3AH5A

Crystal structure of flavin dependent thymidylate synthase thyx from helicobacter pylori complexed with fad and dump
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
215
structure length
215
Chain Sequence
MEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDKELIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAKEFLVFVDNEKVNAMSVLALENLRILLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNFLTLRSSNKALKEMQDLAKALFDALPGEHQYLFEDCLKHLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional analysis of a flavin dependent thymidylate synthase from helicobacter pylori
rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 75
structure length 215
sequence length 215
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ah5A00
1KQ4A 4KARA 5IOQA 4P5AA 4FZBA 2CFAB 1O26A 4KASA 1O2AA 3G4CA 3N0BA 5JFEA 4GTDA 4GTAA 4GTBA 1O2BA 1O29A 5IOTA 1O28A 3N3YA 4KATA 2CFAA 3G4AA 4GTCA 3AH5A 4GTFA 1O25A 5CHPA 4GTLA 1O27A 5IORA 5IOSA 1O24A 3N0CA 4GTEA 4GT9A 4P5BA
chains in the Genus database with same CATH superfamily
1KQ4A 1XZPA 4KARA 4KMDA 3TTGA 5IOQA 3GTGA 4FZBA 4C2MK 2E2IC 4C3HK 4KMUA 1XXCA 2JA7C 3HXAA 2E2JK 3I4MC 3GEEA 3S16C 4A3FC 2JA6C 2PA8D 3FOFA 1SMYA 1TWHC 2JA5C 1WSRA 4LJZA 3H0GK 3GTQC 1I6HC 3GTLC 4LK0A 3BUEA 5C4JC 3AD9C 4Y7NK 3GDZA 4ILDA 3GEHA 3FKIA 3HOXC 3CQZC 4A3BC 4MQ9A 1ZBSA 5D4DA 3L4KA 4LR2A 1I50C 4Q5SA 3GEIA 3N0BA 5M5YK 3HOYC 1F9NA 4AYBL 2XCRB 4G7HA 3T00A 2O5JA 1J6XA 3HOVC 4PABA 1YNNA 2WB1D 2WB1L 3LAJA 4BY7K 2NVYC 3Q3QA 2JA7K 3N0CA 1YX2A 3GSIA 3HOWC 1JQWA 4G7OA 4A3EC 3SZZA 1TWCA 2P8TA 4A3CC 1I3QC 1DCHA 4A3DK 4YG2A 1JVIA 4KB4A 3GTKK 2NVYK 1K83A 3H3VD 2JA8K 1O28A 1G51A 4BY7C 3HOUC 3S1NC 5E68A 4WJ4A 3OEPA 4G7ZA 4G0UA 4KB2A 2NVXK 2NVTK 3M3YK 5IP7K 3GTOA 4AYBD 4MEXA 1IBAA 1WQGA 3PO3C 1K83C 4P5AA 4X6AC 4YFKA 1B4BA 5C3EK 4YFXA 1X31C 3S1RK 4KM8A 2ZUFA 3S2HK 3S14C 2YU9C 2ZUEA 4BXXC 3S1QC 1PJ6A 1R9TA 1BJTA 1V5VA 5CHPA 1UV7A 3S2DK 4J3NA 5TMFA 5IOSA 1O24A 1DD5A 4A93C 3DXJA 3FKIK 1EH1A 4OIRA 3OPFA 2CFAB 1O26A 2VUMA 3T01A 1USMA 3ADAC 1SFOC 2R93A 4A3IK 4GTAA 5CJ9A 2NVQC 4BXXK 2VUMK 1TWFK 4QJVA 3A8JA 5IYBC 5C3EC 3EQLA 3AD8C 3VA7A 3AH5A 1BS2A 1WCMK 4X6AK 2B63C 2JA8C 1VH2A 1J98A 2R93C 1R9TK 4GT9A 2VUMC 2PA8L 2JA6A 5IYBK 3G4CA 3M3YC 2RH6A 2XCQA 3RZOK 4Y52C 3HKZL 1Y1VK 3FKIC 2CW0A 1TWGK 1INNA 4MEYA 4OIQA 4A3EK 1BGWA 1B4AA 2R92A 4WILA 3GTJC 4PAAA 3GTMA 4WJ3M 2V6SA 5IYDK 1XZQA 3GTOC 3GTMC 2R92K 2A6EA 5TMCA 4GTBA 4DDQA 4FM9A 1O29A 2GSUA 3A8IA 1TWCK 2WAQL 3AD7C 1IW7A 5IP7C 5IYCK 1K83K 2NVYA 4LK1A 4OIPA 4C3HC 3WODA 4BLBA 4KN7A 4KAWX 2KWAA 4P5BA 3SZYA 3TFJA 1TWCC 3ERED 3K7AC 4XCHA 4ZH4A 1O2AA 3CQZK 4C45A 1WCMC 4C3JK 1TWGA 1EFWA 3S1QK 5C4JK 3GTGK 4A3BK 3MMLB 4NOIA 3IPJA 1XZQB 2E2JC 3HOWK 1WOSA 1VRQC 2JA6K 3GTMK 5IYCC 4QJVB 1TWGC 5FLMC 2PMZL 3GTLA 2V6UA 2YU9K 2B63A 4AH6A 1SFOA 3TFIA 1RU0A 5HL8A 1HQMA 1IS1A 3AQOA 2PHCB 1J6WA 5M3FK 1Y1WC 2R93K 4A3MC 1R9TC 4KN4A 3V4GA 4BBSK 3S1MC 1USOA 1VGXA 1WSVA 1VJEA 1XPPA 4BBRK 4G0VA 1GE9A 1PJ7A 3S16K 4A3KK 4A3FK 1VLOA 2GAGC 4KMHA 4BLAA 5L46A 1IL2A 3GTLK 3H0GC 2YU9A 3OREA 3H0GA 3HOZC 1BDFA 2E2HA 5IOTA 1J6VA 4OINA 2E2IK 2O5IA 4A3DC 1DCPA 4A3CK 1XXBA 1C0AA 1O2FB 1I50K 1O25A 2A68A 4XLPA 2R7ZC 5IORA 3T02A 3GTQK 4A3JC 1YCLA 3HOZK 1TWFC 2V6TA 2ZFZA 3FOEA 1WIHA 2E2HC 1TWAA 4BBRC 3CAGA 2GSNA 3AQPA 3PO3K 2R7ZK 5C4XC 1YNJA 1WCMA 4A93K 4A3LK 2GSOA 4P9SA 2CFAA 4QIWL 1XXAA 1I3QK 2Y0SL 3S0XA 3S2HC 1F7UA 2P5MA 3BP8C 3GTKC 5FJ8K 4KASA 3FHZA 3GTKA 3HOXK 4KM9A 4A3LC 1EQRA 3RZDK 2E2IA 1I50A 3NUHA 4QIWD 5M5XK 2NVQK 3PO2K 1ZYRA 5M5WK 1TWHA 1ZXOA 2A69A 3RZOC 1TWAC 2JA5A 1AB4A 4BY1K 4YFNA 4JK1A 3L4JA 3HOUK 3S1NK 4Q4ZA 2JA7A 3S1RC 3I4NK 3GTPA 4KC6A 4LQYA 3S15C 2B63K 3GIRA 1ZQ1C 3S14K 5FLMK 4Y7NC 1JOEA 4C3IK 1L0WA 3LAPA 3HKZD 1DCOA 3GTJA 5EGEA 3RZDC 2E2HK 4GTCA 4A3KC 2D6FC 3I4MK 3HOYK 5JVOA 4A3IC 5C4XK 1WOOA 3BP3A 3A8KA 1I6HK 4A3MK 4G0WA 4O2DA 4C3IC 2Y0SD 1WORA 4M1XA 1Y1WA 3S1MK 4GFQA 2NVTC 2BE5A 1XZPB 5TJ3A 4LOWA 1O2BA 2Y3PA 5IYDC 3H3VL 1TWAK 4BY1C 1I3QA 1ZVUA 3G4AA 4GTLA 3S17K 1O27A 1SFOK 2W7VA 4Y52K 3HOVK 4BKWA 3PO2C 1Y1VC 3GTQA 1Y1VA 5JFEA 5C44K 1EK8A 1HI9A 4RMFA 4A3JK 3LPXA 5EGHA 4KMAA 2NVXC 3CQZA 5IP9C 4XSXA 3N3YA 1EI6A 2NVXA 4A3GK 1F7VA 4C3JC 2JH3A 4KATA 2R7ZA 3S15K 1TWFA 1ISEA 4GTFA 3TFHA 2GAHC 5C44C 2EBBA 2RGRA 3GTPK 3M4OC 1F93A 2WAQD 5IP9K 4KDDA 1TWHK 2JA5K 1WOPA 4GTDA 4BBSC 2A6HA 5M3MK 2XCOA 4LLGA 1PJ5A 1WQHA 4C2MC 3S2DC 1WQFA 3GTPC 3M4OK 1IE0A 3S17C 2R92C 2FQOA 2PPBA 3GTOK 3JSTA 4OIOA 3GTJK 1IQ0A 3I4NC 3QX3A 4XLNA 3K7AK 1Y1WK 2FQTA 1I6VA 4XSZA 4GTEA 4A3GC 4GZYA 2PMZD 3GTGC
chains in the Genus database with same CATH topology
1KQ4A 2B63A 4KARA 4KMDA 5IOQA 1EH1A 3GTGA 4FZBA 3OPFA 2CFAB 1O26A 1SFOA 2JA7A 2VUMA 3GTPA 1XXCA 4KC6A 4LQYA 2R93A 1IS1A 3AQOA 2PHCB 4GTAA 5CJ9A 3LAPA 3GTJA 3FOFA 3V4GA 5EGEA 3BUEA 3VA7A 4GTCA 3AH5A 4ILDA 1DD5A 3FKIA 5JVOA 4G0WA 1ZBSA 4G0VA 4GT9A 1GE9A 4C3IC 3L4KA 4LR2A 4M1XA 4KMHA 4BLAA 1Y1WA 4GFQA 2JA6A 3G4CA 3N0BA 2RH6A 2YU9A 3OREA 2XCQA 3H0GA 5TJ3A 1F9NA 2XCRB 1O2BA 2Y3PA 2E2HA 5IOTA 1I3QA 1ZVUA 3G4AA 1XXBA 3LAJA 1O25A 1BGWA 4GTLA 1O27A 3Q3QA 5IORA 3N0CA 1B4AA 2R92A 4BKWA 3GTMA 3GTQA 2ZFZA 1Y1VA 1TWCA 5JFEA 1WIHA 3FOEA 1EK8A 1TWAA 4GTBA 4DDQA 3CAGA 3LPXA 2GSNA 3AQPA 4KB4A 4KMAA 3CQZA 1O29A 2GSUA 5EGHA 4FM9A 1O28A 1K83A 3N3YA 2NVXA 1WCMA 4C3JC 2GSOA 2JH3A 3OEPA 4KATA 2CFAA 2NVYA 1TWFA 4G0UA 2R7ZA 1XXAA 4KB2A 1ISEA 4C3HC 4BLBA 4GTFA 3S0XA 3GTOA 4KAWX 2KWAA 2RGRA 4P5BA 2P5MA 1WQGA 4KDDA 4P5AA 4KASA 3ERED 1O2AA 3FHZA 3GTKA 4GTDA 4KM9A 1B4BA 1TWGA 2E2IA 2XCOA 1WQHA 4C2MC 3MMLB 4KM8A 1WQFA 1I50A 3NUHA 1R9TA 1BJTA 3QX3A 5CHPA 1TWHA 1ZXOA 2JA5A 4J3NA 5IOSA 1AB4A 1O24A 3GTLA 4GTEA 3L4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ4 A;  4KAR A;  5IOQ A;  4P5A A;  4FZB A;  2CFA B;  1O26 A;  4KAS A;  1O2A A;  3G4C A;  3N0B A;  5JFE A;  4GTD A;  4GTA A;  4GTB A;  1O2B A;  1O29 A;  5IOT A;  1O28 A;  3N3Y A;  4KAT A;  2CFA A;  3G4A A;  4GTC A;  3AH5 A;  4GTF A;  1O25 A;  5CHP A;  4GTL A;  1O27 A;  5IOR A;  5IOS A;  1O24 A;  3N0C A;  4GTE A;  4GT9 A;  4P5B A; 
#chains in the Genus database with same CATH topology
 1KQ4 A;  1XZP A;  4KAR A;  4KMD A;  3TTG A;  5IOQ A;  3GTG A;  4FZB A;  4C2M K;  2E2I C;  4C3H K;  4KMU A;  1XXC A;  2JA7 C;  3HXA A;  2E2J K;  3I4M C;  3GEE A;  3S16 C;  4A3F C;  2JA6 C;  2PA8 D;  3FOF A;  1SMY A;  1TWH C;  2JA5 C;  1WSR A;  4LJZ A;  3H0G K;  3GTQ C;  1I6H C;  3GTL C;  4LK0 A;  3BUE A;  5C4J C;  3AD9 C;  4Y7N K;  3GDZ A;  4ILD A;  3GEH A;  3FKI A;  3HOX C;  3CQZ C;  4A3B C;  4MQ9 A;  1ZBS A;  5D4D A;  3L4K A;  4LR2 A;  1I50 C;  4Q5S A;  3GEI A;  3N0B A;  5M5Y K;  3HOY C;  1F9N A;  4AYB L;  2XCR B;  4G7H A;  3T00 A;  2O5J A;  1J6X A;  3HOV C;  4PAB A;  1YNN A;  2WB1 D;  2WB1 L;  3LAJ A;  4BY7 K;  2NVY C;  3Q3Q A;  2JA7 K;  3N0C A;  1YX2 A;  3GSI A;  3HOW C;  1JQW A;  4G7O A;  4A3E C;  3SZZ A;  1TWC A;  2P8T A;  4A3C C;  1I3Q C;  1DCH A;  4A3D K;  4YG2 A;  1JVI A;  4KB4 A;  3GTK K;  2NVY K;  1K83 A;  3H3V D;  2JA8 K;  1O28 A;  1G51 A;  4BY7 C;  3HOU C;  3S1N C;  5E68 A;  4WJ4 A;  3OEP A;  4G7Z A;  4G0U A;  4KB2 A;  2NVX K;  2NVT K;  3M3Y K;  5IP7 K;  3GTO A;  4AYB D;  4MEX A;  1IBA A;  1WQG A;  3PO3 C;  1K83 C;  4P5A A;  4X6A C;  4YFK A;  1B4B A;  5C3E K;  4YFX A;  1X31 C;  3S1R K;  4KM8 A;  2ZUF A;  3S2H K;  3S14 C;  2YU9 C;  2ZUE A;  4BXX C;  3S1Q C;  1PJ6 A;  1R9T A;  1BJT A;  1V5V A;  5CHP A;  1UV7 A;  3S2D K;  4J3N A;  5TMF A;  5IOS A;  1O24 A;  1DD5 A;  4A93 C;  3DXJ A;  3FKI K;  1EH1 A;  4OIR A;  3OPF A;  2CFA B;  1O26 A;  2VUM A;  3T01 A;  1USM A;  3ADA C;  1SFO C;  2R93 A;  4A3I K;  4GTA A;  5CJ9 A;  2NVQ C;  4BXX K;  2VUM K;  1TWF K;  4QJV A;  3A8J A;  5IYB C;  5C3E C;  3EQL A;  3AD8 C;  3VA7 A;  3AH5 A;  1BS2 A;  1WCM K;  4X6A K;  2B63 C;  2JA8 C;  1VH2 A;  1J98 A;  2R93 C;  1R9T K;  4GT9 A;  2VUM C;  2PA8 L;  2JA6 A;  5IYB K;  3G4C A;  3M3Y C;  2RH6 A;  2XCQ A;  3RZO K;  4Y52 C;  3HKZ L;  1Y1V K;  3FKI C;  2CW0 A;  1TWG K;  1INN A;  4MEY A;  4OIQ A;  4A3E K;  1BGW A;  1B4A A;  2R92 A;  4WIL A;  3GTJ C;  4PAA A;  3GTM A;  4WJ3 M;  2V6S A;  5IYD K;  1XZQ A;  3GTO C;  3GTM C;  2R92 K;  2A6E A;  5TMC A;  4GTB A;  4DDQ A;  4FM9 A;  1O29 A;  2GSU A;  3A8I A;  1TWC K;  2WAQ L;  3AD7 C;  1IW7 A;  5IP7 C;  5IYC K;  1K83 K;  2NVY A;  4LK1 A;  4OIP A;  4C3H C;  3WOD A;  4BLB A;  4KN7 A;  4KAW X;  2KWA A;  4P5B A;  3SZY A;  3TFJ A;  1TWC C;  3ERE D;  3K7A C;  4XCH A;  4ZH4 A;  1O2A A;  3CQZ K;  4C45 A;  1WCM C;  4C3J K;  1TWG A;  1EFW A;  3S1Q K;  5C4J K;  3GTG K;  4A3B K;  3MML B;  4NOI A;  3IPJ A;  1XZQ B;  2E2J C;  3HOW K;  1WOS A;  1VRQ C;  2JA6 K;  3GTM K;  5IYC C;  4QJV B;  1TWG C;  5FLM C;  2PMZ L;  3GTL A;  2V6U A;  2YU9 K;  2B63 A;  4AH6 A;  1SFO A;  3TFI A;  1RU0 A;  5HL8 A;  1HQM A;  1IS1 A;  3AQO A;  2PHC B;  1J6W A;  5M3F K;  1Y1W C;  2R93 K;  4A3M C;  1R9T C;  4KN4 A;  3V4G A;  4BBS K;  3S1M C;  1USO A;  1VGX A;  1WSV A;  1VJE A;  1XPP A;  4BBR K;  4G0V A;  1GE9 A;  1PJ7 A;  3S16 K;  4A3K K;  4A3F K;  1VLO A;  2GAG C;  4KMH A;  4BLA A;  5L46 A;  1IL2 A;  3GTL K;  3H0G C;  2YU9 A;  3ORE A;  3H0G A;  3HOZ C;  1BDF A;  2E2H A;  5IOT A;  1J6V A;  4OIN A;  2E2I K;  2O5I A;  4A3D C;  1DCP A;  4A3C K;  1XXB A;  1C0A A;  1O2F B;  1I50 K;  1O25 A;  2A68 A;  4XLP A;  2R7Z C;  5IOR A;  3T02 A;  3GTQ K;  4A3J C;  1YCL A;  3HOZ K;  1TWF C;  2V6T A;  2ZFZ A;  3FOE A;  1WIH A;  2E2H C;  1TWA A;  4BBR C;  3CAG A;  2GSN A;  3AQP A;  3PO3 K;  2R7Z K;  5C4X C;  1YNJ A;  1WCM A;  4A93 K;  4A3L K;  2GSO A;  4P9S A;  2CFA A;  4QIW L;  1XXA A;  1I3Q K;  2Y0S L;  3S0X A;  3S2H C;  1F7U A;  2P5M A;  3BP8 C;  3GTK C;  5FJ8 K;  4KAS A;  3FHZ A;  3GTK A;  3HOX K;  4KM9 A;  4A3L C;  1EQR A;  3RZD K;  2E2I A;  1I50 A;  3NUH A;  4QIW D;  5M5X K;  2NVQ K;  3PO2 K;  1ZYR A;  5M5W K;  1TWH A;  1ZXO A;  2A69 A;  3RZO C;  1TWA C;  2JA5 A;  1AB4 A;  4BY1 K;  4YFN A;  4JK1 A;  3L4J A;  3HOU K;  3S1N K;  4Q4Z A;  2JA7 A;  3S1R C;  3I4N K;  3GTP A;  4KC6 A;  4LQY A;  3S15 C;  2B63 K;  3GIR A;  1ZQ1 C;  3S14 K;  5FLM K;  4Y7N C;  1JOE A;  4C3I K;  1L0W A;  3LAP A;  3HKZ D;  1DCO A;  3GTJ A;  5EGE A;  3RZD C;  2E2H K;  4GTC A;  4A3K C;  2D6F C;  3I4M K;  3HOY K;  5JVO A;  4A3I C;  5C4X K;  1WOO A;  3BP3 A;  3A8K A;  1I6H K;  4A3M K;  4G0W A;  4O2D A;  4C3I C;  2Y0S D;  1WOR A;  4M1X A;  1Y1W A;  3S1M K;  4GFQ A;  2NVT C;  2BE5 A;  1XZP B;  5TJ3 A;  4LOW A;  1O2B A;  2Y3P A;  5IYD C;  3H3V L;  1TWA K;  4BY1 C;  1I3Q A;  1ZVU A;  3G4A A;  4GTL A;  3S17 K;  1O27 A;  1SFO K;  2W7V A;  4Y52 K;  3HOV K;  4BKW A;  3PO2 C;  1Y1V C;  3GTQ A;  1Y1V A;  5JFE A;  5C44 K;  1EK8 A;  1HI9 A;  4RMF A;  4A3J K;  3LPX A;  5EGH A;  4KMA A;  2NVX C;  3CQZ A;  5IP9 C;  4XSX A;  3N3Y A;  1EI6 A;  2NVX A;  4A3G K;  1F7V A;  4C3J C;  2JH3 A;  4KAT A;  2R7Z A;  3S15 K;  1TWF A;  1ISE A;  4GTF A;  3TFH A;  2GAH C;  5C44 C;  2EBB A;  2RGR A;  3GTP K;  3M4O C;  1F93 A;  2WAQ D;  5IP9 K;  4KDD A;  1TWH K;  2JA5 K;  1WOP A;  4GTD A;  4BBS C;  2A6H A;  5M3M K;  2XCO A;  4LLG A;  1PJ5 A;  1WQH A;  4C2M C;  3S2D C;  1WQF A;  3GTP C;  3M4O K;  1IE0 A;  3S17 C;  2R92 C;  2FQO A;  2PPB A;  3GTO K;  3JST A;  4OIO A;  3GTJ K;  1IQ0 A;  3I4N C;  3QX3 A;  4XLN A;  3K7A K;  1Y1W K;  2FQT A;  1I6V A;  4XSZ A;  4GTE A;  4A3G C;  4GZY A;  2PMZ D;  3GTG C; 
#chains in the Genus database with same CATH homology
 1KQ4 A;  2B63 A;  4KAR A;  4KMD A;  5IOQ A;  1EH1 A;  3GTG A;  4FZB A;  3OPF A;  2CFA B;  1O26 A;  1SFO A;  2JA7 A;  2VUM A;  3GTP A;  1XXC A;  4KC6 A;  4LQY A;  2R93 A;  1IS1 A;  3AQO A;  2PHC B;  4GTA A;  5CJ9 A;  3LAP A;  3GTJ A;  3FOF A;  3V4G A;  5EGE A;  3BUE A;  3VA7 A;  4GTC A;  3AH5 A;  4ILD A;  1DD5 A;  3FKI A;  5JVO A;  4G0W A;  1ZBS A;  4G0V A;  4GT9 A;  1GE9 A;  4C3I C;  3L4K A;  4LR2 A;  4M1X A;  4KMH A;  4BLA A;  1Y1W A;  4GFQ A;  2JA6 A;  3G4C A;  3N0B A;  2RH6 A;  2YU9 A;  3ORE A;  2XCQ A;  3H0G A;  5TJ3 A;  1F9N A;  2XCR B;  1O2B A;  2Y3P A;  2E2H A;  5IOT A;  1I3Q A;  1ZVU A;  3G4A A;  1XXB A;  3LAJ A;  1O25 A;  1BGW A;  4GTL A;  1O27 A;  3Q3Q A;  5IOR A;  3N0C A;  1B4A A;  2R92 A;  4BKW A;  3GTM A;  3GTQ A;  2ZFZ A;  1Y1V A;  1TWC A;  5JFE A;  1WIH A;  3FOE A;  1EK8 A;  1TWA A;  4GTB A;  4DDQ A;  3CAG A;  3LPX A;  2GSN A;  3AQP A;  4KB4 A;  4KMA A;  3CQZ A;  1O29 A;  2GSU A;  5EGH A;  4FM9 A;  1O28 A;  1K83 A;  3N3Y A;  2NVX A;  1WCM A;  4C3J C;  2GSO A;  2JH3 A;  3OEP A;  4KAT A;  2CFA A;  2NVY A;  1TWF A;  4G0U A;  2R7Z A;  1XXA A;  4KB2 A;  1ISE A;  4C3H C;  4BLB A;  4GTF A;  3S0X A;  3GTO A;  4KAW X;  2KWA A;  2RGR A;  4P5B A;  2P5M A;  1WQG A;  4KDD A;  4P5A A;  4KAS A;  3ERE D;  1O2A A;  3FHZ A;  3GTK A;  4GTD A;  4KM9 A;  1B4B A;  1TWG A;  2E2I A;  2XCO A;  1WQH A;  4C2M C;  3MML B;  4KM8 A;  1WQF A;  1I50 A;  3NUH A;  1R9T A;  1BJT A;  3QX3 A;  5CHP A;  1TWH A;  1ZXO A;  2JA5 A;  4J3N A;  5IOS A;  1AB4 A;  1O24 A;  3GTL A;  4GTE A;  3L4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...