3AH5A

Crystal structure of flavin dependent thymidylate synthase thyx from helicobacter pylori complexed with fad and dump
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
215
structure length
215
Chain Sequence
MEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAKEFLVFVDNEKVNAMSVLALENLRILLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNFLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKHLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional analysis of a flavin dependent thymidylate synthase from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 75
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ah5A00
4GTFA 4P5BA 3N0CA 4GTBA 4GTEA 1O28A 4GTLA 4GTAA 5IORA 1KQ4A 5JFEA 3G4CA 1O25A 4GTCA 4KATA 2CFAB 4FZBA 4P5AA 3N3YA 1O2BA 3N0BA 4GT9A 1O29A 3AH5A 5IOSA 3G4AA 1O26A 5CHPA 4GTDA 1O24A 4KASA 1O2AA 5IOTA 2CFAA 1O27A 4KARA 5IOQA
chains in the Genus database with same CATH superfamily
4QIWL 4P5BA 1TWCA 5FLMK 1R9TK 5C4JK 3FKIK 2B63K 1F93A 4LQYA 1TWFK 3WODA 4BLAA 4LR2A 1WIHA 2VUMC 4DDQA 4A3FK 3FHZA 4WJ4A 3I4MC 2NVXK 1O26A 5C44K 3FOEA 3PO3K 1I50A 4A3DK 1O27A 4GTCA 4C3HK 4LK0A 1DD5A 2E2HA 1SFOC 3GEIA 3HOVC 1KQ4A 4G0WA 1WOSA 1VJEA 3S0XA 2R92K 3GIRA 4XLNA 4KAWX 5C3EC 3AD7C 3S14C 2O5IA 4FZBA 5M3MK 1X31C 1K83K 1YX2A 5D4DA 3S1MK 4A3EK 1TWCC 1ZVUA 2GSNA 5EGEA 1JOEA 1VRQC 4KMHA 4Q5SA 4BLBA 5TJ3A 1WSVA 4KMUA 3RZDC 4BKWA 3BP3A 3NUHA 3PO3C 4GTFA 4GTLA 1HQMA 4BBSC 4OINA 5JFEA 1IS1A 3GTJC 1TWGA 2B63A 1XPPA 4A3BK 3HOXK 4QJVA 3LAJA 1EFWA 3GTLA 3AQPA 2JA5A 4YFXA 3A8JA 5FJ8K 4A3JC 1PJ6A 4ZH4A 1EH1A 4BY7K 5M5YK 4A3KK 2ZUFA 1TWGC 4Y52C 1GE9A 1TWAK 3H0GK 1I50C 2Y0SL 3AQOA 2WB1D 3GTKA 3S2HC 2CW0A 5IORA 1I3QA 3RZDK 1C0AA 1O25A 3AD8C 4M1XA 1Y1VK 3I4NK 2R92A 2FQTA 1EQRA 4X6AC 1K83A 1TWHC 1ZXOA 3LPXA 4WJ3M 4A3GK 5IP7C 1J6WA 4KC6A 2E2JC 4LK1A 2JA8K 1IBAA 1O24A 3JSTA 3S1RC 3GTQK 3BP8C 1I6HC 2R93A 5IOTA 3T01A 1WORA 4XSZA 5E68A 2E2IC 1Y1VC 2GSUA 3I4NC 4GTEA 1SFOA 1K83C 4Y7NC 1I6VA 4A3CC 1ZQ1C 1HI9A 1ZBSA 4C2MC 1ISEA 4X6AK 2W7VA 4PAAA 2XCRB 1J6VA 3S17C 3GTPA 1TWCK 1PJ7A 4KB2A 2WB1L 2JA7K 2NVTK 2V6TA 2PA8D 2Y0SD 2CFAA 3CQZA 2PPBA 5IOQA 2NVQC 3OREA 3GDZA 1PJ5A 1TWHA 3BUEA 3GTOC 3A8IA 3S16K 3GTJA 1L0WA 2O5JA 4PABA 4BBSK 2B63C 4OIQA 4C3JC 2BE5A 1I3QC 4OIOA 4RMFA 1WCMA 2JH3A 3H3VD 1BS2A 3GTGC 4BXXC 1IL2A 5IYBC 4GTBA 2XCQA 1RU0A 3GTQA 3GTOA 2NVYK 1B4BA 3G4CA 1XXAA 3H0GC 1YNJA 2RGRA 3T02A 1Y1WA 3S16C 4KMDA 3CQZC 2WAQL 4OIRA 1O2BA 5IYCC 2JA8C 4KM8A 3GTMA 3S14K 3L4JA 5FLMC 5M5XK 4A3MC 1EI6A 4C45A 2PA8L 2R7ZA 4YFKA 1JQWA 2YU9K 3LAPA 1IQ0A 3TFIA 3GTKC 3HKZD 3IPJA 3GTMC 1WQGA 1BDFA 4FM9A 5C4JC 1USMA 1R9TC 3ADAC 4P5AA 4P9SA 3N3YA 2JA6C 1J98A 1INNA 4YG2A 5C4XC 2P8TA 2PHCB 3G4AA 3H3VL 1EK8A 1DCPA 3GTKK 5HL8A 3GEHA 3FKIA 2NVQK 1O2AA 3OPFA 1BGWA 3SZZA 1WQFA 2R92C 3TFHA 1WOPA 1VLOA 5IYDK 4A3LC 1TWAC 3SZYA 4A3IC 1XXCA 4KDDA 3EQLA 5C4XK 4MQ9A 2JA6K 1UV7A 2NVYA 4G7OA 1IE0A 1Y1VA 1USOA 5IYBK 3RZOC 1VGXA 4LOWA 4A3EC 4G0UA 2ZUEA 2A68A 4C2MK 2E2JK 3QX3A 3GTPC 3S15C 2NVXA 1V5VA 1WCMC 4WILA 5IP9K 3OEPA 3S1QC 2E2IK 4KB4A 3DXJA 4KMAA 5IOSA 1YCLA 1BJTA 4QJVB 3S2HK 4JK1A 1XZPA 1B4AA 2JA7C 3A8KA 3CAGA 3GSIA 2JA7A 1TWGK 3S1NK 4Y52K 4AYBL 4BY7C 4C3HC 2ZFZA 3HXAA 4NOIA 3AD9C 1TWHK 3K7AK 4A3GC 2A69A 3TTGA 4O2DA 3HOVK 4OIPA 1TWAA 4MEYA 4GFQA 3GTGK 3HOUC 1AB4A 2PMZL 4Q4ZA 3M4OK 1I3QK 3M3YC 3FKIC 4A3LK 4J3NA 2A6EA 4KARA 4A3CK 2GAHC 2FQOA 2EBBA 5IYCK 3S17K 3H0GA 1R9TA 5TMCA 3N0BA 2R93K 1O29A 2E2HC 2YU9C 2NVTC 4A93C 1TWFA 5JVOA 1XZQB 5M3FK 1SFOK 4AYBD 5CHPA 3GEEA 4GTDA 2R7ZC 3HOYC 4A3MK 3HOZC 3V4GA 1DCHA 5M5WK 3S15K 3M4OC 1G51A 2V6SA 1DCOA 2NVXC 2YU9A 3GTPK 1I50K 1JVIA 2GSOA 4BY1K 5IP7K 2E2HK 4GZYA 2JA5C 2D6FC 3GTLC 3VA7A 3S2DC 3GTQC 1I6HK 3S1MC 5C3EK 4BXXK 4BBRC 1O2FB 3GTGA 4KASA 4LLGA 4A3IK 2P5MA 4C3JK 3HOWC 4KN7A 3T00A 1TWFC 4XCHA 4C3IC 4GTAA 4G7ZA 4MEXA 1WOOA 4KATA 3L4KA 2JA5K 3HOUK 2GAGC 4XSXA 1XXBA 3ERED 1ZYRA 2VUMA 5L46A 4BY1C 4BBRK 3TFJA 2KWAA 3GTJK 3HOXC 4A3KC 3K7AC 1F9NA 4A3DC 2A6HA 3FOFA 3GTLK 3S2DK 1WQHA 5C44C 1Y1WK 3S1QK 1XZQA 3PO2K 3N0CA 3RZOK 1YNNA 5CJ9A 1O28A 1WCMK 4QIWD 4AH6A 3HOWK 5IP9C 3GTMK 2CFAB 2WAQD 1J6XA 4G0VA 2Y3PA 4C3IK 4ILDA 3S1RK 3HOYK 3GTOK 3HOZK 2E2IA 2V6UA 3AH5A 4YFNA 3S1NC 4KM9A 1F7VA 4Y7NK 4LJZA 4A93K 1Y1WC 4KN4A 2R93C 5EGHA 2PMZD 2XCOA 3HKZL 2R7ZK 2RH6A 4A3FC 4A3BC 3Q3QA 2NVYC 5IYDC 1XZPB 3I4MK 4G7HA 3PO2C 4GT9A 1VH2A 5TMFA 2VUMK 3M3YK 1SMYA 1WSRA 4A3JK 3CQZK 3MMLB 1F7UA 1IW7A 4XLPA 2JA6A
chains in the Genus database with same CATH topology
4P5BA 1TWCA 2GSUA 4GTEA 1XXCA 1SFOA 2YU9A 4KDDA 4LQYA 2GSOA 4BLAA 1ZBSA 4LR2A 2NVYA 4C2MC 1WIHA 1ISEA 2XCRB 3VA7A 4DDQA 1Y1VA 3GTPA 3FHZA 4KB2A 1O26A 3FOEA 3GTGA 4KASA 4G0UA 2CFAA 1I50A 3CQZA 4GTCA 2P5MA 1O27A 5IOQA 1DD5A 2E2HA 3OREA 3QX3A 2NVXA 1TWHA 3BUEA 4C3IC 4GTAA 1KQ4A 4G0WA 3GTJA 3S0XA 4KATA 3L4KA 4KAWX 3OEPA 4FZBA 1XXBA 3ERED 2VUMA 4KB4A 4KMAA 1ZVUA 2GSNA 4C3JC 2KWAA 5EGEA 5IOSA 1BJTA 4KMHA 1WCMA 2JH3A 1F9NA 4BLBA 5TJ3A 3FOFA 4BKWA 1WQHA 1B4AA 3CAGA 2JA7A 3NUHA 4GTFA 3N0CA 2XCQA 4GTBA 5CJ9A 3GTQA 1O28A 4GTLA 4C3HC 2ZFZA 3GTOA 1B4BA 5JFEA 3G4CA 1XXAA 1IS1A 2RGRA 2CFAB 1TWGA 1Y1WA 2B63A 4KMDA 4G0VA 2Y3PA 3LAJA 3GTLA 4ILDA 1O2BA 3AQPA 2JA5A 1TWAA 2E2IA 4GFQA 3AH5A 4KM8A 3GTMA 3L4JA 1EH1A 1AB4A 4KM9A 2R7ZA 1GE9A 4J3NA 4KARA 3LAPA 3AQOA 5EGHA 3GTKA 2XCOA 1WQGA 5IORA 2RH6A 1I3QA 1O25A 4FM9A 3H0GA 3Q3QA 4M1XA 4P5AA 1R9TA 2R92A 3N3YA 3N0BA 4GT9A 1O29A 2PHCB 1K83A 3G4AA 1EK8A 1TWFA 1ZXOA 3LPXA 5JVOA 4KC6A 5CHPA 3FKIA 4GTDA 1O24A 1O2AA 3OPFA 3MMLB 1BGWA 1WQFA 3V4GA 2R93A 5IOTA 2JA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTF A;  4P5B A;  3N0C A;  4GTB A;  4GTE A;  1O28 A;  4GTL A;  4GTA A;  5IOR A;  1KQ4 A;  5JFE A;  3G4C A;  1O25 A;  4GTC A;  4KAT A;  2CFA B;  4FZB A;  4P5A A;  3N3Y A;  1O2B A;  3N0B A;  4GT9 A;  1O29 A;  3AH5 A;  5IOS A;  3G4A A;  1O26 A;  5CHP A;  4GTD A;  1O24 A;  4KAS A;  1O2A A;  5IOT A;  2CFA A;  1O27 A;  4KAR A;  5IOQ A; 
#chains in the Genus database with same CATH topology
 4QIW L;  4P5B A;  1TWC A;  5FLM K;  1R9T K;  5C4J K;  3FKI K;  2B63 K;  1F93 A;  4LQY A;  1TWF K;  3WOD A;  4BLA A;  4LR2 A;  1WIH A;  2VUM C;  4DDQ A;  4A3F K;  3FHZ A;  4WJ4 A;  3I4M C;  2NVX K;  1O26 A;  5C44 K;  3FOE A;  3PO3 K;  1I50 A;  4A3D K;  1O27 A;  4GTC A;  4C3H K;  4LK0 A;  1DD5 A;  2E2H A;  1SFO C;  3GEI A;  3HOV C;  1KQ4 A;  4G0W A;  1WOS A;  1VJE A;  3S0X A;  2R92 K;  3GIR A;  4XLN A;  4KAW X;  5C3E C;  3AD7 C;  3S14 C;  2O5I A;  4FZB A;  5M3M K;  1X31 C;  1K83 K;  1YX2 A;  5D4D A;  3S1M K;  4A3E K;  1TWC C;  1ZVU A;  2GSN A;  5EGE A;  1JOE A;  1VRQ C;  4KMH A;  4Q5S A;  4BLB A;  5TJ3 A;  1WSV A;  4KMU A;  3RZD C;  4BKW A;  3BP3 A;  3NUH A;  3PO3 C;  4GTF A;  4GTL A;  1HQM A;  4BBS C;  4OIN A;  5JFE A;  1IS1 A;  3GTJ C;  1TWG A;  2B63 A;  1XPP A;  4A3B K;  3HOX K;  4QJV A;  3LAJ A;  1EFW A;  3GTL A;  3AQP A;  2JA5 A;  4YFX A;  3A8J A;  5FJ8 K;  4A3J C;  1PJ6 A;  4ZH4 A;  1EH1 A;  4BY7 K;  5M5Y K;  4A3K K;  2ZUF A;  1TWG C;  4Y52 C;  1GE9 A;  1TWA K;  3H0G K;  1I50 C;  2Y0S L;  3AQO A;  2WB1 D;  3GTK A;  3S2H C;  2CW0 A;  5IOR A;  1I3Q A;  3RZD K;  1C0A A;  1O25 A;  3AD8 C;  4M1X A;  1Y1V K;  3I4N K;  2R92 A;  2FQT A;  1EQR A;  4X6A C;  1K83 A;  1TWH C;  1ZXO A;  3LPX A;  4WJ3 M;  4A3G K;  5IP7 C;  1J6W A;  4KC6 A;  2E2J C;  4LK1 A;  2JA8 K;  1IBA A;  1O24 A;  3JST A;  3S1R C;  3GTQ K;  3BP8 C;  1I6H C;  2R93 A;  5IOT A;  3T01 A;  1WOR A;  4XSZ A;  5E68 A;  2E2I C;  1Y1V C;  2GSU A;  3I4N C;  4GTE A;  1SFO A;  1K83 C;  4Y7N C;  1I6V A;  4A3C C;  1ZQ1 C;  1HI9 A;  1ZBS A;  4C2M C;  1ISE A;  4X6A K;  2W7V A;  4PAA A;  2XCR B;  1J6V A;  3S17 C;  3GTP A;  1TWC K;  1PJ7 A;  4KB2 A;  2WB1 L;  2JA7 K;  2NVT K;  2V6T A;  2PA8 D;  2Y0S D;  2CFA A;  3CQZ A;  2PPB A;  5IOQ A;  2NVQ C;  3ORE A;  3GDZ A;  1PJ5 A;  1TWH A;  3BUE A;  3GTO C;  3A8I A;  3S16 K;  3GTJ A;  1L0W A;  2O5J A;  4PAB A;  4BBS K;  2B63 C;  4OIQ A;  4C3J C;  2BE5 A;  1I3Q C;  4OIO A;  4RMF A;  1WCM A;  2JH3 A;  3H3V D;  1BS2 A;  3GTG C;  4BXX C;  1IL2 A;  5IYB C;  4GTB A;  2XCQ A;  1RU0 A;  3GTQ A;  3GTO A;  2NVY K;  1B4B A;  3G4C A;  1XXA A;  3H0G C;  1YNJ A;  2RGR A;  3T02 A;  1Y1W A;  3S16 C;  4KMD A;  3CQZ C;  2WAQ L;  4OIR A;  1O2B A;  5IYC C;  2JA8 C;  4KM8 A;  3GTM A;  3S14 K;  3L4J A;  5FLM C;  5M5X K;  4A3M C;  1EI6 A;  4C45 A;  2PA8 L;  2R7Z A;  4YFK A;  1JQW A;  2YU9 K;  3LAP A;  1IQ0 A;  3TFI A;  3GTK C;  3HKZ D;  3IPJ A;  3GTM C;  1WQG A;  1BDF A;  4FM9 A;  5C4J C;  1USM A;  1R9T C;  3ADA C;  4P5A A;  4P9S A;  3N3Y A;  2JA6 C;  1J98 A;  1INN A;  4YG2 A;  5C4X C;  2P8T A;  2PHC B;  3G4A A;  3H3V L;  1EK8 A;  1DCP A;  3GTK K;  5HL8 A;  3GEH A;  3FKI A;  2NVQ K;  1O2A A;  3OPF A;  1BGW A;  3SZZ A;  1WQF A;  2R92 C;  3TFH A;  1WOP A;  1VLO A;  5IYD K;  4A3L C;  1TWA C;  3SZY A;  4A3I C;  1XXC A;  4KDD A;  3EQL A;  5C4X K;  4MQ9 A;  2JA6 K;  1UV7 A;  2NVY A;  4G7O A;  1IE0 A;  1Y1V A;  1USO A;  5IYB K;  3RZO C;  1VGX A;  4LOW A;  4A3E C;  4G0U A;  2ZUE A;  2A68 A;  4C2M K;  2E2J K;  3QX3 A;  3GTP C;  3S15 C;  2NVX A;  1V5V A;  1WCM C;  4WIL A;  5IP9 K;  3OEP A;  3S1Q C;  2E2I K;  4KB4 A;  3DXJ A;  4KMA A;  5IOS A;  1YCL A;  1BJT A;  4QJV B;  3S2H K;  4JK1 A;  1XZP A;  1B4A A;  2JA7 C;  3A8K A;  3CAG A;  3GSI A;  2JA7 A;  1TWG K;  3S1N K;  4Y52 K;  4AYB L;  4BY7 C;  4C3H C;  2ZFZ A;  3HXA A;  4NOI A;  3AD9 C;  1TWH K;  3K7A K;  4A3G C;  2A69 A;  3TTG A;  4O2D A;  3HOV K;  4OIP A;  1TWA A;  4MEY A;  4GFQ A;  3GTG K;  3HOU C;  1AB4 A;  2PMZ L;  4Q4Z A;  3M4O K;  1I3Q K;  3M3Y C;  3FKI C;  4A3L K;  4J3N A;  2A6E A;  4KAR A;  4A3C K;  2GAH C;  2FQO A;  2EBB A;  5IYC K;  3S17 K;  3H0G A;  1R9T A;  5TMC A;  3N0B A;  2R93 K;  1O29 A;  2E2H C;  2YU9 C;  2NVT C;  4A93 C;  1TWF A;  5JVO A;  1XZQ B;  5M3F K;  1SFO K;  4AYB D;  5CHP A;  3GEE A;  4GTD A;  2R7Z C;  3HOY C;  4A3M K;  3HOZ C;  3V4G A;  1DCH A;  5M5W K;  3S15 K;  3M4O C;  1G51 A;  2V6S A;  1DCO A;  2NVX C;  2YU9 A;  3GTP K;  1I50 K;  1JVI A;  2GSO A;  4BY1 K;  5IP7 K;  2E2H K;  4GZY A;  2JA5 C;  2D6F C;  3GTL C;  3VA7 A;  3S2D C;  3GTQ C;  1I6H K;  3S1M C;  5C3E K;  4BXX K;  4BBR C;  1O2F B;  3GTG A;  4KAS A;  4LLG A;  4A3I K;  2P5M A;  4C3J K;  3HOW C;  4KN7 A;  3T00 A;  1TWF C;  4XCH A;  4C3I C;  4GTA A;  4G7Z A;  4MEX A;  1WOO A;  4KAT A;  3L4K A;  2JA5 K;  3HOU K;  2GAG C;  4XSX A;  1XXB A;  3ERE D;  1ZYR A;  2VUM A;  5L46 A;  4BY1 C;  4BBR K;  3TFJ A;  2KWA A;  3GTJ K;  3HOX C;  4A3K C;  3K7A C;  1F9N A;  4A3D C;  2A6H A;  3FOF A;  3GTL K;  3S2D K;  1WQH A;  5C44 C;  1Y1W K;  3S1Q K;  1XZQ A;  3PO2 K;  3N0C A;  3RZO K;  1YNN A;  5CJ9 A;  1O28 A;  1WCM K;  4QIW D;  4AH6 A;  3HOW K;  5IP9 C;  3GTM K;  2CFA B;  2WAQ D;  1J6X A;  4G0V A;  2Y3P A;  4C3I K;  4ILD A;  3S1R K;  3HOY K;  3GTO K;  3HOZ K;  2E2I A;  2V6U A;  3AH5 A;  4YFN A;  3S1N C;  4KM9 A;  1F7V A;  4Y7N K;  4LJZ A;  4A93 K;  1Y1W C;  4KN4 A;  2R93 C;  5EGH A;  2PMZ D;  2XCO A;  3HKZ L;  2R7Z K;  2RH6 A;  4A3F C;  4A3B C;  3Q3Q A;  2NVY C;  5IYD C;  1XZP B;  3I4M K;  4G7H A;  3PO2 C;  4GT9 A;  1VH2 A;  5TMF A;  2VUM K;  3M3Y K;  1SMY A;  1WSR A;  4A3J K;  3CQZ K;  3MML B;  1F7U A;  1IW7 A;  4XLP A;  2JA6 A; 
#chains in the Genus database with same CATH homology
 4P5B A;  1TWC A;  2GSU A;  4GTE A;  1XXC A;  1SFO A;  2YU9 A;  4KDD A;  4LQY A;  2GSO A;  4BLA A;  1ZBS A;  4LR2 A;  2NVY A;  4C2M C;  1WIH A;  1ISE A;  2XCR B;  3VA7 A;  4DDQ A;  1Y1V A;  3GTP A;  3FHZ A;  4KB2 A;  1O26 A;  3FOE A;  3GTG A;  4KAS A;  4G0U A;  2CFA A;  1I50 A;  3CQZ A;  4GTC A;  2P5M A;  1O27 A;  5IOQ A;  1DD5 A;  2E2H A;  3ORE A;  3QX3 A;  2NVX A;  1TWH A;  3BUE A;  4C3I C;  4GTA A;  1KQ4 A;  4G0W A;  3GTJ A;  3S0X A;  4KAT A;  3L4K A;  4KAW X;  3OEP A;  4FZB A;  1XXB A;  3ERE D;  2VUM A;  4KB4 A;  4KMA A;  1ZVU A;  2GSN A;  4C3J C;  2KWA A;  5EGE A;  5IOS A;  1BJT A;  4KMH A;  1WCM A;  2JH3 A;  1F9N A;  4BLB A;  5TJ3 A;  3FOF A;  4BKW A;  1WQH A;  1B4A A;  3CAG A;  2JA7 A;  3NUH A;  4GTF A;  3N0C A;  2XCQ A;  4GTB A;  5CJ9 A;  3GTQ A;  1O28 A;  4GTL A;  4C3H C;  2ZFZ A;  3GTO A;  1B4B A;  5JFE A;  3G4C A;  1XXA A;  1IS1 A;  2RGR A;  2CFA B;  1TWG A;  1Y1W A;  2B63 A;  4KMD A;  4G0V A;  2Y3P A;  3LAJ A;  3GTL A;  4ILD A;  1O2B A;  3AQP A;  2JA5 A;  1TWA A;  2E2I A;  4GFQ A;  3AH5 A;  4KM8 A;  3GTM A;  3L4J A;  1EH1 A;  1AB4 A;  4KM9 A;  2R7Z A;  1GE9 A;  4J3N A;  4KAR A;  3LAP A;  3AQO A;  5EGH A;  3GTK A;  2XCO A;  1WQG A;  5IOR A;  2RH6 A;  1I3Q A;  1O25 A;  4FM9 A;  3H0G A;  3Q3Q A;  4M1X A;  4P5A A;  1R9T A;  2R92 A;  3N3Y A;  3N0B A;  4GT9 A;  1O29 A;  2PHC B;  1K83 A;  3G4A A;  1EK8 A;  1TWF A;  1ZXO A;  3LPX A;  5JVO A;  4KC6 A;  5CHP A;  3FKI A;  4GTD A;  1O24 A;  1O2A A;  3OPF A;  3MML B;  1BGW A;  1WQF A;  3V4G A;  2R93 A;  5IOT A;  2JA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...