3AH5A

Crystal structure of flavin dependent thymidylate synthase thyx from helicobacter pylori complexed with fad and dump
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
215
structure length
215
Chain Sequence
MEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAKEFLVFVDNEKVNAMSVLALENLRILLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNFLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKHLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Crystal structure and functional analysis of a flavin dependent thymidylate synthase from helicobacter pylori
rcsb
source organism Helicobacter pylori
total genus 75
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ah5A00
4GTCA 3N0BA 1O27A 1O25A 4GTAA 4GTLA 5IOQA 3G4AA 3G4CA 5IOTA 1O29A 1O28A 1O24A 1O2AA 4FZBA 4GTFA 1O2BA 4GT9A 4GTEA 4KARA 3AH5A 4P5BA 5JFEA 4GTDA 3N3YA 2CFAA 4KASA 5IOSA 1KQ4A 4P5AA 2CFAB 3N0CA 5IORA 4GTBA 4KATA 1O26A 5CHPA
chains in the Genus database with same CATH superfamily
1WQHA 1IE0A 2WAQL 4A3KK 3GTQC 4BXXC 4O2DA 1B4BA 1ZXOA 1TWAK 1R9TK 3BP8C 3S2HK 2E2IA 1O24A 3I4NC 2GAGC 4NOIA 4MEXA 3HOYK 2EBBA 3AH5A 1VJEA 5M3FK 3GTQK 3M4OK 1VH2A 1SFOC 3N3YA 4BXXK 2JA7A 4OIPA 4RMFA 1SMYA 3FKIA 3GEHA 2V6TA 1TWGA 3GIRA 4C3JC 1ZYRA 1EH1A 3I4NK 5E68A 3TFHA 2V6SA 3GTOK 2ZUFA 4MQ9A 1I3QA 1TWHA 1SFOK 4KC6A 4KM8A 3K7AC 3S17C 4A3BC 1YX2A 3M3YC 4C45A 1WOSA 4OIOA 4C3JK 3GTJA 4P5BA 1L0WA 3GTGC 4LJZA 2JA8C 4MEYA 2ZFZA 4KMDA 2R92A 5C3EK 3AD7C 1G51A 1YNJA 4KATA 3K7AK 4A3BK 4G7ZA 3S1RC 2R7ZC 1XXBA 3H0GA 1I6VA 2VUMA 3GTGK 2PA8L 2JA8K 2O5IA 1TWCC 2NVQC 1TWFA 2NVTK 3GTPA 1WQFA 4OINA 3I4MK 4QJVA 4GZYA 3S1RK 4BY1C 2R7ZK 3GTMA 2NVXC 4XLNA 2GSNA 3GTKA 2CFAB 3HXAA 3CQZC 4BBSC 2JH3A 1O26A 3GEIA 1EI6A 4G0WA 1TWCK 2NVQK 4LK0A 3N0BA 2E2IC 3HOUC 3GTLA 3TFJA 1I50A 4BY1K 1ZQ1C 2NVXK 1EFWA 1HI9A 2NVYA 1XXCA 3ADAC 4BKWA 2A6EA 3CQZK 4BBSK 4KMAA 2XCOA 2JA7C 5JFEA 3FKIC 4A3DC 2Y0SL 2E2IK 3HOUK 4Q5SA 5IORA 1F93A 3HOVC 4A3CC 1I3QC 2D6FC 1PJ7A 1TWHC 4YFNA 4FM9A 4G0UA 2JA7K 1DD5A 3FKIK 1TWGK 4A3DK 3AQPA 3SZYA 3GTJC 3RZOC 4A3KC 3CAGA 4AH6A 3HOVK 4LQYA 4A3CK 1I3QK 3HOXK 1K83A 4KASA 4ZH4A 1BJTA 3S2HC 1TWHK 4KDDA 2V6UA 4WJ4A 5FLMC 4BY7C 5IP9C 3T00A 1I6HC 4JK1A 4G7HA 3H0GC 2VUMC 1EK8A 3GTJK 3RZOK 3M4OC 1WOPA 1XZQA 1XXAA 1XZPB 2R92K 1HQMA 2PA8D 5IOTA 1TWFC 3GTPC 1O2FB 5FLMK 4BY7K 5IP9K 2FQOA 3GTOC 5IYDC 3GTMC 1I6HK 3H0GK 2VUMK 3GTKC 5M5XK 2CFAA 3LPXA 1PJ5A 4ILDA 4A3LC 3S1QC 4GTBA 1TWFK 3GTPK 3V4GA 5IP7C 5C4XC 3GTLC 5TMFA 1I50C 2P8TA 2PPBA 3GTMK 3S14C 5IYDK 2NVYC 5C3EC 3GTKK 4WJ3M 4Q4ZA 2RGRA 3LAJA 2E2HA 4A3LK 3OPFA 3MMLB 3S1QK 3H3VL 3BUEA 3A8JA 4A3GC 3S0XA 2JA6A 5IP7K 5C4XK 3GTLK 2GSOA 5IOSA 1PJ6A 1I50K 3S2DC 3S15C 1VGXA 2Y0SD 3S14K 2BE5A 2NVYK 2YU9A 1EQRA 4DDQA 1Y1VA 2NVTC 1INNA 3I4MC 1Y1WA 4KB2A 4A3GK 1WOOA 4LR2A 4A3EC 1IL2A 3A8IA 3S2DK 3S15K 4WILA 3OEPA 3GDZA 2B63A 1K83C 5TJ3A 3HKZL 3PO2C 2FQTA 1WIHA 5D4DA 1TWAA 4KM9A 3S1MC 4A3EK 5M5WK 3PO3C 5CHPA 4X6AK 1B4AA 1XZPA 1YNNA 1K83K 1O27A 4KMUA 3PO2K 4C3IC 3FOFA 1O29A 4FZBA 1GE9A 4XSXA 3S1MK 1XPPA 4A93K 4GTEA 3PO3K 3S16C 3HOWC 3ERED 1KQ4A 1AB4A 1TWGC 4C3IK 1BGWA 3BP3A 1J6XA 3HOXC 1DCOA 4J3NA 2E2HC 4GTAA 1JQWA 3LAPA 3S16K 3HOWK 2W7VA 4YFXA 2JA6C 3H3VD 5IYBC 3VA7A 4KB4A 1DCHA 3Q3QA 1USMA 2E2JC 5C44C 2R92C 4Y52C 4P5AA 2E2HK 2GAHC 1Y1WC 4C3HC 5CJ9A 2JA6K 5IYBK 2PMZD 3T01A 2E2JK 4OIRA 4A3FK 5C44K 4Y7NC 1VRQC 5M3MK 4YFKA 4A3JK 2B63C 4Y52K 4GTFA 2CW0A 1O2BA 3S1NK 3NUHA 3L4KA 3L4JA 1Y1WK 1RU0A 4XSZA 3HKZD 4C3HK 4QJVB 5C4JK 2ZUEA 5JVOA 4Y7NK 2A68A 4BBRC 4G7OA 2B63K 4M1XA 1DCPA 3CQZA 1ZVUA 4GTCA 1WQGA 1J98A 4GTLA 1IQ0A 3AD9C 3GSIA 4C2MC 5M5YK 1O28A 1F7VA 1X31C 1JVIA 3HOZC 4KN7A 2Y3PA 4BBRK 2O5JA 4KARA 4A3MC 4AYBD 3GEEA 2R93A 3FOEA 2XCRB 4P9SA 4C2MK 4QIWD 4LK1A 5TMCA 3HOZK 5FJ8K 3AQOA 1WCMA 5EGEA 2PMZL 1J6WA 4KMHA 4A3MK 2JA5A 2PHCB 3G4AA 3TTGA 1IBAA 3FHZA 1BDFA 4X6AC 4BLAA 3SZZA 1C0AA 2RH6A 4GTDA 5IYCC 2XCQA 3WODA 1R9TA 1ZBSA 3AD8C 2WB1D 3S17K 4A93C 3M3YK 1IW7A 2A69A 3GTQA 5EGHA 1XZQB 5IYCK 4YG2A 1F9NA 3QX3A 4GT9A 4KN4A 4G0VA 4GFQA 3DXJA 4XCHA 1WSRA 3GTOA 4AYBL 3EQLA 4A3IC 4LOWA 2KWAA 1SFOA 1J6VA 4OIQA 2A6HA 2WAQD 4QIWL 1YCLA 4XLPA 3RZDC 1USOA 1O25A 3G4CA 3TFIA 3JSTA 4A3IK 1O2AA 2R93C 3RZDK 4A3FC 4A3JC 3T02A 3GTGA 2YU9C 1Y1VC 3S1NC 2WB1L 1F7UA 1WCMC 1V5VA 1IS1A 2JA5C 1UV7A 4KAWX 5HL8A 5C4JC 4PAAA 5IOQA 2R93K 1BS2A 2R7ZA 3OREA 1ISEA 4LLGA 4BLBA 2YU9K 1Y1VK 1WCMK 1JOEA 1TWCA 1TWAC 5L46A 1R9TC 2JA5K 3IPJA 2P5MA 3A8KA 1WORA 1WSVA 2GSUA 1VLOA 4PABA 2NVXA 3N0CA 3HOYC
chains in the Genus database with same CATH topology
1WQHA 1B4AA 3AQOA 1WCMA 5EGEA 1B4BA 4KMHA 2JA5A 1ZXOA 1O27A 2PHCB 4FM9A 4G0UA 1DD5A 3G4AA 4C3IC 3FOFA 3FHZA 2E2IA 1O29A 1O24A 4FZBA 1GE9A 3AQPA 3CAGA 4BLAA 4GTEA 2RH6A 4LQYA 3AH5A 4GTDA 1K83A 3N3YA 4KASA 2XCQA 1BJTA 3ERED 2JA7A 1R9TA 1KQ4A 1ZBSA 1AB4A 4KDDA 3FKIA 1BGWA 1TWGA 4C3JC 1EH1A 1EK8A 3GTQA 5EGHA 4J3NA 1I3QA 4GTAA 1XXAA 3LAPA 1TWHA 4KC6A 5IOTA 4KM8A 1F9NA 3QX3A 4GT9A 4G0VA 4GFQA 3VA7A 4KB4A 3GTJA 3Q3QA 4P5BA 3GTOA 2CFAA 3LPXA 4ILDA 2ZFZA 2KWAA 4KMDA 2R92A 4P5AA 1SFOA 4GTBA 4KATA 3V4GA 4C3HC 5CJ9A 1XXBA 3H0GA 2VUMA 1O25A 3G4CA 2RGRA 4GTFA 3LAJA 1O2AA 2E2HA 3OPFA 1O2BA 3MMLB 3BUEA 3NUHA 1TWFA 3L4KA 3L4JA 3GTPA 3S0XA 1WQFA 2JA6A 2GSOA 3GTMA 5IOSA 2GSNA 5JVOA 3GTKA 3GTGA 2CFAB 2JH3A 2YU9A 1O26A 1Y1VA 4M1XA 4DDQA 3CQZA 1IS1A 4G0WA 1ZVUA 4GTCA 1Y1WA 3N0BA 4KB2A 1WQGA 4KAWX 3GTLA 4LR2A 4GTLA 5IOQA 2R7ZA 1I50A 4C2MC 3OREA 1O28A 1ISEA 2NVYA 1XXCA 4BLBA 3OEPA 4BKWA 2B63A 2Y3PA 4KARA 4KMAA 1TWCA 2XCOA 5TJ3A 5JFEA 1WIHA 1TWAA 2P5MA 4KM9A 2GSUA 2R93A 3FOEA 2NVXA 3N0CA 5IORA 2XCRB 5CHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTC A;  3N0B A;  1O27 A;  1O25 A;  4GTA A;  4GTL A;  5IOQ A;  3G4A A;  3G4C A;  5IOT A;  1O29 A;  1O28 A;  1O24 A;  1O2A A;  4FZB A;  4GTF A;  1O2B A;  4GT9 A;  4GTE A;  4KAR A;  3AH5 A;  4P5B A;  5JFE A;  4GTD A;  3N3Y A;  2CFA A;  4KAS A;  5IOS A;  1KQ4 A;  4P5A A;  2CFA B;  3N0C A;  5IOR A;  4GTB A;  4KAT A;  1O26 A;  5CHP A; 
#chains in the Genus database with same CATH topology
 1WQH A;  1IE0 A;  2WAQ L;  4A3K K;  3GTQ C;  4BXX C;  4O2D A;  1B4B A;  1ZXO A;  1TWA K;  1R9T K;  3BP8 C;  3S2H K;  2E2I A;  1O24 A;  3I4N C;  2GAG C;  4NOI A;  4MEX A;  3HOY K;  2EBB A;  3AH5 A;  1VJE A;  5M3F K;  3GTQ K;  3M4O K;  1VH2 A;  1SFO C;  3N3Y A;  4BXX K;  2JA7 A;  4OIP A;  4RMF A;  1SMY A;  3FKI A;  3GEH A;  2V6T A;  1TWG A;  3GIR A;  4C3J C;  1ZYR A;  1EH1 A;  3I4N K;  5E68 A;  3TFH A;  2V6S A;  3GTO K;  2ZUF A;  4MQ9 A;  1I3Q A;  1TWH A;  1SFO K;  4KC6 A;  4KM8 A;  3K7A C;  3S17 C;  4A3B C;  1YX2 A;  3M3Y C;  4C45 A;  1WOS A;  4OIO A;  4C3J K;  3GTJ A;  4P5B A;  1L0W A;  3GTG C;  4LJZ A;  2JA8 C;  4MEY A;  2ZFZ A;  4KMD A;  2R92 A;  5C3E K;  3AD7 C;  1G51 A;  1YNJ A;  4KAT A;  3K7A K;  4A3B K;  4G7Z A;  3S1R C;  2R7Z C;  1XXB A;  3H0G A;  1I6V A;  2VUM A;  3GTG K;  2PA8 L;  2JA8 K;  2O5I A;  1TWC C;  2NVQ C;  1TWF A;  2NVT K;  3GTP A;  1WQF A;  4OIN A;  3I4M K;  4QJV A;  4GZY A;  3S1R K;  4BY1 C;  2R7Z K;  3GTM A;  2NVX C;  4XLN A;  2GSN A;  3GTK A;  2CFA B;  3HXA A;  3CQZ C;  4BBS C;  2JH3 A;  1O26 A;  3GEI A;  1EI6 A;  4G0W A;  1TWC K;  2NVQ K;  4LK0 A;  3N0B A;  2E2I C;  3HOU C;  3GTL A;  3TFJ A;  1I50 A;  4BY1 K;  1ZQ1 C;  2NVX K;  1EFW A;  1HI9 A;  2NVY A;  1XXC A;  3ADA C;  4BKW A;  2A6E A;  3CQZ K;  4BBS K;  4KMA A;  2XCO A;  2JA7 C;  5JFE A;  3FKI C;  4A3D C;  2Y0S L;  2E2I K;  3HOU K;  4Q5S A;  5IOR A;  1F93 A;  3HOV C;  4A3C C;  1I3Q C;  2D6F C;  1PJ7 A;  1TWH C;  4YFN A;  4FM9 A;  4G0U A;  2JA7 K;  1DD5 A;  3FKI K;  1TWG K;  4A3D K;  3AQP A;  3SZY A;  3GTJ C;  3RZO C;  4A3K C;  3CAG A;  4AH6 A;  3HOV K;  4LQY A;  4A3C K;  1I3Q K;  3HOX K;  1K83 A;  4KAS A;  4ZH4 A;  1BJT A;  3S2H C;  1TWH K;  4KDD A;  2V6U A;  4WJ4 A;  5FLM C;  4BY7 C;  5IP9 C;  3T00 A;  1I6H C;  4JK1 A;  4G7H A;  3H0G C;  2VUM C;  1EK8 A;  3GTJ K;  3RZO K;  3M4O C;  1WOP A;  1XZQ A;  1XXA A;  1XZP B;  2R92 K;  1HQM A;  2PA8 D;  5IOT A;  1TWF C;  3GTP C;  1O2F B;  5FLM K;  4BY7 K;  5IP9 K;  2FQO A;  3GTO C;  5IYD C;  3GTM C;  1I6H K;  3H0G K;  2VUM K;  3GTK C;  5M5X K;  2CFA A;  3LPX A;  1PJ5 A;  4ILD A;  4A3L C;  3S1Q C;  4GTB A;  1TWF K;  3GTP K;  3V4G A;  5IP7 C;  5C4X C;  3GTL C;  5TMF A;  1I50 C;  2P8T A;  2PPB A;  3GTM K;  3S14 C;  5IYD K;  2NVY C;  5C3E C;  3GTK K;  4WJ3 M;  4Q4Z A;  2RGR A;  3LAJ A;  2E2H A;  4A3L K;  3OPF A;  3MML B;  3S1Q K;  3H3V L;  3BUE A;  3A8J A;  4A3G C;  3S0X A;  2JA6 A;  5IP7 K;  5C4X K;  3GTL K;  2GSO A;  5IOS A;  1PJ6 A;  1I50 K;  3S2D C;  3S15 C;  1VGX A;  2Y0S D;  3S14 K;  2BE5 A;  2NVY K;  2YU9 A;  1EQR A;  4DDQ A;  1Y1V A;  2NVT C;  1INN A;  3I4M C;  1Y1W A;  4KB2 A;  4A3G K;  1WOO A;  4LR2 A;  4A3E C;  1IL2 A;  3A8I A;  3S2D K;  3S15 K;  4WIL A;  3OEP A;  3GDZ A;  2B63 A;  1K83 C;  5TJ3 A;  3HKZ L;  3PO2 C;  2FQT A;  1WIH A;  5D4D A;  1TWA A;  4KM9 A;  3S1M C;  4A3E K;  5M5W K;  3PO3 C;  5CHP A;  4X6A K;  1B4A A;  1XZP A;  1YNN A;  1K83 K;  1O27 A;  4KMU A;  3PO2 K;  4C3I C;  3FOF A;  1O29 A;  4FZB A;  1GE9 A;  4XSX A;  3S1M K;  1XPP A;  4A93 K;  4GTE A;  3PO3 K;  3S16 C;  3HOW C;  3ERE D;  1KQ4 A;  1AB4 A;  1TWG C;  4C3I K;  1BGW A;  3BP3 A;  1J6X A;  3HOX C;  1DCO A;  4J3N A;  2E2H C;  4GTA A;  1JQW A;  3LAP A;  3S16 K;  3HOW K;  2W7V A;  4YFX A;  2JA6 C;  3H3V D;  5IYB C;  3VA7 A;  4KB4 A;  1DCH A;  3Q3Q A;  1USM A;  2E2J C;  5C44 C;  2R92 C;  4Y52 C;  4P5A A;  2E2H K;  2GAH C;  1Y1W C;  4C3H C;  5CJ9 A;  2JA6 K;  5IYB K;  2PMZ D;  3T01 A;  2E2J K;  4OIR A;  4A3F K;  5C44 K;  4Y7N C;  1VRQ C;  5M3M K;  4YFK A;  4A3J K;  2B63 C;  4Y52 K;  4GTF A;  2CW0 A;  1O2B A;  3S1N K;  3NUH A;  3L4K A;  3L4J A;  1Y1W K;  1RU0 A;  4XSZ A;  3HKZ D;  4C3H K;  4QJV B;  5C4J K;  2ZUE A;  5JVO A;  4Y7N K;  2A68 A;  4BBR C;  4G7O A;  2B63 K;  4M1X A;  1DCP A;  3CQZ A;  1ZVU A;  4GTC A;  1WQG A;  1J98 A;  4GTL A;  1IQ0 A;  3AD9 C;  3GSI A;  4C2M C;  5M5Y K;  1O28 A;  1F7V A;  1X31 C;  1JVI A;  3HOZ C;  4KN7 A;  2Y3P A;  4BBR K;  2O5J A;  4KAR A;  4A3M C;  4AYB D;  3GEE A;  2R93 A;  3FOE A;  2XCR B;  4P9S A;  4C2M K;  4QIW D;  4LK1 A;  5TMC A;  3HOZ K;  5FJ8 K;  3AQO A;  1WCM A;  5EGE A;  2PMZ L;  1J6W A;  4KMH A;  4A3M K;  2JA5 A;  2PHC B;  3G4A A;  3TTG A;  1IBA A;  3FHZ A;  1BDF A;  4X6A C;  4BLA A;  3SZZ A;  1C0A A;  2RH6 A;  4GTD A;  5IYC C;  2XCQ A;  3WOD A;  1R9T A;  1ZBS A;  3AD8 C;  2WB1 D;  3S17 K;  4A93 C;  3M3Y K;  1IW7 A;  2A69 A;  3GTQ A;  5EGH A;  1XZQ B;  5IYC K;  4YG2 A;  1F9N A;  3QX3 A;  4GT9 A;  4KN4 A;  4G0V A;  4GFQ A;  3DXJ A;  4XCH A;  1WSR A;  3GTO A;  4AYB L;  3EQL A;  4A3I C;  4LOW A;  2KWA A;  1SFO A;  1J6V A;  4OIQ A;  2A6H A;  2WAQ D;  4QIW L;  1YCL A;  4XLP A;  3RZD C;  1USO A;  1O25 A;  3G4C A;  3TFI A;  3JST A;  4A3I K;  1O2A A;  2R93 C;  3RZD K;  4A3F C;  4A3J C;  3T02 A;  3GTG A;  2YU9 C;  1Y1V C;  3S1N C;  2WB1 L;  1F7U A;  1WCM C;  1V5V A;  1IS1 A;  2JA5 C;  1UV7 A;  4KAW X;  5HL8 A;  5C4J C;  4PAA A;  5IOQ A;  2R93 K;  1BS2 A;  2R7Z A;  3ORE A;  1ISE A;  4LLG A;  4BLB A;  2YU9 K;  1Y1V K;  1WCM K;  1JOE A;  1TWC A;  1TWA C;  5L46 A;  1R9T C;  2JA5 K;  3IPJ A;  2P5M A;  3A8K A;  1WOR A;  1WSV A;  2GSU A;  1VLO A;  4PAB A;  2NVX A;  3N0C A;  3HOY C; 
#chains in the Genus database with same CATH homology
 1WQH A;  1B4A A;  3AQO A;  1WCM A;  5EGE A;  1B4B A;  4KMH A;  2JA5 A;  1ZXO A;  1O27 A;  2PHC B;  4FM9 A;  4G0U A;  1DD5 A;  3G4A A;  4C3I C;  3FOF A;  3FHZ A;  2E2I A;  1O29 A;  1O24 A;  4FZB A;  1GE9 A;  3AQP A;  3CAG A;  4BLA A;  4GTE A;  2RH6 A;  4LQY A;  3AH5 A;  4GTD A;  1K83 A;  3N3Y A;  4KAS A;  2XCQ A;  1BJT A;  3ERE D;  2JA7 A;  1R9T A;  1KQ4 A;  1ZBS A;  1AB4 A;  4KDD A;  3FKI A;  1BGW A;  1TWG A;  4C3J C;  1EH1 A;  1EK8 A;  3GTQ A;  5EGH A;  4J3N A;  1I3Q A;  4GTA A;  1XXA A;  3LAP A;  1TWH A;  4KC6 A;  5IOT A;  4KM8 A;  1F9N A;  3QX3 A;  4GT9 A;  4G0V A;  4GFQ A;  3VA7 A;  4KB4 A;  3GTJ A;  3Q3Q A;  4P5B A;  3GTO A;  2CFA A;  3LPX A;  4ILD A;  2ZFZ A;  2KWA A;  4KMD A;  2R92 A;  4P5A A;  1SFO A;  4GTB A;  4KAT A;  3V4G A;  4C3H C;  5CJ9 A;  1XXB A;  3H0G A;  2VUM A;  1O25 A;  3G4C A;  2RGR A;  4GTF A;  3LAJ A;  1O2A A;  2E2H A;  3OPF A;  1O2B A;  3MML B;  3BUE A;  3NUH A;  1TWF A;  3L4K A;  3L4J A;  3GTP A;  3S0X A;  1WQF A;  2JA6 A;  2GSO A;  3GTM A;  5IOS A;  2GSN A;  5JVO A;  3GTK A;  3GTG A;  2CFA B;  2JH3 A;  2YU9 A;  1O26 A;  1Y1V A;  4M1X A;  4DDQ A;  3CQZ A;  1IS1 A;  4G0W A;  1ZVU A;  4GTC A;  1Y1W A;  3N0B A;  4KB2 A;  1WQG A;  4KAW X;  3GTL A;  4LR2 A;  4GTL A;  5IOQ A;  2R7Z A;  1I50 A;  4C2M C;  3ORE A;  1O28 A;  1ISE A;  2NVY A;  1XXC A;  4BLB A;  3OEP A;  4BKW A;  2B63 A;  2Y3P A;  4KAR A;  4KMA A;  1TWC A;  2XCO A;  5TJ3 A;  5JFE A;  1WIH A;  1TWA A;  2P5M A;  4KM9 A;  2GSU A;  2R93 A;  3FOE A;  2NVX A;  3N0C A;  5IOR A;  2XCR B;  5CHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...