4BBRK

Structure of rna polymerase ii-tfiib complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbrK00
4C3JK 4XLNA 4Q4ZA 5FLMK 2B63K 3RZOC 4XSZA 1YNJA 3DXJA 1I6VA 3CQZC 3HOZK 2A69A 4A3DK 1SFOC 5IYCK 3GTKK 2Y0SL 3S16K 5C4JC 2E2IC 3GTLC 2JA7C 3S1RK 4A93C 4BBRC 4NOIA 3S17C 2NVQC 3GTOK 3I4MK 2NVYK 2O5JA 1K83K 4BXXC 3S1QK 4QIWL 5C44C 2JA8C 4A3GC 3FKIK 3HOWC 2WAQD 1HQMA 3RZOK 2YU9C 5M5WK 1Y1WC 4YFKA 4Y7NC 4JK1A 3CQZK 4BBSC 4KN4A 4A3BK 2VUMC 1SFOK 2A68A 1TWGC 5FJ8K 4A3FC 5C4JK 4LK0A 2E2IK 3GTLK 2JA7K 2BE5A 3H3VD 2CW0A 4A93K 4LJZA 5TMCA 4BBRK 3S2DC 2PMZL 3S17K 1BDFA 2NVQK 4G7HA 3GTPC 3H0GC 3GTJC 4BXXK 5C44K 2A6HA 2PA8D 2JA8K 2NVTC 4A3GK 1TWAC 3HOWK 3HOVC 2YU9K 1Y1WK 4Y7NK 4BBSK 2VUMK 5IYDC 1TWGK 4A3FK 4OIPA 4G7ZA 3GTQC 4A3KC 4OIRA 4AYBD 3S2HC 3M3YC 3S2DK 1I3QC 3GTPK 2A6EA 3S1MC 3H0GK 3GTJK 2NVXC 5M5XK 2NVTK 3HKZL 4BY7C 1TWAK 2WAQL 3HOUC 4XSXA 3S1NC 3HOVK 1TWFC 5IP9C 5C3EC 3HOYC 4QJVB 3PO3C 3PO2C 3GTGC 1Y1VC 2Y0SD 4C3HK 2R93C 5IYDK 4A3EC 3GTQK 4A3CC 4A3KK 2E2JC 3GTMC 4KN7A 5M3MK 2WB1L 2O5IA 4ZH4A 4A3IC 1I6HC 1YNNA 3M3YK 3S2HK 1I3QK 4OIQA 3S1MK 4KMUA 4BY1C 4A3JC 3I4NC 4QJVA 2NVXK 4BY7K 5C4XC 3HOUK 4C3IK 4OIOA 4MEXA 2R7ZC 3S1NK 1TWFK 5IP9K 4C2MK 5C3EK 1I50C 3HOYK 3PO3K 3PO2K 3GTGK 5IP7C 1Y1VK 2E2HC 1SMYA 3HOXC 2R93K 4A3EK 5M3FK 5D4DA 4A3CK 4A3LC 5M5YK 2E2JK 2PPBA 3GTMK 4LLGA 2PMZD 2R92C 4A3IK 1I6HK 1WCMC 4A3JK 4BY1K 3I4NK 5C4XK 1TWCC 3EQLA 4X6AC 4MEYA 3K7AC 5IYBC 2R7ZK 3RZDC 1TWHC 1I50K 4A3MC 4YFNA 2JA6C 4G7OA 4Q5SA 3S14C 3M4OC 5IP7K 3H3VL 1XPPA 2E2HK 3HOXK 5TMFA 4XLPA 3S15C 4Y52C 4A3LK 4MQ9A 2JA5C 4QIWD 4A3BC 4LK1A 1R9TC 1ZYRA 2PA8L 2R92K 3WODA 2B63C 5FLMC 4YFXA 3HKZD 1WCMK 4OINA 3HOZC 4A3DC 5IYCC 1TWCK 4X6AK 3K7AK 3GTKC 5IYBK 3S16C 4YG2A 3RZDK 1TWHK 4A3MK 2JA6K 3S1RC 3S14K 3M4OK 4AYBL 4GZYA 1IW7A 3GTOC 3S15K 3I4MC 2NVYC 4Y52K 2WB1D 1K83C 3S1QC 2JA5K 1R9TK 3FKIC
chains in the Genus database with same CATH superfamily
3RZOC 4XSZA 1YNJA 3GDZA 2JA6A 2JA7A 2Y0SL 3S16K 2P8TA 1RU0A 3OEPA 5IOTA 2JA7C 3GTLC 2JA5A 3GEIA 2V6TA 4NOIA 1XZQB 3GTOK 1YCLA 4XCHA 3GIRA 1WIHA 4BLBA 4JK1A 3CQZK 4BBSC 4KN4A 1SFOK 1TWGC 2E2IK 1XZQA 2CW0A 4A93K 1IQ0A 5EGEA 5TMCA 3S2DC 3S17K 3GTPC 1XXBA 3CQZA 3H0GC 4KB2A 3G4AA 1SFOA 3AQPA 1XXCA 3HOWK 2E2IA 1Y1WK 1F9NA 3AH5A 2ZUFA 4GTEA 1I3QA 1O25A 3M3YC 1I3QC 5JVOA 1Y1WA 2NVTK 3HKZL 4BY7C 5TJ3A 1TWAK 4KARA 4XSXA 3NUHA 4C2MC 1USOA 4QJVB 3FOEA 5EGHA 2R93C 1DCOA 4DDQA 2E2JC 2ZUEA 2Y3PA 4KN7A 3SZZA 4A3IC 3S2HK 3S1MK 3I4NC 4QJVA 2NVXK 5C4XC 4C3IK 1WOOA 4WJ4A 5C3EK 1JQWA 4KASA 3PO3K 3GSIA 3T01A 4KB4A 5IP7C 2E2HC 4LQYA 3HOXC 2GAHC 5D4DA 4A3LC 2NVXA 3GTMK 4LLGA 3IPJA 2R92C 3BUEA 3EQLA 5IYBC 3GTMA 3S14C 1XPPA 5TMFA 4XLPA 4Y52C 1O24A 4QIWD 1ZYRA 2PA8L 3OPFA 5E68A 1EQRA 3S0XA 3VA7A 1WSRA 3RZDK 4A3MK 3M4OK 4AYBL 2CFAB 4WILA 4KC6A 2WB1D 4A3BK 3FKIC 4XLNA 2PHCB 1HI9A 2B63K 5FLMK 1I6VA 5L46A 3HOZK 3ERED 2RGRA 5IYCK 2CFAA 1F93A 3CAGA 1F7VA 3V4GA 3S1RK 1J6XA 4BBRC 1DCPA 2B63A 2NVQC 3L4KA 3I4MK 1IS1A 1PJ6A 1K83K 4A3GC 4QIWL 5C44C 4KM9A 1WQGA 3RZOK 5M5WK 1ZVUA 4Y7NC 3N0BA 4GTCA 1USMA 2XCQA 4LOWA 2A68A 3N3YA 3L4JA 4M1XA 4A3FC 1K83A 3GTLK 2JA7K 4KDDA 2PMZL 4G7HA 2W7VA 3GTJC 3GTLA 3TFHA 4BBSK 3GEHA 5IYDC 1TWGK 3AD9C 4PABA 4PAAA 4WJ3M 3S2DK 4P9SA 3GTPK 1INNA 2A6EA 4AH6A 1J6VA 3H0GK 5M5XK 3ADAC 4G0WA 2GSUA 1TWGA 4G0VA 3HOYC 5IP9C 3GTPA 4A3EC 1O2BA 1B4AA 2RH6A 3H0GA 4A3CC 1O29A 2FQOA 5M3MK 3FOFA 1ISEA 3M3YK 1I3QK 4O2DA 4BY1C 4BY7K 4OIOA 1I50A 4C2MK 1I50C 3AD8C 1SMYA 2R93K 2E2JK 4A3IK 1EFWA 1ZQ1C 2GSNA 1WCMC 3I4NK 2R93A 5C4XK 1TWCC 1TWHA 3K7AC 1TWHC 1J6WA 4YFNA 5JFEA 4G7OA 4Q5SA 5IP7K 2E2HK 3HOXK 3S15C 4A3LK 4MQ9A 1PJ7A 1R9TC 2R92K 4C3JC 3WODA 3T00A 4KMDA 4OINA 2E2HA 4A3DC 5CHPA 3GTKC 5IYBK 3BP8C 4YG2A 3BP3A 3S14K 2R92A 4GZYA 2NVYA 3TTGA 1WOPA 2NVYC 1O2AA 4Y52K 3G4CA 5CJ9A 3S1QC 3DXJA 2A69A 5C4JC 2GAGC 5IORA 3LAPA 2O5JA 1VJEA 4BXXC 2JA8C 1VRQC 3FKIK 2YU9A 2YU9C 4YFKA 1JOEA 3AQOA 2VUMC 3HXAA 5FJ8K 3AD7C 3H3VD 3FKIA 4LJZA 4BBRK 1L0WA 1F7UA 4KM8A 1BDFA 4GTFA 2NVQK 4A3GK 5C44K 4FZBA 1IBAA 2JH3A 3HOVC 3TFIA 4Y7NK 1V5VA 4C3HC 4A3FK 3GTQC 4A3KC 3Q3QA 2ZFZA 1EK8A 3SZYA 1PJ5A 1WORA 3GTJK 3HOUC 3S1NC 1TWFC 3GTGA 4RMFA 1Y1VA 3PO2C 3GTGC 1WQFA 1Y1VC 2Y0SD 5IYDK 4KAWX 3GTJA 2WB1L 2O5IA 4ZH4A 3LPXA 1I6HC 1YNNA 4KMUA 1ZXOA 1VLOA 4A3JC 5HL8A 2R7ZA 1KQ4A 3GEEA 4MEXA 2R7ZC 3HOYK 5IP9K 1IE0A 4C45A 4A3EK 1O2FB 4GTBA 4A3CK 5M5YK 5IOQA 2PPBA 5IOSA 1O28A 4GTDA 4BY1K 4GFQA 4X6AC 1WQHA 1I50K 2JA6C 1BJTA 1EH1A 1BGWA 3JSTA 2JA5C 1WSVA 2XCOA 2P5MA 3HKZD 1WCMK 1TWCK 2V6SA 3K7AK 3S16C 1TWHK 1G51A 3GTOA 4KATA 3GTOC 3S15K 1WCMA 1R9TK 3OREA 1TWCA 4C3JK 3A8KA 4Q4ZA 1VH2A 3CQZC 4A3DK 1SFOC 3GTKK 1JVIA 1O26A 1ZBSA 2E2IC 2FQTA 1R9TA 4A93C 2EBBA 3S17C 2NVYK 3MMLB 4BKWA 1BS2A 3S1QK 1VGXA 3HOWC 2WAQD 1HQMA 4FM9A 3GTKA 1Y1WC 1B4BA 1XZPB 1DD5A 5C4JK 1DCHA 4LK0A 3TFJA 2BE5A 1TWAA 4BXXK 1GE9A 2NVTC 2A6HA 2PA8D 2JA8K 1XZPA 1TWAC 1XXAA 2YU9K 1C0AA 2VUMK 1EI6A 4OIPA 4G7ZA 4GTAA 4OIRA 4AYBD 3T02A 2GSOA 3S2HC 3S1MC 2NVXC 2VUMA 1AB4A 2WAQL 4C3IC 3HOVK 5C3EC 2XCRB 4J3NA 3PO3C 4GT9A 1YX2A 4C3HK 3GTQK 4A3KK 3N0CA 3GTMC 4OIQA 3QX3A 3HOUK 3GTQA 3S1NK 1TWFK 4KMHA 3PO2K 3GTGK 1Y1VK 5M3FK 1WOSA 4ILDA 3A8JA 3FHZA 1O27A 2PMZD 1I6HK 1TWFA 4A3JK 1X31C 4MEYA 2R7ZK 3RZDC 4A3MC 4LR2A 3M4OC 3H3VL 4G0UA 2V6UA 4A3BC 4LK1A 1J98A 2B63C 4P5BA 2KWAA 4YFXA 5FLMC 1IL2A 3LAJA 3HOZC 5IYCC 4X6AK 1UV7A 3A8IA 4GTLA 2JA6K 4P5AA 3S1RC 4BLAA 4KMAA 1IW7A 2D6FC 3I4MC 1K83C 2JA5K
chains in the Genus database with same CATH topology
4C3JK 4XLNA 4Q4ZA 5FLMK 2B63K 3RZOC 4XSZA 1YNJA 3DXJA 1I6VA 3CQZC 3HOZK 2A69A 4A3DK 1SFOC 5IYCK 3GTKK 2Y0SL 3S16K 5C4JC 2E2IC 3GTLC 2JA7C 3S1RK 4A93C 4BBRC 4NOIA 3S17C 2NVQC 3GTOK 3I4MK 2NVYK 2O5JA 1K83K 4BXXC 3S1QK 4QIWL 5C44C 2JA8C 4A3GC 3FKIK 3HOWC 2WAQD 1HQMA 3RZOK 2YU9C 5M5WK 1Y1WC 4YFKA 4Y7NC 4JK1A 3CQZK 4BBSC 4KN4A 4A3BK 2VUMC 1SFOK 2A68A 1TWGC 5FJ8K 4A3FC 5C4JK 4LK0A 2E2IK 3GTLK 2JA7K 2BE5A 3H3VD 2CW0A 4A93K 4LJZA 5TMCA 4BBRK 3S2DC 2PMZL 3S17K 1BDFA 2NVQK 4G7HA 3GTPC 3H0GC 3GTJC 4BXXK 5C44K 2A6HA 2PA8D 2JA8K 2NVTC 4A3GK 1TWAC 3HOWK 3HOVC 2YU9K 1Y1WK 4Y7NK 4BBSK 2VUMK 5IYDC 1TWGK 4A3FK 4OIPA 4G7ZA 3GTQC 4A3KC 4OIRA 4AYBD 3S2HC 3M3YC 3S2DK 1I3QC 3GTPK 2A6EA 3S1MC 3H0GK 3GTJK 2NVXC 5M5XK 2NVTK 3HKZL 4BY7C 1TWAK 2WAQL 3HOUC 4XSXA 3S1NC 3HOVK 1TWFC 5IP9C 5C3EC 3HOYC 4QJVB 3PO3C 3PO2C 3GTGC 1Y1VC 2Y0SD 4C3HK 2R93C 5IYDK 4A3EC 3GTQK 4A3CC 4A3KK 2E2JC 3GTMC 4KN7A 5M3MK 2WB1L 2O5IA 4ZH4A 4A3IC 1I6HC 1YNNA 3M3YK 3S2HK 1I3QK 4OIQA 3S1MK 4KMUA 4BY1C 4A3JC 3I4NC 4QJVA 2NVXK 4BY7K 5C4XC 3HOUK 4C3IK 4OIOA 4MEXA 2R7ZC 3S1NK 1TWFK 5IP9K 4C2MK 5C3EK 1I50C 3HOYK 3PO3K 3PO2K 3GTGK 5IP7C 1Y1VK 2E2HC 1SMYA 3HOXC 2R93K 4A3EK 5M3FK 5D4DA 4A3CK 4A3LC 5M5YK 2E2JK 2PPBA 3GTMK 4LLGA 2PMZD 2R92C 4A3IK 1I6HK 1WCMC 4A3JK 4BY1K 3I4NK 5C4XK 1TWCC 3EQLA 4X6AC 4MEYA 3K7AC 5IYBC 2R7ZK 3RZDC 1TWHC 1I50K 4A3MC 4YFNA 2JA6C 4G7OA 4Q5SA 3S14C 3M4OC 5IP7K 3H3VL 1XPPA 2E2HK 3HOXK 5TMFA 4XLPA 3S15C 4Y52C 4A3LK 4MQ9A 2JA5C 4QIWD 4A3BC 4LK1A 1R9TC 1ZYRA 2PA8L 2R92K 3WODA 2B63C 5FLMC 4YFXA 3HKZD 1WCMK 4OINA 3HOZC 4A3DC 5IYCC 1TWCK 4X6AK 3K7AK 3GTKC 5IYBK 3S16C 4YG2A 3RZDK 1TWHK 4A3MK 2JA6K 3S1RC 3S14K 3M4OK 4AYBL 4GZYA 1IW7A 3GTOC 3S15K 3I4MC 2NVYC 4Y52K 2WB1D 1K83C 3S1QC 2JA5K 1R9TK 3FKIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3J K;  4XLN A;  4Q4Z A;  5FLM K;  2B63 K;  3RZO C;  4XSZ A;  1YNJ A;  3DXJ A;  1I6V A;  3CQZ C;  3HOZ K;  2A69 A;  4A3D K;  1SFO C;  5IYC K;  3GTK K;  2Y0S L;  3S16 K;  5C4J C;  2E2I C;  3GTL C;  2JA7 C;  3S1R K;  4A93 C;  4BBR C;  4NOI A;  3S17 C;  2NVQ C;  3GTO K;  3I4M K;  2NVY K;  2O5J A;  1K83 K;  4BXX C;  3S1Q K;  4QIW L;  5C44 C;  2JA8 C;  4A3G C;  3FKI K;  3HOW C;  2WAQ D;  1HQM A;  3RZO K;  2YU9 C;  5M5W K;  1Y1W C;  4YFK A;  4Y7N C;  4JK1 A;  3CQZ K;  4BBS C;  4KN4 A;  4A3B K;  2VUM C;  1SFO K;  2A68 A;  1TWG C;  5FJ8 K;  4A3F C;  5C4J K;  4LK0 A;  2E2I K;  3GTL K;  2JA7 K;  2BE5 A;  3H3V D;  2CW0 A;  4A93 K;  4LJZ A;  5TMC A;  4BBR K;  3S2D C;  2PMZ L;  3S17 K;  1BDF A;  2NVQ K;  4G7H A;  3GTP C;  3H0G C;  3GTJ C;  4BXX K;  5C44 K;  2A6H A;  2PA8 D;  2JA8 K;  2NVT C;  4A3G K;  1TWA C;  3HOW K;  3HOV C;  2YU9 K;  1Y1W K;  4Y7N K;  4BBS K;  2VUM K;  5IYD C;  1TWG K;  4A3F K;  4OIP A;  4G7Z A;  3GTQ C;  4A3K C;  4OIR A;  4AYB D;  3S2H C;  3M3Y C;  3S2D K;  1I3Q C;  3GTP K;  2A6E A;  3S1M C;  3H0G K;  3GTJ K;  2NVX C;  5M5X K;  2NVT K;  3HKZ L;  4BY7 C;  1TWA K;  2WAQ L;  3HOU C;  4XSX A;  3S1N C;  3HOV K;  1TWF C;  5IP9 C;  5C3E C;  3HOY C;  4QJV B;  3PO3 C;  3PO2 C;  3GTG C;  1Y1V C;  2Y0S D;  4C3H K;  2R93 C;  5IYD K;  4A3E C;  3GTQ K;  4A3C C;  4A3K K;  2E2J C;  3GTM C;  4KN7 A;  5M3M K;  2WB1 L;  2O5I A;  4ZH4 A;  4A3I C;  1I6H C;  1YNN A;  3M3Y K;  3S2H K;  1I3Q K;  4OIQ A;  3S1M K;  4KMU A;  4BY1 C;  4A3J C;  3I4N C;  4QJV A;  2NVX K;  4BY7 K;  5C4X C;  3HOU K;  4C3I K;  4OIO A;  4MEX A;  2R7Z C;  3S1N K;  1TWF K;  5IP9 K;  4C2M K;  5C3E K;  1I50 C;  3HOY K;  3PO3 K;  3PO2 K;  3GTG K;  5IP7 C;  1Y1V K;  2E2H C;  1SMY A;  3HOX C;  2R93 K;  4A3E K;  5M3F K;  5D4D A;  4A3C K;  4A3L C;  5M5Y K;  2E2J K;  2PPB A;  3GTM K;  4LLG A;  2PMZ D;  2R92 C;  4A3I K;  1I6H K;  1WCM C;  4A3J K;  4BY1 K;  3I4N K;  5C4X K;  1TWC C;  3EQL A;  4X6A C;  4MEY A;  3K7A C;  5IYB C;  2R7Z K;  3RZD C;  1TWH C;  1I50 K;  4A3M C;  4YFN A;  2JA6 C;  4G7O A;  4Q5S A;  3S14 C;  3M4O C;  5IP7 K;  3H3V L;  1XPP A;  2E2H K;  3HOX K;  5TMF A;  4XLP A;  3S15 C;  4Y52 C;  4A3L K;  4MQ9 A;  2JA5 C;  4QIW D;  4A3B C;  4LK1 A;  1R9T C;  1ZYR A;  2PA8 L;  2R92 K;  3WOD A;  2B63 C;  5FLM C;  4YFX A;  3HKZ D;  1WCM K;  4OIN A;  3HOZ C;  4A3D C;  5IYC C;  1TWC K;  4X6A K;  3K7A K;  3GTK C;  5IYB K;  3S16 C;  4YG2 A;  3RZD K;  1TWH K;  4A3M K;  2JA6 K;  3S1R C;  3S14 K;  3M4O K;  4AYB L;  4GZY A;  1IW7 A;  3GTO C;  3S15 K;  3I4M C;  2NVY C;  4Y52 K;  2WB1 D;  1K83 C;  3S1Q C;  2JA5 K;  1R9T K;  3FKI C; 
#chains in the Genus database with same CATH topology
 3RZO C;  4XSZ A;  1YNJ A;  3GDZ A;  2JA6 A;  2JA7 A;  2Y0S L;  3S16 K;  2P8T A;  1RU0 A;  3OEP A;  5IOT A;  2JA7 C;  3GTL C;  2JA5 A;  3GEI A;  2V6T A;  4NOI A;  1XZQ B;  3GTO K;  1YCL A;  4XCH A;  3GIR A;  1WIH A;  4BLB A;  4JK1 A;  3CQZ K;  4BBS C;  4KN4 A;  1SFO K;  1TWG C;  2E2I K;  1XZQ A;  2CW0 A;  4A93 K;  1IQ0 A;  5EGE A;  5TMC A;  3S2D C;  3S17 K;  3GTP C;  1XXB A;  3CQZ A;  3H0G C;  4KB2 A;  3G4A A;  1SFO A;  3AQP A;  1XXC A;  3HOW K;  2E2I A;  1Y1W K;  1F9N A;  3AH5 A;  2ZUF A;  4GTE A;  1I3Q A;  1O25 A;  3M3Y C;  1I3Q C;  5JVO A;  1Y1W A;  2NVT K;  3HKZ L;  4BY7 C;  5TJ3 A;  1TWA K;  4KAR A;  4XSX A;  3NUH A;  4C2M C;  1USO A;  4QJV B;  3FOE A;  5EGH A;  2R93 C;  1DCO A;  4DDQ A;  2E2J C;  2ZUE A;  2Y3P A;  4KN7 A;  3SZZ A;  4A3I C;  3S2H K;  3S1M K;  3I4N C;  4QJV A;  2NVX K;  5C4X C;  4C3I K;  1WOO A;  4WJ4 A;  5C3E K;  1JQW A;  4KAS A;  3PO3 K;  3GSI A;  3T01 A;  4KB4 A;  5IP7 C;  2E2H C;  4LQY A;  3HOX C;  2GAH C;  5D4D A;  4A3L C;  2NVX A;  3GTM K;  4LLG A;  3IPJ A;  2R92 C;  3BUE A;  3EQL A;  5IYB C;  3GTM A;  3S14 C;  1XPP A;  5TMF A;  4XLP A;  4Y52 C;  1O24 A;  4QIW D;  1ZYR A;  2PA8 L;  3OPF A;  5E68 A;  1EQR A;  3S0X A;  3VA7 A;  1WSR A;  3RZD K;  4A3M K;  3M4O K;  4AYB L;  2CFA B;  4WIL A;  4KC6 A;  2WB1 D;  4A3B K;  3FKI C;  4XLN A;  2PHC B;  1HI9 A;  2B63 K;  5FLM K;  1I6V A;  5L46 A;  3HOZ K;  3ERE D;  2RGR A;  5IYC K;  2CFA A;  1F93 A;  3CAG A;  1F7V A;  3V4G A;  3S1R K;  1J6X A;  4BBR C;  1DCP A;  2B63 A;  2NVQ C;  3L4K A;  3I4M K;  1IS1 A;  1PJ6 A;  1K83 K;  4A3G C;  4QIW L;  5C44 C;  4KM9 A;  1WQG A;  3RZO K;  5M5W K;  1ZVU A;  4Y7N C;  3N0B A;  4GTC A;  1USM A;  2XCQ A;  4LOW A;  2A68 A;  3N3Y A;  3L4J A;  4M1X A;  4A3F C;  1K83 A;  3GTL K;  2JA7 K;  4KDD A;  2PMZ L;  4G7H A;  2W7V A;  3GTJ C;  3GTL A;  3TFH A;  4BBS K;  3GEH A;  5IYD C;  1TWG K;  3AD9 C;  4PAB A;  4PAA A;  4WJ3 M;  3S2D K;  4P9S A;  3GTP K;  1INN A;  2A6E A;  4AH6 A;  1J6V A;  3H0G K;  5M5X K;  3ADA C;  4G0W A;  2GSU A;  1TWG A;  4G0V A;  3HOY C;  5IP9 C;  3GTP A;  4A3E C;  1O2B A;  1B4A A;  2RH6 A;  3H0G A;  4A3C C;  1O29 A;  2FQO A;  5M3M K;  3FOF A;  1ISE A;  3M3Y K;  1I3Q K;  4O2D A;  4BY1 C;  4BY7 K;  4OIO A;  1I50 A;  4C2M K;  1I50 C;  3AD8 C;  1SMY A;  2R93 K;  2E2J K;  4A3I K;  1EFW A;  1ZQ1 C;  2GSN A;  1WCM C;  3I4N K;  2R93 A;  5C4X K;  1TWC C;  1TWH A;  3K7A C;  1TWH C;  1J6W A;  4YFN A;  5JFE A;  4G7O A;  4Q5S A;  5IP7 K;  2E2H K;  3HOX K;  3S15 C;  4A3L K;  4MQ9 A;  1PJ7 A;  1R9T C;  2R92 K;  4C3J C;  3WOD A;  3T00 A;  4KMD A;  4OIN A;  2E2H A;  4A3D C;  5CHP A;  3GTK C;  5IYB K;  3BP8 C;  4YG2 A;  3BP3 A;  3S14 K;  2R92 A;  4GZY A;  2NVY A;  3TTG A;  1WOP A;  2NVY C;  1O2A A;  4Y52 K;  3G4C A;  5CJ9 A;  3S1Q C;  3DXJ A;  2A69 A;  5C4J C;  2GAG C;  5IOR A;  3LAP A;  2O5J A;  1VJE A;  4BXX C;  2JA8 C;  1VRQ C;  3FKI K;  2YU9 A;  2YU9 C;  4YFK A;  1JOE A;  3AQO A;  2VUM C;  3HXA A;  5FJ8 K;  3AD7 C;  3H3V D;  3FKI A;  4LJZ A;  4BBR K;  1L0W A;  1F7U A;  4KM8 A;  1BDF A;  4GTF A;  2NVQ K;  4A3G K;  5C44 K;  4FZB A;  1IBA A;  2JH3 A;  3HOV C;  3TFI A;  4Y7N K;  1V5V A;  4C3H C;  4A3F K;  3GTQ C;  4A3K C;  3Q3Q A;  2ZFZ A;  1EK8 A;  3SZY A;  1PJ5 A;  1WOR A;  3GTJ K;  3HOU C;  3S1N C;  1TWF C;  3GTG A;  4RMF A;  1Y1V A;  3PO2 C;  3GTG C;  1WQF A;  1Y1V C;  2Y0S D;  5IYD K;  4KAW X;  3GTJ A;  2WB1 L;  2O5I A;  4ZH4 A;  3LPX A;  1I6H C;  1YNN A;  4KMU A;  1ZXO A;  1VLO A;  4A3J C;  5HL8 A;  2R7Z A;  1KQ4 A;  3GEE A;  4MEX A;  2R7Z C;  3HOY K;  5IP9 K;  1IE0 A;  4C45 A;  4A3E K;  1O2F B;  4GTB A;  4A3C K;  5M5Y K;  5IOQ A;  2PPB A;  5IOS A;  1O28 A;  4GTD A;  4BY1 K;  4GFQ A;  4X6A C;  1WQH A;  1I50 K;  2JA6 C;  1BJT A;  1EH1 A;  1BGW A;  3JST A;  2JA5 C;  1WSV A;  2XCO A;  2P5M A;  3HKZ D;  1WCM K;  1TWC K;  2V6S A;  3K7A K;  3S16 C;  1TWH K;  1G51 A;  3GTO A;  4KAT A;  3GTO C;  3S15 K;  1WCM A;  1R9T K;  3ORE A;  1TWC A;  4C3J K;  3A8K A;  4Q4Z A;  1VH2 A;  3CQZ C;  4A3D K;  1SFO C;  3GTK K;  1JVI A;  1O26 A;  1ZBS A;  2E2I C;  2FQT A;  1R9T A;  4A93 C;  2EBB A;  3S17 C;  2NVY K;  3MML B;  4BKW A;  1BS2 A;  3S1Q K;  1VGX A;  3HOW C;  2WAQ D;  1HQM A;  4FM9 A;  3GTK A;  1Y1W C;  1B4B A;  1XZP B;  1DD5 A;  5C4J K;  1DCH A;  4LK0 A;  3TFJ A;  2BE5 A;  1TWA A;  4BXX K;  1GE9 A;  2NVT C;  2A6H A;  2PA8 D;  2JA8 K;  1XZP A;  1TWA C;  1XXA A;  2YU9 K;  1C0A A;  2VUM K;  1EI6 A;  4OIP A;  4G7Z A;  4GTA A;  4OIR A;  4AYB D;  3T02 A;  2GSO A;  3S2H C;  3S1M C;  2NVX C;  2VUM A;  1AB4 A;  2WAQ L;  4C3I C;  3HOV K;  5C3E C;  2XCR B;  4J3N A;  3PO3 C;  4GT9 A;  1YX2 A;  4C3H K;  3GTQ K;  4A3K K;  3N0C A;  3GTM C;  4OIQ A;  3QX3 A;  3HOU K;  3GTQ A;  3S1N K;  1TWF K;  4KMH A;  3PO2 K;  3GTG K;  1Y1V K;  5M3F K;  1WOS A;  4ILD A;  3A8J A;  3FHZ A;  1O27 A;  2PMZ D;  1I6H K;  1TWF A;  4A3J K;  1X31 C;  4MEY A;  2R7Z K;  3RZD C;  4A3M C;  4LR2 A;  3M4O C;  3H3V L;  4G0U A;  2V6U A;  4A3B C;  4LK1 A;  1J98 A;  2B63 C;  4P5B A;  2KWA A;  4YFX A;  5FLM C;  1IL2 A;  3LAJ A;  3HOZ C;  5IYC C;  4X6A K;  1UV7 A;  3A8I A;  4GTL A;  2JA6 K;  4P5A A;  3S1R C;  4BLA A;  4KMA A;  1IW7 A;  2D6F C;  3I4M C;  1K83 C;  2JA5 K; 
#chains in the Genus database with same CATH homology
 4C3J K;  4XLN A;  4Q4Z A;  5FLM K;  2B63 K;  3RZO C;  4XSZ A;  1YNJ A;  3DXJ A;  1I6V A;  3CQZ C;  3HOZ K;  2A69 A;  4A3D K;  1SFO C;  5IYC K;  3GTK K;  2Y0S L;  3S16 K;  5C4J C;  2E2I C;  3GTL C;  2JA7 C;  3S1R K;  4A93 C;  4BBR C;  4NOI A;  3S17 C;  2NVQ C;  3GTO K;  3I4M K;  2NVY K;  2O5J A;  1K83 K;  4BXX C;  3S1Q K;  4QIW L;  5C44 C;  2JA8 C;  4A3G C;  3FKI K;  3HOW C;  2WAQ D;  1HQM A;  3RZO K;  2YU9 C;  5M5W K;  1Y1W C;  4YFK A;  4Y7N C;  4JK1 A;  3CQZ K;  4BBS C;  4KN4 A;  4A3B K;  2VUM C;  1SFO K;  2A68 A;  1TWG C;  5FJ8 K;  4A3F C;  5C4J K;  4LK0 A;  2E2I K;  3GTL K;  2JA7 K;  2BE5 A;  3H3V D;  2CW0 A;  4A93 K;  4LJZ A;  5TMC A;  4BBR K;  3S2D C;  2PMZ L;  3S17 K;  1BDF A;  2NVQ K;  4G7H A;  3GTP C;  3H0G C;  3GTJ C;  4BXX K;  5C44 K;  2A6H A;  2PA8 D;  2JA8 K;  2NVT C;  4A3G K;  1TWA C;  3HOW K;  3HOV C;  2YU9 K;  1Y1W K;  4Y7N K;  4BBS K;  2VUM K;  5IYD C;  1TWG K;  4A3F K;  4OIP A;  4G7Z A;  3GTQ C;  4A3K C;  4OIR A;  4AYB D;  3S2H C;  3M3Y C;  3S2D K;  1I3Q C;  3GTP K;  2A6E A;  3S1M C;  3H0G K;  3GTJ K;  2NVX C;  5M5X K;  2NVT K;  3HKZ L;  4BY7 C;  1TWA K;  2WAQ L;  3HOU C;  4XSX A;  3S1N C;  3HOV K;  1TWF C;  5IP9 C;  5C3E C;  3HOY C;  4QJV B;  3PO3 C;  3PO2 C;  3GTG C;  1Y1V C;  2Y0S D;  4C3H K;  2R93 C;  5IYD K;  4A3E C;  3GTQ K;  4A3C C;  4A3K K;  2E2J C;  3GTM C;  4KN7 A;  5M3M K;  2WB1 L;  2O5I A;  4ZH4 A;  4A3I C;  1I6H C;  1YNN A;  3M3Y K;  3S2H K;  1I3Q K;  4OIQ A;  3S1M K;  4KMU A;  4BY1 C;  4A3J C;  3I4N C;  4QJV A;  2NVX K;  4BY7 K;  5C4X C;  3HOU K;  4C3I K;  4OIO A;  4MEX A;  2R7Z C;  3S1N K;  1TWF K;  5IP9 K;  4C2M K;  5C3E K;  1I50 C;  3HOY K;  3PO3 K;  3PO2 K;  3GTG K;  5IP7 C;  1Y1V K;  2E2H C;  1SMY A;  3HOX C;  2R93 K;  4A3E K;  5M3F K;  5D4D A;  4A3C K;  4A3L C;  5M5Y K;  2E2J K;  2PPB A;  3GTM K;  4LLG A;  2PMZ D;  2R92 C;  4A3I K;  1I6H K;  1WCM C;  4A3J K;  4BY1 K;  3I4N K;  5C4X K;  1TWC C;  3EQL A;  4X6A C;  4MEY A;  3K7A C;  5IYB C;  2R7Z K;  3RZD C;  1TWH C;  1I50 K;  4A3M C;  4YFN A;  2JA6 C;  4G7O A;  4Q5S A;  3S14 C;  3M4O C;  5IP7 K;  3H3V L;  1XPP A;  2E2H K;  3HOX K;  5TMF A;  4XLP A;  3S15 C;  4Y52 C;  4A3L K;  4MQ9 A;  2JA5 C;  4QIW D;  4A3B C;  4LK1 A;  1R9T C;  1ZYR A;  2PA8 L;  2R92 K;  3WOD A;  2B63 C;  5FLM C;  4YFX A;  3HKZ D;  1WCM K;  4OIN A;  3HOZ C;  4A3D C;  5IYC C;  1TWC K;  4X6A K;  3K7A K;  3GTK C;  5IYB K;  3S16 C;  4YG2 A;  3RZD K;  1TWH K;  4A3M K;  2JA6 K;  3S1R C;  3S14 K;  3M4O K;  4AYB L;  4GZY A;  1IW7 A;  3GTO C;  3S15 K;  3I4M C;  2NVY C;  4Y52 K;  2WB1 D;  1K83 C;  3S1Q C;  2JA5 K;  1R9T K;  3FKI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...