3AH5A

Crystal structure of flavin dependent thymidylate synthase thyx from helicobacter pylori complexed with fad and dump
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
215
structure length
215
Chain Sequence
MEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAKEFLVFVDNEKVNAMSVLALENLRILLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNFLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKHLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Crystal structure and functional analysis of a flavin dependent thymidylate synthase from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 75
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ah5A00
1O2BA 4GTCA 4KASA 4GTBA 3N0BA 2CFAB 1O29A 5IOQA 3G4AA 4GT9A 4KATA 3N3YA 1KQ4A 1O27A 3N0CA 4GTLA 1O24A 4GTEA 4P5BA 5CHPA 5IOSA 5IOTA 1O28A 4KARA 1O26A 2CFAA 1O25A 3G4CA 1O2AA 4P5AA 4GTDA 4GTAA 4FZBA 3AH5A 5JFEA 4GTFA 5IORA
chains in the Genus database with same CATH superfamily
2R92C 1Y1WA 1WSVA 1XZQA 4NOIA 4J3NA 3HKZD 3HOWC 1YCLA 3GTKA 2R93K 3N0CA 2JA6C 5IP9K 4KB4A 1V5VA 2A6HA 3CQZK 1O2FB 3PO2K 3S17K 1TWHK 4A3EC 3AD7C 4XSZA 5IOTA 1K83A 4KDDA 5L46A 5C4XC 1TWCK 3A8JA 2BE5A 3GSIA 4WILA 3I4NC 3M3YC 2A6EA 4YG2A 3PO3C 5M3MK 3V4GA 3CQZA 4KC6A 1VH2A 3H3VD 4KATA 4A3MK 4BY1K 4G7HA 2VUMC 4GTEA 5M5XK 3A8KA 1XZQB 1TWCA 3GTLK 4YFNA 1L0WA 1O28A 4OIPA 1Y1WC 4KMHA 3S1QC 4KM9A 4A93C 1Y1VA 4Y52C 4OIOA 1WSRA 3JSTA 3ERED 4GTFA 4BBSC 3ADAC 2O5IA 1VJEA 4BBRK 5C44C 4KASA 2JA5K 3GTJA 1EK8A 3HOVK 1TWFK 2ZUEA 1B4AA 1K83C 1XPPA 4C3JK 1DCPA 2NVTK 2Y0SD 1I50C 2ZFZA 3AQPA 5JVOA 2B63K 4A3KK 5M5WK 1BDFA 3GTQC 3RZOK 1PJ7A 2WAQL 2R93C 1GE9A 3LPXA 5IP9C 3CQZC 3PO2C 1ZYRA 1O2AA 3S17C 1TWHC 4GTAA 4BY7K 4KAWX 2PPBA 1JQWA 1R9TC 3NUHA 1XXBA 4GTCA 2PHCB 1SFOA 4GTBA 4C45A 2O5JA 1O29A 3RZDC 3WODA 3S1RK 2XCOA 3QX3A 3L4KA 3H0GA 4A3GK 2R92A 4QIWD 5IP7K 1I6HK 1AB4A 3GTOK 3DXJA 4A3MC 4BY1C 3PO3K 3SZYA 5TMCA 5C4JK 4C3HC 4LLGA 2JA6A 1YNJA 3K7AK 3GTGK 4GTDA 4LJZA 3GTLC 1B4BA 3BUEA 4G7ZA 3TTGA 4Q4ZA 3GEHA 1WQHA 4WJ4A 3N3YA 2YU9K 4P5BA 3HKZL 4BBRC 2JA5C 1UV7A 3HOVC 1TWFC 5M3FK 5FLMK 5D4DA 5C3EK 4BBSK 4DDQA 3GTGA 1O26A 4C3JC 3HOXC 2E2JK 2R7ZK 2NVTC 2B63C 2VUMA 4A3KC 1PJ6A 1HI9A 2ZUFA 1I50K 3AQOA 3T02A 1SMYA 3GTQK 4BY7C 1O27A 4LR2A 4C3IK 3Q3QA 3H3VL 4X6AK 2E2HC 2KWAA 2P5MA 1IW7A 1R9TK 3S1RC 1J6XA 4KN7A 4MEYA 3AD8C 4YFXA 4A3GC 2A68A 1I50A 3RZDK 5IP7C 1I6HC 1TWGK 3GIRA 1WCMC 4A3FK 3GTOC 1F7VA 3GTQA 3T01A 3LAJA 2R93A 2JH3A 1IS1A 3N0BA 3OEPA 5C4JC 4QJVA 3K7AC 4KM8A 3GTGC 1TWHA 3S15K 3TFIA 4GFQA 4C3HK 1R9TA 2E2IK 2Y0SL 1INNA 1YX2A 2YU9C 1F7UA 2RGRA 4PAAA 3FKIC 5FLMC 3GTPK 5IYCK 4LQYA 5C3EC 4P9SA 4LK1A 1XZPA 2R7ZC 2E2JC 4A3LK 1JOEA 1IE0A 4A3CK 4OINA 1IBAA 1F93A 1WQFA 2PA8L 3GTLA 2E2IA 3HOXK 3I4MK 2JA8K 4O2DA 4QJVB 1VRQC 4QIWL 3GTPA 1O25A 2FQTA 4C3IC 2CW0A 2W7VA 4LOWA 4ZH4A 2JA5A 3T00A 3BP8C 4X6AC 4FZBA 1TWFA 4A3JK 1EQRA 5TMFA 3GDZA 4KB2A 1RU0A 1DCOA 2E2HK 2RH6A 2B63A 4GTLA 1TWGC 1O24A 1WOSA 4A3FC 3GEIA 4A3IK 2V6UA 1WCMK 3EQLA 5IYBK 3GEEA 4G7OA 3S15C 1IQ0A 3L4JA 2CFAA 3HOUK 4XLNA 2PMZD 3HOZC 2A69A 4XSXA 3OREA 5FJ8K 2E2IC 2E2HA 2P8TA 5CJ9A 4ILDA 3FOEA 2V6TA 4OIRA 4LK0A 3AD9C 1J6WA 3S2DC 4GZYA 1C0AA 3GTPC 4BLBA 5IYCC 4BXXK 1WCMA 1I3QK 1PJ5A 3GTOA 4AYBD 2NVXK 2GSOA 4KMDA 1ZBSA 2D6FC 4A3LC 1DD5A 4A3CC 3FKIK 1G51A 1WOPA 4G0WA 1HQMA 4BLAA 3I4MC 3GTMK 2WB1D 4FM9A 2JA8C 3HXAA 5JFEA 1USMA 5EGHA 1TWAK 4KMAA 2CFAB 4C2MC 4Y7NK 2YU9A 1EI6A 1X31C 3MMLB 4A3JC 3FKIA 3GTKK 1WOOA 2XCQA 1F9NA 2R7ZA 3HOYC 4JK1A 1XXCA 3G4CA 3TFJA 4A3IC 4P5AA 4KMUA 4A3BK 1IL2A 2Y3PA 2GAGC 5IYBC 1O2BA 1BJTA 3HOUC 3SZZA 4GT9A 3S14K 2NVYC 4MQ9A 3VA7A 4OIQA 3BP3A 3HOZK 5CHPA 2GAHC 5IOSA 1BS2A 4M1XA 4KN4A 1WIHA 1TWGA 4BXXC 1I3QC 2NVXC 2JA7K 3S1NK 3TFHA 3FHZA 1Y1VK 3S2DK 3OPFA 4A3DK 4WJ3M 5IYDK 3LAPA 3G4AA 3GTJK 1I6VA 3GTMC 1TWAC 3M4OK 1VLOA 4Y7NC 3S1MK 2JA7A 2GSUA 3IPJA 2FQOA 4C2MK 5E68A 3GTKC 1USOA 1J6VA 2NVQK 1XXAA 2PMZL 3CAGA 3S2HC 1SFOK 4PABA 5HL8A 4A3BC 3HOYK 3S0XA 4XCHA 1JVIA 1XZPB 3S16K 3H0GK 1EH1A 2R92K 3S14C 4AYBL 4YFKA 3HOWK 2GSNA 3AH5A 2JA6K 2NVYK 4MEXA 2PA8D 1TWCC 4A3EK 4RMFA 2WB1L 5IOQA 2JA7C 3S1NC 5C4XK 1Y1VC 2WAQD 5M5YK 4G0UA 4A3DC 3I4NK 3M3YK 5IYDC 5TJ3A 3GTJC 3FOFA 1WORA 1ISEA 1YNNA 2NVYA 3M4OC 2XCRB 4XLPA 1ZXOA 1BGWA 2VUMK 3S1MC 5IORA 1VGXA 2NVQC 1ZVUA 1I3QA 1Y1WK 1KQ4A 3S1QK 2NVXA 4AH6A 1EFWA 4A93K 4Y52K 2V6SA 4BKWA 4Q5SA 4G0VA 5EGEA 1SFOC 3A8IA 1J98A 1ZQ1C 4KARA 5C44K 1WQGA 3GTMA 3S2HK 2EBBA 1DCHA 1TWAA 1K83K 3RZOC 3S16C 3H0GC
chains in the Genus database with same CATH topology
1Y1WA 4KB2A 1WQHA 4J3NA 3LAPA 3G4AA 2RH6A 3N3YA 3GTKA 2B63A 3N0CA 4GTLA 4KB4A 1O24A 4P5BA 5IOTA 4DDQA 1K83A 4KDDA 1O26A 3GTGA 2GSUA 2JA7A 3L4JA 2CFAA 4C3JC 2VUMA 1XXAA 3OREA 2E2HA 5CJ9A 3CAGA 4ILDA 3FOEA 3AQOA 3V4GA 3CQZA 4KC6A 4KATA 1O27A 4LR2A 4GTEA 4BLBA 1WCMA 3GTOA 3Q3QA 3S0XA 2GSOA 1TWCA 4KMDA 1ZBSA 2KWAA 1DD5A 2P5MA 1EH1A 1O28A 4KMHA 4KM9A 4G0WA 4BLAA 1Y1VA 1I50A 4FM9A 3ERED 2GSNA 3AH5A 5JFEA 4GTFA 5EGHA 3GTQA 4KASA 3GTJA 1EK8A 3LAJA 2R93A 2JH3A 1IS1A 3N0BA 2CFAB 3OEPA 4KMAA 4C2MC 2YU9A 5IOQA 4KM8A 1B4AA 1TWHA 3MMLB 4GFQA 3FKIA 2ZFZA 3AQPA 5JVOA 2XCQA 1R9TA 4G0UA 1F9NA 5TJ3A 2R7ZA 3FOFA 1GE9A 3LPXA 1ISEA 2NVYA 1XXCA 3G4CA 1O2AA 2XCRB 2RGRA 4P5AA 4GTAA 1ZXOA 1BGWA 2Y3PA 4KAWX 4LQYA 5IORA 1O2BA 1XXBA 3NUHA 2PHCB 4GTCA 4GTBA 1SFOA 1BJTA 1O29A 4GT9A 1ZVUA 1I3QA 1KQ4A 2NVXA 1WQFA 2XCOA 3GTLA 3QX3A 3VA7A 2E2IA 3L4KA 3H0GA 4BKWA 5CHPA 2R92A 5IOSA 4G0VA 5EGEA 1AB4A 4M1XA 4KARA 1WQGA 3GTMA 1WIHA 3GTPA 4C3HC 2JA6A 1O25A 1TWGA 4C3IC 1TWAA 2JA5A 4GTDA 4FZBA 1B4BA 3BUEA 1TWFA 3FHZA 3OPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2B A;  4GTC A;  4KAS A;  4GTB A;  3N0B A;  2CFA B;  1O29 A;  5IOQ A;  3G4A A;  4GT9 A;  4KAT A;  3N3Y A;  1KQ4 A;  1O27 A;  3N0C A;  4GTL A;  1O24 A;  4GTE A;  4P5B A;  5CHP A;  5IOS A;  5IOT A;  1O28 A;  4KAR A;  1O26 A;  2CFA A;  1O25 A;  3G4C A;  1O2A A;  4P5A A;  4GTD A;  4GTA A;  4FZB A;  3AH5 A;  5JFE A;  4GTF A;  5IOR A; 
#chains in the Genus database with same CATH topology
 2R92 C;  1Y1W A;  1WSV A;  1XZQ A;  4NOI A;  4J3N A;  3HKZ D;  3HOW C;  1YCL A;  3GTK A;  2R93 K;  3N0C A;  2JA6 C;  5IP9 K;  4KB4 A;  1V5V A;  2A6H A;  3CQZ K;  1O2F B;  3PO2 K;  3S17 K;  1TWH K;  4A3E C;  3AD7 C;  4XSZ A;  5IOT A;  1K83 A;  4KDD A;  5L46 A;  5C4X C;  1TWC K;  3A8J A;  2BE5 A;  3GSI A;  4WIL A;  3I4N C;  3M3Y C;  2A6E A;  4YG2 A;  3PO3 C;  5M3M K;  3V4G A;  3CQZ A;  4KC6 A;  1VH2 A;  3H3V D;  4KAT A;  4A3M K;  4BY1 K;  4G7H A;  2VUM C;  4GTE A;  5M5X K;  3A8K A;  1XZQ B;  1TWC A;  3GTL K;  4YFN A;  1L0W A;  1O28 A;  4OIP A;  1Y1W C;  4KMH A;  3S1Q C;  4KM9 A;  4A93 C;  1Y1V A;  4Y52 C;  4OIO A;  1WSR A;  3JST A;  3ERE D;  4GTF A;  4BBS C;  3ADA C;  2O5I A;  1VJE A;  4BBR K;  5C44 C;  4KAS A;  2JA5 K;  3GTJ A;  1EK8 A;  3HOV K;  1TWF K;  2ZUE A;  1B4A A;  1K83 C;  1XPP A;  4C3J K;  1DCP A;  2NVT K;  2Y0S D;  1I50 C;  2ZFZ A;  3AQP A;  5JVO A;  2B63 K;  4A3K K;  5M5W K;  1BDF A;  3GTQ C;  3RZO K;  1PJ7 A;  2WAQ L;  2R93 C;  1GE9 A;  3LPX A;  5IP9 C;  3CQZ C;  3PO2 C;  1ZYR A;  1O2A A;  3S17 C;  1TWH C;  4GTA A;  4BY7 K;  4KAW X;  2PPB A;  1JQW A;  1R9T C;  3NUH A;  1XXB A;  4GTC A;  2PHC B;  1SFO A;  4GTB A;  4C45 A;  2O5J A;  1O29 A;  3RZD C;  3WOD A;  3S1R K;  2XCO A;  3QX3 A;  3L4K A;  3H0G A;  4A3G K;  2R92 A;  4QIW D;  5IP7 K;  1I6H K;  1AB4 A;  3GTO K;  3DXJ A;  4A3M C;  4BY1 C;  3PO3 K;  3SZY A;  5TMC A;  5C4J K;  4C3H C;  4LLG A;  2JA6 A;  1YNJ A;  3K7A K;  3GTG K;  4GTD A;  4LJZ A;  3GTL C;  1B4B A;  3BUE A;  4G7Z A;  3TTG A;  4Q4Z A;  3GEH A;  1WQH A;  4WJ4 A;  3N3Y A;  2YU9 K;  4P5B A;  3HKZ L;  4BBR C;  2JA5 C;  1UV7 A;  3HOV C;  1TWF C;  5M3F K;  5FLM K;  5D4D A;  5C3E K;  4BBS K;  4DDQ A;  3GTG A;  1O26 A;  4C3J C;  3HOX C;  2E2J K;  2R7Z K;  2NVT C;  2B63 C;  2VUM A;  4A3K C;  1PJ6 A;  1HI9 A;  2ZUF A;  1I50 K;  3AQO A;  3T02 A;  1SMY A;  3GTQ K;  4BY7 C;  1O27 A;  4LR2 A;  4C3I K;  3Q3Q A;  3H3V L;  4X6A K;  2E2H C;  2KWA A;  2P5M A;  1IW7 A;  1R9T K;  3S1R C;  1J6X A;  4KN7 A;  4MEY A;  3AD8 C;  4YFX A;  4A3G C;  2A68 A;  1I50 A;  3RZD K;  5IP7 C;  1I6H C;  1TWG K;  3GIR A;  1WCM C;  4A3F K;  3GTO C;  1F7V A;  3GTQ A;  3T01 A;  3LAJ A;  2R93 A;  2JH3 A;  1IS1 A;  3N0B A;  3OEP A;  5C4J C;  4QJV A;  3K7A C;  4KM8 A;  3GTG C;  1TWH A;  3S15 K;  3TFI A;  4GFQ A;  4C3H K;  1R9T A;  2E2I K;  2Y0S L;  1INN A;  1YX2 A;  2YU9 C;  1F7U A;  2RGR A;  4PAA A;  3FKI C;  5FLM C;  3GTP K;  5IYC K;  4LQY A;  5C3E C;  4P9S A;  4LK1 A;  1XZP A;  2R7Z C;  2E2J C;  4A3L K;  1JOE A;  1IE0 A;  4A3C K;  4OIN A;  1IBA A;  1F93 A;  1WQF A;  2PA8 L;  3GTL A;  2E2I A;  3HOX K;  3I4M K;  2JA8 K;  4O2D A;  4QJV B;  1VRQ C;  4QIW L;  3GTP A;  1O25 A;  2FQT A;  4C3I C;  2CW0 A;  2W7V A;  4LOW A;  4ZH4 A;  2JA5 A;  3T00 A;  3BP8 C;  4X6A C;  4FZB A;  1TWF A;  4A3J K;  1EQR A;  5TMF A;  3GDZ A;  4KB2 A;  1RU0 A;  1DCO A;  2E2H K;  2RH6 A;  2B63 A;  4GTL A;  1TWG C;  1O24 A;  1WOS A;  4A3F C;  3GEI A;  4A3I K;  2V6U A;  1WCM K;  3EQL A;  5IYB K;  3GEE A;  4G7O A;  3S15 C;  1IQ0 A;  3L4J A;  2CFA A;  3HOU K;  4XLN A;  2PMZ D;  3HOZ C;  2A69 A;  4XSX A;  3ORE A;  5FJ8 K;  2E2I C;  2E2H A;  2P8T A;  5CJ9 A;  4ILD A;  3FOE A;  2V6T A;  4OIR A;  4LK0 A;  3AD9 C;  1J6W A;  3S2D C;  4GZY A;  1C0A A;  3GTP C;  4BLB A;  5IYC C;  4BXX K;  1WCM A;  1I3Q K;  1PJ5 A;  3GTO A;  4AYB D;  2NVX K;  2GSO A;  4KMD A;  1ZBS A;  2D6F C;  4A3L C;  1DD5 A;  4A3C C;  3FKI K;  1G51 A;  1WOP A;  4G0W A;  1HQM A;  4BLA A;  3I4M C;  3GTM K;  2WB1 D;  4FM9 A;  2JA8 C;  3HXA A;  5JFE A;  1USM A;  5EGH A;  1TWA K;  4KMA A;  2CFA B;  4C2M C;  4Y7N K;  2YU9 A;  1EI6 A;  1X31 C;  3MML B;  4A3J C;  3FKI A;  3GTK K;  1WOO A;  2XCQ A;  1F9N A;  2R7Z A;  3HOY C;  4JK1 A;  1XXC A;  3G4C A;  3TFJ A;  4A3I C;  4P5A A;  4KMU A;  4A3B K;  1IL2 A;  2Y3P A;  2GAG C;  5IYB C;  1O2B A;  1BJT A;  3HOU C;  3SZZ A;  4GT9 A;  3S14 K;  2NVY C;  4MQ9 A;  3VA7 A;  4OIQ A;  3BP3 A;  3HOZ K;  5CHP A;  2GAH C;  5IOS A;  1BS2 A;  4M1X A;  4KN4 A;  1WIH A;  1TWG A;  4BXX C;  1I3Q C;  2NVX C;  2JA7 K;  3S1N K;  3TFH A;  3FHZ A;  1Y1V K;  3S2D K;  3OPF A;  4A3D K;  4WJ3 M;  5IYD K;  3LAP A;  3G4A A;  3GTJ K;  1I6V A;  3GTM C;  1TWA C;  3M4O K;  1VLO A;  4Y7N C;  3S1M K;  2JA7 A;  2GSU A;  3IPJ A;  2FQO A;  4C2M K;  5E68 A;  3GTK C;  1USO A;  1J6V A;  2NVQ K;  1XXA A;  2PMZ L;  3CAG A;  3S2H C;  1SFO K;  4PAB A;  5HL8 A;  4A3B C;  3HOY K;  3S0X A;  4XCH A;  1JVI A;  1XZP B;  3S16 K;  3H0G K;  1EH1 A;  2R92 K;  3S14 C;  4AYB L;  4YFK A;  3HOW K;  2GSN A;  3AH5 A;  2JA6 K;  2NVY K;  4MEX A;  2PA8 D;  1TWC C;  4A3E K;  4RMF A;  2WB1 L;  5IOQ A;  2JA7 C;  3S1N C;  5C4X K;  1Y1V C;  2WAQ D;  5M5Y K;  4G0U A;  4A3D C;  3I4N K;  3M3Y K;  5IYD C;  5TJ3 A;  3GTJ C;  3FOF A;  1WOR A;  1ISE A;  1YNN A;  2NVY A;  3M4O C;  2XCR B;  4XLP A;  1ZXO A;  1BGW A;  2VUM K;  3S1M C;  5IOR A;  1VGX A;  2NVQ C;  1ZVU A;  1I3Q A;  1Y1W K;  1KQ4 A;  3S1Q K;  2NVX A;  4AH6 A;  1EFW A;  4A93 K;  4Y52 K;  2V6S A;  4BKW A;  4Q5S A;  4G0V A;  5EGE A;  1SFO C;  3A8I A;  1J98 A;  1ZQ1 C;  4KAR A;  5C44 K;  1WQG A;  3GTM A;  3S2H K;  2EBB A;  1DCH A;  1TWA A;  1K83 K;  3RZO C;  3S16 C;  3H0G C; 
#chains in the Genus database with same CATH homology
 1Y1W A;  4KB2 A;  1WQH A;  4J3N A;  3LAP A;  3G4A A;  2RH6 A;  3N3Y A;  3GTK A;  2B63 A;  3N0C A;  4GTL A;  4KB4 A;  1O24 A;  4P5B A;  5IOT A;  4DDQ A;  1K83 A;  4KDD A;  1O26 A;  3GTG A;  2GSU A;  2JA7 A;  3L4J A;  2CFA A;  4C3J C;  2VUM A;  1XXA A;  3ORE A;  2E2H A;  5CJ9 A;  3CAG A;  4ILD A;  3FOE A;  3AQO A;  3V4G A;  3CQZ A;  4KC6 A;  4KAT A;  1O27 A;  4LR2 A;  4GTE A;  4BLB A;  1WCM A;  3GTO A;  3Q3Q A;  3S0X A;  2GSO A;  1TWC A;  4KMD A;  1ZBS A;  2KWA A;  1DD5 A;  2P5M A;  1EH1 A;  1O28 A;  4KMH A;  4KM9 A;  4G0W A;  4BLA A;  1Y1V A;  1I50 A;  4FM9 A;  3ERE D;  2GSN A;  3AH5 A;  5JFE A;  4GTF A;  5EGH A;  3GTQ A;  4KAS A;  3GTJ A;  1EK8 A;  3LAJ A;  2R93 A;  2JH3 A;  1IS1 A;  3N0B A;  2CFA B;  3OEP A;  4KMA A;  4C2M C;  2YU9 A;  5IOQ A;  4KM8 A;  1B4A A;  1TWH A;  3MML B;  4GFQ A;  3FKI A;  2ZFZ A;  3AQP A;  5JVO A;  2XCQ A;  1R9T A;  4G0U A;  1F9N A;  5TJ3 A;  2R7Z A;  3FOF A;  1GE9 A;  3LPX A;  1ISE A;  2NVY A;  1XXC A;  3G4C A;  1O2A A;  2XCR B;  2RGR A;  4P5A A;  4GTA A;  1ZXO A;  1BGW A;  2Y3P A;  4KAW X;  4LQY A;  5IOR A;  1O2B A;  1XXB A;  3NUH A;  2PHC B;  4GTC A;  4GTB A;  1SFO A;  1BJT A;  1O29 A;  4GT9 A;  1ZVU A;  1I3Q A;  1KQ4 A;  2NVX A;  1WQF A;  2XCO A;  3GTL A;  3QX3 A;  3VA7 A;  2E2I A;  3L4K A;  3H0G A;  4BKW A;  5CHP A;  2R92 A;  5IOS A;  4G0V A;  5EGE A;  1AB4 A;  4M1X A;  4KAR A;  1WQG A;  3GTM A;  1WIH A;  3GTP A;  4C3H C;  2JA6 A;  1O25 A;  1TWG A;  4C3I C;  1TWA A;  2JA5 A;  4GTD A;  4FZB A;  1B4B A;  3BUE A;  1TWF A;  3FHZ A;  3OPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...