4GTFA

T. maritima fdts (h53a mutant) with fad, dump and folate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
213
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMKDEERDRHLIEYLMKHGAETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 79
structure length 213
sequence length 215
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtfA00
1O24A 4GT9A 4GTFA 2CFAB 1O28A 4GTAA 1O2BA 1O26A 3N3YA 1KQ4A 4GTLA 4GTDA 5JFEA 4GTCA 4P5BA 4GTEA 5IOTA 3N0CA 1O2AA 4KATA 5IOQA 2CFAA 5IORA 5IOSA 3N0BA 3AH5A 4FZBA 4P5AA 5CHPA 1O27A 3G4CA 3G4AA 4KASA 1O29A 1O25A 4KARA 4GTBA
chains in the Genus database with same CATH superfamily
4QJVA 4A3JK 4BXXK 1J98A 3GTKK 1XZQA 5C4JK 4KC6A 3T01A 3S16K 1J6VA 1KQ4A 5M5YK 3S14C 4MEYA 3HOYC 1AB4A 5L46A 3HOVK 1ZBSA 1TWGA 4KMHA 5IOQA 3S1RC 3HKZD 4P5AA 1TWHC 4G7OA 2R7ZA 1Y1VA 3CQZK 1UV7A 3TFIA 5IYDK 4XLNA 2P8TA 4BBSK 1WQHA 1F9NA 3S1NC 3GTQK 3FKIK 2JA7C 3GDZA 4WILA 4MQ9A 1JVIA 3NUHA 3M4OK 4A3KK 3GTOK 1WSRA 5EGEA 1DCPA 4KASA 2V6SA 3SZYA 1GE9A 4FM9A 4LR2A 3GTMK 3H0GA 1YCLA 2NVYC 4OIRA 4A93K 1TWAC 3HOWC 2GSUA 1O28A 3GEHA 3EQLA 3S2DK 1EK8A 1R9TK 1I6HK 1TWCK 2ZUFA 4KDDA 4AH6A 3OREA 4A3IC 1C0AA 1USMA 2PA8L 3PO2C 4C3JC 2KWAA 3GTGA 3S1MC 3RZDC 4BY1C 2R92A 2CW0A 4LOWA 3K7AC 2NVXC 3GTLK 1EQRA 5IP9K 1WCMK 4Y7NC 1Y1WA 1IW7A 4X6AK 2VUMK 3GTGK 4C3IC 2GSOA 1BS2A 4BBRK 2JA6A 2NVQC 3GTPC 3M3YC 1WOOA 2JH3A 4KN4A 2XCRB 2BE5A 3GIRA 1SMYA 4RMFA 4A3LC 5CHPA 3BP3A 2NVTK 3G4AA 4BLBA 4PAAA 1EFWA 5FJ8K 2E2JK 1XXCA 4G7HA 1L0WA 5IP7C 1YNNA 2R93K 1O2FB 3GTJA 1DCOA 1WQGA 4ZH4A 4DDQA 1SFOK 1B4AA 2PHCB 1TWFC 1I50A 4WJ4A 4C3HK 4GTEA 3GTKA 1JQWA 2JA8K 2D6FC 1J6WA 3FOEA 4KAWX 5IYCK 3TFHA 4G0UA 1TWGC 5C3EK 2JA5K 1K83K 4A3EC 3PO3C 1F7UA 2YU9K 4A3CC 1VLOA 3S2HC 3GEIA 2XCOA 2E2HK 2WAQL 2A68A 1HI9A 1DD5A 4GFQA 4KM8A 3S1QC 2R7ZC 5FLMK 1Y1VC 5JFEA 1IE0A 3HOUC 3JSTA 4AYBD 3CQZA 3A8JA 1XZPA 5C44K 3LAJA 4QJVB 5IYBC 1B4BA 2WB1L 3S15K 3OEPA 4GZYA 1XZQB 3IPJA 4A3FC 3S17K 3GTQA 3FKIA 4KB2A 4OIQA 5TMFA 4C2MC 2A6HA 4XSZA 2P5MA 2Y3PA 5JVOA 3RZOK 3GTOA 5EGHA 4O2DA 3N3YA 1ZXOA 4YFKA 4GTDA 3H0GC 3GTMA 4A3MC 4QIWD 5HL8A 1ZQ1C 4Y52K 4A3GC 4KM9A 5C4XK 3I4MK 3HOZC 1O27A 2E2IK 1R9TA 1I3QK 1TWCA 3SZZA 1WQFA 2B63K 2Y0SD 4JK1A 3S1NK 4A3BK 4GTAA 2V6UA 2R92C 2PPBA 4GTCA 5TMCA 3BUEA 3N0CA 3GTLA 3S14K 5CJ9A 5IORA 1VJEA 3HOYK 1Y1WC 1WOSA 5TJ3A 5IOSA 3LPXA 1WCMA 2VUMA 4BY7C 3S1RK 1DCHA 2JA6C 3HKZL 1TWHK 1V5VA 1IS1A 4WJ3M 3HOXC 3H3VD 3TTGA 2FQTA 3S0XA 1F93A 3AD7C 4G0VA 2PMZD 2JA7K 1WORA 3GTJC 2XCQA 3FOFA 2O5JA 2R93A 1IQ0A 3I4NC 1I50C 2EBBA 1SFOA 4A3DC 1YX2A 4Q5SA 4A3JC 4BXXC 1BGWA 3GTKC 5C4JC 4XSXA 3S16C 2NVYK 1EI6A 5E68A 1TWAK 3HOWK 1I6VA 2ZUEA 4KN7A 4G0WA 3HOVC 1X31C 2JA5A 1K83A 1ZYRA 4KATA 3AQPA 2YU9A 1RU0A 2A6EA 1ZVUA 4A3IK 2E2HA 3WODA 3AH5A 3S17C 3PO2K 4C3JK 1O25A 3CQZC 3S1MK 3RZDK 4BY1K 5IYDC 4GT9A 2NVXK 4BBSC 1ISEA 4OIPA 5D4DA 3FHZA 5M5XK 4ILDA 3GTQC 1PJ7A 3FKIC 4PABA 4Y7NK 4GTLA 1HQMA 4C3IK 3M4OC 4LK1A 2V6TA 4A3KC 3BP8C 3GTOC 2NVQK 3HXAA 3T00A 4LLGA 3GTPK 3M3YK 4P9SA 2GAGC 2GAHC 3GTMC 1IBAA 2RGRA 4LQYA 1YNJA 4A3BC 4A3LK 1WIHA 4A93C 3L4JA 3Q3QA 4OINA 4NOIA 1XZPB 1O2BA 5IP7K 3S2DC 3ERED 1R9TC 4LK0A 4YFNA 4J3NA 1I6HC 1TWCC 2E2IA 2FQOA 1I3QA 1TWFK 4KB4A 2PA8D 1XXBA 2CFAA 2B63A 5M3FK 3AQOA 4C45A 3GTLC 3VA7A 1EH1A 3GEEA 1INNA 4OIOA 5IP9C 1WCMC 1TWGK 3CAGA 1PJ6A 4A3EK 3PO3K 2CFAB 4X6AC 4A3CK 2VUMC 3GTGC 3S2HK 1G51A 4YFXA 4BBRC 2ZFZA 3S1QK 2R7ZK 1TWHA 1USOA 1Y1VK 4P5BA 1O2AA 3HOUK 4AYBL 4BLAA 3MMLB 2NVTC 4FZBA 5IYBK 1IL2A 2E2JC 1BDFA 2GSNA 4A3FK 2JA7A 5M3MK 2O5IA 2R93C 4YG2A 5M5WK 4C2MK 1SFOC 3DXJA 1BJTA 1XPPA 4C3HC 3LAPA 2W7VA 4Q4ZA 3H0GK 5IOTA 4KMDA 4A3MK 4QIWL 3A8IA 2JA8C 1VH2A 3N0BA 2NVYA 4A3GK 5IYCC 1TWAA 3TFJA 2A69A 5C3EC 2JA5C 1K83C 4LJZA 3HOZK 2YU9C 4KARA 3AD9C 4GTBA 1WSVA 2E2HC 2WAQD 4GTFA 2Y0SL 3L4KA 5FLMC 1O26A 3V4GA 4BKWA 2R92K 4G7ZA 1F7VA 5C44C 3T02A 2WB1D 3QX3A 3S15C 2NVXA 3AD8C 1WOPA 4M1XA 1Y1WK 1VRQC 3G4CA 4XCHA 4BY7K 3A8KA 2JA6K 3ADAC 4XLPA 1PJ5A 3RZOC 1O24A 3K7AK 3OPFA 3GTPA 4KMUA 3HOXK 3H3VL 4KMAA 4Y52C 1VGXA 1JOEA 1J6XA 5C4XC 2PMZL 4MEXA 3GSIA 3I4MC 3GTJK 2E2IC 1XXAA 1I3QC 1O29A 3I4NK 1I50K 4A3DK 2B63C 2RH6A 1TWFA
chains in the Genus database with same CATH topology
1XXCA 3CAGA 1IS1A 2CFAB 4KC6A 3GTJA 1WQGA 4DDQA 1B4AA 2PHCB 1KQ4A 2ZFZA 1I50A 3S0XA 1TWHA 4G0VA 4P5BA 4GTEA 1O2AA 1AB4A 1ZBSA 1TWGA 4KMHA 5IOQA 2XCQA 3FOFA 4BLAA 3GTKA 3MMLB 2R93A 3FOEA 4FZBA 1SFOA 4P5AA 4KAWX 4G0UA 2R7ZA 2GSNA 1Y1VA 2JA7A 1BGWA 2XCOA 1BJTA 1DD5A 4GFQA 4KM8A 1WQHA 1F9NA 4C3HC 5JFEA 3LAPA 4G0WA 2JA5A 3CQZA 5IOTA 3NUHA 4KMDA 1K83A 4KATA 3AQPA 2YU9A 1ZVUA 3LAJA 1B4BA 2NVYA 3AH5A 3N0BA 3OEPA 2E2HA 1TWAA 5EGEA 4KASA 1O25A 1GE9A 3GTQA 4FM9A 4LR2A 3FKIA 4KB2A 4KARA 3H0GA 4GTBA 4C2MC 4GT9A 2P5MA 4GTFA 2GSUA 1O28A 2Y3PA 1ISEA 5JVOA 3GTOA 5EGHA 3L4KA 3FHZA 1O26A 4ILDA 3V4GA 4BKWA 3N3YA 1ZXOA 4GTLA 4GTDA 1EK8A 3GTMA 4KDDA 3OREA 3QX3A 4KM9A 2NVXA 4C3JC 2KWAA 4M1XA 3GTGA 2RGRA 1O27A 3G4CA 4LQYA 2R92A 1R9TA 1WIHA 1TWCA 1WQFA 1O24A 3L4JA 3Q3QA 3OPFA 4GTAA 1O2BA 3GTPA 1Y1WA 3ERED 4J3NA 4C3IC 2GSOA 4GTCA 2E2IA 4KMAA 1I3QA 3BUEA 2JA6A 4KB4A 3N0CA 3GTLA 1XXBA 5CJ9A 2CFAA 5IORA 2B63A 2JH3A 2XCRB 5TJ3A 5IOSA 3LPXA 1WCMA 3AQOA 1XXAA 5CHPA 2VUMA 3G4AA 1O29A 4BLBA 3VA7A 1EH1A 2RH6A 1TWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O24 A;  4GT9 A;  4GTF A;  2CFA B;  1O28 A;  4GTA A;  1O2B A;  1O26 A;  3N3Y A;  1KQ4 A;  4GTL A;  4GTD A;  5JFE A;  4GTC A;  4P5B A;  4GTE A;  5IOT A;  3N0C A;  1O2A A;  4KAT A;  5IOQ A;  2CFA A;  5IOR A;  5IOS A;  3N0B A;  3AH5 A;  4FZB A;  4P5A A;  5CHP A;  1O27 A;  3G4C A;  3G4A A;  4KAS A;  1O29 A;  1O25 A;  4KAR A;  4GTB A; 
#chains in the Genus database with same CATH topology
 4QJV A;  4A3J K;  4BXX K;  1J98 A;  3GTK K;  1XZQ A;  5C4J K;  4KC6 A;  3T01 A;  3S16 K;  1J6V A;  1KQ4 A;  5M5Y K;  3S14 C;  4MEY A;  3HOY C;  1AB4 A;  5L46 A;  3HOV K;  1ZBS A;  1TWG A;  4KMH A;  5IOQ A;  3S1R C;  3HKZ D;  4P5A A;  1TWH C;  4G7O A;  2R7Z A;  1Y1V A;  3CQZ K;  1UV7 A;  3TFI A;  5IYD K;  4XLN A;  2P8T A;  4BBS K;  1WQH A;  1F9N A;  3S1N C;  3GTQ K;  3FKI K;  2JA7 C;  3GDZ A;  4WIL A;  4MQ9 A;  1JVI A;  3NUH A;  3M4O K;  4A3K K;  3GTO K;  1WSR A;  5EGE A;  1DCP A;  4KAS A;  2V6S A;  3SZY A;  1GE9 A;  4FM9 A;  4LR2 A;  3GTM K;  3H0G A;  1YCL A;  2NVY C;  4OIR A;  4A93 K;  1TWA C;  3HOW C;  2GSU A;  1O28 A;  3GEH A;  3EQL A;  3S2D K;  1EK8 A;  1R9T K;  1I6H K;  1TWC K;  2ZUF A;  4KDD A;  4AH6 A;  3ORE A;  4A3I C;  1C0A A;  1USM A;  2PA8 L;  3PO2 C;  4C3J C;  2KWA A;  3GTG A;  3S1M C;  3RZD C;  4BY1 C;  2R92 A;  2CW0 A;  4LOW A;  3K7A C;  2NVX C;  3GTL K;  1EQR A;  5IP9 K;  1WCM K;  4Y7N C;  1Y1W A;  1IW7 A;  4X6A K;  2VUM K;  3GTG K;  4C3I C;  2GSO A;  1BS2 A;  4BBR K;  2JA6 A;  2NVQ C;  3GTP C;  3M3Y C;  1WOO A;  2JH3 A;  4KN4 A;  2XCR B;  2BE5 A;  3GIR A;  1SMY A;  4RMF A;  4A3L C;  5CHP A;  3BP3 A;  2NVT K;  3G4A A;  4BLB A;  4PAA A;  1EFW A;  5FJ8 K;  2E2J K;  1XXC A;  4G7H A;  1L0W A;  5IP7 C;  1YNN A;  2R93 K;  1O2F B;  3GTJ A;  1DCO A;  1WQG A;  4ZH4 A;  4DDQ A;  1SFO K;  1B4A A;  2PHC B;  1TWF C;  1I50 A;  4WJ4 A;  4C3H K;  4GTE A;  3GTK A;  1JQW A;  2JA8 K;  2D6F C;  1J6W A;  3FOE A;  4KAW X;  5IYC K;  3TFH A;  4G0U A;  1TWG C;  5C3E K;  2JA5 K;  1K83 K;  4A3E C;  3PO3 C;  1F7U A;  2YU9 K;  4A3C C;  1VLO A;  3S2H C;  3GEI A;  2XCO A;  2E2H K;  2WAQ L;  2A68 A;  1HI9 A;  1DD5 A;  4GFQ A;  4KM8 A;  3S1Q C;  2R7Z C;  5FLM K;  1Y1V C;  5JFE A;  1IE0 A;  3HOU C;  3JST A;  4AYB D;  3CQZ A;  3A8J A;  1XZP A;  5C44 K;  3LAJ A;  4QJV B;  5IYB C;  1B4B A;  2WB1 L;  3S15 K;  3OEP A;  4GZY A;  1XZQ B;  3IPJ A;  4A3F C;  3S17 K;  3GTQ A;  3FKI A;  4KB2 A;  4OIQ A;  5TMF A;  4C2M C;  2A6H A;  4XSZ A;  2P5M A;  2Y3P A;  5JVO A;  3RZO K;  3GTO A;  5EGH A;  4O2D A;  3N3Y A;  1ZXO A;  4YFK A;  4GTD A;  3H0G C;  3GTM A;  4A3M C;  4QIW D;  5HL8 A;  1ZQ1 C;  4Y52 K;  4A3G C;  4KM9 A;  5C4X K;  3I4M K;  3HOZ C;  1O27 A;  2E2I K;  1R9T A;  1I3Q K;  1TWC A;  3SZZ A;  1WQF A;  2B63 K;  2Y0S D;  4JK1 A;  3S1N K;  4A3B K;  4GTA A;  2V6U A;  2R92 C;  2PPB A;  4GTC A;  5TMC A;  3BUE A;  3N0C A;  3GTL A;  3S14 K;  5CJ9 A;  5IOR A;  1VJE A;  3HOY K;  1Y1W C;  1WOS A;  5TJ3 A;  5IOS A;  3LPX A;  1WCM A;  2VUM A;  4BY7 C;  3S1R K;  1DCH A;  2JA6 C;  3HKZ L;  1TWH K;  1V5V A;  1IS1 A;  4WJ3 M;  3HOX C;  3H3V D;  3TTG A;  2FQT A;  3S0X A;  1F93 A;  3AD7 C;  4G0V A;  2PMZ D;  2JA7 K;  1WOR A;  3GTJ C;  2XCQ A;  3FOF A;  2O5J A;  2R93 A;  1IQ0 A;  3I4N C;  1I50 C;  2EBB A;  1SFO A;  4A3D C;  1YX2 A;  4Q5S A;  4A3J C;  4BXX C;  1BGW A;  3GTK C;  5C4J C;  4XSX A;  3S16 C;  2NVY K;  1EI6 A;  5E68 A;  1TWA K;  3HOW K;  1I6V A;  2ZUE A;  4KN7 A;  4G0W A;  3HOV C;  1X31 C;  2JA5 A;  1K83 A;  1ZYR A;  4KAT A;  3AQP A;  2YU9 A;  1RU0 A;  2A6E A;  1ZVU A;  4A3I K;  2E2H A;  3WOD A;  3AH5 A;  3S17 C;  3PO2 K;  4C3J K;  1O25 A;  3CQZ C;  3S1M K;  3RZD K;  4BY1 K;  5IYD C;  4GT9 A;  2NVX K;  4BBS C;  1ISE A;  4OIP A;  5D4D A;  3FHZ A;  5M5X K;  4ILD A;  3GTQ C;  1PJ7 A;  3FKI C;  4PAB A;  4Y7N K;  4GTL A;  1HQM A;  4C3I K;  3M4O C;  4LK1 A;  2V6T A;  4A3K C;  3BP8 C;  3GTO C;  2NVQ K;  3HXA A;  3T00 A;  4LLG A;  3GTP K;  3M3Y K;  4P9S A;  2GAG C;  2GAH C;  3GTM C;  1IBA A;  2RGR A;  4LQY A;  1YNJ A;  4A3B C;  4A3L K;  1WIH A;  4A93 C;  3L4J A;  3Q3Q A;  4OIN A;  4NOI A;  1XZP B;  1O2B A;  5IP7 K;  3S2D C;  3ERE D;  1R9T C;  4LK0 A;  4YFN A;  4J3N A;  1I6H C;  1TWC C;  2E2I A;  2FQO A;  1I3Q A;  1TWF K;  4KB4 A;  2PA8 D;  1XXB A;  2CFA A;  2B63 A;  5M3F K;  3AQO A;  4C45 A;  3GTL C;  3VA7 A;  1EH1 A;  3GEE A;  1INN A;  4OIO A;  5IP9 C;  1WCM C;  1TWG K;  3CAG A;  1PJ6 A;  4A3E K;  3PO3 K;  2CFA B;  4X6A C;  4A3C K;  2VUM C;  3GTG C;  3S2H K;  1G51 A;  4YFX A;  4BBR C;  2ZFZ A;  3S1Q K;  2R7Z K;  1TWH A;  1USO A;  1Y1V K;  4P5B A;  1O2A A;  3HOU K;  4AYB L;  4BLA A;  3MML B;  2NVT C;  4FZB A;  5IYB K;  1IL2 A;  2E2J C;  1BDF A;  2GSN A;  4A3F K;  2JA7 A;  5M3M K;  2O5I A;  2R93 C;  4YG2 A;  5M5W K;  4C2M K;  1SFO C;  3DXJ A;  1BJT A;  1XPP A;  4C3H C;  3LAP A;  2W7V A;  4Q4Z A;  3H0G K;  5IOT A;  4KMD A;  4A3M K;  4QIW L;  3A8I A;  2JA8 C;  1VH2 A;  3N0B A;  2NVY A;  4A3G K;  5IYC C;  1TWA A;  3TFJ A;  2A69 A;  5C3E C;  2JA5 C;  1K83 C;  4LJZ A;  3HOZ K;  2YU9 C;  4KAR A;  3AD9 C;  4GTB A;  1WSV A;  2E2H C;  2WAQ D;  4GTF A;  2Y0S L;  3L4K A;  5FLM C;  1O26 A;  3V4G A;  4BKW A;  2R92 K;  4G7Z A;  1F7V A;  5C44 C;  3T02 A;  2WB1 D;  3QX3 A;  3S15 C;  2NVX A;  3AD8 C;  1WOP A;  4M1X A;  1Y1W K;  1VRQ C;  3G4C A;  4XCH A;  4BY7 K;  3A8K A;  2JA6 K;  3ADA C;  4XLP A;  1PJ5 A;  3RZO C;  1O24 A;  3K7A K;  3OPF A;  3GTP A;  4KMU A;  3HOX K;  3H3V L;  4KMA A;  4Y52 C;  1VGX A;  1JOE A;  1J6X A;  5C4X C;  2PMZ L;  4MEX A;  3GSI A;  3I4M C;  3GTJ K;  2E2I C;  1XXA A;  1I3Q C;  1O29 A;  3I4N K;  1I50 K;  4A3D K;  2B63 C;  2RH6 A;  1TWF A; 
#chains in the Genus database with same CATH homology
 1XXC A;  3CAG A;  1IS1 A;  2CFA B;  4KC6 A;  3GTJ A;  1WQG A;  4DDQ A;  1B4A A;  2PHC B;  1KQ4 A;  2ZFZ A;  1I50 A;  3S0X A;  1TWH A;  4G0V A;  4P5B A;  4GTE A;  1O2A A;  1AB4 A;  1ZBS A;  1TWG A;  4KMH A;  5IOQ A;  2XCQ A;  3FOF A;  4BLA A;  3GTK A;  3MML B;  2R93 A;  3FOE A;  4FZB A;  1SFO A;  4P5A A;  4KAW X;  4G0U A;  2R7Z A;  2GSN A;  1Y1V A;  2JA7 A;  1BGW A;  2XCO A;  1BJT A;  1DD5 A;  4GFQ A;  4KM8 A;  1WQH A;  1F9N A;  4C3H C;  5JFE A;  3LAP A;  4G0W A;  2JA5 A;  3CQZ A;  5IOT A;  3NUH A;  4KMD A;  1K83 A;  4KAT A;  3AQP A;  2YU9 A;  1ZVU A;  3LAJ A;  1B4B A;  2NVY A;  3AH5 A;  3N0B A;  3OEP A;  2E2H A;  1TWA A;  5EGE A;  4KAS A;  1O25 A;  1GE9 A;  3GTQ A;  4FM9 A;  4LR2 A;  3FKI A;  4KB2 A;  4KAR A;  3H0G A;  4GTB A;  4C2M C;  4GT9 A;  2P5M A;  4GTF A;  2GSU A;  1O28 A;  2Y3P A;  1ISE A;  5JVO A;  3GTO A;  5EGH A;  3L4K A;  3FHZ A;  1O26 A;  4ILD A;  3V4G A;  4BKW A;  3N3Y A;  1ZXO A;  4GTL A;  4GTD A;  1EK8 A;  3GTM A;  4KDD A;  3ORE A;  3QX3 A;  4KM9 A;  2NVX A;  4C3J C;  2KWA A;  4M1X A;  3GTG A;  2RGR A;  1O27 A;  3G4C A;  4LQY A;  2R92 A;  1R9T A;  1WIH A;  1TWC A;  1WQF A;  1O24 A;  3L4J A;  3Q3Q A;  3OPF A;  4GTA A;  1O2B A;  3GTP A;  1Y1W A;  3ERE D;  4J3N A;  4C3I C;  2GSO A;  4GTC A;  2E2I A;  4KMA A;  1I3Q A;  3BUE A;  2JA6 A;  4KB4 A;  3N0C A;  3GTL A;  1XXB A;  5CJ9 A;  2CFA A;  5IOR A;  2B63 A;  2JH3 A;  2XCR B;  5TJ3 A;  5IOS A;  3LPX A;  1WCM A;  3AQO A;  1XXA A;  5CHP A;  2VUM A;  3G4A A;  1O29 A;  4BLB A;  3VA7 A;  1EH1 A;  2RH6 A;  1TWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...