3AH5A

Crystal structure of flavin dependent thymidylate synthase thyx from helicobacter pylori complexed with fad and dump
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
215
structure length
215
Chain Sequence
b'MEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAKEFLVFVDNEKVNAMSVLALENLRILLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNFLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKHLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Crystal structure and functional analysis of a flavin dependent thymidylate synthase from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 75
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ah5A00
5CHPA 5IORA 4GTFA 4GTDA 5IOTA 4KASA 3N0BA 1KQ4A 4FZBA 1O28A 5JFEA 4GTEA 4GTCA 3G4AA 4P5BA 3AH5A 5IOQA 2CFAA 4KARA 1O2BA 1O2AA 2CFAB 4GT9A 1O26A 4P5AA 1O25A 4GTLA 4GTAA 1O27A 3G4CA 3N0CA 4KATA 1O24A 4GTBA 1O29A 3N3YA 5IOSA
chains in the Genus database with same CATH superfamily
1K83K 1TWGA 1L0WA 4KMDA 4A3KC 4A3CC 1R9TA 4BLAA 5CJ9A 1DCPA 3OPFA 4A3EK 5C44K 2R7ZC 1Y1WC 2CFAA 1BS2A 2A6EA 3SZYA 2VUMA 3S1MK 4LR2A 3K7AK 4ILDA 4KB4A 4ZH4A 4OIRA 2V6SA 3GTPC 2JH3A 1YX2A 1R9TC 3N0BA 1VH2A 4MQ9A 3PO2K 3S16K 1O28A 1X31C 2BE5A 1DCOA 4P5BA 2VUMC 1O2AA 3RZDK 1RU0A 4KM9A 4KMAA 3VA7A 4BLBA 3FOEA 3MMLB 1XZQB 2E2JK 2ZUEA 4KATA 4A3IK 3GTKC 5CHPA 1I6HK 4BY1K 3AD7C 2RGRA 1KQ4A 1EQRA 2JA7K 3HOYC 3ADAC 4A3GK 3HKZL 3AQPA 3GTGK 5IP7K 4BBSC 1G51A 4XCHA 1WCMK 2XCQA 1PJ6A 2Y0SD 3HOXC 2JA6K 1WOPA 3I4NC 2R92C 3HXAA 3GIRA 4KN7A 3PO3K 3S1NC 1O2FB 5IOSA 4BBRK 5IOTA 1XPPA 3GTLK 5L46A 4KC6A 1C0AA 5C3EK 4JK1A 5HL8A 1I50K 2E2HK 2PHCB 3BP3A 3CAGA 3AH5A 4XSZA 4G0WA 2R93A 1WQHA 5IYCK 3S1RC 1VRQC 3GTMK 2ZUFA 1I50A 2B63A 4C3HK 2JA5A 1IS1A 4GZYA 1SFOK 3GTOK 4X6AK 1XXCA 1WORA 1TWCK 3LAPA 3S17C 3HOUK 3FKIK 3T00A 2NVYC 1B4AA 3M4OK 5IYBC 5FLMK 1SFOA 3WODA 3GEEA 2JA8C 1USMA 1TWFK 3CQZK 3FKIA 4C45A 2NVXK 5M3FK 3FHZA 3HOVK 3GTQK 1EFWA 3H0GK 1J6WA 4KB2A 4BXXC 4G7OA 3H3VL 2R93C 1TWFA 2NVXA 3S14K 4A3LK 2GAGC 2XCOA 5TJ3A 2B63C 3H0GA 4LK1A 2JA5C 3S1QC 4A3CK 2WB1L 3OEPA 1VJEA 2FQOA 5C4JC 4A3FK 1WOOA 1I3QK 3TTGA 4A3DC 2PPBA 1Y1WK 1J98A 2V6UA 2FQTA 4XSXA 3GEHA 1IBAA 3GTJK 1K83A 4YFXA 1WSRA 3A8IA 3DXJA 4QIWD 4G0VA 4Y7NK 3L4JA 1F93A 4A3MC 1JOEA 2E2IC 4G0UA 4C3JK 3SZZA 1TWGC 1F7VA 5IYDC 1PJ7A 3I4MK 3HOWC 4C2MC 4AYBD 1K83C 1EI6A 3NUHA 4G7ZA 4GTCA 4A3JK 4OINA 3AD8C 3FOFA 4KARA 2NVQK 4YG2A 1XZPA 4YFKA 2PMZL 3S2HK 2P8TA 2ZFZA 4A3EC 5C44C 2Y3PA 1O27A 5FJ8K 3S1MC 1ZYRA 3K7AC 3ERED 1IL2A 4RMFA 1BDFA 5C4XK 4Q5SA 5M5XK 1UV7A 3M3YK 4BY7K 3PO2C 3S16C 2CFAB 3RZOK 2JA7A 4KMHA 1J6XA 1J6VA 1TWHK 3S2DK 4GTLA 4QJVA 2NVTK 2GSNA 3GTGA 3G4CA 1WCMA 1USOA 3GEIA 5IORA 4LQYA 3RZDC 3S15K 4Q4ZA 2JA6A 2E2JC 4A3IC 3HOWK 1I6HC 2PA8L 2P5MA 4BY1C 4Y52K 3V4GA 3GTLA 2JA7C 1B4BA 1O2BA 4A3GC 3A8JA 1O25A 4KAWX 1DD5A 4BKWA 2E2HA 3GTGC 4A3BK 4LK0A 2W7VA 3HKZD 5IP7C 4MEYA 4GFQA 1WCMC 3N3YA 3GTMA 4C3IK 2JA6C 4KASA 1Y1VK 3GTOA 1TWCA 4KN4A 3PO3C 4BBRC 5IP9K 5JFEA 3HOZK 4A93K 3GTLC 2A6HA 3A8KA 4KMUA 2KWAA 2YU9K 5C3EC 3CQZA 1TWAK 2CW0A 3GTQA 1I50C 3GDZA 2E2HC 4A3KK 2PA8D 5M3MK 3OREA 1I6VA 5IYCC 1VGXA 4GTDA 2R7ZK 4C3HC 1SFOC 3GTOC 4X6AC 1TWCC 3HOUC 3FKIC 4KDDA 4XLNA 1I3QA 3M4OC 4GTEA 1ISEA 5TMCA 5FLMC 4O2DA 1XXBA 4DDQA 1Y1WA 1DCHA 1WQGA 1TWFC 3CQZC 3LAJA 2NVXC 3HOVC 3GTQC 1ZQ1C 3H0GC 1XZQA 3GTPK 4MEXA 3GTJA 1SMYA 1JVIA 4GTAA 1R9TK 1ZVUA 2EBBA 1YNNA 1YCLA 4A3LC 4FM9A 3H3VD 4LOWA 1BJTA 1IE0A 3TFIA 3GTPA 1F9NA 2VUMK 5E68A 4A3FC 2WB1D 1I3QC 3T02A 5D4DA 3S0XA 3L4KA 1AB4A 5TMFA 3GTKK 4KM8A 1V5VA 3GTJC 1YNJA 4WJ3M 4G7HA 1IW7A 1PJ5A 3HOYK 1JQWA 3GTKA 1XXAA 3LPXA 4Y7NC 4LLGA 1WOSA 1F7UA 4YFNA 4BBSK 2Y0SL 1VLOA 4FZBA 4C3JC 5M5YK 2GAHC 3HOXK 2A68A 3I4NK 5IOQA 2R92K 4M1XA 3QX3A 1ZXOA 3S1NK 3I4MC 1O26A 5EGEA 2GSUA 4A3JC 2XCRB 2R92A 4OIPA 5EGHA 2NVQC 4GTBA 1O29A 5JVOA 1INNA 3S2HC 4GTFA 5M5WK 3AD9C 2PMZD 1TWHA 3BUEA 3TFJA 3Q3QA 3S1RK 1GE9A 4NOIA 3EQLA 4OIOA 3S17K 2NVYK 5C4XC 4GT9A 2O5JA 1XZPB 5IYBK 3M3YC 3JSTA 4PAAA 2JA8K 4BY7C 4LJZA 2NVYA 3RZOC 1WIHA 4WILA 1TWHC 3S2DC 4BXXK 3T01A 3IPJA 2NVTC 2R93K 2GSOA 4WJ4A 1WQFA 4AH6A 2B63K 2JA5K 3S1QK 3G4AA 2WAQL 3S15C 4OIQA 4PABA 1Y1VA 5C4JK 4A3DK 3TFHA 4Y52C 4XLPA 1EK8A 3BP8C 3N0CA 2O5IA 4QJVB 2YU9A 2RH6A 2D6FC 1TWAA 4QIWL 3GTMC 4P9SA 4A3BC 1HQMA 1ZBSA 3GSIA 1EH1A 1HI9A 2V6TA 4C3IC 3AQOA 2R7ZA 1Y1VC 4A3MK 2E2IK 4P5AA 1TWGK 5IP9C 3HOZC 4J3NA 4A93C 1BGWA 2A69A 4AYBL 2WAQD 1IQ0A 2YU9C 2E2IA 1O24A 5IYDK 1WSVA 1TWAC 4C2MK 3S14C
chains in the Genus database with same CATH topology
5IORA 4LQYA 1TWGA 3LPXA 4KMDA 1SFOA 2JA6A 3FKIA 1R9TA 4BLAA 5CJ9A 3OPFA 4FZBA 4C3JC 3FHZA 2P5MA 4KB2A 3V4GA 5IOQA 3GTLA 2CFAA 4M1XA 1TWFA 3QX3A 1B4BA 1ZXOA 1O2BA 2NVXA 2VUMA 2XCOA 1O26A 5EGEA 5TJ3A 1O25A 3H0GA 4LR2A 2GSUA 4ILDA 4KAWX 2XCRB 1DD5A 4KB4A 4BKWA 2E2HA 3OEPA 2R92A 5EGHA 4GFQA 4GTBA 1O29A 3N3YA 5JVOA 4GTFA 2JH3A 3GTMA 1TWHA 4KASA 3BUEA 3N0BA 3GTOA 3Q3QA 1TWCA 1XXAA 1O28A 1GE9A 5JFEA 1K83A 4P5BA 2KWAA 3CQZA 1O2AA 4GT9A 4KM9A 4KMAA 4G0VA 3VA7A 3GTQA 4BLBA 3FOEA 3MMLB 3L4JA 3OREA 4KATA 2NVYA 4G0UA 1WIHA 5CHPA 4GTDA 4C3HC 2RGRA 2GSOA 1KQ4A 4KDDA 1WQFA 4C2MC 1I3QA 4GTEA 3NUHA 4GTCA 3AQPA 1ISEA 3G4AA 3FOFA 1XXBA 4DDQA 4KARA 1Y1WA 1WQGA 1Y1VA 3LAJA 2XCQA 2ZFZA 2Y3PA 3GTJA 4GTAA 1ZVUA 1EK8A 1O27A 3N0CA 4FM9A 2YU9A 5IOSA 1BJTA 2RH6A 5IOTA 1TWAA 3GTPA 3ERED 1F9NA 4KC6A 1ZBSA 1EH1A 1B4AA 3S0XA 4C3IC 2PHCB 3AQOA 3CAGA 3AH5A 3L4KA 2R7ZA 1AB4A 4G0WA 2R93A 1WQHA 2CFAB 2JA7A 4KMHA 4P5AA 4KM8A 1I50A 2B63A 4J3NA 2JA5A 1IS1A 1BGWA 1XXCA 4GTLA 3LAPA 2GSNA 3GTGA 3G4CA 2E2IA 1O24A 3GTKA 1WCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHP A;  5IOR A;  4GTF A;  4GTD A;  5IOT A;  4KAS A;  3N0B A;  1KQ4 A;  4FZB A;  1O28 A;  5JFE A;  4GTE A;  4GTC A;  3G4A A;  4P5B A;  3AH5 A;  5IOQ A;  2CFA A;  4KAR A;  1O2B A;  1O2A A;  2CFA B;  4GT9 A;  1O26 A;  4P5A A;  1O25 A;  4GTL A;  4GTA A;  1O27 A;  3G4C A;  3N0C A;  4KAT A;  1O24 A;  4GTB A;  1O29 A;  3N3Y A;  5IOS A; 
#chains in the Genus database with same CATH topology
 1K83 K;  1TWG A;  1L0W A;  4KMD A;  4A3K C;  4A3C C;  1R9T A;  4BLA A;  5CJ9 A;  1DCP A;  3OPF A;  4A3E K;  5C44 K;  2R7Z C;  1Y1W C;  2CFA A;  1BS2 A;  2A6E A;  3SZY A;  2VUM A;  3S1M K;  4LR2 A;  3K7A K;  4ILD A;  4KB4 A;  4ZH4 A;  4OIR A;  2V6S A;  3GTP C;  2JH3 A;  1YX2 A;  1R9T C;  3N0B A;  1VH2 A;  4MQ9 A;  3PO2 K;  3S16 K;  1O28 A;  1X31 C;  2BE5 A;  1DCO A;  4P5B A;  2VUM C;  1O2A A;  3RZD K;  1RU0 A;  4KM9 A;  4KMA A;  3VA7 A;  4BLB A;  3FOE A;  3MML B;  1XZQ B;  2E2J K;  2ZUE A;  4KAT A;  4A3I K;  3GTK C;  5CHP A;  1I6H K;  4BY1 K;  3AD7 C;  2RGR A;  1KQ4 A;  1EQR A;  2JA7 K;  3HOY C;  3ADA C;  4A3G K;  3HKZ L;  3AQP A;  3GTG K;  5IP7 K;  4BBS C;  1G51 A;  4XCH A;  1WCM K;  2XCQ A;  1PJ6 A;  2Y0S D;  3HOX C;  2JA6 K;  1WOP A;  3I4N C;  2R92 C;  3HXA A;  3GIR A;  4KN7 A;  3PO3 K;  3S1N C;  1O2F B;  5IOS A;  4BBR K;  5IOT A;  1XPP A;  3GTL K;  5L46 A;  4KC6 A;  1C0A A;  5C3E K;  4JK1 A;  5HL8 A;  1I50 K;  2E2H K;  2PHC B;  3BP3 A;  3CAG A;  3AH5 A;  4XSZ A;  4G0W A;  2R93 A;  1WQH A;  5IYC K;  3S1R C;  1VRQ C;  3GTM K;  2ZUF A;  1I50 A;  2B63 A;  4C3H K;  2JA5 A;  1IS1 A;  4GZY A;  1SFO K;  3GTO K;  4X6A K;  1XXC A;  1WOR A;  1TWC K;  3LAP A;  3S17 C;  3HOU K;  3FKI K;  3T00 A;  2NVY C;  1B4A A;  3M4O K;  5IYB C;  5FLM K;  1SFO A;  3WOD A;  3GEE A;  2JA8 C;  1USM A;  1TWF K;  3CQZ K;  3FKI A;  4C45 A;  2NVX K;  5M3F K;  3FHZ A;  3HOV K;  3GTQ K;  1EFW A;  3H0G K;  1J6W A;  4KB2 A;  4BXX C;  4G7O A;  3H3V L;  2R93 C;  1TWF A;  2NVX A;  3S14 K;  4A3L K;  2GAG C;  2XCO A;  5TJ3 A;  2B63 C;  3H0G A;  4LK1 A;  2JA5 C;  3S1Q C;  4A3C K;  2WB1 L;  3OEP A;  1VJE A;  2FQO A;  5C4J C;  4A3F K;  1WOO A;  1I3Q K;  3TTG A;  4A3D C;  2PPB A;  1Y1W K;  1J98 A;  2V6U A;  2FQT A;  4XSX A;  3GEH A;  1IBA A;  3GTJ K;  1K83 A;  4YFX A;  1WSR A;  3A8I A;  3DXJ A;  4QIW D;  4G0V A;  4Y7N K;  3L4J A;  1F93 A;  4A3M C;  1JOE A;  2E2I C;  4G0U A;  4C3J K;  3SZZ A;  1TWG C;  1F7V A;  5IYD C;  1PJ7 A;  3I4M K;  3HOW C;  4C2M C;  4AYB D;  1K83 C;  1EI6 A;  3NUH A;  4G7Z A;  4GTC A;  4A3J K;  4OIN A;  3AD8 C;  3FOF A;  4KAR A;  2NVQ K;  4YG2 A;  1XZP A;  4YFK A;  2PMZ L;  3S2H K;  2P8T A;  2ZFZ A;  4A3E C;  5C44 C;  2Y3P A;  1O27 A;  5FJ8 K;  3S1M C;  1ZYR A;  3K7A C;  3ERE D;  1IL2 A;  4RMF A;  1BDF A;  5C4X K;  4Q5S A;  5M5X K;  1UV7 A;  3M3Y K;  4BY7 K;  3PO2 C;  3S16 C;  2CFA B;  3RZO K;  2JA7 A;  4KMH A;  1J6X A;  1J6V A;  1TWH K;  3S2D K;  4GTL A;  4QJV A;  2NVT K;  2GSN A;  3GTG A;  3G4C A;  1WCM A;  1USO A;  3GEI A;  5IOR A;  4LQY A;  3RZD C;  3S15 K;  4Q4Z A;  2JA6 A;  2E2J C;  4A3I C;  3HOW K;  1I6H C;  2PA8 L;  2P5M A;  4BY1 C;  4Y52 K;  3V4G A;  3GTL A;  2JA7 C;  1B4B A;  1O2B A;  4A3G C;  3A8J A;  1O25 A;  4KAW X;  1DD5 A;  4BKW A;  2E2H A;  3GTG C;  4A3B K;  4LK0 A;  2W7V A;  3HKZ D;  5IP7 C;  4MEY A;  4GFQ A;  1WCM C;  3N3Y A;  3GTM A;  4C3I K;  2JA6 C;  4KAS A;  1Y1V K;  3GTO A;  1TWC A;  4KN4 A;  3PO3 C;  4BBR C;  5IP9 K;  5JFE A;  3HOZ K;  4A93 K;  3GTL C;  2A6H A;  3A8K A;  4KMU A;  2KWA A;  2YU9 K;  5C3E C;  3CQZ A;  1TWA K;  2CW0 A;  3GTQ A;  1I50 C;  3GDZ A;  2E2H C;  4A3K K;  2PA8 D;  5M3M K;  3ORE A;  1I6V A;  5IYC C;  1VGX A;  4GTD A;  2R7Z K;  4C3H C;  1SFO C;  3GTO C;  4X6A C;  1TWC C;  3HOU C;  3FKI C;  4KDD A;  4XLN A;  1I3Q A;  3M4O C;  4GTE A;  1ISE A;  5TMC A;  5FLM C;  4O2D A;  1XXB A;  4DDQ A;  1Y1W A;  1DCH A;  1WQG A;  1TWF C;  3CQZ C;  3LAJ A;  2NVX C;  3HOV C;  3GTQ C;  1ZQ1 C;  3H0G C;  1XZQ A;  3GTP K;  4MEX A;  3GTJ A;  1SMY A;  1JVI A;  4GTA A;  1R9T K;  1ZVU A;  2EBB A;  1YNN A;  1YCL A;  4A3L C;  4FM9 A;  3H3V D;  4LOW A;  1BJT A;  1IE0 A;  3TFI A;  3GTP A;  1F9N A;  2VUM K;  5E68 A;  4A3F C;  2WB1 D;  1I3Q C;  3T02 A;  5D4D A;  3S0X A;  3L4K A;  1AB4 A;  5TMF A;  3GTK K;  4KM8 A;  1V5V A;  3GTJ C;  1YNJ A;  4WJ3 M;  4G7H A;  1IW7 A;  1PJ5 A;  3HOY K;  1JQW A;  3GTK A;  1XXA A;  3LPX A;  4Y7N C;  4LLG A;  1WOS A;  1F7U A;  4YFN A;  4BBS K;  2Y0S L;  1VLO A;  4FZB A;  4C3J C;  5M5Y K;  2GAH C;  3HOX K;  2A68 A;  3I4N K;  5IOQ A;  2R92 K;  4M1X A;  3QX3 A;  1ZXO A;  3S1N K;  3I4M C;  1O26 A;  5EGE A;  2GSU A;  4A3J C;  2XCR B;  2R92 A;  4OIP A;  5EGH A;  2NVQ C;  4GTB A;  1O29 A;  5JVO A;  1INN A;  3S2H C;  4GTF A;  5M5W K;  3AD9 C;  2PMZ D;  1TWH A;  3BUE A;  3TFJ A;  3Q3Q A;  3S1R K;  1GE9 A;  4NOI A;  3EQL A;  4OIO A;  3S17 K;  2NVY K;  5C4X C;  4GT9 A;  2O5J A;  1XZP B;  5IYB K;  3M3Y C;  3JST A;  4PAA A;  2JA8 K;  4BY7 C;  4LJZ A;  2NVY A;  3RZO C;  1WIH A;  4WIL A;  1TWH C;  3S2D C;  4BXX K;  3T01 A;  3IPJ A;  2NVT C;  2R93 K;  2GSO A;  4WJ4 A;  1WQF A;  4AH6 A;  2B63 K;  2JA5 K;  3S1Q K;  3G4A A;  2WAQ L;  3S15 C;  4OIQ A;  4PAB A;  1Y1V A;  5C4J K;  4A3D K;  3TFH A;  4Y52 C;  4XLP A;  1EK8 A;  3BP8 C;  3N0C A;  2O5I A;  4QJV B;  2YU9 A;  2RH6 A;  2D6F C;  1TWA A;  4QIW L;  3GTM C;  4P9S A;  4A3B C;  1HQM A;  1ZBS A;  3GSI A;  1EH1 A;  1HI9 A;  2V6T A;  4C3I C;  3AQO A;  2R7Z A;  1Y1V C;  4A3M K;  2E2I K;  4P5A A;  1TWG K;  5IP9 C;  3HOZ C;  4J3N A;  4A93 C;  1BGW A;  2A69 A;  4AYB L;  2WAQ D;  1IQ0 A;  2YU9 C;  2E2I A;  1O24 A;  5IYD K;  1WSV A;  1TWA C;  4C2M K;  3S14 C; 
#chains in the Genus database with same CATH homology
 5IOR A;  4LQY A;  1TWG A;  3LPX A;  4KMD A;  1SFO A;  2JA6 A;  3FKI A;  1R9T A;  4BLA A;  5CJ9 A;  3OPF A;  4FZB A;  4C3J C;  3FHZ A;  2P5M A;  4KB2 A;  3V4G A;  5IOQ A;  3GTL A;  2CFA A;  4M1X A;  1TWF A;  3QX3 A;  1B4B A;  1ZXO A;  1O2B A;  2NVX A;  2VUM A;  2XCO A;  1O26 A;  5EGE A;  5TJ3 A;  1O25 A;  3H0G A;  4LR2 A;  2GSU A;  4ILD A;  4KAW X;  2XCR B;  1DD5 A;  4KB4 A;  4BKW A;  2E2H A;  3OEP A;  2R92 A;  5EGH A;  4GFQ A;  4GTB A;  1O29 A;  3N3Y A;  5JVO A;  4GTF A;  2JH3 A;  3GTM A;  1TWH A;  4KAS A;  3BUE A;  3N0B A;  3GTO A;  3Q3Q A;  1TWC A;  1XXA A;  1O28 A;  1GE9 A;  5JFE A;  1K83 A;  4P5B A;  2KWA A;  3CQZ A;  1O2A A;  4GT9 A;  4KM9 A;  4KMA A;  4G0V A;  3VA7 A;  3GTQ A;  4BLB A;  3FOE A;  3MML B;  3L4J A;  3ORE A;  4KAT A;  2NVY A;  4G0U A;  1WIH A;  5CHP A;  4GTD A;  4C3H C;  2RGR A;  2GSO A;  1KQ4 A;  4KDD A;  1WQF A;  4C2M C;  1I3Q A;  4GTE A;  3NUH A;  4GTC A;  3AQP A;  1ISE A;  3G4A A;  3FOF A;  1XXB A;  4DDQ A;  4KAR A;  1Y1W A;  1WQG A;  1Y1V A;  3LAJ A;  2XCQ A;  2ZFZ A;  2Y3P A;  3GTJ A;  4GTA A;  1ZVU A;  1EK8 A;  1O27 A;  3N0C A;  4FM9 A;  2YU9 A;  5IOS A;  1BJT A;  2RH6 A;  5IOT A;  1TWA A;  3GTP A;  3ERE D;  1F9N A;  4KC6 A;  1ZBS A;  1EH1 A;  1B4A A;  3S0X A;  4C3I C;  2PHC B;  3AQO A;  3CAG A;  3AH5 A;  3L4K A;  2R7Z A;  1AB4 A;  4G0W A;  2R93 A;  1WQH A;  2CFA B;  2JA7 A;  4KMH A;  4P5A A;  4KM8 A;  1I50 A;  2B63 A;  4J3N A;  2JA5 A;  1IS1 A;  1BGW A;  1XXC A;  4GTL A;  3LAP A;  2GSN A;  3GTG A;  3G4C A;  2E2I A;  1O24 A;  3GTK A;  1WCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...