTJC 3GSIA 4YFNA 1O26A 1O2FB 4A3FK 1XXBA 4KASA 4WJ4A 1I3QK 1BS2A 3GTQK 5C4XK 3V4GA 3ADAC 3TTGA 2NVQC 4P5BA 1BGWA 4C3JK 3GEIA 3FKIK 1TWGK 4A3DC 4A3IK 1F7VA 3DXJA 1EFWA 4QIWL 3HOUK 2CW0A 2NVYC 4QJVA 3AQOA 4C2MK 1TWCC 3GTMK 1Y1VC 2JA7K 4P5AA 1ZXOA 4A3IC 4KDDA 2E2JC 3HOZK 1O28A 1PJ7A 1R9TK 1L0WA 4DDQA 4BY1C 4PABA 3AD7C 2XCOA 2R92A 3GEHA 4BY7K 1SMYA 4G7ZA 4KN4A 2JA5C 3GTLA 1XPPA 3A8KA 4BXXC 1I3QC 5C3EC 2JA6C 3GTKK 2PA8L 1ZYRA 3TFIA 3HXAA 3GTOK 2ZFZA 1TWAK 2PA8D 4A3EK 4A3EC 2E2IK 2W7VA 4Q4ZA 3WODA 2E2HK 3RZOK 1ISEA 3H0GC 5IOSA 4AH6A 4LLGA 5M3FK 4BLAA 4P9SA 4C45A 1WORA 1JOEA 3S2HK 5M5YK 1USOA 4MQ9A 3NUHA 1YNJA 3LAPA 3S2DC 4KM9A 1V5VA 3BUEA 2PMZL 1XXAA 2NVXK 4MEXA 2NVQK 5E68A 2NVYA 5TMFA 1I50C 1SFOK 2RGRA 2JA8K 1O29A 1TWCK 3HOYC 5M3MK 2R93A 3I4MC 3M4OK 3HOUC 2VUMA 3OREA 1F9NA 4AYBL 3HKZL 4BBSK 1Y1VK 2JA5A 1B4AA 3GTLC 2RH6A 4G0UA 3RZOC 5C44K 4KARA 5FLMC 4LR2A 1PJ6A 1INNA 1VGXA 4GFQA 2BE5A 1BDFA 3GEEA 1J98A 1GE9A 4C3HC 4Y52C 5JFEA 3GTLK 1AB4A 2E2HC 3TFJA 1O27A 1VLOA 4A3GK 3H0GA 3IPJA 4BLBA 3H3VD 1VH2A 3GTGC 5IOQA 3A8IA 5L46A 5C4XC 1I6HC 3GTOC 3RZDK 3HOXK 1DD5A 4KAWX 1EQRA 4G7OA 5M5WK 3QX3A 1K83A 1XZQB 2V6SA 5IOTA 4G0VA 3PO3K 4YFXA 1TWHA 1XXCA 3T00A 3S1RK 1DCPA 3S15C 3SZYA 1I50A 1SFOC 3K7AK 4KMAA 1XZPA 1IL2A 1WSVA 4PAAA 4KATA 2R93C 1IW7A 3GTPC 3OPFA 4XCHA 3HOWK 2VUMC 3TFHA 4YFKA 4Y7NK 5C44C 4A3JC 3S2HC 3VA7A 3CAGA 1YCLA 1ZVUA 2E2JK 1WCMA 3S16K 3H0GK 2ZUEA 4KN7A 2R93K 2NVTC 4FM9A 1WOSA 4OINA 5EGEA 4Y7NC 4WJ3M 4GT9A 3CQZC 5IYDK 4KMHA 4QIWD 2JA8C 3PO2C 3HOYK 5C4JK 2E2IA 4JK1A 1WCMK 2E2HA 4KB4A 4BXXK 4AYBD 3GTKA 2V6UA 1TWHK 3GTGA 3CQZK 5IYDC 2O5IA 3S1RC 2ZUFA 3GTOA 3GTJK 3HOXC 4MEYA 4GTLA 5C4JC 4Q5SA 3LAJA 1K83C 4A3MK 2YU9C 3GDZA 3N0CA 3S14C 1TWHC 5HL8A 1WQGA 3AD9C 1IBAA 4J3NA 3M4OC 4A93K 2NVYK 4A3JK 2B63A 3RZDC 1SFOA 3M3YK 3M3YC 5IP9C 4A3KK 2P8TA 1JQWA 2GSUA 3S1QC 3FKIC 3GIRA 3S14K 1I6VA 1ZBSA 1B4BA 3G4AA 3GTPA 5TJ3A 3JSTA 4C3IC 2A6EA 3S15K 5CHPA 1X31C 2Y0SL 3S2DK 1RU0A 1YNNA 2R7ZK 1BJTA 5D4DA 2KWAA 4NOIA 1WCMC 1YX2A 4LOWA 3S1NC 1R9TC 1PJ5A 3CQZA 4C2MC 3A8JA 1C0AA 2WB1D 4A3BC 4A3BK 2R7ZA 2E2IC 1TWAC 4ZH4A 2GSNA 3GTKC 3S16C 4LJZA 3GTGK 4LK1A 1TWFC 5IP7C 4XLPA 2R92K 4KC6A 4ILDA 2JA5K 3FOEA 3S1MK 4BY7C 4C3JC 4BBRK 4BBRC 1VRQC 1IQ0A 4GTBA 2YU9A 3AD8C 5IYBC 1WQFA 1TWFK 4C3IK 4XLNA 2B63C 1J6XA 4QJVB 2JH3A 4OIQA 4A3CK 3S1MC 2CFAB 3S1QK 3FKIA 1J6WA 1TWGA 2JA7A 4KMDA 3PO3C 3HOVC 1Y1WC 1VJEA 3L4KA 2XCQA 4KB2A 1XZQA 4A93C 1ZQ1C 3GTMA 1O24A 4O2DA 4X6AK 1WOPA 1UV7A 3GTQC 3FHZA 4OIPA 3GTPK 1F93A 1R9TA 2NVXC 2FQOA 1HI9A 1DCHA 5FLMK 4GTAA 5FJ8K 3PO2K 2WB1L 4GTEA 2R7ZC 1TWAA 4X6AC 4XSXA 3S0XA 3BP8C 1EK8A 3S1NK 3HKZD 4A3LK 3I4NK 1TWFA 3MMLB 1JVIA 1I6HK 4BBSC 3ERED 5IYCC 5IYCK 4OIRA 4KMUA 5IP9K 5TMCA 4A3KC 4A3GC 4A3DK 1IS1A 3N0BA 3S17C 4A3LC 1O2BA 4BY1K 2A68A 2FQTA 2V6TA 1EI6A 3GTJA 1I50K 1USMA 1WSRA 2XCRB 1TWGC 2JA7C 5IYBK 1G51A 5IORA 3OEPA 1F7UA 3S17K 4LQYA 1Y1WA 2Y3PA 4FZBA 1XZPB 3AQPA 3T01A 1O25A 4XSZA 2GSOA
chains in the Genus database with same CATH topology
2A6HA 4BXXC 1I3QC 5C3EC 2JA6C 1SFOC 3GTKC 3GTKK 2PA8L 3S16C 4LJZA 3K7AK 3GTGK 3GTMC 3EQLA 2A69A 1HQMA 1ZYRA 4LK1A 1TWFC 2JA5C 5IP7C 3GTOK 4XLPA 3HOVK 1Y1WK 2R92K 3HOZC 2R93C 1IW7A 3GTPC 3I4MK 1TWAK 2PA8D 4A3EK 4A3EC 2JA5K 2VUMC 2E2IK 4YFKA 5M5XK 4Y7NK 5C44C 4A3JC 2B63K 4BBRK 4BBRC 2NVTK 4Q4ZA 3WODA 2E2HK 3RZOK 3S2HC 2O5JA 3H0GC 5IYBC 4LLGA 3H3VL 5M3FK 4OIOA 4A3CC 3K7AC 1TWFK 4C3IK 4C3HK 4XLNA 2B63C 4G7HA 4Y52K 2E2JK 3S2HK 5M5YK 4YG2A 3H0GK 1XPPA 4KN7A 4MQ9A 3S16K 2WAQD 5C3EK 4QJVB 2JA6K 2NVTC 1YNJA 4GZYA 4OIQA 2VUMK 4A3CK 4OINA 3S1MC 4Y7NC 3S2DC 3S1QK 3CQZC 5IYDK 3PO3C 2PMZL 4QIWD 2JA8C 5IP7K 2PPBA 3HOVC 1Y1WC 2R92C 3PO2C 3HOYK 5C4JK 2NVXK 3HOWC 2WAQL 4JK1A 4MEXA 4A3FC 2NVQK 4A93C 1WCMK 5TMFA 4LK0A 2YU9K 2Y0SD 1K83K 4A3MC 4BXXK 1I50C 1SFOK 4AYBD 2JA8K 1TWHK 3I4NC 1TWCK 3HOWK 3CQZK 5IYDC 5M3MK 3HOYC 2O5IA 4X6AK 3S1RC 2PMZD 3S1MK 3GTJC 3GTJK 3GTQC 3HOXC 4OIPA 4MEYA 4YFNA 3GTPK 4A3FK 3I4MC 3M4OK 3HOUC 4Q5SA 5C4JC 2NVXC 1K83C 4A3MK 1I3QK 5FLMK 2YU9C 4AYBL 3S14C 1TWHC 5FJ8K 3PO2K 3GTQK 3HKZL 4BBSK 2WB1L 5C4XK 2R7ZC 1Y1VK 3M4OC 4A93K 2NVYK 3GTLC 4X6AC 4A3JK 4XSXA 2NVQC 3RZDC 4BY7C 3RZOC 3M3YK 3M3YC 4C3JK 5C44K 5IP9C 4A3KK 3S1NK 3HKZD 4A3LK 2R93K 3I4NK 3S1QC 3FKIK 3FKIC 1TWGK 3S14K 4A3DC 4A3IK 5FLMC 3DXJA 1I6HK 4BBSC 2BE5A 1BDFA 4QIWL 3HOUK 5IYCC 5IYCK 4OIRA 2CW0A 2A6EA 4KMUA 5IP9K 4Y52C 5TMCA 4A3KC 2NVYC 3GTLK 3S15K 4QJVA 2E2HC 4A3GC 4A3GK 4A3DK 2Y0SL 4C2MK 3S17C 4A3LC 3S2DK 1TWCC 3H3VD 3GTGC 1Y1VC 1YNNA 4BY1K 2JA7K 3GTMK 2A68A 2R7ZK 5C4XC 5D4DA 1I6HC 4NOIA 3GTOC 3RZDK 4A3IC 2E2JC 1WCMC 3HOZK 3HOXK 1I50K 3S1NC 1R9TK 1R9TC 4G7OA 5M5WK 1TWGC 4BY1C 2JA7C 5IYBK 3PO3K 4YFXA 3S17K 2WB1D 4A3BC 4A3BK 2E2IC 1SMYA 4G7ZA 3S1RK 4XSZA 4KN4A 1TWAC 3S15C 4BY7K 1I6VA 4ZH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H A;  4BXX C;  1I3Q C;  5C3E C;  2JA6 C;  1SFO C;  3GTK C;  3GTK K;  2PA8 L;  3S16 C;  4LJZ A;  3K7A K;  3GTG K;  3GTM C;  3EQL A;  2A69 A;  1HQM A;  1ZYR A;  4LK1 A;  1TWF C;  2JA5 C;  5IP7 C;  3GTO K;  4XLP A;  3HOV K;  1Y1W K;  2R92 K;  3HOZ C;  2R93 C;  1IW7 A;  3GTP C;  3I4M K;  1TWA K;  2PA8 D;  4A3E K;  4A3E C;  2JA5 K;  2VUM C;  2E2I K;  4YFK A;  5M5X K;  4Y7N K;  5C44 C;  4A3J C;  2B63 K;  4BBR K;  4BBR C;  2NVT K;  4Q4Z A;  3WOD A;  2E2H K;  3RZO K;  3S2H C;  2O5J A;  3H0G C;  5IYB C;  4LLG A;  3H3V L;  5M3F K;  4OIO A;  4A3C C;  3K7A C;  1TWF K;  4C3I K;  4C3H K;  4XLN A;  2B63 C;  4G7H A;  4Y52 K;  2E2J K;  3S2H K;  5M5Y K;  4YG2 A;  3H0G K;  1XPP A;  4KN7 A;  4MQ9 A;  3S16 K;  2WAQ D;  5C3E K;  4QJV B;  2JA6 K;  2NVT C;  1YNJ A;  4GZY A;  4OIQ A;  2VUM K;  4A3C K;  4OIN A;  3S1M C;  4Y7N C;  3S2D C;  3S1Q K;  3CQZ C;  5IYD K;  3PO3 C;  2PMZ L;  4QIW D;  2JA8 C;  5IP7 K;  2PPB A;  3HOV C;  1Y1W C;  2R92 C;  3PO2 C;  3HOY K;  5C4J K;  2NVX K;  3HOW C;  2WAQ L;  4JK1 A;  4MEX A;  4A3F C;  2NVQ K;  4A93 C;  1WCM K;  5TMF A;  4LK0 A;  2YU9 K;  2Y0S D;  1K83 K;  4A3M C;  4BXX K;  1I50 C;  1SFO K;  4AYB D;  2JA8 K;  1TWH K;  3I4N C;  1TWC K;  3HOW K;  3CQZ K;  5IYD C;  5M3M K;  3HOY C;  2O5I A;  4X6A K;  3S1R C;  2PMZ D;  3S1M K;  3GTJ C;  3GTJ K;  3GTQ C;  3HOX C;  4OIP A;  4MEY A;  4YFN A;  3GTP K;  4A3F K;  3I4M C;  3M4O K;  3HOU C;  4Q5S A;  5C4J C;  2NVX C;  1K83 C;  4A3M K;  1I3Q K;  5FLM K;  2YU9 C;  4AYB L;  3S14 C;  1TWH C;  5FJ8 K;  3PO2 K;  3GTQ K;  3HKZ L;  4BBS K;  2WB1 L;  5C4X K;  2R7Z C;  1Y1V K;  3M4O C;  4A93 K;  2NVY K;  3GTL C;  4X6A C;  4A3J K;  4XSX A;  2NVQ C;  3RZD C;  4BY7 C;  3RZO C;  3M3Y K;  3M3Y C;  4C3J K;  5C44 K;  5IP9 C;  4A3K K;  3S1N K;  3HKZ D;  4A3L K;  2R93 K;  3I4N K;  3S1Q C;  3FKI K;  3FKI C;  1TWG K;  3S14 K;  4A3D C;  4A3I K;  5FLM C;  3DXJ A;  1I6H K;  4BBS C;  2BE5 A;  1BDF A;  4QIW L;  3HOU K;  5IYC C;  5IYC K;  4OIR A;  2CW0 A;  2A6E A;  4KMU A;  5IP9 K;  4Y52 C;  5TMC A;  4A3K C;  2NVY C;  3GTL K;  3S15 K;  4QJV A;  2E2H C;  4A3G C;  4A3G K;  4A3D K;  2Y0S L;  4C2M K;  3S17 C;  4A3L C;  3S2D K;  1TWC C;  3H3V D;  3GTG C;  1Y1V C;  1YNN A;  4BY1 K;  2JA7 K;  3GTM K;  2A68 A;  2R7Z K;  5C4X C;  5D4D A;  1I6H C;  4NOI A;  3GTO C;  3RZD K;  4A3I C;  2E2J C;  1WCM C;  3HOZ K;  3HOX K;  1I50 K;  3S1N C;  1R9T K;  1R9T C;  4G7O A;  5M5W K;  1TWG C;  4BY1 C;  2JA7 C;  5IYB K;  3PO3 K;  4YFX A;  3S17 K;  2WB1 D;  4A3B C;  4A3B K;  2E2I C;  1SMY A;  4G7Z A;  3S1R K;  4XSZ A;  4KN4 A;  1TWA C;  3S15 C;  4BY7 K;  1I6V A;  4ZH4 A; 
#chains in the Genus database with same CATH topology
 2GAG C;  4GTF A;  2A6H A;  2CFA A;  4RMF A;  2PHC B;  4GTC A;  1EH1 A;  3GTM C;  3EQL A;  2A69 A;  4BKW A;  1HQM A;  5CJ9 A;  3BP3 A;  3FOF A;  2EBB A;  3HOV K;  1Y1W K;  4GTD A;  3GTQ A;  5JVO A;  3HOZ C;  3I4M K;  4WIL A;  3HOW C;  2NVX A;  4M1X A;  5M5X K;  2B63 K;  2NVT K;  1DCO A;  2O5J A;  4G0W A;  3H3V L;  1WOO A;  4OIO A;  4A3C C;  1TWC A;  1WIH A;  3K7A C;  1Y1V A;  1WQH A;  3G4C A;  3T02 A;  4C3H K;  4KM8 A;  4Y52 K;  4G7H A;  2GAH C;  1KQ4 A;  1O2A A;  4YG2 A;  4GZY A;  2WAQ D;  5C3E K;  2JA6 K;  2VUM K;  3L4J A;  3Q3Q A;  5IP7 K;  2PPB A;  2R92 C;  3N3Y A;  1IE0 A;  2WAQ L;  2D6F C;  4A3F C;  4LK0 A;  2YU9 K;  2Y0S D;  3SZZ A;  1K83 K;  3AH5 A;  2P5M A;  1I3Q A;  4A3M C;  2JA6 A;  5EGH A;  3I4N C;  3LPX A;  1J6V A;  2PMZ D;  3GTJ C;  3GSI A;  4YFN A;  1O26 A;  1O2F B;  4A3F K;  1XXB A;  4KAS A;  4WJ4 A;  1I3Q K;  1BS2 A;  3GTQ K;  5C4X K;  3V4G A;  3ADA C;  3TTG A;  2NVQ C;  4P5B A;  1BGW A;  4C3J K;  3GEI A;  3FKI K;  1TWG K;  4A3D C;  4A3I K;  1F7V A;  3DXJ A;  1EFW A;  4QIW L;  3HOU K;  2CW0 A;  2NVY C;  4QJV A;  3AQO A;  4C2M K;  1TWC C;  3GTM K;  1Y1V C;  2JA7 K;  4P5A A;  1ZXO A;  4A3I C;  4KDD A;  2E2J C;  3HOZ K;  1O28 A;  1PJ7 A;  1R9T K;  1L0W A;  4DDQ A;  4BY1 C;  4PAB A;  3AD7 C;  2XCO A;  2R92 A;  3GEH A;  4BY7 K;  1SMY A;  4G7Z A;  4KN4 A;  2JA5 C;  3GTL A;  1XPP A;  3A8K A;  4BXX C;  1I3Q C;  5C3E C;  2JA6 C;  3GTK K;  2PA8 L;  1ZYR A;  3TFI A;  3HXA A;  3GTO K;  2ZFZ A;  1TWA K;  2PA8 D;  4A3E K;  4A3E C;  2E2I K;  2W7V A;  4Q4Z A;  3WOD A;  2E2H K;  3RZO K;  1ISE A;  3H0G C;  5IOS A;  4AH6 A;  4LLG A;  5M3F K;  4BLA A;  4P9S A;  4C45 A;  1WOR A;  1JOE A;  3S2H K;  5M5Y K;  1USO A;  4MQ9 A;  3NUH A;  1YNJ A;  3LAP A;  3S2D C;  4KM9 A;  1V5V A;  3BUE A;  2PMZ L;  1XXA A;  2NVX K;  4MEX A;  2NVQ K;  5E68 A;  2NVY A;  5TMF A;  1I50 C;  1SFO K;  2RGR A;  2JA8 K;  1O29 A;  1TWC K;  3HOY C;  5M3M K;  2R93 A;  3I4M C;  3M4O K;  3HOU C;  2VUM A;  3ORE A;  1F9N A;  4AYB L;  3HKZ L;  4BBS K;  1Y1V K;  2JA5 A;  1B4A A;  3GTL C;  2RH6 A;  4G0U A;  3RZO C;  5C44 K;  4KAR A;  5FLM C;  4LR2 A;  1PJ6 A;  1INN A;  1VGX A;  4GFQ A;  2BE5 A;  1BDF A;  3GEE A;  1J98 A;  1GE9 A;  4C3H C;  4Y52 C;  5JFE A;  3GTL K;  1AB4 A;  2E2H C;  3TFJ A;  1O27 A;  1VLO A;  4A3G K;  3H0G A;  3IPJ A;  4BLB A;  3H3V D;  1VH2 A;  3GTG C;  5IOQ A;  3A8I A;  5L46 A;  5C4X C;  1I6H C;  3GTO C;  3RZD K;  3HOX K;  1DD5 A;  4KAW X;  1EQR A;  4G7O A;  5M5W K;  3QX3 A;  1K83 A;  1XZQ B;  2V6S A;  5IOT A;  4G0V A;  3PO3 K;  4YFX A;  1TWH A;  1XXC A;  3T00 A;  3S1R K;  1DCP A;  3S15 C;  3SZY A;  1I50 A;  1SFO C;  3K7A K;  4KMA A;  1XZP A;  1IL2 A;  1WSV A;  4PAA A;  4KAT A;  2R93 C;  1IW7 A;  3GTP C;  3OPF A;  4XCH A;  3HOW K;  2VUM C;  3TFH A;  4YFK A;  4Y7N K;  5C44 C;  4A3J C;  3S2H C;  3VA7 A;  3CAG A;  1YCL A;  1ZVU A;  2E2J K;  1WCM A;  3S16 K;  3H0G K;  2ZUE A;  4KN7 A;  2R93 K;  2NVT C;  4FM9 A;  1WOS A;  4OIN A;  5EGE A;  4Y7N C;  4WJ3 M;  4GT9 A;  3CQZ C;  5IYD K;  4KMH A;  4QIW D;  2JA8 C;  3PO2 C;  3HOY K;  5C4J K;  2E2I A;  4JK1 A;  1WCM K;  2E2H A;  4KB4 A;  4BXX K;  4AYB D;  3GTK A;  2V6U A;  1TWH K;  3GTG A;  3CQZ K;  5IYD C;  2O5I A;  3S1R C;  2ZUF A;  3GTO A;  3GTJ K;  3HOX C;  4MEY A;  4GTL A;  5C4J C;  4Q5S A;  3LAJ A;  1K83 C;  4A3M K;  2YU9 C;  3GDZ A;  3N0C A;  3S14 C;  1TWH C;  5HL8 A;  1WQG A;  3AD9 C;  1IBA A;  4J3N A;  3M4O C;  4A93 K;  2NVY K;  4A3J K;  2B63 A;  3RZD C;  1SFO A;  3M3Y K;  3M3Y C;  5IP9 C;  4A3K K;  2P8T A;  1JQW A;  2GSU A;  3S1Q C;  3FKI C;  3GIR A;  3S14 K;  1I6V A;  1ZBS A;  1B4B A;  3G4A A;  3GTP A;  5TJ3 A;  3JST A;  4C3I C;  2A6E A;  3S15 K;  5CHP A;  1X31 C;  2Y0S L;  3S2D K;  1RU0 A;  1YNN A;  2R7Z K;  1BJT A;  5D4D A;  2KWA A;  4NOI A;  1WCM C;  1YX2 A;  4LOW A;  3S1N C;  1R9T C;  1PJ5 A;  3CQZ A;  4C2M C;  3A8J A;  1C0A A;  2WB1 D;  4A3B C;  4A3B K;  2R7Z A;  2E2I C;  1TWA C;  4ZH4 A;  2GSN A;  3GTK C;  3S16 C;  4LJZ A;  3GTG K;  4LK1 A;  1TWF C;  5IP7 C;  4XLP A;  2R92 K;  4KC6 A;  4ILD A;  2JA5 K;  3FOE A;  3S1M K;  4BY7 C;  4C3J C;  4BBR K;  4BBR C;  1VRQ C;  1IQ0 A;  4GTB A;  2YU9 A;  3AD8 C;  5IYB C;  1WQF A;  1TWF K;  4C3I K;  4XLN A;  2B63 C;  1J6X A;  4QJV B;  2JH3 A;  4OIQ A;  4A3C K;  3S1M C;  2CFA B;  3S1Q K;  3FKI A;  1J6W A;  1TWG A;  2JA7 A;  4KMD A;  3PO3 C;  3HOV C;  1Y1W C;  1VJE A;  3L4K A;  2XCQ A;  4KB2 A;  1XZQ A;  4A93 C;  1ZQ1 C;  3GTM A;  1O24 A;  4O2D A;  4X6A K;  1WOP A;  1UV7 A;  3GTQ C;  3FHZ A;  4OIP A;  3GTP K;  1F93 A;  1R9T A;  2NVX C;  2FQO A;  1HI9 A;  1DCH A;  5FLM K;  4GTA A;  5FJ8 K;  3PO2 K;  2WB1 L;  4GTE A;  2R7Z C;  1TWA A;  4X6A C;  4XSX A;  3S0X A;  3BP8 C;  1EK8 A;  3S1N K;  3HKZ D;  4A3L K;  3I4N K;  1TWF A;  3MML B;  1JVI A;  1I6H K;  4BBS C;  3ERE D;  5IYC C;  5IYC K;  4OIR A;  4KMU A;  5IP9 K;  5TMC A;  4A3K C;  4A3G C;  4A3D K;  1IS1 A;  3N0B A;  3S17 C;  4A3L C;  1O2B A;  4BY1 K;  2A68 A;  2FQT A;  2V6T A;  1EI6 A;  3GTJ A;  1I50 K;  1USM A;  1WSR A;  2XCR B;  1TWG C;  2JA7 C;  5IYB K;  1G51 A;  5IOR A;  3OEP A;  1F7U A;  3S17 K;  4LQY A;  1Y1W A;  2Y3P A;  4FZB A;  1XZP B;  3AQP A;  3T01 A;  1O25 A;  4XSZ A;  2GSO A; 
#chains in the Genus database with same CATH homology
 2A6H A;  4BXX C;  1I3Q C;  5C3E C;  2JA6 C;  1SFO C;  3GTK C;  3GTK K;  2PA8 L;  3S16 C;  4LJZ A;  3K7A K;  3GTG K;  3GTM C;  3EQL A;  2A69 A;  1HQM A;  1ZYR A;  4LK1 A;  1TWF C;  2JA5 C;  5IP7 C;  3GTO K;  4XLP A;  3HOV K;  1Y1W K;  2R92 K;  3HOZ C;  2R93 C;  1IW7 A;  3GTP C;  3I4M K;  1TWA K;  2PA8 D;  4A3E K;  4A3E C;  2JA5 K;  2VUM C;  2E2I K;  4YFK A;  5M5X K;  4Y7N K;  5C44 C;  4A3J C;  2B63 K;  4BBR K;  4BBR C;  2NVT K;  4Q4Z A;  3WOD A;  2E2H K;  3RZO K;  3S2H C;  2O5J A;  3H0G C;  5IYB C;  4LLG A;  3H3V L;  5M3F K;  4OIO A;  4A3C C;  3K7A C;  1TWF K;  4C3I K;  4C3H K;  4XLN A;  2B63 C;  4G7H A;  4Y52 K;  2E2J K;  3S2H K;  5M5Y K;  4YG2 A;  3H0G K;  1XPP A;  4KN7 A;  4MQ9 A;  3S16 K;  2WAQ D;  5C3E K;  4QJV B;  2JA6 K;  2NVT C;  1YNJ A;  4GZY A;  4OIQ A;  2VUM K;  4A3C K;  4OIN A;  3S1M C;  4Y7N C;  3S2D C;  3S1Q K;  3CQZ C;  5IYD K;  3PO3 C;  2PMZ L;  4QIW D;  2JA8 C;  5IP7 K;  2PPB A;  3HOV C;  1Y1W C;  2R92 C;  3PO2 C;  3HOY K;  5C4J K;  2NVX K;  3HOW C;  2WAQ L;  4JK1 A;  4MEX A;  4A3F C;  2NVQ K;  4A93 C;  1WCM K;  5TMF A;  4LK0 A;  2YU9 K;  2Y0S D;  1K83 K;  4A3M C;  4BXX K;  1I50 C;  1SFO K;  4AYB D;  2JA8 K;  1TWH K;  3I4N C;  1TWC K;  3HOW K;  3CQZ K;  5IYD C;  5M3M K;  3HOY C;  2O5I A;  4X6A K;  3S1R C;  2PMZ D;  3S1M K;  3GTJ C;  3GTJ K;  3GTQ C;  3HOX C;  4OIP A;  4MEY A;  4YFN A;  3GTP K;  4A3F K;  3I4M C;  3M4O K;  3HOU C;  4Q5S A;  5C4J C;  2NVX C;  1K83 C;  4A3M K;  1I3Q K;  5FLM K;  2YU9 C;  4AYB L;  3S14 C;  1TWH C;  5FJ8 K;  3PO2 K;  3GTQ K;  3HKZ L;  4BBS K;  2WB1 L;  5C4X K;  2R7Z C;  1Y1V K;  3M4O C;  4A93 K;  2NVY K;  3GTL C;  4X6A C;  4A3J K;  4XSX A;  2NVQ C;  3RZD C;  4BY7 C;  3RZO C;  3M3Y K;  3M3Y C;  4C3J K;  5C44 K;  5IP9 C;  4A3K K;  3S1N K;  3HKZ D;  4A3L K;  2R93 K;  3I4N K;  3S1Q C;  3FKI K;  3FKI C;  1TWG K;  3S14 K;  4A3D C;  4A3I K;  5FLM C;  3DXJ A;  1I6H K;  4BBS C;  2BE5 A;  1BDF A;  4QIW L;  3HOU K;  5IYC C;  5IYC K;  4OIR A;  2CW0 A;  2A6E A;  4KMU A;  5IP9 K;  4Y52 C;  5TMC A;  4A3K C;  2NVY C;  3GTL K;  3S15 K;  4QJV A;  2E2H C;  4A3G C;  4A3G K;  4A3D K;  2Y0S L;  4C2M K;  3S17 C;  4A3L C;  3S2D K;  1TWC C;  3H3V D;  3GTG C;  1Y1V C;  1YNN A;  4BY1 K;  2JA7 K;  3GTM K;  2A68 A;  2R7Z K;  5C4X C;  5D4D A;  1I6H C;  4NOI A;  3GTO C;  3RZD K;  4A3I C;  2E2J C;  1WCM C;  3HOZ K;  3HOX K;  1I50 K;  3S1N C;  1R9T K;  1R9T C;  4G7O A;  5M5W K;  1TWG C;  4BY1 C;  2JA7 C;  5IYB K;  3PO3 K;  4YFX A;  3S17 K;  2WB1 D;  4A3B C;  4A3B K;  2E2I C;  1SMY A;  4G7Z A;  3S1R K;  4XSZ A;  4KN4 A;  1TWA C;  3S15 C;  4BY7 K;  1I6V A;  4ZH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...