4GTFA

T. maritima fdts (h53a mutant) with fad, dump and folate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
213
Chain Sequence
MKIDILDKGFVELVDVMGNDLSAVRAARVSFDMKDEERDRHLIEYLMKHGAETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 79
structure length 213
sequence length 215
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtfA00
4P5AA 3G4CA 1O2BA 3N3YA 4GTLA 5JFEA 4KATA 3N0BA 3N0CA 5IOTA 4FZBA 4P5BA 5IOQA 1O27A 4GTCA 5IORA 2CFAB 5IOSA 3AH5A 4GTFA 5CHPA 1KQ4A 4KARA 1O24A 1O28A 2CFAA 1O25A 4GTDA 4GTAA 1O29A 4GTEA 4GTBA 1O26A 4KASA 1O2AA 4GT9A 3G4AA
chains in the Genus database with same CATH superfamily
2V6TA 2E2IC 1WOSA 1USMA 4P5AA 4OIOA 5C3EC 3GTLA 1O2BA 4PAAA 1F93A 1DCOA 3M4OC 4FZBA 3PO2K 2A69A 5FLMC 2XCOA 2NVXC 4GFQA 4LK0A 3GTJA 3AD7C 4A3GC 2JA6K 5C4JC 4Q4ZA 4YFXA 3GTMA 4GTBA 4KC6A 4GT9A 1PJ5A 2NVYA 3RZDK 1F7UA 4X6AK 5JVOA 3TFJA 2NVQK 2ZFZA 3VA7A 3V4GA 1XXAA 3I4MC 3CQZA 1XXCA 1XZQA 3FKIA 4GTFA 1HQMA 4WILA 2PA8D 2V6SA 3K7AC 3S17C 5HL8A 2NVXK 4LLGA 4GTAA 1TWCK 2A6EA 4MEXA 2W7VA 3G4AA 2JA5A 1SFOK 1TWFK 3S1RC 1XZQB 2EBBA 3GDZA 3WODA 3GTGK 2VUMA 1INNA 5IP7C 1O27A 4BLAA 2XCQA 1TWAA 3GEEA 5M5WK 3CAGA 2E2JK 5IORA 2Y0SL 2XCRB 5CHPA 1WQGA 4KAWX 1I50K 3H3VD 3OREA 3GIRA 3JSTA 1TWHC 2PHCB 1TWGA 4C3HK 3M3YC 3S15C 3HOVK 1R9TK 4WJ3M 3SZZA 3T01A 4FM9A 1ZBSA 3GTLK 4C45A 1EI6A 4JK1A 3HOZC 3AD9C 3MMLB 3RZOK 2E2IA 5IYBK 3S1RK 1IE0A 1K83C 4XSXA 2B63C 1EH1A 3BUEA 4LJZA 5IP7K 4BKWA 1I3QC 4KARA 3S2DK 4BBRC 5C4XC 3GTJK 2PPBA 3GEIA 4MEYA 4QIWL 3GTMK 2NVXA 1WSVA 4Y7NC 3GTQK 4A3EC 4A3BC 4A3CC 1AB4A 1BS2A 2KWAA 3S15K 4A3FK 4G7OA 4BY1K 4A3DC 1YX2A 2JA8K 4A3IC 4ILDA 1WSRA 3CQZK 4GTCA 3T00A 3FKIK 1GE9A 1C0AA 2R7ZK 4KDDA 2B63K 3GTOC 3S1NK 1YNJA 1BGWA 2GAHC 4XSZA 3I4NC 3HKZL 1O29A 1UV7A 1I3QK 3SZYA 4G0UA 1EK8A 4A3JK 2JA5K 4A3KK 3HOXK 4Y7NK 1XXBA 1BJTA 2NVTC 5C44C 2VUMK 1EQRA 2GSOA 4A3CK 4A3BK 1IQ0A 1ZXOA 2JA7C 2R92K 2RH6A 4A3DK 1WIHA 1TWAK 4BY7K 1Y1VC 3TFIA 1ZVUA 4A3IK 1WCMC 4KN4A 3FOFA 3HOUC 4Y52C 1O24A 2RGRA 3S2HC 1O25A 5IYDK 5D4DA 4GTDA 1VH2A 1TWGK 3A8JA 3OEPA 2PMZD 2YU9C 4A93C 3GTQA 1TWHA 3EQLA 4KMDA 4MQ9A 4O2DA 3FOEA 3ADAC 1I6HK 4P9SA 1VLOA 2E2IK 3N0CA 4A3LC 5C3EK 4AYBD 1Y1WC 5EGHA 2Y3PA 3M4OK 1WQHA 4C3IC 1KQ4A 2R7ZA 2B63A 1V5VA 1B4BA 5FLMK 3Q3QA 3HOWC 3TTGA 1I3QA 3H3VL 3S2HK 1X31C 1XZPA 4A3GK 5C4JK 1F9NA 3HOYC 3PO3C 3H0GC 5M5XK 4A93K 2P8TA 5IOTA 2R92A 1VJEA 3I4MK 3T02A 3LAPA 3GTPC 1XZPB 4C3IK 2V6UA 1EFWA 3S14C 2R93C 3GTOA 3K7AK 3S17K 3HOWK 4DDQA 3GTKC 4GZYA 5TJ3A 1IBAA 4LR2A 1ISEA 3S1QC 1USOA 3NUHA 4BBSC 4ZH4A 1YCLA 5IOSA 1WOPA 2JA7A 2WAQD 4J3NA 1BDFA 1Y1VA 5EGEA 4G7HA 1WCMA 4LQYA 4C2MC 2O5IA 1O2AA 3BP8C 1TWHK 4GTLA 3M3YK 2D6FC 4LOWA 2YU9A 2Y0SD 3TFHA 2E2HC 1DD5A 1I6HC 5L46A 4Q5SA 4KM8A 2FQTA 3HOZK 1G51A 3ERED 3AH5A 1PJ6A 4BBSK 2GSUA 2WB1D 1K83K 5TMFA 3IPJA 1JQWA 4BBRK 5C4XK 1VGXA 3PO2C 4C2MK 1WQFA 3AQPA 2A68A 4KMUA 4A3EK 4XLPA 3H0GA 2JA6C 4A3MC 3S0XA 2E2HK 4AYBL 4QIWD 3L4JA 4KMAA 3RZDC 1IL2A 1XPPA 4X6AC 2PA8L 4KASA 1DCHA 3GTOK 3GTPA 4KN7A 3I4NK 1L0WA 4WJ4A 2R93A 1VRQC 4BLBA 1J6VA 5M3MK 3GTKA 5M3FK 1B4AA 4OIQA 2NVTK 5C44K 4QJVA 2CW0A 2JA7K 3HKZD 1TWCC 4OIPA 1Y1VK 4A3MK 1SFOC 1K83A 1WCMK 3OPFA 4KMHA 1TWFC 3HOUK 4Y52K 4KB2A 3GTGC 1WOOA 2E2JC 1WORA 1DCPA 2YU9K 4QJVB 4YFKA 4BXXC 4P5BA 1I50C 5IP9C 3A8IA 4NOIA 4A3LK 2E2HA 4C3HC 1Y1WK 3HOVC 1R9TC 5E68A 2ZUFA 3GTLC 2WAQL 1IS1A 4LK1A 2O5JA 1PJ7A 4GTEA 4PABA 4RMFA 1IW7A 3RZOC 3FHZA 3G4CA 5IYBC 5M5YK 2A6HA 4YFNA 2ZUEA 3GSIA 4XCHA 3HOYK 3PO3K 3H0GK 5CJ9A 5IYCC 3S2DC 5FJ8K 3GTJC 3AD8C 4KB4A 4BXXK 3GTMC 1HI9A 1O2FB 3S16C 2NVYC 5IP9K 3GTQC 1O28A 2JA6A 1I6VA 1RU0A 1J6XA 1JOEA 2WB1L 4A3FC 3BP3A 3AQOA 4BY1C 1O26A 3GTPK 1ZYRA 2JA8C 1YNNA 3LPXA 3CQZC 3S14K 2R93K 5JFEA 3FKIC 1J6WA 1SMYA 2GAGC 2R7ZC 3A8KA 3S1MC 3LAJA 3GTKK 5IOQA 3S1NC 4YG2A 3S1QK 5IYCK 1J98A 4A3JC 2JA5C 1Y1WA 4A3KC 4OIRA 2BE5A 2JH3A 2CFAA 4C3JC 4XLNA 3HOXC 4G0WA 3S16K 2NVYK 1TWCA 2GSNA 2VUMC 1SFOA 2P5MA 2FQOA 2R92C 3N3YA 4KM9A 1TWAC 1JVIA 4BY7C 1TWFA 1F7VA 2PMZL 5TMCA 4KATA 3GTGA 3N0BA 3QX3A 4M1XA 3L4KA 4G7ZA 3DXJA 4OINA 3GEHA 3S1MK 2CFAB 5IYDC 1TWGC 1I50A 1ZQ1C 4AH6A 3HXAA 1R9TA 2NVQC 4G0VA 4C3JK
chains in the Genus database with same CATH topology
1AB4A 4P5AA 2KWAA 4DDQA 3GTLA 1O2BA 5TJ3A 4LR2A 1ISEA 4ILDA 4FZBA 3NUHA 4P5BA 4GTCA 1GE9A 5IOSA 2XCOA 4GFQA 4C3HC 2E2HA 2JA7A 4KDDA 4J3NA 1Y1VA 3GTJA 5EGEA 1BGWA 1WCMA 1IS1A 4LQYA 3GTMA 1O29A 4GTEA 4G0UA 4GTBA 1EK8A 4KC6A 4C2MC 1O2AA 4GT9A 2NVYA 3FHZA 3G4CA 5JVOA 1XXBA 4GTLA 1BJTA 2ZFZA 3VA7A 3V4GA 2GSOA 2YU9A 1XXAA 1ZXOA 1DD5A 2RH6A 3CQZA 1WIHA 5CJ9A 1XXCA 1ZVUA 3FKIA 4KM8A 4KB4A 3ERED 3AH5A 4GTFA 3FOFA 2GSUA 1O24A 2RGRA 1O28A 2JA6A 1O25A 4GTDA 4GTAA 3AQOA 3OEPA 1O26A 2JA5A 3G4AA 3LPXA 3GTQA 1TWHA 4KMDA 3FOEA 1WQFA 3AQPA 5JFEA 2VUMA 3N0CA 3LAJA 5IOQA 1O27A 4BLAA 2XCQA 1TWAA 3H0GA 5EGHA 3CAGA 5IORA 2Y3PA 3S0XA 2XCRB 1WQHA 5CHPA 4C3IC 1KQ4A 1WQGA 3L4JA 2R7ZA 4KAWX 2B63A 1Y1WA 2JH3A 4KMAA 2CFAA 3OREA 4C3JC 1B4BA 3Q3QA 2PHCB 1TWGA 4G0WA 1TWCA 2GSNA 4KASA 1I3QA 3GTPA 1SFOA 2P5MA 1F9NA 4FM9A 1ZBSA 3N3YA 4KM9A 2R93A 1TWFA 3GTGA 4KATA 3N0BA 4BLBA 3QX3A 3MMLB 4M1XA 3L4KA 2E2IA 5IOTA 3GTKA 1B4AA 2R92A 1EH1A 2CFAB 3BUEA 4BKWA 3LAPA 4KARA 1I50A 1K83A 3OPFA 4KMHA 2NVXA 4KB2A 3GTOA 1R9TA 4G0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5A A;  3G4C A;  1O2B A;  3N3Y A;  4GTL A;  5JFE A;  4KAT A;  3N0B A;  3N0C A;  5IOT A;  4FZB A;  4P5B A;  5IOQ A;  1O27 A;  4GTC A;  5IOR A;  2CFA B;  5IOS A;  3AH5 A;  4GTF A;  5CHP A;  1KQ4 A;  4KAR A;  1O24 A;  1O28 A;  2CFA A;  1O25 A;  4GTD A;  4GTA A;  1O29 A;  4GTE A;  4GTB A;  1O26 A;  4KAS A;  1O2A A;  4GT9 A;  3G4A A; 
#chains in the Genus database with same CATH topology
 2V6T A;  2E2I C;  1WOS A;  1USM A;  4P5A A;  4OIO A;  5C3E C;  3GTL A;  1O2B A;  4PAA A;  1F93 A;  1DCO A;  3M4O C;  4FZB A;  3PO2 K;  2A69 A;  5FLM C;  2XCO A;  2NVX C;  4GFQ A;  4LK0 A;  3GTJ A;  3AD7 C;  4A3G C;  2JA6 K;  5C4J C;  4Q4Z A;  4YFX A;  3GTM A;  4GTB A;  4KC6 A;  4GT9 A;  1PJ5 A;  2NVY A;  3RZD K;  1F7U A;  4X6A K;  5JVO A;  3TFJ A;  2NVQ K;  2ZFZ A;  3VA7 A;  3V4G A;  1XXA A;  3I4M C;  3CQZ A;  1XXC A;  1XZQ A;  3FKI A;  4GTF A;  1HQM A;  4WIL A;  2PA8 D;  2V6S A;  3K7A C;  3S17 C;  5HL8 A;  2NVX K;  4LLG A;  4GTA A;  1TWC K;  2A6E A;  4MEX A;  2W7V A;  3G4A A;  2JA5 A;  1SFO K;  1TWF K;  3S1R C;  1XZQ B;  2EBB A;  3GDZ A;  3WOD A;  3GTG K;  2VUM A;  1INN A;  5IP7 C;  1O27 A;  4BLA A;  2XCQ A;  1TWA A;  3GEE A;  5M5W K;  3CAG A;  2E2J K;  5IOR A;  2Y0S L;  2XCR B;  5CHP A;  1WQG A;  4KAW X;  1I50 K;  3H3V D;  3ORE A;  3GIR A;  3JST A;  1TWH C;  2PHC B;  1TWG A;  4C3H K;  3M3Y C;  3S15 C;  3HOV K;  1R9T K;  4WJ3 M;  3SZZ A;  3T01 A;  4FM9 A;  1ZBS A;  3GTL K;  4C45 A;  1EI6 A;  4JK1 A;  3HOZ C;  3AD9 C;  3MML B;  3RZO K;  2E2I A;  5IYB K;  3S1R K;  1IE0 A;  1K83 C;  4XSX A;  2B63 C;  1EH1 A;  3BUE A;  4LJZ A;  5IP7 K;  4BKW A;  1I3Q C;  4KAR A;  3S2D K;  4BBR C;  5C4X C;  3GTJ K;  2PPB A;  3GEI A;  4MEY A;  4QIW L;  3GTM K;  2NVX A;  1WSV A;  4Y7N C;  3GTQ K;  4A3E C;  4A3B C;  4A3C C;  1AB4 A;  1BS2 A;  2KWA A;  3S15 K;  4A3F K;  4G7O A;  4BY1 K;  4A3D C;  1YX2 A;  2JA8 K;  4A3I C;  4ILD A;  1WSR A;  3CQZ K;  4GTC A;  3T00 A;  3FKI K;  1GE9 A;  1C0A A;  2R7Z K;  4KDD A;  2B63 K;  3GTO C;  3S1N K;  1YNJ A;  1BGW A;  2GAH C;  4XSZ A;  3I4N C;  3HKZ L;  1O29 A;  1UV7 A;  1I3Q K;  3SZY A;  4G0U A;  1EK8 A;  4A3J K;  2JA5 K;  4A3K K;  3HOX K;  4Y7N K;  1XXB A;  1BJT A;  2NVT C;  5C44 C;  2VUM K;  1EQR A;  2GSO A;  4A3C K;  4A3B K;  1IQ0 A;  1ZXO A;  2JA7 C;  2R92 K;  2RH6 A;  4A3D K;  1WIH A;  1TWA K;  4BY7 K;  1Y1V C;  3TFI A;  1ZVU A;  4A3I K;  1WCM C;  4KN4 A;  3FOF A;  3HOU C;  4Y52 C;  1O24 A;  2RGR A;  3S2H C;  1O25 A;  5IYD K;  5D4D A;  4GTD A;  1VH2 A;  1TWG K;  3A8J A;  3OEP A;  2PMZ D;  2YU9 C;  4A93 C;  3GTQ A;  1TWH A;  3EQL A;  4KMD A;  4MQ9 A;  4O2D A;  3FOE A;  3ADA C;  1I6H K;  4P9S A;  1VLO A;  2E2I K;  3N0C A;  4A3L C;  5C3E K;  4AYB D;  1Y1W C;  5EGH A;  2Y3P A;  3M4O K;  1WQH A;  4C3I C;  1KQ4 A;  2R7Z A;  2B63 A;  1V5V A;  1B4B A;  5FLM K;  3Q3Q A;  3HOW C;  3TTG A;  1I3Q A;  3H3V L;  3S2H K;  1X31 C;  1XZP A;  4A3G K;  5C4J K;  1F9N A;  3HOY C;  3PO3 C;  3H0G C;  5M5X K;  4A93 K;  2P8T A;  5IOT A;  2R92 A;  1VJE A;  3I4M K;  3T02 A;  3LAP A;  3GTP C;  1XZP B;  4C3I K;  2V6U A;  1EFW A;  3S14 C;  2R93 C;  3GTO A;  3K7A K;  3S17 K;  3HOW K;  4DDQ A;  3GTK C;  4GZY A;  5TJ3 A;  1IBA A;  4LR2 A;  1ISE A;  3S1Q C;  1USO A;  3NUH A;  4BBS C;  4ZH4 A;  1YCL A;  5IOS A;  1WOP A;  2JA7 A;  2WAQ D;  4J3N A;  1BDF A;  1Y1V A;  5EGE A;  4G7H A;  1WCM A;  4LQY A;  4C2M C;  2O5I A;  1O2A A;  3BP8 C;  1TWH K;  4GTL A;  3M3Y K;  2D6F C;  4LOW A;  2YU9 A;  2Y0S D;  3TFH A;  2E2H C;  1DD5 A;  1I6H C;  5L46 A;  4Q5S A;  4KM8 A;  2FQT A;  3HOZ K;  1G51 A;  3ERE D;  3AH5 A;  1PJ6 A;  4BBS K;  2GSU A;  2WB1 D;  1K83 K;  5TMF A;  3IPJ A;  1JQW A;  4BBR K;  5C4X K;  1VGX A;  3PO2 C;  4C2M K;  1WQF A;  3AQP A;  2A68 A;  4KMU A;  4A3E K;  4XLP A;  3H0G A;  2JA6 C;  4A3M C;  3S0X A;  2E2H K;  4AYB L;  4QIW D;  3L4J A;  4KMA A;  3RZD C;  1IL2 A;  1XPP A;  4X6A C;  2PA8 L;  4KAS A;  1DCH A;  3GTO K;  3GTP A;  4KN7 A;  3I4N K;  1L0W A;  4WJ4 A;  2R93 A;  1VRQ C;  4BLB A;  1J6V A;  5M3M K;  3GTK A;  5M3F K;  1B4A A;  4OIQ A;  2NVT K;  5C44 K;  4QJV A;  2CW0 A;  2JA7 K;  3HKZ D;  1TWC C;  4OIP A;  1Y1V K;  4A3M K;  1SFO C;  1K83 A;  1WCM K;  3OPF A;  4KMH A;  1TWF C;  3HOU K;  4Y52 K;  4KB2 A;  3GTG C;  1WOO A;  2E2J C;  1WOR A;  1DCP A;  2YU9 K;  4QJV B;  4YFK A;  4BXX C;  4P5B A;  1I50 C;  5IP9 C;  3A8I A;  4NOI A;  4A3L K;  2E2H A;  4C3H C;  1Y1W K;  3HOV C;  1R9T C;  5E68 A;  2ZUF A;  3GTL C;  2WAQ L;  1IS1 A;  4LK1 A;  2O5J A;  1PJ7 A;  4GTE A;  4PAB A;  4RMF A;  1IW7 A;  3RZO C;  3FHZ A;  3G4C A;  5IYB C;  5M5Y K;  2A6H A;  4YFN A;  2ZUE A;  3GSI A;  4XCH A;  3HOY K;  3PO3 K;  3H0G K;  5CJ9 A;  5IYC C;  3S2D C;  5FJ8 K;  3GTJ C;  3AD8 C;  4KB4 A;  4BXX K;  3GTM C;  1HI9 A;  1O2F B;  3S16 C;  2NVY C;  5IP9 K;  3GTQ C;  1O28 A;  2JA6 A;  1I6V A;  1RU0 A;  1J6X A;  1JOE A;  2WB1 L;  4A3F C;  3BP3 A;  3AQO A;  4BY1 C;  1O26 A;  3GTP K;  1ZYR A;  2JA8 C;  1YNN A;  3LPX A;  3CQZ C;  3S14 K;  2R93 K;  5JFE A;  3FKI C;  1J6W A;  1SMY A;  2GAG C;  2R7Z C;  3A8K A;  3S1M C;  3LAJ A;  3GTK K;  5IOQ A;  3S1N C;  4YG2 A;  3S1Q K;  5IYC K;  1J98 A;  4A3J C;  2JA5 C;  1Y1W A;  4A3K C;  4OIR A;  2BE5 A;  2JH3 A;  2CFA A;  4C3J C;  4XLN A;  3HOX C;  4G0W A;  3S16 K;  2NVY K;  1TWC A;  2GSN A;  2VUM C;  1SFO A;  2P5M A;  2FQO A;  2R92 C;  3N3Y A;  4KM9 A;  1TWA C;  1JVI A;  4BY7 C;  1TWF A;  1F7V A;  2PMZ L;  5TMC A;  4KAT A;  3GTG A;  3N0B A;  3QX3 A;  4M1X A;  3L4K A;  4G7Z A;  3DXJ A;  4OIN A;  3GEH A;  3S1M K;  2CFA B;  5IYD C;  1TWG C;  1I50 A;  1ZQ1 C;  4AH6 A;  3HXA A;  1R9T A;  2NVQ C;  4G0V A;  4C3J K; 
#chains in the Genus database with same CATH homology
 1AB4 A;  4P5A A;  2KWA A;  4DDQ A;  3GTL A;  1O2B A;  5TJ3 A;  4LR2 A;  1ISE A;  4ILD A;  4FZB A;  3NUH A;  4P5B A;  4GTC A;  1GE9 A;  5IOS A;  2XCO A;  4GFQ A;  4C3H C;  2E2H A;  2JA7 A;  4KDD A;  4J3N A;  1Y1V A;  3GTJ A;  5EGE A;  1BGW A;  1WCM A;  1IS1 A;  4LQY A;  3GTM A;  1O29 A;  4GTE A;  4G0U A;  4GTB A;  1EK8 A;  4KC6 A;  4C2M C;  1O2A A;  4GT9 A;  2NVY A;  3FHZ A;  3G4C A;  5JVO A;  1XXB A;  4GTL A;  1BJT A;  2ZFZ A;  3VA7 A;  3V4G A;  2GSO A;  2YU9 A;  1XXA A;  1ZXO A;  1DD5 A;  2RH6 A;  3CQZ A;  1WIH A;  5CJ9 A;  1XXC A;  1ZVU A;  3FKI A;  4KM8 A;  4KB4 A;  3ERE D;  3AH5 A;  4GTF A;  3FOF A;  2GSU A;  1O24 A;  2RGR A;  1O28 A;  2JA6 A;  1O25 A;  4GTD A;  4GTA A;  3AQO A;  3OEP A;  1O26 A;  2JA5 A;  3G4A A;  3LPX A;  3GTQ A;  1TWH A;  4KMD A;  3FOE A;  1WQF A;  3AQP A;  5JFE A;  2VUM A;  3N0C A;  3LAJ A;  5IOQ A;  1O27 A;  4BLA A;  2XCQ A;  1TWA A;  3H0G A;  5EGH A;  3CAG A;  5IOR A;  2Y3P A;  3S0X A;  2XCR B;  1WQH A;  5CHP A;  4C3I C;  1KQ4 A;  1WQG A;  3L4J A;  2R7Z A;  4KAW X;  2B63 A;  1Y1W A;  2JH3 A;  4KMA A;  2CFA A;  3ORE A;  4C3J C;  1B4B A;  3Q3Q A;  2PHC B;  1TWG A;  4G0W A;  1TWC A;  2GSN A;  4KAS A;  1I3Q A;  3GTP A;  1SFO A;  2P5M A;  1F9N A;  4FM9 A;  1ZBS A;  3N3Y A;  4KM9 A;  2R93 A;  1TWF A;  3GTG A;  4KAT A;  3N0B A;  4BLB A;  3QX3 A;  3MML B;  4M1X A;  3L4K A;  2E2I A;  5IOT A;  3GTK A;  1B4A A;  2R92 A;  1EH1 A;  2CFA B;  3BUE A;  4BKW A;  3LAP A;  4KAR A;  1I50 A;  1K83 A;  3OPF A;  4KMH A;  2NVX A;  4KB2 A;  3GTO A;  1R9T A;  4G0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...