3AH5A

Crystal structure of flavin dependent thymidylate synthase thyx from helicobacter pylori complexed with fad and dump
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
215
structure length
215
Chain Sequence
MEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAKEFLVFVDNEKVNAMSVLALENLRILLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNFLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKHLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Crystal structure and functional analysis of a flavin dependent thymidylate synthase from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 75
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ah5A00
1O25A 4FZBA 4GTCA 5IOSA 1O2BA 4GTLA 4P5AA 5IOTA 2CFAA 3G4CA 1O28A 1O2AA 4KARA 4P5BA 4GT9A 1O29A 1KQ4A 1O24A 4KASA 5IOQA 4KATA 5IORA 3G4AA 1O26A 4GTFA 2CFAB 3N0CA 1O27A 4GTAA 5CHPA 5JFEA 4GTEA 3N0BA 3AH5A 3N3YA 4GTBA 4GTDA
chains in the Genus database with same CATH superfamily
3VA7A 3S17K 5IYDC 3DXJA 3H3VD 3JSTA 3FOEA 5M3MK 2XCOA 1Y1WK 4KDDA 2JA6K 2NVYC 1Y1WA 1IE0A 1I50C 1K83K 4DDQA 2JA6A 4A3KC 1XPPA 5IP9C 1I3QC 1K83A 4Q4ZA 2JA7K 3HKZL 5JVOA 1IW7A 1BGWA 4KB4A 4BXXC 3AQOA 2JA7A 2E2IK 3HOUC 2V6TA 1F7UA 2NVTC 1WORA 2E2IA 4LLGA 2GSOA 4ILDA 3EQLA 4G0VA 1IL2A 4WJ4A 4Y7NK 1O28A 1TWCC 1YNJA 3S1MK 3SZZA 5C44K 5M5WK 4KASA 1BDFA 1UV7A 3GTQK 4LJZA 4A3JK 3GTLK 2JA8K 2ZUFA 2B63K 1V5VA 5FLMK 3GTQA 1WCMK 1EK8A 3OREA 5HL8A 2JA7C 2WB1D 2NVXK 4C3JC 2NVQK 1TWHK 1WSVA 4LOWA 4G7HA 4G0UA 3PO3K 3LAJA 2KWAA 4P5BA 1TWHA 3GTGC 3S0XA 4KATA 3HOVK 4A93K 1WOPA 3WODA 4MEYA 3M3YC 3S1MC 4GTBA 5C4XK 3MMLB 1VJEA 3S1RC 1HQMA 4RMFA 3I4MK 5IYBK 4A3JC 1YCLA 3GTLC 2FQTA 4FM9A 3HOZC 1ZVUA 2B63C 1WCMC 3HXAA 1WOSA 1XZQA 4OIOA 5IOTA 3G4CA 2XCQA 4KMDA 3GTOK 2NVXC 4KM9A 5IORA 4A3IC 1SMYA 4BY1C 2Y0SL 1TWHC 3GTOA 1ZXOA 2JA5K 3PO3C 1AB4A 1F7VA 4A93C 2JA5A 4GTDA 1XXBA 2PPBA 3SZYA 4A3CK 5C4XC 4LK1A 4LQYA 1EFWA 3T01A 2BE5A 2ZFZA 3GEIA 4XSXA 1DCOA 5E68A 5IYCK 5IYBC 3HOXC 2A69A 5IP9K 3I4NK 4A3FC 1IS1A 1O29A 4JK1A 2R92C 4BXXK 5EGHA 3HOWC 1USMA 1R9TK 1EH1A 5M5YK 4J3NA 5L46A 4C3HC 4KAWX 1IBAA 1R9TA 2JA5C 1I6VA 3TFJA 1TWCK 4GTCA 4A3LC 1J6WA 3K7AK 3FHZA 4BBSC 2RH6A 4P5AA 4A3MC 2PA8L 4KN4A 1TWCA 2E2HC 4KB2A 2GSNA 4KMHA 4A3CC 4G7ZA 4BBRC 2WAQL 5IYCC 3S2DK 1INNA 2CFAB 3I4NC 3GTMK 3N0BA 4KC6A 3T02A 4C3JK 4C3IK 3GTMA 1DCHA 4MEXA 2E2JC 2GAGC 4O2DA 3GTPK 3S1NK 3GIRA 1R9TC 2A6HA 4XSZA 3GTGK 3L4JA 3GTPA 1XXCA 4G7OA 1JOEA 3GEEA 2CFAA 4OIRA 3GTGA 3M3YK 5IOQA 1KQ4A 3K7AC 3NUHA 4G0WA 3FKIK 3S1RK 3G4AA 3ADAC 2P5MA 4QIWL 2XCRB 3HOZK 3FKIA 1L0WA 3GTLA 3S2DC 4OINA 2B63A 2P8TA 1WCMA 3CAGA 3GTMC 5IOSA 1XZPA 1TWFC 3GTJC 4C2MC 4A3IK 4C3IC 4BY1K 4A3BC 1ISEA 2NVXA 1VH2A 3GTPC 3S1NC 2ZUEA 1O24A 1RU0A 1B4BA 3OPFA 1XZQB 3PO2C 4GTAA 1XXAA 3H0GC 4Y52C 1Y1VC 3S1QC 3LAPA 2VUMK 3FKIC 5C4JC 4KMUA 3HOXK 1VRQC 1O25A 1TWAK 4A3FK 3HKZD 4GTLA 1I6HK 4XCHA 4KMAA 4WILA 1PJ5A 2R92K 1TWGC 3HOWK 3Q3QA 2R92A 1WSRA 4KN7A 4C3HK 5CHPA 3H3VL 1G51A 4GTEA 4GZYA 3RZDK 1PJ6A 4XLNA 4A3LK 1EQRA 2PMZL 4BBSK 1J6VA 3M4OK 4A3EK 4A3MK 2E2HK 3GSIA 4BLAA 1ZBSA 3S14K 4AH6A 1DCPA 4BBRK 2VUMC 2E2HA 5FJ8K 3S15K 1X31C 4GFQA 3HOYK 4M1XA 1B4AA 1TWAC 2PHCB 4GT9A 3TFIA 3AQPA 1GE9A 1I6HC 3BUEA 1USOA 1J6XA 4QJVB 4C45A 2E2JK 1IQ0A 5JFEA 3GTKK 1WQHA 3FOFA 4LR2A 3GTKA 1F93A 2JH3A 3V4GA 3RZDC 2RGRA 3CQZK 4P9SA 3M4OC 4YFKA 4QJVA 4A3EC 2CW0A 3CQZA 2O5JA 3GEHA 3S14C 1JVIA 3S15C 1O26A 4A3GK 2YU9C 3IPJA 3N0CA 1O27A 3HOYC 1WOOA 2WB1L 4YFXA 1YX2A 1TWFK 4BKWA 3GTJK 4C2MK 2Y0SD 4A3BK 4LK0A 3S2HC 1EI6A 1TWFA 3GTJA 5D4DA 4AYBL 3GTKC 2R7ZK 2PMZD 3ERED 1VLOA 3PO2K 2R7ZA 3RZOC 4KARA 3H0GK 3T00A 1Y1VK 3S1QK 4Y52K 1XZPB 3CQZC 4OIPA 3L4KA 2V6UA 1JQWA 5C4JK 5M3FK 3H0GA 1Y1VA 1HI9A 5TMCA 3AD8C 4A3DK 3N3YA 4Q5SA 4A3GC 2A6EA 4MQ9A 1PJ7A 1TWGK 5CJ9A 2EBBA 2Y3PA 2FQOA 4X6AC 3A8KA 1BS2A 3S17C 1TWGA 1O2FB 1O2AA 2V6SA 4WJ3M 1DD5A 1WIHA 2R7ZC 4ZH4A 1Y1WC 3GDZA 2PA8D 1YNNA 2JA6C 2O5IA 1K83C 3BP3A 2WAQD 4YG2A 4NOIA 2R93K 2A68A 1ZQ1C 4A3DC 2VUMA 4KM8A 2R93A 2E2IC 1TWAA 4AYBD 5IP7K 4Y7NC 4GTFA 5C44C 1C0AA 1SFOK 3GTQC 5TMFA 2JA8C 3OEPA 1SFOA 5FLMC 3S16K 4QIWD 3A8IA 3AD9C 1ZYRA 5EGEA 1BJTA 4BY7K 4BLBA 4PABA 2GSUA 2R93C 2YU9K 5C3EK 2NVQC 2YU9A 1VGXA 4OIQA 5IYDK 3S2HK 5TJ3A 3AH5A 3TFHA 3HOVC 3BP8C 3A8JA 5IP7C 2D6FC 3TTGA 2NVYK 4FZBA 1WQGA 1SFOC 1WQFA 3RZOK 3I4MC 1I50K 1O2BA 2NVYA 4A3KK 1I3QK 3AD7C 3S16C 1I50A 1J98A 1I3QA 3QX3A 4PAAA 3LPXA 4BY7C 4XLPA 5M5XK 3HOUK 3GTOC 5C3EC 2NVTK 4YFNA 1F9NA 2W7VA 2GAHC 4X6AK
chains in the Genus database with same CATH topology
3VA7A 1O25A 4LQYA 5CJ9A 2Y3PA 2ZFZA 3FOEA 2XCOA 4GTLA 1TWGA 4KMAA 4KDDA 1IS1A 1O2AA 1DD5A 3Q3QA 1O29A 1WIHA 1Y1WA 2R92A 4DDQA 2JA6A 5EGHA 5CHPA 1K83A 4GTEA 5JVOA 1EH1A 1BGWA 4J3NA 4KB4A 3AQOA 4C3HC 4KAWX 2JA7A 1R9TA 4BLAA 1ZBSA 2VUMA 4GTCA 4KM8A 3FHZA 2E2HA 2E2IA 2RH6A 2GSOA 4P5AA 4ILDA 2R93A 1TWCA 4G0VA 4KB2A 1TWAA 1O28A 2GSNA 4GFQA 4KMHA 4M1XA 1B4AA 2PHCB 4GT9A 3AQPA 4KASA 1GE9A 3BUEA 4GTFA 2CFAB 5JFEA 3GTQA 3N0BA 1EK8A 3OREA 1WQHA 4KC6A 3FOFA 3GTMA 3OEPA 4LR2A 1SFOA 3GTKA 2JH3A 3V4GA 2RGRA 5EGEA 4C3JC 1BJTA 3L4JA 4BLBA 3GTPA 1XXCA 4G0UA 2GSUA 2CFAA 3CQZA 3GTGA 3LAJA 2KWAA 4P5BA 1TWHA 5IOQA 1KQ4A 3S0XA 4KATA 3NUHA 4G0WA 2YU9A 3G4AA 1O26A 2P5MA 3N0CA 1O27A 2XCRB 3FKIA 4GTBA 3AH5A 5TJ3A 3MMLB 3GTLA 4BKWA 2B63A 4FM9A 1ZVUA 1WCMA 3CAGA 1TWFA 3GTJA 4FZBA 1WQGA 1WQFA 5IOSA 4C2MC 1O2BA 4C3IC 2NVYA 3ERED 5IOTA 1ISEA 3G4CA 2NVXA 2R7ZA 2XCQA 4KMDA 1I50A 4KARA 4KM9A 5IORA 1O24A 1I3QA 3QX3A 3LPXA 1B4BA 3L4KA 3GTOA 3OPFA 3H0GA 1Y1VA 1ZXOA 4GTAA 1XXAA 1AB4A 3N3YA 1F9NA 3LAPA 2JA5A 4GTDA 1XXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O25 A;  4FZB A;  4GTC A;  5IOS A;  1O2B A;  4GTL A;  4P5A A;  5IOT A;  2CFA A;  3G4C A;  1O28 A;  1O2A A;  4KAR A;  4P5B A;  4GT9 A;  1O29 A;  1KQ4 A;  1O24 A;  4KAS A;  5IOQ A;  4KAT A;  5IOR A;  3G4A A;  1O26 A;  4GTF A;  2CFA B;  3N0C A;  1O27 A;  4GTA A;  5CHP A;  5JFE A;  4GTE A;  3N0B A;  3AH5 A;  3N3Y A;  4GTB A;  4GTD A; 
#chains in the Genus database with same CATH topology
 3VA7 A;  3S17 K;  5IYD C;  3DXJ A;  3H3V D;  3JST A;  3FOE A;  5M3M K;  2XCO A;  1Y1W K;  4KDD A;  2JA6 K;  2NVY C;  1Y1W A;  1IE0 A;  1I50 C;  1K83 K;  4DDQ A;  2JA6 A;  4A3K C;  1XPP A;  5IP9 C;  1I3Q C;  1K83 A;  4Q4Z A;  2JA7 K;  3HKZ L;  5JVO A;  1IW7 A;  1BGW A;  4KB4 A;  4BXX C;  3AQO A;  2JA7 A;  2E2I K;  3HOU C;  2V6T A;  1F7U A;  2NVT C;  1WOR A;  2E2I A;  4LLG A;  2GSO A;  4ILD A;  3EQL A;  4G0V A;  1IL2 A;  4WJ4 A;  4Y7N K;  1O28 A;  1TWC C;  1YNJ A;  3S1M K;  3SZZ A;  5C44 K;  5M5W K;  4KAS A;  1BDF A;  1UV7 A;  3GTQ K;  4LJZ A;  4A3J K;  3GTL K;  2JA8 K;  2ZUF A;  2B63 K;  1V5V A;  5FLM K;  3GTQ A;  1WCM K;  1EK8 A;  3ORE A;  5HL8 A;  2JA7 C;  2WB1 D;  2NVX K;  4C3J C;  2NVQ K;  1TWH K;  1WSV A;  4LOW A;  4G7H A;  4G0U A;  3PO3 K;  3LAJ A;  2KWA A;  4P5B A;  1TWH A;  3GTG C;  3S0X A;  4KAT A;  3HOV K;  4A93 K;  1WOP A;  3WOD A;  4MEY A;  3M3Y C;  3S1M C;  4GTB A;  5C4X K;  3MML B;  1VJE A;  3S1R C;  1HQM A;  4RMF A;  3I4M K;  5IYB K;  4A3J C;  1YCL A;  3GTL C;  2FQT A;  4FM9 A;  3HOZ C;  1ZVU A;  2B63 C;  1WCM C;  3HXA A;  1WOS A;  1XZQ A;  4OIO A;  5IOT A;  3G4C A;  2XCQ A;  4KMD A;  3GTO K;  2NVX C;  4KM9 A;  5IOR A;  4A3I C;  1SMY A;  4BY1 C;  2Y0S L;  1TWH C;  3GTO A;  1ZXO A;  2JA5 K;  3PO3 C;  1AB4 A;  1F7V A;  4A93 C;  2JA5 A;  4GTD A;  1XXB A;  2PPB A;  3SZY A;  4A3C K;  5C4X C;  4LK1 A;  4LQY A;  1EFW A;  3T01 A;  2BE5 A;  2ZFZ A;  3GEI A;  4XSX A;  1DCO A;  5E68 A;  5IYC K;  5IYB C;  3HOX C;  2A69 A;  5IP9 K;  3I4N K;  4A3F C;  1IS1 A;  1O29 A;  4JK1 A;  2R92 C;  4BXX K;  5EGH A;  3HOW C;  1USM A;  1R9T K;  1EH1 A;  5M5Y K;  4J3N A;  5L46 A;  4C3H C;  4KAW X;  1IBA A;  1R9T A;  2JA5 C;  1I6V A;  3TFJ A;  1TWC K;  4GTC A;  4A3L C;  1J6W A;  3K7A K;  3FHZ A;  4BBS C;  2RH6 A;  4P5A A;  4A3M C;  2PA8 L;  4KN4 A;  1TWC A;  2E2H C;  4KB2 A;  2GSN A;  4KMH A;  4A3C C;  4G7Z A;  4BBR C;  2WAQ L;  5IYC C;  3S2D K;  1INN A;  2CFA B;  3I4N C;  3GTM K;  3N0B A;  4KC6 A;  3T02 A;  4C3J K;  4C3I K;  3GTM A;  1DCH A;  4MEX A;  2E2J C;  2GAG C;  4O2D A;  3GTP K;  3S1N K;  3GIR A;  1R9T C;  2A6H A;  4XSZ A;  3GTG K;  3L4J A;  3GTP A;  1XXC A;  4G7O A;  1JOE A;  3GEE A;  2CFA A;  4OIR A;  3GTG A;  3M3Y K;  5IOQ A;  1KQ4 A;  3K7A C;  3NUH A;  4G0W A;  3FKI K;  3S1R K;  3G4A A;  3ADA C;  2P5M A;  4QIW L;  2XCR B;  3HOZ K;  3FKI A;  1L0W A;  3GTL A;  3S2D C;  4OIN A;  2B63 A;  2P8T A;  1WCM A;  3CAG A;  3GTM C;  5IOS A;  1XZP A;  1TWF C;  3GTJ C;  4C2M C;  4A3I K;  4C3I C;  4BY1 K;  4A3B C;  1ISE A;  2NVX A;  1VH2 A;  3GTP C;  3S1N C;  2ZUE A;  1O24 A;  1RU0 A;  1B4B A;  3OPF A;  1XZQ B;  3PO2 C;  4GTA A;  1XXA A;  3H0G C;  4Y52 C;  1Y1V C;  3S1Q C;  3LAP A;  2VUM K;  3FKI C;  5C4J C;  4KMU A;  3HOX K;  1VRQ C;  1O25 A;  1TWA K;  4A3F K;  3HKZ D;  4GTL A;  1I6H K;  4XCH A;  4KMA A;  4WIL A;  1PJ5 A;  2R92 K;  1TWG C;  3HOW K;  3Q3Q A;  2R92 A;  1WSR A;  4KN7 A;  4C3H K;  5CHP A;  3H3V L;  1G51 A;  4GTE A;  4GZY A;  3RZD K;  1PJ6 A;  4XLN A;  4A3L K;  1EQR A;  2PMZ L;  4BBS K;  1J6V A;  3M4O K;  4A3E K;  4A3M K;  2E2H K;  3GSI A;  4BLA A;  1ZBS A;  3S14 K;  4AH6 A;  1DCP A;  4BBR K;  2VUM C;  2E2H A;  5FJ8 K;  3S15 K;  1X31 C;  4GFQ A;  3HOY K;  4M1X A;  1B4A A;  1TWA C;  2PHC B;  4GT9 A;  3TFI A;  3AQP A;  1GE9 A;  1I6H C;  3BUE A;  1USO A;  1J6X A;  4QJV B;  4C45 A;  2E2J K;  1IQ0 A;  5JFE A;  3GTK K;  1WQH A;  3FOF A;  4LR2 A;  3GTK A;  1F93 A;  2JH3 A;  3V4G A;  3RZD C;  2RGR A;  3CQZ K;  4P9S A;  3M4O C;  4YFK A;  4QJV A;  4A3E C;  2CW0 A;  3CQZ A;  2O5J A;  3GEH A;  3S14 C;  1JVI A;  3S15 C;  1O26 A;  4A3G K;  2YU9 C;  3IPJ A;  3N0C A;  1O27 A;  3HOY C;  1WOO A;  2WB1 L;  4YFX A;  1YX2 A;  1TWF K;  4BKW A;  3GTJ K;  4C2M K;  2Y0S D;  4A3B K;  4LK0 A;  3S2H C;  1EI6 A;  1TWF A;  3GTJ A;  5D4D A;  4AYB L;  3GTK C;  2R7Z K;  2PMZ D;  3ERE D;  1VLO A;  3PO2 K;  2R7Z A;  3RZO C;  4KAR A;  3H0G K;  3T00 A;  1Y1V K;  3S1Q K;  4Y52 K;  1XZP B;  3CQZ C;  4OIP A;  3L4K A;  2V6U A;  1JQW A;  5C4J K;  5M3F K;  3H0G A;  1Y1V A;  1HI9 A;  5TMC A;  3AD8 C;  4A3D K;  3N3Y A;  4Q5S A;  4A3G C;  2A6E A;  4MQ9 A;  1PJ7 A;  1TWG K;  5CJ9 A;  2EBB A;  2Y3P A;  2FQO A;  4X6A C;  3A8K A;  1BS2 A;  3S17 C;  1TWG A;  1O2F B;  1O2A A;  2V6S A;  4WJ3 M;  1DD5 A;  1WIH A;  2R7Z C;  4ZH4 A;  1Y1W C;  3GDZ A;  2PA8 D;  1YNN A;  2JA6 C;  2O5I A;  1K83 C;  3BP3 A;  2WAQ D;  4YG2 A;  4NOI A;  2R93 K;  2A68 A;  1ZQ1 C;  4A3D C;  2VUM A;  4KM8 A;  2R93 A;  2E2I C;  1TWA A;  4AYB D;  5IP7 K;  4Y7N C;  4GTF A;  5C44 C;  1C0A A;  1SFO K;  3GTQ C;  5TMF A;  2JA8 C;  3OEP A;  1SFO A;  5FLM C;  3S16 K;  4QIW D;  3A8I A;  3AD9 C;  1ZYR A;  5EGE A;  1BJT A;  4BY7 K;  4BLB A;  4PAB A;  2GSU A;  2R93 C;  2YU9 K;  5C3E K;  2NVQ C;  2YU9 A;  1VGX A;  4OIQ A;  5IYD K;  3S2H K;  5TJ3 A;  3AH5 A;  3TFH A;  3HOV C;  3BP8 C;  3A8J A;  5IP7 C;  2D6F C;  3TTG A;  2NVY K;  4FZB A;  1WQG A;  1SFO C;  1WQF A;  3RZO K;  3I4M C;  1I50 K;  1O2B A;  2NVY A;  4A3K K;  1I3Q K;  3AD7 C;  3S16 C;  1I50 A;  1J98 A;  1I3Q A;  3QX3 A;  4PAA A;  3LPX A;  4BY7 C;  4XLP A;  5M5X K;  3HOU K;  3GTO C;  5C3E C;  2NVT K;  4YFN A;  1F9N A;  2W7V A;  2GAH C;  4X6A K; 
#chains in the Genus database with same CATH homology
 3VA7 A;  1O25 A;  4LQY A;  5CJ9 A;  2Y3P A;  2ZFZ A;  3FOE A;  2XCO A;  4GTL A;  1TWG A;  4KMA A;  4KDD A;  1IS1 A;  1O2A A;  1DD5 A;  3Q3Q A;  1O29 A;  1WIH A;  1Y1W A;  2R92 A;  4DDQ A;  2JA6 A;  5EGH A;  5CHP A;  1K83 A;  4GTE A;  5JVO A;  1EH1 A;  1BGW A;  4J3N A;  4KB4 A;  3AQO A;  4C3H C;  4KAW X;  2JA7 A;  1R9T A;  4BLA A;  1ZBS A;  2VUM A;  4GTC A;  4KM8 A;  3FHZ A;  2E2H A;  2E2I A;  2RH6 A;  2GSO A;  4P5A A;  4ILD A;  2R93 A;  1TWC A;  4G0V A;  4KB2 A;  1TWA A;  1O28 A;  2GSN A;  4GFQ A;  4KMH A;  4M1X A;  1B4A A;  2PHC B;  4GT9 A;  3AQP A;  4KAS A;  1GE9 A;  3BUE A;  4GTF A;  2CFA B;  5JFE A;  3GTQ A;  3N0B A;  1EK8 A;  3ORE A;  1WQH A;  4KC6 A;  3FOF A;  3GTM A;  3OEP A;  4LR2 A;  1SFO A;  3GTK A;  2JH3 A;  3V4G A;  2RGR A;  5EGE A;  4C3J C;  1BJT A;  3L4J A;  4BLB A;  3GTP A;  1XXC A;  4G0U A;  2GSU A;  2CFA A;  3CQZ A;  3GTG A;  3LAJ A;  2KWA A;  4P5B A;  1TWH A;  5IOQ A;  1KQ4 A;  3S0X A;  4KAT A;  3NUH A;  4G0W A;  2YU9 A;  3G4A A;  1O26 A;  2P5M A;  3N0C A;  1O27 A;  2XCR B;  3FKI A;  4GTB A;  3AH5 A;  5TJ3 A;  3MML B;  3GTL A;  4BKW A;  2B63 A;  4FM9 A;  1ZVU A;  1WCM A;  3CAG A;  1TWF A;  3GTJ A;  4FZB A;  1WQG A;  1WQF A;  5IOS A;  4C2M C;  1O2B A;  4C3I C;  2NVY A;  3ERE D;  5IOT A;  1ISE A;  3G4C A;  2NVX A;  2R7Z A;  2XCQ A;  4KMD A;  1I50 A;  4KAR A;  4KM9 A;  5IOR A;  1O24 A;  1I3Q A;  3QX3 A;  3LPX A;  1B4B A;  3L4K A;  3GTO A;  3OPF A;  3H0G A;  1Y1V A;  1ZXO A;  4GTA A;  1XXA A;  1AB4 A;  3N3Y A;  1F9N A;  3LAP A;  2JA5 A;  4GTD A;  1XXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...