4BY7K

Elongating rna polymerase ii-bye1 tld complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4by7K00
3I4NK 2E2JC 4MEYA 3S1QC 3H0GK 1TWHK 4QJVA 5IYCK 5M3MK 4OIRA 4BBRC 3PO2C 3S14K 5C4XK 3GTPC 3S1NK 1WCMC 1I6HC 4XSXA 4A93C 4MQ9A 5C44K 3H3VL 2A6HA 5FJ8K 3EQLA 4A3LC 4BY7K 4A3IC 3H3VD 5M5XK 2R92K 4BY7C 4KN4A 4Y7NK 3K7AC 1TWCK 2YU9C 3WODA 2JA6K 1I50C 3RZOK 1TWCC 4AYBL 1K83K 3S15C 4Q4ZA 3I4MC 5IP9C 2R93K 3S16C 4YG2A 1TWAC 5C4JK 2R7ZC 4JK1A 4G7HA 3M4OK 4X6AC 3HOVC 5IYDK 4QJVB 4MEXA 1R9TC 4GZYA 4LJZA 4BBSC 4QIWL 4A3GC 1I3QC 3M3YK 4OINA 4OIQA 2PMZD 3HKZD 1YNJA 3S1RC 2YU9K 3S2HK 2E2JK 3S1MC 3S1QK 3S2DK 3PO2K 4BBRK 3GTPK 1WCMK 3S2DC 5C3EC 4OIPA 3GTQC 1BDFA 4A3CC 4A93K 4A3LK 4A3IK 4A3MC 1IW7A 2O5IA 3K7AK 4LK1A 1I50K 2E2IK 1ZYRA 3S15K 1Y1VC 3HOXC 2E2IC 3I4MK 4Q5SA 5IP9K 3S16K 4AYBD 1TWAK 5FLMC 2NVQC 3GTKC 2WB1L 2R7ZK 4X6AK 3HOVK 1R9TK 4YFKA 5TMFA 3FKIC 1Y1WK 4A3GK 2A6EA 4BBSK 1I3QK 2NVYC 1Y1WC 1I6VA 3S1RK 5TMCA 4QIWD 2PPBA 3S1MK 2WAQL 3HOZC 4LLGA 3PO3C 4BY1C 4C3JK 5C3EK 4A3CK 2A68A 3GTQK 3GTGK 1I6HK 3GTGC 4A3MK 5M3FK 3S17C 4Y52C 4XLNA 3HOYC 4NOIA 1XPPA 5IP7C 4ZH4A 3GTLC 4BXXC 2NVTC 1Y1VK 3HOXK 4C3IK 1SFOC 2VUMK 3HOUK 3GTJC 2O5JA 4A3JC 2VUMC 3HOUC 2B63C 2Y0SL 5FLMK 2NVQK 2NVXC 3GTKK 5M5WK 4A3EC 1TWFC 2A69A 2WB1D 4G7ZA 4KMUA 1YNNA 2E2HC 3S2HC 4A3DC 3CQZC 2PA8L 3FKIK 1TWGC 5IYBC 3RZDC 2JA8C 2NVYK 2JA5C 1SMYA 4G7OA 4A3BC 4A3FC 4C3HK 2JA7C 3DXJA 4A3KC 3HOZK 3I4NC 3H0GC 3PO3K 1TWHC 2CW0A 5IYCC 4BY1K 3HOWK 3S14C 2WAQD 3S1NC 5C4XC 4KN7A 5M5YK 3HOWC 3GTOK 5C44C 4LK0A 3S17K 3GTOC 2R92C 4Y52K 3HOYK 5D4DA 4Y7NC 5IP7K 3GTLK 2JA6C 3RZOC 4BXXK 2NVTK 1SFOK 1K83C 1HQMA 3GTJK 4A3JK 4YFXA 2B63K 2R93C 2NVXK 4C2MK 5C4JC 4A3EK 3GTMK 3M4OC 1TWFK 2Y0SD 4YFNA 4XSZA 5IYDC 3GTMC 2E2HK 4A3DK 2BE5A 3CQZK 5IYBK 1TWGK 3RZDK 2PMZL 3HKZL 2JA5K 2JA8K 4OIOA 3M3YC 2PA8D 4A3BK 4A3FK 2JA7K 4XLPA 4A3KK
chains in the Genus database with same CATH superfamily
4MEYA 3H0GK 3GTQA 3S1NK 3S14K 4G0WA 3H3VL 4BY7K 3EQLA 1DCHA 4BY7C 1J6VA 2JA6K 1I50C 3S15C 4Q4ZA 3I4MC 3BUEA 3S16C 3MMLB 3A8IA 3HOVC 4MEXA 3AH5A 3SZZA 2GSOA 3S1RC 1HI9A 3S1QK 4LOWA 3GTPK 1F7VA 3GTQC 1WOSA 3LAPA 4A3LK 1IW7A 3GTLA 2O5IA 3K7AK 2E2IK 2GSNA 2E2IC 4KB4A 3GTMA 5IOSA 1TWAK 2R7ZK 2RH6A 2E2HA 4X6AK 3CQZA 4YFKA 4BBSK 3A8JA 3L4JA 1JVIA 3AD9C 3ADAC 2PPBA 3S1MK 2WAQL 3GEIA 4XCHA 3PO3C 1XXCA 4C3JK 1O25A 4A3CK 1GE9A 2GAGC 3AQPA 1O2BA 4FM9A 3GTLC 3A8KA 1Y1VK 1IE0A 4C3IK 3QX3A 2VUMK 1O26A 2VUMC 4DDQA 2Y0SL 5FLMK 3G4AA 2A69A 2JH3A 4G7ZA 2E2HC 3CQZC 3FKIK 2YU9A 2CFAA 2JA8C 2NVYK 1SMYA 5HL8A 1BS2A 1WCMA 1DCOA 2CW0A 5IYCC 2WAQD 1ZVUA 5C44C 3HOYK 5D4DA 5IP7K 3NUHA 3RZOC 2NVTK 1SFOK 1PJ6A 2CFAB 4A3JK 4YFXA 1VGXA 3G4CA 1R9TA 3M4OC 1TWFK 2Y0SD 1O28A 5IYDC 1I3QA 2P5MA 4A3DK 3N3YA 1TWGK 1BJTA 3M3YC 1JOEA 4A3BK 2YU9C 3I4NK 2E2JC 1TWHK 4QJVA 3T01A 4OIRA 3PO2C 4BBRC 3GTGA 3GDZA 2EBBA 3FOEA 1WCMC 5CJ9A 4MQ9A 4KASA 4KM8A 2R92K 3TFJA 4Y7NK 3LPXA 4GTEA 2R93K 4YG2A 5C4JK 4QJVB 1R9TC 4LJZA 1I3QC 3CAGA 4OIQA 4FZBA 3S2HK 1VLOA 4WILA 1YX2A 4KMDA 4LK1A 1I50K 1VRQC 2B63A 1ZYRA 3S15K 3HOXC 3I4MK 2NVXA 3GIRA 1DD5A 3S16K 4GTLA 1BGWA 1XZQA 2WB1L 1G51A 3HOVK 1EK8A 2JA5A 5TMFA 2JA7A 4P9SA 2V6UA 3S1RK 4C3HC 4P5BA 3LAJA 3T00A 4LLGA 4BKWA 3GTQK 2FQTA 3OREA 1INNA 2XCOA 1ZQ1C 1TWCA 1XZQB 3S17C 1IL2A 1K83A 1KQ4A 3BP3A 2Y3PA 4KMAA 4GTFA 5E68A 3AD8C 2B63C 2NVXC 4A3EC 2WB1D 4KMUA 5IORA 2JA5C 1EI6A 2JA7C 2KWAA 3DXJA 4A3KC 3PO3K 4PAAA 1ISEA 4KN7A 5C4XC 2V6TA 1DCPA 4LR2A 4BLAA 4KATA 3GTLK 1F7UA 1K83C 1HQMA 1AB4A 4BLBA 3FKIA 1J6XA 3GTMK 1Y1WA 1VH2A 4XSZA 3GTMC 2E2HK 1WORA 3CQZK 1V5VA 2PMZL 3HKZL 2JA8K 4OIOA 4XLPA 4G0UA 5M3MK 5IYCK 3GSIA 3L4KA 4A93C 5C44K 5FJ8K 4A3IC 4KN4A 1O2FB 3IPJA 3RZOK 3VA7A 3GTKA 4KM9A 1TWFA 4GTBA 5IP9C 2PHCB 4JK1A 4G7HA 3M4OK 5IYDK 4A3GC 4QIWL 1TWHA 3M3YK 2PMZD 3HKZD 1YNJA 2YU9K 4LQYA 2E2JK 4C45A 3S2DK 3PO2K 3T02A 4BBRK 3GTOA 1WCMK 3S2DC 5C3EC 1BDFA 1WSRA 3Q3QA 4A3MC 4KMHA 1X31C 3GTJA 4KDDA 1O24A 1WQHA 1WQFA 5EGEA 1UV7A 2NVQC 3GTKC 3TFHA 4WJ4A 1R9TK 4PABA 1EQRA 2A6EA 1I3QK 1L0WA 3H0GA 4KC6A 4QIWD 3HOZC 4BY1C 4ILDA 2V6SA 3TFIA 3GTGK 4KAWX 3GTGC 5M3FK 2JA6A 4Y52C 4XLNA 3GEEA 1XPPA 4BXXC 3HOXK 4RMFA 3GTJC 1XZPA 5M5WK 1IQ0A 2P8TA 1C0AA 5IYBC 3RZDC 1ZBSA 3V4GA 4C3HK 3S0XA 3HXAA 4A3FC 1EFWA 3GTPA 3TTGA 3H0GC 2W7VA 1ZXOA 1J98A 2ZFZA 3HOWK 3S14C 3S1NC 3HOWC 1XZPB 5L46A 4LK0A 3S17K 2E2IA 1J6WA 2JA6C 1WSVA 2ZUFA 1TWAA 2R7ZA 3FHZA 2B63K 2NVXK 4C2MK 4A3EK 4C2MC 4WJ3M 2JA5K 2FQOA 2JA7K 2RGRA 4A3KK 3S1QC 1I6HK 5C4XK 3GTPC 1I6HC 4XSXA 4A3LC 2A6HA 3SZYA 3H3VD 5M5XK 1YCLA 1Y1VA 3BP8C 4GTAA 3K7AC 1TWCK 2VUMA 3WODA 1TWCC 4AYBL 1K83K 4GTCA 1XXBA 1WOOA 1IS1A 1TWAC 2R7ZC 4X6AC 2NVYA 4GZYA 3N0BA 1PJ7A 4BBSC 4OINA 5IOTA 3S1MC 4AH6A 5JVOA 4C3JC 4OIPA 4A3CC 4A93K 4A3IK 1SFOA 5TJ3A 1B4BA 3N0CA 1Y1VC 4Q5SA 4C3IC 5IP9K 4AYBD 4KARA 5FLMC 1VJEA 1O27A 1O2AA 1TWGA 4GTDA 3GEHA 3FKIC 4KB2A 3ERED 1Y1WK 4A3GK 2NVYC 1Y1WC 1I6VA 5TMCA 4J3NA 4GFQA 5EGHA 5C3EK 1WIHA 2A68A 2R92A 4A3MK 2GAHC 1IBAA 3HOYC 4NOIA 5IP7C 2GSUA 1WQGA 1XXAA 4ZH4A 2R93A 2NVTC 1SFOC 3HOUK 2O5JA 1WOPA 4A3JC 3HOUC 2NVQK 3GTKK 1PJ5A 4G0VA 1TWFC 5JFEA 1YNNA 4A3DC 1O29A 2PA8L 1TWGC 1USOA 1B4AA 3AQOA 4O2DA 2XCQA 4G7OA 4A3BC 3HOZK 3I4NC 1TWHC 3FOFA 4BY1K 4M1XA 1JQWA 3JSTA 5M5YK 3GTOK 1RU0A 3OEPA 2D6FC 3GTOC 5IOQA 1I50A 2R92C 1USMA 4Y52K 5CHPA 3AD7C 4Y7NC 1F9NA 4BXXK 3GTJK 2R93C 1F93A 1EH1A 5C4JC 2ZUEA 4YFNA 2BE5A 3OPFA 4P5AA 5IYBK 3RZDK 4GT9A 2PA8D 4A3FK 2XCRB 3S2HC
chains in the Genus database with same CATH topology
3I4NK 2E2JC 4MEYA 3S1QC 3H0GK 1TWHK 4QJVA 5IYCK 5M3MK 4OIRA 4BBRC 3PO2C 3S14K 5C4XK 3GTPC 3S1NK 1WCMC 1I6HC 4XSXA 4A93C 4MQ9A 5C44K 3H3VL 2A6HA 5FJ8K 3EQLA 4A3LC 4BY7K 4A3IC 3H3VD 5M5XK 2R92K 4BY7C 4KN4A 4Y7NK 3K7AC 1TWCK 2YU9C 3WODA 2JA6K 1I50C 3RZOK 1TWCC 4AYBL 1K83K 3S15C 4Q4ZA 3I4MC 5IP9C 2R93K 3S16C 4YG2A 1TWAC 5C4JK 2R7ZC 4JK1A 4G7HA 3M4OK 4X6AC 3HOVC 5IYDK 4QJVB 4MEXA 1R9TC 4GZYA 4LJZA 4BBSC 4QIWL 4A3GC 1I3QC 3M3YK 4OINA 4OIQA 2PMZD 3HKZD 1YNJA 3S1RC 2YU9K 3S2HK 2E2JK 3S1MC 3S1QK 3S2DK 3PO2K 4BBRK 3GTPK 1WCMK 3S2DC 5C3EC 4OIPA 3GTQC 1BDFA 4A3CC 4A93K 4A3LK 4A3IK 4A3MC 1IW7A 2O5IA 3K7AK 4LK1A 1I50K 2E2IK 1ZYRA 3S15K 1Y1VC 3HOXC 2E2IC 3I4MK 4Q5SA 5IP9K 3S16K 4AYBD 1TWAK 5FLMC 2NVQC 3GTKC 2WB1L 2R7ZK 4X6AK 3HOVK 1R9TK 4YFKA 5TMFA 3FKIC 1Y1WK 4A3GK 2A6EA 4BBSK 1I3QK 2NVYC 1Y1WC 1I6VA 3S1RK 5TMCA 4QIWD 2PPBA 3S1MK 2WAQL 3HOZC 4LLGA 3PO3C 4BY1C 4C3JK 5C3EK 4A3CK 2A68A 3GTQK 3GTGK 1I6HK 3GTGC 4A3MK 5M3FK 3S17C 4Y52C 4XLNA 3HOYC 4NOIA 1XPPA 5IP7C 4ZH4A 3GTLC 4BXXC 2NVTC 1Y1VK 3HOXK 4C3IK 1SFOC 2VUMK 3HOUK 3GTJC 2O5JA 4A3JC 2VUMC 3HOUC 2B63C 2Y0SL 5FLMK 2NVQK 2NVXC 3GTKK 5M5WK 4A3EC 1TWFC 2A69A 2WB1D 4G7ZA 4KMUA 1YNNA 2E2HC 3S2HC 4A3DC 3CQZC 2PA8L 3FKIK 1TWGC 5IYBC 3RZDC 2JA8C 2NVYK 2JA5C 1SMYA 4G7OA 4A3BC 4A3FC 4C3HK 2JA7C 3DXJA 4A3KC 3HOZK 3I4NC 3H0GC 3PO3K 1TWHC 2CW0A 5IYCC 4BY1K 3HOWK 3S14C 2WAQD 3S1NC 5C4XC 4KN7A 5M5YK 3HOWC 3GTOK 5C44C 4LK0A 3S17K 3GTOC 2R92C 4Y52K 3HOYK 5D4DA 4Y7NC 5IP7K 3GTLK 2JA6C 3RZOC 4BXXK 2NVTK 1SFOK 1K83C 1HQMA 3GTJK 4A3JK 4YFXA 2B63K 2R93C 2NVXK 4C2MK 5C4JC 4A3EK 3GTMK 3M4OC 1TWFK 2Y0SD 4YFNA 4XSZA 5IYDC 3GTMC 2E2HK 4A3DK 2BE5A 3CQZK 5IYBK 1TWGK 3RZDK 2PMZL 3HKZL 2JA5K 2JA8K 4OIOA 3M3YC 2PA8D 4A3BK 4A3FK 2JA7K 4XLPA 4A3KK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N K;  2E2J C;  4MEY A;  3S1Q C;  3H0G K;  1TWH K;  4QJV A;  5IYC K;  5M3M K;  4OIR A;  4BBR C;  3PO2 C;  3S14 K;  5C4X K;  3GTP C;  3S1N K;  1WCM C;  1I6H C;  4XSX A;  4A93 C;  4MQ9 A;  5C44 K;  3H3V L;  2A6H A;  5FJ8 K;  3EQL A;  4A3L C;  4BY7 K;  4A3I C;  3H3V D;  5M5X K;  2R92 K;  4BY7 C;  4KN4 A;  4Y7N K;  3K7A C;  1TWC K;  2YU9 C;  3WOD A;  2JA6 K;  1I50 C;  3RZO K;  1TWC C;  4AYB L;  1K83 K;  3S15 C;  4Q4Z A;  3I4M C;  5IP9 C;  2R93 K;  3S16 C;  4YG2 A;  1TWA C;  5C4J K;  2R7Z C;  4JK1 A;  4G7H A;  3M4O K;  4X6A C;  3HOV C;  5IYD K;  4QJV B;  4MEX A;  1R9T C;  4GZY A;  4LJZ A;  4BBS C;  4QIW L;  4A3G C;  1I3Q C;  3M3Y K;  4OIN A;  4OIQ A;  2PMZ D;  3HKZ D;  1YNJ A;  3S1R C;  2YU9 K;  3S2H K;  2E2J K;  3S1M C;  3S1Q K;  3S2D K;  3PO2 K;  4BBR K;  3GTP K;  1WCM K;  3S2D C;  5C3E C;  4OIP A;  3GTQ C;  1BDF A;  4A3C C;  4A93 K;  4A3L K;  4A3I K;  4A3M C;  1IW7 A;  2O5I A;  3K7A K;  4LK1 A;  1I50 K;  2E2I K;  1ZYR A;  3S15 K;  1Y1V C;  3HOX C;  2E2I C;  3I4M K;  4Q5S A;  5IP9 K;  3S16 K;  4AYB D;  1TWA K;  5FLM C;  2NVQ C;  3GTK C;  2WB1 L;  2R7Z K;  4X6A K;  3HOV K;  1R9T K;  4YFK A;  5TMF A;  3FKI C;  1Y1W K;  4A3G K;  2A6E A;  4BBS K;  1I3Q K;  2NVY C;  1Y1W C;  1I6V A;  3S1R K;  5TMC A;  4QIW D;  2PPB A;  3S1M K;  2WAQ L;  3HOZ C;  4LLG A;  3PO3 C;  4BY1 C;  4C3J K;  5C3E K;  4A3C K;  2A68 A;  3GTQ K;  3GTG K;  1I6H K;  3GTG C;  4A3M K;  5M3F K;  3S17 C;  4Y52 C;  4XLN A;  3HOY C;  4NOI A;  1XPP A;  5IP7 C;  4ZH4 A;  3GTL C;  4BXX C;  2NVT C;  1Y1V K;  3HOX K;  4C3I K;  1SFO C;  2VUM K;  3HOU K;  3GTJ C;  2O5J A;  4A3J C;  2VUM C;  3HOU C;  2B63 C;  2Y0S L;  5FLM K;  2NVQ K;  2NVX C;  3GTK K;  5M5W K;  4A3E C;  1TWF C;  2A69 A;  2WB1 D;  4G7Z A;  4KMU A;  1YNN A;  2E2H C;  3S2H C;  4A3D C;  3CQZ C;  2PA8 L;  3FKI K;  1TWG C;  5IYB C;  3RZD C;  2JA8 C;  2NVY K;  2JA5 C;  1SMY A;  4G7O A;  4A3B C;  4A3F C;  4C3H K;  2JA7 C;  3DXJ A;  4A3K C;  3HOZ K;  3I4N C;  3H0G C;  3PO3 K;  1TWH C;  2CW0 A;  5IYC C;  4BY1 K;  3HOW K;  3S14 C;  2WAQ D;  3S1N C;  5C4X C;  4KN7 A;  5M5Y K;  3HOW C;  3GTO K;  5C44 C;  4LK0 A;  3S17 K;  3GTO C;  2R92 C;  4Y52 K;  3HOY K;  5D4D A;  4Y7N C;  5IP7 K;  3GTL K;  2JA6 C;  3RZO C;  4BXX K;  2NVT K;  1SFO K;  1K83 C;  1HQM A;  3GTJ K;  4A3J K;  4YFX A;  2B63 K;  2R93 C;  2NVX K;  4C2M K;  5C4J C;  4A3E K;  3GTM K;  3M4O C;  1TWF K;  2Y0S D;  4YFN A;  4XSZ A;  5IYD C;  3GTM C;  2E2H K;  4A3D K;  2BE5 A;  3CQZ K;  5IYB K;  1TWG K;  3RZD K;  2PMZ L;  3HKZ L;  2JA5 K;  2JA8 K;  4OIO A;  3M3Y C;  2PA8 D;  4A3B K;  4A3F K;  2JA7 K;  4XLP A;  4A3K K; 
#chains in the Genus database with same CATH topology
 4MEY A;  3H0G K;  3GTQ A;  3S1N K;  3S14 K;  4G0W A;  3H3V L;  4BY7 K;  3EQL A;  1DCH A;  4BY7 C;  1J6V A;  2JA6 K;  1I50 C;  3S15 C;  4Q4Z A;  3I4M C;  3BUE A;  3S16 C;  3MML B;  3A8I A;  3HOV C;  4MEX A;  3AH5 A;  3SZZ A;  2GSO A;  3S1R C;  1HI9 A;  3S1Q K;  4LOW A;  3GTP K;  1F7V A;  3GTQ C;  1WOS A;  3LAP A;  4A3L K;  1IW7 A;  3GTL A;  2O5I A;  3K7A K;  2E2I K;  2GSN A;  2E2I C;  4KB4 A;  3GTM A;  5IOS A;  1TWA K;  2R7Z K;  2RH6 A;  2E2H A;  4X6A K;  3CQZ A;  4YFK A;  4BBS K;  3A8J A;  3L4J A;  1JVI A;  3AD9 C;  3ADA C;  2PPB A;  3S1M K;  2WAQ L;  3GEI A;  4XCH A;  3PO3 C;  1XXC A;  4C3J K;  1O25 A;  4A3C K;  1GE9 A;  2GAG C;  3AQP A;  1O2B A;  4FM9 A;  3GTL C;  3A8K A;  1Y1V K;  1IE0 A;  4C3I K;  3QX3 A;  2VUM K;  1O26 A;  2VUM C;  4DDQ A;  2Y0S L;  5FLM K;  3G4A A;  2A69 A;  2JH3 A;  4G7Z A;  2E2H C;  3CQZ C;  3FKI K;  2YU9 A;  2CFA A;  2JA8 C;  2NVY K;  1SMY A;  5HL8 A;  1BS2 A;  1WCM A;  1DCO A;  2CW0 A;  5IYC C;  2WAQ D;  1ZVU A;  5C44 C;  3HOY K;  5D4D A;  5IP7 K;  3NUH A;  3RZO C;  2NVT K;  1SFO K;  1PJ6 A;  2CFA B;  4A3J K;  4YFX A;  1VGX A;  3G4C A;  1R9T A;  3M4O C;  1TWF K;  2Y0S D;  1O28 A;  5IYD C;  1I3Q A;  2P5M A;  4A3D K;  3N3Y A;  1TWG K;  1BJT A;  3M3Y C;  1JOE A;  4A3B K;  2YU9 C;  3I4N K;  2E2J C;  1TWH K;  4QJV A;  3T01 A;  4OIR A;  3PO2 C;  4BBR C;  3GTG A;  3GDZ A;  2EBB A;  3FOE A;  1WCM C;  5CJ9 A;  4MQ9 A;  4KAS A;  4KM8 A;  2R92 K;  3TFJ A;  4Y7N K;  3LPX A;  4GTE A;  2R93 K;  4YG2 A;  5C4J K;  4QJV B;  1R9T C;  4LJZ A;  1I3Q C;  3CAG A;  4OIQ A;  4FZB A;  3S2H K;  1VLO A;  4WIL A;  1YX2 A;  4KMD A;  4LK1 A;  1I50 K;  1VRQ C;  2B63 A;  1ZYR A;  3S15 K;  3HOX C;  3I4M K;  2NVX A;  3GIR A;  1DD5 A;  3S16 K;  4GTL A;  1BGW A;  1XZQ A;  2WB1 L;  1G51 A;  3HOV K;  1EK8 A;  2JA5 A;  5TMF A;  2JA7 A;  4P9S A;  2V6U A;  3S1R K;  4C3H C;  4P5B A;  3LAJ A;  3T00 A;  4LLG A;  4BKW A;  3GTQ K;  2FQT A;  3ORE A;  1INN A;  2XCO A;  1ZQ1 C;  1TWC A;  1XZQ B;  3S17 C;  1IL2 A;  1K83 A;  1KQ4 A;  3BP3 A;  2Y3P A;  4KMA A;  4GTF A;  5E68 A;  3AD8 C;  2B63 C;  2NVX C;  4A3E C;  2WB1 D;  4KMU A;  5IOR A;  2JA5 C;  1EI6 A;  2JA7 C;  2KWA A;  3DXJ A;  4A3K C;  3PO3 K;  4PAA A;  1ISE A;  4KN7 A;  5C4X C;  2V6T A;  1DCP A;  4LR2 A;  4BLA A;  4KAT A;  3GTL K;  1F7U A;  1K83 C;  1HQM A;  1AB4 A;  4BLB A;  3FKI A;  1J6X A;  3GTM K;  1Y1W A;  1VH2 A;  4XSZ A;  3GTM C;  2E2H K;  1WOR A;  3CQZ K;  1V5V A;  2PMZ L;  3HKZ L;  2JA8 K;  4OIO A;  4XLP A;  4G0U A;  5M3M K;  5IYC K;  3GSI A;  3L4K A;  4A93 C;  5C44 K;  5FJ8 K;  4A3I C;  4KN4 A;  1O2F B;  3IPJ A;  3RZO K;  3VA7 A;  3GTK A;  4KM9 A;  1TWF A;  4GTB A;  5IP9 C;  2PHC B;  4JK1 A;  4G7H A;  3M4O K;  5IYD K;  4A3G C;  4QIW L;  1TWH A;  3M3Y K;  2PMZ D;  3HKZ D;  1YNJ A;  2YU9 K;  4LQY A;  2E2J K;  4C45 A;  3S2D K;  3PO2 K;  3T02 A;  4BBR K;  3GTO A;  1WCM K;  3S2D C;  5C3E C;  1BDF A;  1WSR A;  3Q3Q A;  4A3M C;  4KMH A;  1X31 C;  3GTJ A;  4KDD A;  1O24 A;  1WQH A;  1WQF A;  5EGE A;  1UV7 A;  2NVQ C;  3GTK C;  3TFH A;  4WJ4 A;  1R9T K;  4PAB A;  1EQR A;  2A6E A;  1I3Q K;  1L0W A;  3H0G A;  4KC6 A;  4QIW D;  3HOZ C;  4BY1 C;  4ILD A;  2V6S A;  3TFI A;  3GTG K;  4KAW X;  3GTG C;  5M3F K;  2JA6 A;  4Y52 C;  4XLN A;  3GEE A;  1XPP A;  4BXX C;  3HOX K;  4RMF A;  3GTJ C;  1XZP A;  5M5W K;  1IQ0 A;  2P8T A;  1C0A A;  5IYB C;  3RZD C;  1ZBS A;  3V4G A;  4C3H K;  3S0X A;  3HXA A;  4A3F C;  1EFW A;  3GTP A;  3TTG A;  3H0G C;  2W7V A;  1ZXO A;  1J98 A;  2ZFZ A;  3HOW K;  3S14 C;  3S1N C;  3HOW C;  1XZP B;  5L46 A;  4LK0 A;  3S17 K;  2E2I A;  1J6W A;  2JA6 C;  1WSV A;  2ZUF A;  1TWA A;  2R7Z A;  3FHZ A;  2B63 K;  2NVX K;  4C2M K;  4A3E K;  4C2M C;  4WJ3 M;  2JA5 K;  2FQO A;  2JA7 K;  2RGR A;  4A3K K;  3S1Q C;  1I6H K;  5C4X K;  3GTP C;  1I6H C;  4XSX A;  4A3L C;  2A6H A;  3SZY A;  3H3V D;  5M5X K;  1YCL A;  1Y1V A;  3BP8 C;  4GTA A;  3K7A C;  1TWC K;  2VUM A;  3WOD A;  1TWC C;  4AYB L;  1K83 K;  4GTC A;  1XXB A;  1WOO A;  1IS1 A;  1TWA C;  2R7Z C;  4X6A C;  2NVY A;  4GZY A;  3N0B A;  1PJ7 A;  4BBS C;  4OIN A;  5IOT A;  3S1M C;  4AH6 A;  5JVO A;  4C3J C;  4OIP A;  4A3C C;  4A93 K;  4A3I K;  1SFO A;  5TJ3 A;  1B4B A;  3N0C A;  1Y1V C;  4Q5S A;  4C3I C;  5IP9 K;  4AYB D;  4KAR A;  5FLM C;  1VJE A;  1O27 A;  1O2A A;  1TWG A;  4GTD A;  3GEH A;  3FKI C;  4KB2 A;  3ERE D;  1Y1W K;  4A3G K;  2NVY C;  1Y1W C;  1I6V A;  5TMC A;  4J3N A;  4GFQ A;  5EGH A;  5C3E K;  1WIH A;  2A68 A;  2R92 A;  4A3M K;  2GAH C;  1IBA A;  3HOY C;  4NOI A;  5IP7 C;  2GSU A;  1WQG A;  1XXA A;  4ZH4 A;  2R93 A;  2NVT C;  1SFO C;  3HOU K;  2O5J A;  1WOP A;  4A3J C;  3HOU C;  2NVQ K;  3GTK K;  1PJ5 A;  4G0V A;  1TWF C;  5JFE A;  1YNN A;  4A3D C;  1O29 A;  2PA8 L;  1TWG C;  1USO A;  1B4A A;  3AQO A;  4O2D A;  2XCQ A;  4G7O A;  4A3B C;  3HOZ K;  3I4N C;  1TWH C;  3FOF A;  4BY1 K;  4M1X A;  1JQW A;  3JST A;  5M5Y K;  3GTO K;  1RU0 A;  3OEP A;  2D6F C;  3GTO C;  5IOQ A;  1I50 A;  2R92 C;  1USM A;  4Y52 K;  5CHP A;  3AD7 C;  4Y7N C;  1F9N A;  4BXX K;  3GTJ K;  2R93 C;  1F93 A;  1EH1 A;  5C4J C;  2ZUE A;  4YFN A;  2BE5 A;  3OPF A;  4P5A A;  5IYB K;  3RZD K;  4GT9 A;  2PA8 D;  4A3F K;  2XCR B;  3S2H C; 
#chains in the Genus database with same CATH homology
 3I4N K;  2E2J C;  4MEY A;  3S1Q C;  3H0G K;  1TWH K;  4QJV A;  5IYC K;  5M3M K;  4OIR A;  4BBR C;  3PO2 C;  3S14 K;  5C4X K;  3GTP C;  3S1N K;  1WCM C;  1I6H C;  4XSX A;  4A93 C;  4MQ9 A;  5C44 K;  3H3V L;  2A6H A;  5FJ8 K;  3EQL A;  4A3L C;  4BY7 K;  4A3I C;  3H3V D;  5M5X K;  2R92 K;  4BY7 C;  4KN4 A;  4Y7N K;  3K7A C;  1TWC K;  2YU9 C;  3WOD A;  2JA6 K;  1I50 C;  3RZO K;  1TWC C;  4AYB L;  1K83 K;  3S15 C;  4Q4Z A;  3I4M C;  5IP9 C;  2R93 K;  3S16 C;  4YG2 A;  1TWA C;  5C4J K;  2R7Z C;  4JK1 A;  4G7H A;  3M4O K;  4X6A C;  3HOV C;  5IYD K;  4QJV B;  4MEX A;  1R9T C;  4GZY A;  4LJZ A;  4BBS C;  4QIW L;  4A3G C;  1I3Q C;  3M3Y K;  4OIN A;  4OIQ A;  2PMZ D;  3HKZ D;  1YNJ A;  3S1R C;  2YU9 K;  3S2H K;  2E2J K;  3S1M C;  3S1Q K;  3S2D K;  3PO2 K;  4BBR K;  3GTP K;  1WCM K;  3S2D C;  5C3E C;  4OIP A;  3GTQ C;  1BDF A;  4A3C C;  4A93 K;  4A3L K;  4A3I K;  4A3M C;  1IW7 A;  2O5I A;  3K7A K;  4LK1 A;  1I50 K;  2E2I K;  1ZYR A;  3S15 K;  1Y1V C;  3HOX C;  2E2I C;  3I4M K;  4Q5S A;  5IP9 K;  3S16 K;  4AYB D;  1TWA K;  5FLM C;  2NVQ C;  3GTK C;  2WB1 L;  2R7Z K;  4X6A K;  3HOV K;  1R9T K;  4YFK A;  5TMF A;  3FKI C;  1Y1W K;  4A3G K;  2A6E A;  4BBS K;  1I3Q K;  2NVY C;  1Y1W C;  1I6V A;  3S1R K;  5TMC A;  4QIW D;  2PPB A;  3S1M K;  2WAQ L;  3HOZ C;  4LLG A;  3PO3 C;  4BY1 C;  4C3J K;  5C3E K;  4A3C K;  2A68 A;  3GTQ K;  3GTG K;  1I6H K;  3GTG C;  4A3M K;  5M3F K;  3S17 C;  4Y52 C;  4XLN A;  3HOY C;  4NOI A;  1XPP A;  5IP7 C;  4ZH4 A;  3GTL C;  4BXX C;  2NVT C;  1Y1V K;  3HOX K;  4C3I K;  1SFO C;  2VUM K;  3HOU K;  3GTJ C;  2O5J A;  4A3J C;  2VUM C;  3HOU C;  2B63 C;  2Y0S L;  5FLM K;  2NVQ K;  2NVX C;  3GTK K;  5M5W K;  4A3E C;  1TWF C;  2A69 A;  2WB1 D;  4G7Z A;  4KMU A;  1YNN A;  2E2H C;  3S2H C;  4A3D C;  3CQZ C;  2PA8 L;  3FKI K;  1TWG C;  5IYB C;  3RZD C;  2JA8 C;  2NVY K;  2JA5 C;  1SMY A;  4G7O A;  4A3B C;  4A3F C;  4C3H K;  2JA7 C;  3DXJ A;  4A3K C;  3HOZ K;  3I4N C;  3H0G C;  3PO3 K;  1TWH C;  2CW0 A;  5IYC C;  4BY1 K;  3HOW K;  3S14 C;  2WAQ D;  3S1N C;  5C4X C;  4KN7 A;  5M5Y K;  3HOW C;  3GTO K;  5C44 C;  4LK0 A;  3S17 K;  3GTO C;  2R92 C;  4Y52 K;  3HOY K;  5D4D A;  4Y7N C;  5IP7 K;  3GTL K;  2JA6 C;  3RZO C;  4BXX K;  2NVT K;  1SFO K;  1K83 C;  1HQM A;  3GTJ K;  4A3J K;  4YFX A;  2B63 K;  2R93 C;  2NVX K;  4C2M K;  5C4J C;  4A3E K;  3GTM K;  3M4O C;  1TWF K;  2Y0S D;  4YFN A;  4XSZ A;  5IYD C;  3GTM C;  2E2H K;  4A3D K;  2BE5 A;  3CQZ K;  5IYB K;  1TWG K;  3RZD K;  2PMZ L;  3HKZ L;  2JA5 K;  2JA8 K;  4OIO A;  3M3Y C;  2PA8 D;  4A3B K;  4A3F K;  2JA7 K;  4XLP A;  4A3K K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...