4GTFA

T. maritima fdts (h53a mutant) with fad, dump and folate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
213
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMKDEERDRHLIEYLMKHGAETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 79
structure length 213
sequence length 215
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtfA00
4GTCA 4GTFA 4KASA 5CHPA 3N3YA 5IORA 3N0BA 1O2AA 4GT9A 5IOQA 3N0CA 5IOTA 1O2BA 1O25A 2CFAA 4GTEA 4GTLA 4P5AA 3G4CA 1O28A 1KQ4A 4FZBA 1O27A 1O24A 3G4AA 4GTAA 1O29A 1O26A 3AH5A 5JFEA 4GTBA 4KATA 4P5BA 4KARA 5IOSA 4GTDA 2CFAB
chains in the Genus database with same CATH superfamily
3S14K 2R92A 3H0GA 4BY1K 5IYDK 3HKZD 4KDDA 1L0WA 5C44K 1INNA 3IPJA 3GTKK 4WJ3M 3GTQA 5D4DA 4BY7K 3N0CA 5M5XK 4OIPA 4XLNA 4BBRC 3S1RK 2E2JC 3ERED 3S17C 4A3JC 3BP8C 4C2MK 4J3NA 4GZYA 2PMZD 2JA5K 1JQWA 5HL8A 4QJVA 3HOZC 1I3QK 2KWAA 3TTGA 5CJ9A 2CW0A 1EK8A 4A3KC 3S2DK 3I4MK 5M3MK 4KM8A 3S2HK 3T00A 2NVTK 1R9TC 4A3DC 3GTLA 1ISEA 4ZH4A 1XZPA 1WSVA 1YX2A 2PHCB 4Y7NK 4O2DA 2E2HA 4FZBA 2JH3A 1WSRA 5FJ8K 1I6VA 3LAJA 4BBRK 1YNJA 2E2JK 1SMYA 4A3JK 3S17K 1VRQC 2GAGC 4Y52K 2B63A 3GTKA 3A8IA 5C4JC 3S1MC 1BGWA 3HOZK 3LPXA 5IYCK 4LK0A 2FQTA 2FQOA 4YFNA 1R9TK 4A3DK 1I3QA 3VA7A 1ZYRA 1TWFK 4G0WA 3S1QC 2R7ZK 4A3MC 3S15K 1VJEA 4KMHA 1Y1WA 4A3GC 1I50C 4ILDA 1TWHC 2O5JA 1DCOA 2NVYC 1Y1VC 5M5WK 2ZFZA 5C4JK 5IP9C 3S1MK 2PPBA 5IP7C 4BLBA 4BLAA 1O2BA 4NOIA 3G4CA 4P9SA 3GIRA 4QIWL 4LLGA 3RZDC 1TWGC 2ZUEA 4KAWX 4WJ4A 4KATA 3TFIA 4KN7A 2W7VA 3S1QK 1TWAC 5FLMC 4GTCA 3GTGC 4LJZA 5CHPA 4A3MK 4G7ZA 1XZQB 2GSOA 4KMUA 1I50K 1TWHK 2JA8C 1TWFA 1C0AA 4KMAA 3EQLA 3S16C 4P5AA 1EI6A 5IP9K 3M3YC 3GTMA 2R7ZA 2WB1L 5IP7K 2NVXC 3FOEA 1YCLA 4MEXA 1O26A 3BUEA 5TMFA 3I4NC 4KMDA 1BDFA 1YNNA 3CQZA 4BXXC 1ZBSA 2V6UA 3RZDK 1TWGK 5C4XK 5M3FK 3S1NC 4GTFA 4MQ9A 1B4BA 3N3YA 1TWAK 5FLMK 3GTGK 1F93A 3HOUC 1K83C 3GTJA 4LK1A 4GTEA 3GSIA 2E2IC 3L4JA 2JA8K 1DD5A 1TWCA 4MEYA 2R93C 4QIWD 3S16K 3CAGA 4KC6A 1JVIA 3M3YK 1F9NA 4OIQA 1WORA 2BE5A 2XCOA 2WAQL 1UV7A 1I50A 1USMA 1SFOC 1EFWA 3GEHA 3HOYC 4BXXK 3HOVC 1WQFA 2A69A 4A93C 4G7HA 1O2AA 4YG2A 3FOFA 3QX3A 3S1NK 3H3VL 5M5YK 4GT9A 4PAAA 2VUMC 1WIHA 1XXCA 3LAPA 1X31C 1WCMA 4BBSC 3HOXC 4Q4ZA 3HOUK 1K83K 1O24A 4C3HC 3HOWC 4OIRA 1WOOA 2WB1D 4A3IC 4WILA 2E2IK 3GTOC 1TWAA 2R93K 4AYBL 1XPPA 4QJVB 3TFHA 4A3KK 2YU9C 1SFOK 3HOYK 3HOVK 1AB4A 4A93K 2JA5A 4C45A 1O28A 4Q5SA 2VUMK 1XZPB 1WQHA 3HXAA 4BBSK 4P5BA 3HOXK 4KASA 4C3HK 2R92C 3HOWK 4A3BC 1ZVUA 2WAQD 3TFJA 4KB2A 4G7OA 1VLOA 3AQPA 2XCQA 1USOA 3OREA 3JSTA 2ZUFA 4LQYA 2JA7C 3H3VD 1IBAA 4GFQA 5TJ3A 2E2IA 3SZZA 2YU9K 1KQ4A 3FKIC 3GDZA 1WOPA 2R93A 3PO2C 3AH5A 1VH2A 1PJ5A 3T02A 3PO3C 2GSUA 1O27A 1IS1A 1J98A 2V6SA 1SFOA 1XXAA 4AYBD 1R9TA 2R92K 5IORA 3GTLC 4M1XA 4C3JC 4G0UA 4KM9A 4XLPA 4A3BK 5C3EC 4A3GK 1WQGA 5IOQA 3M4OC 2NVYK 1Y1VK 2E2HC 2CFAA 3GTPC 3S14C 3MMLB 2Y0SL 1HI9A 4BY1C 2JA7K 1BJTA 1O29A 1DCPA 3FKIK 5C44C 2B63C 3PO2K 3PO3K 3N0BA 1IW7A 2YU9A 4AH6A 1PJ7A 2NVQC 2RH6A 3GTLK 4OINA 4C3JK 1O25A 5C3EK 3AD7C 4RMFA 5IYBC 1DCHA 2E2HK 3S2HC 3V4GA 3GTPK 1IL2A 4BKWA 1Y1WC 4YFXA 2NVXK 3WODA 1TWHA 1ZXOA 2O5IA 3I4NK 2NVYA 1Y1VA 3T01A 4Y7NC 2B63K 4DDQA 1V5VA 2JA6C 1IQ0A 2JA7A 3NUHA 2XCRB 3FKIA 1BS2A 4Y52C 4A3FC 2NVQK 1TWGA 2Y0SD 4YFKA 4PABA 5IYBK 4X6AC 2PA8L 1IE0A 5IYCC 3GTGA 3A8KA 3RZOC 1Y1WK 4A3EC 3ADAC 2RGRA 2P8TA 4C3IC 1TWFC 3GTMC 2R7ZC 3S15C 3GTPA 3DXJA 2JA6K 1F7VA 3AD9C 1PJ6A 3GEIA 5JFEA 2NVXA 1B4AA 3CQZC 3Q3QA 4XSXA 5IOSA 4A3FK 4A3LC 3H0GC 3L4KA 2A6HA 1VGXA 3FHZA 4A3IK 2P5MA 1J6VA 3GTOK 1I6HC 4FM9A 4X6AK 1F7UA 3GTJC 2A68A 3OEPA 3GTQC 3RZOK 1K83A 4A3EK 5E68A 5EGHA 4GTLA 4C3IK 1ZQ1C 1TWCC 4JK1A 2GAHC 3K7AC 2A6EA 1XZQA 3GTMK 3AD8C 4OIOA 1G51A 4XCHA 5L46A 3HKZL 2GSNA 3CQZK 1GE9A 2PA8D 1HQMA 1J6WA 4A3LK 3H0GK 2JA6A 4KB4A 1J6XA 3OPFA 5TMCA 1EH1A 5IOTA 3A8JA 2VUMA 1WCMC 3GEEA 1I6HK 2Y3PA 2PMZL 2D6FC 4A3CC 3GTJK 3GTQK 5C4XC 3SZYA 3BP3A 5IYDC 1XXBA 4GTBA 4KARA 1EQRA 4LR2A 4LOWA 1TWCK 4GTDA 3GTOA 3S0XA 3K7AK 3GTKC 1O2FB 2V6TA 4BY7C 3S1RC 4C2MC 1RU0A 4KN4A 2JA5C 5JVOA 1I3QC 1JOEA 3M4OK 3S2DC 3G4AA 1WOSA 4GTAA 5EGEA 2EBBA 1WCMK 4XSZA 3I4MC 4G0VA 4A3CK 2NVTC 3AQOA 2CFAB
chains in the Genus database with same CATH topology
2R92A 3H0GA 4GTCA 1ZVUA 3GTGA 5CHPA 4KB2A 4KDDA 2GSOA 3AQPA 2XCQA 3OREA 2RGRA 4C3IC 3GTQA 4LQYA 3N0CA 1TWFA 4KMAA 4GFQA 5TJ3A 4P5AA 3ERED 3GTPA 3GTMA 2R7ZA 2E2IA 1KQ4A 4J3NA 2R93A 3FOEA 2NVXA 1O26A 3AH5A 3BUEA 1B4AA 5JFEA 4KMDA 3CQZA 2KWAA 3Q3QA 1ZBSA 5CJ9A 2GSUA 1O27A 1EK8A 1IS1A 5IOSA 4GTFA 4KM8A 1XXAA 3L4KA 1SFOA 3FHZA 2P5MA 1B4BA 3N3YA 1R9TA 5IORA 4M1XA 3GTLA 4C3JC 4G0UA 1ISEA 4KM9A 4FM9A 1WQGA 5IOQA 3OEPA 3GTJA 2PHCB 1K83A 2CFAA 5EGHA 4GTLA 4GTEA 2E2HA 3L4JA 4FZBA 1DD5A 2JH3A 1TWCA 3MMLB 3LAJA 1BJTA 1O29A 3CAGA 4KC6A 1F9NA 2XCOA 2GSNA 2B63A 3GTKA 1I50A 1BGWA 1GE9A 3LPXA 1WQFA 3N0BA 1O2AA 3FOFA 2JA6A 3QX3A 2YU9A 4GT9A 4KB4A 3OPFA 1EH1A 5IOTA 2RH6A 1WIHA 2VUMA 1XXCA 3LAPA 1WCMA 1O25A 2Y3PA 1I3QA 3VA7A 1O24A 4C3HC 4G0WA 1XXBA 4GTBA 4KARA 4LR2A 3V4GA 4KMHA 4BKWA 4GTDA 3GTOA 3S0XA 1Y1WA 1TWAA 4ILDA 1TWHA 1ZXOA 2NVYA 1Y1VA 2ZFZA 4DDQA 4C2MC 2JA7A 4BLBA 1AB4A 4BLAA 2JA5A 3NUHA 1O2BA 5JVOA 3G4CA 1O28A 3FKIA 2XCRB 3G4AA 1TWGA 4KAWX 4GTAA 5EGEA 1WQHA 4KATA 4P5BA 4G0VA 3AQOA 4KASA 2CFAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTC A;  4GTF A;  4KAS A;  5CHP A;  3N3Y A;  5IOR A;  3N0B A;  1O2A A;  4GT9 A;  5IOQ A;  3N0C A;  5IOT A;  1O2B A;  1O25 A;  2CFA A;  4GTE A;  4GTL A;  4P5A A;  3G4C A;  1O28 A;  1KQ4 A;  4FZB A;  1O27 A;  1O24 A;  3G4A A;  4GTA A;  1O29 A;  1O26 A;  3AH5 A;  5JFE A;  4GTB A;  4KAT A;  4P5B A;  4KAR A;  5IOS A;  4GTD A;  2CFA B; 
#chains in the Genus database with same CATH topology
 3S14 K;  2R92 A;  3H0G A;  4BY1 K;  5IYD K;  3HKZ D;  4KDD A;  1L0W A;  5C44 K;  1INN A;  3IPJ A;  3GTK K;  4WJ3 M;  3GTQ A;  5D4D A;  4BY7 K;  3N0C A;  5M5X K;  4OIP A;  4XLN A;  4BBR C;  3S1R K;  2E2J C;  3ERE D;  3S17 C;  4A3J C;  3BP8 C;  4C2M K;  4J3N A;  4GZY A;  2PMZ D;  2JA5 K;  1JQW A;  5HL8 A;  4QJV A;  3HOZ C;  1I3Q K;  2KWA A;  3TTG A;  5CJ9 A;  2CW0 A;  1EK8 A;  4A3K C;  3S2D K;  3I4M K;  5M3M K;  4KM8 A;  3S2H K;  3T00 A;  2NVT K;  1R9T C;  4A3D C;  3GTL A;  1ISE A;  4ZH4 A;  1XZP A;  1WSV A;  1YX2 A;  2PHC B;  4Y7N K;  4O2D A;  2E2H A;  4FZB A;  2JH3 A;  1WSR A;  5FJ8 K;  1I6V A;  3LAJ A;  4BBR K;  1YNJ A;  2E2J K;  1SMY A;  4A3J K;  3S17 K;  1VRQ C;  2GAG C;  4Y52 K;  2B63 A;  3GTK A;  3A8I A;  5C4J C;  3S1M C;  1BGW A;  3HOZ K;  3LPX A;  5IYC K;  4LK0 A;  2FQT A;  2FQO A;  4YFN A;  1R9T K;  4A3D K;  1I3Q A;  3VA7 A;  1ZYR A;  1TWF K;  4G0W A;  3S1Q C;  2R7Z K;  4A3M C;  3S15 K;  1VJE A;  4KMH A;  1Y1W A;  4A3G C;  1I50 C;  4ILD A;  1TWH C;  2O5J A;  1DCO A;  2NVY C;  1Y1V C;  5M5W K;  2ZFZ A;  5C4J K;  5IP9 C;  3S1M K;  2PPB A;  5IP7 C;  4BLB A;  4BLA A;  1O2B A;  4NOI A;  3G4C A;  4P9S A;  3GIR A;  4QIW L;  4LLG A;  3RZD C;  1TWG C;  2ZUE A;  4KAW X;  4WJ4 A;  4KAT A;  3TFI A;  4KN7 A;  2W7V A;  3S1Q K;  1TWA C;  5FLM C;  4GTC A;  3GTG C;  4LJZ A;  5CHP A;  4A3M K;  4G7Z A;  1XZQ B;  2GSO A;  4KMU A;  1I50 K;  1TWH K;  2JA8 C;  1TWF A;  1C0A A;  4KMA A;  3EQL A;  3S16 C;  4P5A A;  1EI6 A;  5IP9 K;  3M3Y C;  3GTM A;  2R7Z A;  2WB1 L;  5IP7 K;  2NVX C;  3FOE A;  1YCL A;  4MEX A;  1O26 A;  3BUE A;  5TMF A;  3I4N C;  4KMD A;  1BDF A;  1YNN A;  3CQZ A;  4BXX C;  1ZBS A;  2V6U A;  3RZD K;  1TWG K;  5C4X K;  5M3F K;  3S1N C;  4GTF A;  4MQ9 A;  1B4B A;  3N3Y A;  1TWA K;  5FLM K;  3GTG K;  1F93 A;  3HOU C;  1K83 C;  3GTJ A;  4LK1 A;  4GTE A;  3GSI A;  2E2I C;  3L4J A;  2JA8 K;  1DD5 A;  1TWC A;  4MEY A;  2R93 C;  4QIW D;  3S16 K;  3CAG A;  4KC6 A;  1JVI A;  3M3Y K;  1F9N A;  4OIQ A;  1WOR A;  2BE5 A;  2XCO A;  2WAQ L;  1UV7 A;  1I50 A;  1USM A;  1SFO C;  1EFW A;  3GEH A;  3HOY C;  4BXX K;  3HOV C;  1WQF A;  2A69 A;  4A93 C;  4G7H A;  1O2A A;  4YG2 A;  3FOF A;  3QX3 A;  3S1N K;  3H3V L;  5M5Y K;  4GT9 A;  4PAA A;  2VUM C;  1WIH A;  1XXC A;  3LAP A;  1X31 C;  1WCM A;  4BBS C;  3HOX C;  4Q4Z A;  3HOU K;  1K83 K;  1O24 A;  4C3H C;  3HOW C;  4OIR A;  1WOO A;  2WB1 D;  4A3I C;  4WIL A;  2E2I K;  3GTO C;  1TWA A;  2R93 K;  4AYB L;  1XPP A;  4QJV B;  3TFH A;  4A3K K;  2YU9 C;  1SFO K;  3HOY K;  3HOV K;  1AB4 A;  4A93 K;  2JA5 A;  4C45 A;  1O28 A;  4Q5S A;  2VUM K;  1XZP B;  1WQH A;  3HXA A;  4BBS K;  4P5B A;  3HOX K;  4KAS A;  4C3H K;  2R92 C;  3HOW K;  4A3B C;  1ZVU A;  2WAQ D;  3TFJ A;  4KB2 A;  4G7O A;  1VLO A;  3AQP A;  2XCQ A;  1USO A;  3ORE A;  3JST A;  2ZUF A;  4LQY A;  2JA7 C;  3H3V D;  1IBA A;  4GFQ A;  5TJ3 A;  2E2I A;  3SZZ A;  2YU9 K;  1KQ4 A;  3FKI C;  3GDZ A;  1WOP A;  2R93 A;  3PO2 C;  3AH5 A;  1VH2 A;  1PJ5 A;  3T02 A;  3PO3 C;  2GSU A;  1O27 A;  1IS1 A;  1J98 A;  2V6S A;  1SFO A;  1XXA A;  4AYB D;  1R9T A;  2R92 K;  5IOR A;  3GTL C;  4M1X A;  4C3J C;  4G0U A;  4KM9 A;  4XLP A;  4A3B K;  5C3E C;  4A3G K;  1WQG A;  5IOQ A;  3M4O C;  2NVY K;  1Y1V K;  2E2H C;  2CFA A;  3GTP C;  3S14 C;  3MML B;  2Y0S L;  1HI9 A;  4BY1 C;  2JA7 K;  1BJT A;  1O29 A;  1DCP A;  3FKI K;  5C44 C;  2B63 C;  3PO2 K;  3PO3 K;  3N0B A;  1IW7 A;  2YU9 A;  4AH6 A;  1PJ7 A;  2NVQ C;  2RH6 A;  3GTL K;  4OIN A;  4C3J K;  1O25 A;  5C3E K;  3AD7 C;  4RMF A;  5IYB C;  1DCH A;  2E2H K;  3S2H C;  3V4G A;  3GTP K;  1IL2 A;  4BKW A;  1Y1W C;  4YFX A;  2NVX K;  3WOD A;  1TWH A;  1ZXO A;  2O5I A;  3I4N K;  2NVY A;  1Y1V A;  3T01 A;  4Y7N C;  2B63 K;  4DDQ A;  1V5V A;  2JA6 C;  1IQ0 A;  2JA7 A;  3NUH A;  2XCR B;  3FKI A;  1BS2 A;  4Y52 C;  4A3F C;  2NVQ K;  1TWG A;  2Y0S D;  4YFK A;  4PAB A;  5IYB K;  4X6A C;  2PA8 L;  1IE0 A;  5IYC C;  3GTG A;  3A8K A;  3RZO C;  1Y1W K;  4A3E C;  3ADA C;  2RGR A;  2P8T A;  4C3I C;  1TWF C;  3GTM C;  2R7Z C;  3S15 C;  3GTP A;  3DXJ A;  2JA6 K;  1F7V A;  3AD9 C;  1PJ6 A;  3GEI A;  5JFE A;  2NVX A;  1B4A A;  3CQZ C;  3Q3Q A;  4XSX A;  5IOS A;  4A3F K;  4A3L C;  3H0G C;  3L4K A;  2A6H A;  1VGX A;  3FHZ A;  4A3I K;  2P5M A;  1J6V A;  3GTO K;  1I6H C;  4FM9 A;  4X6A K;  1F7U A;  3GTJ C;  2A68 A;  3OEP A;  3GTQ C;  3RZO K;  1K83 A;  4A3E K;  5E68 A;  5EGH A;  4GTL A;  4C3I K;  1ZQ1 C;  1TWC C;  4JK1 A;  2GAH C;  3K7A C;  2A6E A;  1XZQ A;  3GTM K;  3AD8 C;  4OIO A;  1G51 A;  4XCH A;  5L46 A;  3HKZ L;  2GSN A;  3CQZ K;  1GE9 A;  2PA8 D;  1HQM A;  1J6W A;  4A3L K;  3H0G K;  2JA6 A;  4KB4 A;  1J6X A;  3OPF A;  5TMC A;  1EH1 A;  5IOT A;  3A8J A;  2VUM A;  1WCM C;  3GEE A;  1I6H K;  2Y3P A;  2PMZ L;  2D6F C;  4A3C C;  3GTJ K;  3GTQ K;  5C4X C;  3SZY A;  3BP3 A;  5IYD C;  1XXB A;  4GTB A;  4KAR A;  1EQR A;  4LR2 A;  4LOW A;  1TWC K;  4GTD A;  3GTO A;  3S0X A;  3K7A K;  3GTK C;  1O2F B;  2V6T A;  4BY7 C;  3S1R C;  4C2M C;  1RU0 A;  4KN4 A;  2JA5 C;  5JVO A;  1I3Q C;  1JOE A;  3M4O K;  3S2D C;  3G4A A;  1WOS A;  4GTA A;  5EGE A;  2EBB A;  1WCM K;  4XSZ A;  3I4M C;  4G0V A;  4A3C K;  2NVT C;  3AQO A;  2CFA B; 
#chains in the Genus database with same CATH homology
 2R92 A;  3H0G A;  4GTC A;  1ZVU A;  3GTG A;  5CHP A;  4KB2 A;  4KDD A;  2GSO A;  3AQP A;  2XCQ A;  3ORE A;  2RGR A;  4C3I C;  3GTQ A;  4LQY A;  3N0C A;  1TWF A;  4KMA A;  4GFQ A;  5TJ3 A;  4P5A A;  3ERE D;  3GTP A;  3GTM A;  2R7Z A;  2E2I A;  1KQ4 A;  4J3N A;  2R93 A;  3FOE A;  2NVX A;  1O26 A;  3AH5 A;  3BUE A;  1B4A A;  5JFE A;  4KMD A;  3CQZ A;  2KWA A;  3Q3Q A;  1ZBS A;  5CJ9 A;  2GSU A;  1O27 A;  1EK8 A;  1IS1 A;  5IOS A;  4GTF A;  4KM8 A;  1XXA A;  3L4K A;  1SFO A;  3FHZ A;  2P5M A;  1B4B A;  3N3Y A;  1R9T A;  5IOR A;  4M1X A;  3GTL A;  4C3J C;  4G0U A;  1ISE A;  4KM9 A;  4FM9 A;  1WQG A;  5IOQ A;  3OEP A;  3GTJ A;  2PHC B;  1K83 A;  2CFA A;  5EGH A;  4GTL A;  4GTE A;  2E2H A;  3L4J A;  4FZB A;  1DD5 A;  2JH3 A;  1TWC A;  3MML B;  3LAJ A;  1BJT A;  1O29 A;  3CAG A;  4KC6 A;  1F9N A;  2XCO A;  2GSN A;  2B63 A;  3GTK A;  1I50 A;  1BGW A;  1GE9 A;  3LPX A;  1WQF A;  3N0B A;  1O2A A;  3FOF A;  2JA6 A;  3QX3 A;  2YU9 A;  4GT9 A;  4KB4 A;  3OPF A;  1EH1 A;  5IOT A;  2RH6 A;  1WIH A;  2VUM A;  1XXC A;  3LAP A;  1WCM A;  1O25 A;  2Y3P A;  1I3Q A;  3VA7 A;  1O24 A;  4C3H C;  4G0W A;  1XXB A;  4GTB A;  4KAR A;  4LR2 A;  3V4G A;  4KMH A;  4BKW A;  4GTD A;  3GTO A;  3S0X A;  1Y1W A;  1TWA A;  4ILD A;  1TWH A;  1ZXO A;  2NVY A;  1Y1V A;  2ZFZ A;  4DDQ A;  4C2M C;  2JA7 A;  4BLB A;  1AB4 A;  4BLA A;  2JA5 A;  3NUH A;  1O2B A;  5JVO A;  3G4C A;  1O28 A;  3FKI A;  2XCR B;  3G4A A;  1TWG A;  4KAW X;  4GTA A;  5EGE A;  1WQH A;  4KAT A;  4P5B A;  4G0V A;  3AQO A;  4KAS A;  2CFA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...