4BBRK

Structure of rna polymerase ii-tfiib complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbrK00
4A3CC 4Q4ZA 4Y52K 5IP9C 5D4DA 3CQZC 5TMFA 4BXXK 1TWFK 3PO3K 1I6HC 4BBRC 2JA7C 1I50K 4C3IK 5IYBK 5C4JK 3HOYK 1I50C 5IYCC 2NVQK 5C44K 5IYBC 2YU9K 3HOYC 2NVXC 5TMCA 1TWAC 4C3HK 4A3JC 3M3YC 1HQMA 4A3EC 4A3DK 1Y1VK 4A3IC 3S14C 1Y1WK 2BE5A 4XLPA 1Y1VC 2E2JC 3HKZL 3HOVK 5M3MK 2R92C 3GTJC 4LK1A 2O5IA 2PA8D 3H3VL 2R93K 3HOVC 3HOZK 2E2IC 2NVTK 1TWGK 2R93C 2E2HK 2R7ZK 3GTKK 2NVTC 1SFOC 4MEYA 4A3GK 5C4XC 1SMYA 2PMZL 5M5YK 5M3FK 3S2HK 4Y52C 4BXXC 1YNNA 1TWFC 2A6EA 4A3FK 4YFXA 5FLMK 3HOWK 3S2HC 3PO3C 4XLNA 4OIPA 4A3FC 3S15K 3HOXK 1WCMK 3GTOK 2Y0SL 4QIWD 2PPBA 4GZYA 1ZYRA 3HKZD 5C4JC 3FKIK 3M4OK 4A3KK 1WCMC 2JA6K 4LLGA 1I3QK 4OIRA 2NVQC 5C44C 2YU9C 3M4OC 1TWHK 4LK0A 3DXJA 5IYDK 4BBSK 4A3DC 5C3EK 1R9TK 2A6HA 2VUMK 4Q5SA 3WODA 1Y1WC 4AYBL 2PMZD 1R9TC 3HOUK 3GTQK 3RZOK 4BY1K 4A3BK 3GTPK 2WAQL 3GTMK 2WB1L 1K83K 4G7ZA 4YFKA 4XSZA 4Y7NK 4BY1C 3GTQC 3HOZC 3I4NK 4A3BC 3S1QK 3S1NK 1TWGC 4G7OA 2E2HC 2R7ZC 3S1MK 3GTKC 4YG2A 3I4NC 2JA5K 3I4MK 2A68A 4JK1A 3GTLK 3PO2K 3RZDK 3S1NC 4A3GC 4BY7K 4C3JK 3PO2C 4A3MK 4C2MK 1I6VA 3RZDC 4OIQA 4A93K 3GTGK 5FLMC 3HOWC 2O5JA 1IW7A 2JA8K 4G7HA 3S15C 4MQ9A 5IP7K 3HOXC 4AYBD 3GTOC 4LJZA 3H3VD 2CW0A 3FKIC 4NOIA 4A3KC 2JA6C 1I3QC 3S1RK 4A3LK 1TWHC 2NVYK 2B63K 3CQZK 5IYDC 3S1RC 3S16K 3EQLA 5C3EC 4XSXA 2VUMC 4BBSC 4A3LC 2NVYC 5M5XK 2B63C 2A69A 3S17K 4BBRK 2PA8L 3S16C 1I6HK 5FJ8K 3HOUC 4ZH4A 2JA7K 3S2DK 3RZOC 4KMUA 3S17C 4QJVB 3GTPC 4X6AK 3GTMC 1BDFA 1K83C 1YNJA 4Y7NC 3S1QC 3S2DC 5IYCK 4YFNA 4X6AC 2Y0SD 4MEXA 2NVXK 3S1MC 1TWAK 3M3YK 4A3JK 2JA5C 1XPPA 4A3EK 3GTLC 3I4MC 4BY7C 5M5WK 1TWCK 4A3IK 3S14K 4QJVA 4A3MC 2E2JK 1TWCC 3H0GK 4A93C 3K7AK 3GTGC 2R92K 4QIWL 3GTJK 4KN4A 3H0GC 4OINA 2JA8C 3K7AC 2E2IK 5IP7C 2WAQD 2WB1D 4A3CK 4KN7A 4OIOA 5C4XK 1SFOK 5IP9K
chains in the Genus database with same CATH superfamily
1ZXOA 1VH2A 4Q4ZA 1O28A 1I6HC 4BBRC 3FHZA 1BS2A 2JA7C 3AD8C 5IYCC 4GTEA 5IYBC 2NVXC 1BGWA 4FM9A 1HQMA 4A3EC 3GTMA 3MMLB 4XLPA 1WSRA 3HKZL 1WOOA 3GEHA 4GTFA 1XXBA 5M3MK 3H3VL 3GTJC 2O5IA 2R93K 2GSNA 2E2IC 2RGRA 1TWGK 1DCHA 2E2HK 1J6VA 3OEPA 4MEYA 1WQFA 5TJ3A 1WQGA 1YNNA 2JA6A 5FLMK 1O2FB 2V6TA 3S15K 1J98A 1ISEA 3GTOK 1ZYRA 3Q3QA 2B63A 3CQZA 4A3KK 4LLGA 1I3QK 1WSVA 3BUEA 2ZUFA 2D6FC 4BLAA 1R9TK 2A6HA 1ZVUA 3HOUK 1KQ4A 3GTQK 1INNA 1RU0A 4A3BK 2WB1L 3S1QK 4YFKA 4XSZA 1TWGC 1DCOA 2E2HC 2P5MA 3I4NC 2JA5K 1XZQB 3H0GA 3I4MK 3S1NC 1USOA 2R92A 3PO2C 3RZDC 4OIQA 3AD9C 2EBBA 5FLMC 4G7HA 3S15C 4FZBA 3A8KA 4M1XA 4MQ9A 1O2AA 5IP7K 3GTOC 3H3VD 4LJZA 2CW0A 4A3KC 1I3QC 3S1RK 4A3LK 4WILA 4GTBA 3TFJA 1I50A 5IOQA 5M5XK 2A69A 3G4CA 3HOUC 4ZH4A 3L4KA 3S2DK 1BDFA 1YNJA 3N0BA 3S1QC 4YFNA 1Y1WA 1TWAK 3SZZA 2JA5C 1XPPA 3I4MC 5M5WK 3HXAA 2XCOA 2FQOA 4GTCA 4QJVA 3AQPA 2R7ZA 3AD7C 3OREA 4OINA 4GT9A 1EH1A 5IP7C 3LAJA 2WB1D 5C4XK 1SFOK 2V6UA 4Y52K 5TMFA 1WCMA 3FKIA 3IPJA 4C3IK 4LOWA 5IYBK 2VUMA 4AH6A 3HOYC 2FQTA 1VJEA 1L0WA 1TWAC 3GTPA 4PAAA 1B4AA 2BE5A 1Y1VC 4KASA 4LK1A 3GTLA 2V6SA 1X31C 3GTKK 2NVTC 1SFOC 4A3GK 4RMFA 5C4XC 4LR2A 4Y52C 1C0AA 3OPFA 4OIPA 4A3FC 4C3IC 2NVYA 5IOSA 2JA6K 3GEIA 1TWHK 5IYDK 2JA7A 1AB4A 4Q5SA 3AQOA 3FOFA 1F9NA 1WQHA 5JVOA 1K83K 1IS1A 1O25A 4BY1C 1TWCA 5EGEA 4G0UA 3I4NK 3S1NK 4G7OA 3GTKC 4YG2A 4A3GC 3PO2K 4J3NA 4BY7K 3RZDK 2E2IA 4A93K 3GTGK 3GEEA 1IW7A 1BJTA 1IBAA 2JA6C 1TWHC 5IYDC 3SZYA 5IORA 2B63C 1IE0A 1O24A 3S16C 1XXCA 5FJ8K 3A8JA 1JVIA 3S17C 4QJVB 1K83C 1PJ6A 4X6AC 3M3YK 4A3JK 4WJ4A 4BY7C 1ZBSA 2R93A 4KM9A 4A93C 5EGHA 3GTGC 2E2HA 4QIWL 1UV7A 4KN4A 3H0GC 4KM8A 3K7AC 4P5BA 1WOSA 4KAWX 2CFAA 1WIHA 1GE9A 4A3CC 1DCPA 5IP9C 1TWFK 3GTOA 3PO3K 3T00A 4KDDA 1I3QA 1IQ0A 3CAGA 3HOYK 3TTGA 1I50C 2GSUA 1R9TA 1VRQC 2NVQK 2YU9K 3M3YC 4A3JC 1WOPA 3TFHA 2GAGC 3GTQA 1Y1VK 1ZQ1C 3GSIA 4P5AA 1F7UA 4KB2A 3HOVC 2NVTK 1O2BA 4PABA 5M3FK 1TWFC 5IOTA 4A3FK 3S2HC 3HOWK 3PO3C 4XLNA 2KWAA 4XCHA 2Y0SL 4QIWD 2PPBA 1WCMC 2GSOA 3LAPA 4OIRA 2NVQC 2YU9C 3M4OC 1F7VA 5L46A 3DXJA 3QX3A 4KMDA 4GTLA 1G51A 5C3EK 1USMA 2PMZD 1EI6A 4BY1K 1TWAA 3GTMK 4Y7NK 5CJ9A 4DDQA 4C2MK 4C3JC 3N3YA 1J6XA 5CHPA 3HOWC 1WORA 1SFOA 2JA8K 3A8IA 4AYBD 4NOIA 3G4AA 1XXAA 2B63K 3CQZK 3S16K 3EQLA 5C3EC 2NVYC 1PJ5A 3S17K 2PA8L 4ILDA 2NVXA 1EFWA 2P8TA 4KMUA 4X6AK 5HL8A 1EK8A 3GTMC 4O2DA 4Y7NC 2Y0SD 4MEXA 4GTDA 3ADAC 3GTJA 4A3IK 3S14K 3L4JA 4GTAA 2E2JK 2CFAB 4C2MC 3TFIA 1TWCC 1HI9A 3H0GK 1XZPA 1O29A 3K7AK 1PJ7A 3NUHA 2R92K 3GTKA 1F93A 2JA8C 2JH3A 4BLBA 4A3CK 2ZUEA 5IP9K 5D4DA 3CQZC 4BXXK 3V4GA 5E68A 1DD5A 1I50K 1O26A 1TWHA 2ZFZA 5C4JK 5C44K 2W7VA 5TMCA 4C3HK 2PHCB 3T02A 1VGXA 4A3DK 4A3IC 3S14C 1TWGA 1Y1WK 1K83A 2XCRB 2E2JC 3HOVK 1J6WA 2R92C 4GFQA 2PA8D 2GAHC 3HOZK 4KMAA 5JFEA 2R7ZK 2R93C 3GTGA 1SMYA 2PMZL 5M5YK 1YX2A 3S2HK 4BXXC 2A6EA 4YFXA 3BP8C 3HOXK 1WCMK 4GZYA 1V5VA 3HKZD 3S0XA 3FKIK 5C4JC 3M4OK 5C44C 4LK0A 4C3HC 4BBSK 4A3DC 2VUMK 3WODA 1Y1WC 4AYBL 1R9TC 2JA5A 3RZOK 4G0VA 3GTPK 2WAQL 4G0WA 3GTQC 4G7ZA 3HOZC 4LQYA 4A3BC 1JQWA 3VA7A 1VLOA 2R7ZC 3S1MK 2A68A 3LPXA 4JK1A 3GTLK 4C3JK 3JSTA 2Y3PA 4A3MK 4P9SA 1I6VA 2RH6A 4KB4A 2O5JA 4WJ3M 1O27A 1XZQA 3HOXC 3FKIC 1TWFA 1B4BA 4KARA 3N0CA 2NVYK 3S1RC 4BBSC 4A3LC 4XSXA 1IL2A 2VUMC 1I6HK 4BBRK 3GIRA 1EQRA 4BKWA 4C45A 2JA7K 2YU9A 3RZOC 3ERED 3GTPC 3BP3A 1XZPB 3FOEA 3S2DC 1Y1VA 5IYCK 2NVXK 3S1MC 3GDZA 4A3EK 3GTLC 3T01A 1TWCK 3AH5A 4KATA 1YCLA 4A3MC 1JOEA 3GTJK 4KMHA 2E2IK 2XCQA 4KC6A 2WAQD 4KN7A 4OIOA
chains in the Genus database with same CATH topology
4A3CC 4Q4ZA 4Y52K 5IP9C 5D4DA 3CQZC 5TMFA 4BXXK 1TWFK 3PO3K 1I6HC 4BBRC 2JA7C 1I50K 4C3IK 5IYBK 5C4JK 3HOYK 1I50C 5IYCC 2NVQK 5C44K 5IYBC 2YU9K 3HOYC 2NVXC 5TMCA 1TWAC 4C3HK 4A3JC 3M3YC 1HQMA 4A3EC 4A3DK 1Y1VK 4A3IC 3S14C 1Y1WK 2BE5A 4XLPA 1Y1VC 2E2JC 3HKZL 3HOVK 5M3MK 2R92C 3GTJC 4LK1A 2O5IA 2PA8D 3H3VL 2R93K 3HOVC 3HOZK 2E2IC 2NVTK 1TWGK 2R93C 2E2HK 2R7ZK 3GTKK 2NVTC 1SFOC 4MEYA 4A3GK 5C4XC 1SMYA 2PMZL 5M5YK 5M3FK 3S2HK 4Y52C 4BXXC 1YNNA 1TWFC 2A6EA 4A3FK 4YFXA 5FLMK 3HOWK 3S2HC 3PO3C 4XLNA 4OIPA 4A3FC 3S15K 3HOXK 1WCMK 3GTOK 2Y0SL 4QIWD 2PPBA 4GZYA 1ZYRA 3HKZD 5C4JC 3FKIK 3M4OK 4A3KK 1WCMC 2JA6K 4LLGA 1I3QK 4OIRA 2NVQC 5C44C 2YU9C 3M4OC 1TWHK 4LK0A 3DXJA 5IYDK 4BBSK 4A3DC 5C3EK 1R9TK 2A6HA 2VUMK 4Q5SA 3WODA 1Y1WC 4AYBL 2PMZD 1R9TC 3HOUK 3GTQK 3RZOK 4BY1K 4A3BK 3GTPK 2WAQL 3GTMK 2WB1L 1K83K 4G7ZA 4YFKA 4XSZA 4Y7NK 4BY1C 3GTQC 3HOZC 3I4NK 4A3BC 3S1QK 3S1NK 1TWGC 4G7OA 2E2HC 2R7ZC 3S1MK 3GTKC 4YG2A 3I4NC 2JA5K 3I4MK 2A68A 4JK1A 3GTLK 3PO2K 3RZDK 3S1NC 4A3GC 4BY7K 4C3JK 3PO2C 4A3MK 4C2MK 1I6VA 3RZDC 4OIQA 4A93K 3GTGK 5FLMC 3HOWC 2O5JA 1IW7A 2JA8K 4G7HA 3S15C 4MQ9A 5IP7K 3HOXC 4AYBD 3GTOC 4LJZA 3H3VD 2CW0A 3FKIC 4NOIA 4A3KC 2JA6C 1I3QC 3S1RK 4A3LK 1TWHC 2NVYK 2B63K 3CQZK 5IYDC 3S1RC 3S16K 3EQLA 5C3EC 4XSXA 2VUMC 4BBSC 4A3LC 2NVYC 5M5XK 2B63C 2A69A 3S17K 4BBRK 2PA8L 3S16C 1I6HK 5FJ8K 3HOUC 4ZH4A 2JA7K 3S2DK 3RZOC 4KMUA 3S17C 4QJVB 3GTPC 4X6AK 3GTMC 1BDFA 1K83C 1YNJA 4Y7NC 3S1QC 3S2DC 5IYCK 4YFNA 4X6AC 2Y0SD 4MEXA 2NVXK 3S1MC 1TWAK 3M3YK 4A3JK 2JA5C 1XPPA 4A3EK 3GTLC 3I4MC 4BY7C 5M5WK 1TWCK 4A3IK 3S14K 4QJVA 4A3MC 2E2JK 1TWCC 3H0GK 4A93C 3K7AK 3GTGC 2R92K 4QIWL 3GTJK 4KN4A 3H0GC 4OINA 2JA8C 3K7AC 2E2IK 5IP7C 2WAQD 2WB1D 4A3CK 4KN7A 4OIOA 5C4XK 1SFOK 5IP9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C C;  4Q4Z A;  4Y52 K;  5IP9 C;  5D4D A;  3CQZ C;  5TMF A;  4BXX K;  1TWF K;  3PO3 K;  1I6H C;  4BBR C;  2JA7 C;  1I50 K;  4C3I K;  5IYB K;  5C4J K;  3HOY K;  1I50 C;  5IYC C;  2NVQ K;  5C44 K;  5IYB C;  2YU9 K;  3HOY C;  2NVX C;  5TMC A;  1TWA C;  4C3H K;  4A3J C;  3M3Y C;  1HQM A;  4A3E C;  4A3D K;  1Y1V K;  4A3I C;  3S14 C;  1Y1W K;  2BE5 A;  4XLP A;  1Y1V C;  2E2J C;  3HKZ L;  3HOV K;  5M3M K;  2R92 C;  3GTJ C;  4LK1 A;  2O5I A;  2PA8 D;  3H3V L;  2R93 K;  3HOV C;  3HOZ K;  2E2I C;  2NVT K;  1TWG K;  2R93 C;  2E2H K;  2R7Z K;  3GTK K;  2NVT C;  1SFO C;  4MEY A;  4A3G K;  5C4X C;  1SMY A;  2PMZ L;  5M5Y K;  5M3F K;  3S2H K;  4Y52 C;  4BXX C;  1YNN A;  1TWF C;  2A6E A;  4A3F K;  4YFX A;  5FLM K;  3HOW K;  3S2H C;  3PO3 C;  4XLN A;  4OIP A;  4A3F C;  3S15 K;  3HOX K;  1WCM K;  3GTO K;  2Y0S L;  4QIW D;  2PPB A;  4GZY A;  1ZYR A;  3HKZ D;  5C4J C;  3FKI K;  3M4O K;  4A3K K;  1WCM C;  2JA6 K;  4LLG A;  1I3Q K;  4OIR A;  2NVQ C;  5C44 C;  2YU9 C;  3M4O C;  1TWH K;  4LK0 A;  3DXJ A;  5IYD K;  4BBS K;  4A3D C;  5C3E K;  1R9T K;  2A6H A;  2VUM K;  4Q5S A;  3WOD A;  1Y1W C;  4AYB L;  2PMZ D;  1R9T C;  3HOU K;  3GTQ K;  3RZO K;  4BY1 K;  4A3B K;  3GTP K;  2WAQ L;  3GTM K;  2WB1 L;  1K83 K;  4G7Z A;  4YFK A;  4XSZ A;  4Y7N K;  4BY1 C;  3GTQ C;  3HOZ C;  3I4N K;  4A3B C;  3S1Q K;  3S1N K;  1TWG C;  4G7O A;  2E2H C;  2R7Z C;  3S1M K;  3GTK C;  4YG2 A;  3I4N C;  2JA5 K;  3I4M K;  2A68 A;  4JK1 A;  3GTL K;  3PO2 K;  3RZD K;  3S1N C;  4A3G C;  4BY7 K;  4C3J K;  3PO2 C;  4A3M K;  4C2M K;  1I6V A;  3RZD C;  4OIQ A;  4A93 K;  3GTG K;  5FLM C;  3HOW C;  2O5J A;  1IW7 A;  2JA8 K;  4G7H A;  3S15 C;  4MQ9 A;  5IP7 K;  3HOX C;  4AYB D;  3GTO C;  4LJZ A;  3H3V D;  2CW0 A;  3FKI C;  4NOI A;  4A3K C;  2JA6 C;  1I3Q C;  3S1R K;  4A3L K;  1TWH C;  2NVY K;  2B63 K;  3CQZ K;  5IYD C;  3S1R C;  3S16 K;  3EQL A;  5C3E C;  4XSX A;  2VUM C;  4BBS C;  4A3L C;  2NVY C;  5M5X K;  2B63 C;  2A69 A;  3S17 K;  4BBR K;  2PA8 L;  3S16 C;  1I6H K;  5FJ8 K;  3HOU C;  4ZH4 A;  2JA7 K;  3S2D K;  3RZO C;  4KMU A;  3S17 C;  4QJV B;  3GTP C;  4X6A K;  3GTM C;  1BDF A;  1K83 C;  1YNJ A;  4Y7N C;  3S1Q C;  3S2D C;  5IYC K;  4YFN A;  4X6A C;  2Y0S D;  4MEX A;  2NVX K;  3S1M C;  1TWA K;  3M3Y K;  4A3J K;  2JA5 C;  1XPP A;  4A3E K;  3GTL C;  3I4M C;  4BY7 C;  5M5W K;  1TWC K;  4A3I K;  3S14 K;  4QJV A;  4A3M C;  2E2J K;  1TWC C;  3H0G K;  4A93 C;  3K7A K;  3GTG C;  2R92 K;  4QIW L;  3GTJ K;  4KN4 A;  3H0G C;  4OIN A;  2JA8 C;  3K7A C;  2E2I K;  5IP7 C;  2WAQ D;  2WB1 D;  4A3C K;  4KN7 A;  4OIO A;  5C4X K;  1SFO K;  5IP9 K; 
#chains in the Genus database with same CATH topology
 1ZXO A;  1VH2 A;  4Q4Z A;  1O28 A;  1I6H C;  4BBR C;  3FHZ A;  1BS2 A;  2JA7 C;  3AD8 C;  5IYC C;  4GTE A;  5IYB C;  2NVX C;  1BGW A;  4FM9 A;  1HQM A;  4A3E C;  3GTM A;  3MML B;  4XLP A;  1WSR A;  3HKZ L;  1WOO A;  3GEH A;  4GTF A;  1XXB A;  5M3M K;  3H3V L;  3GTJ C;  2O5I A;  2R93 K;  2GSN A;  2E2I C;  2RGR A;  1TWG K;  1DCH A;  2E2H K;  1J6V A;  3OEP A;  4MEY A;  1WQF A;  5TJ3 A;  1WQG A;  1YNN A;  2JA6 A;  5FLM K;  1O2F B;  2V6T A;  3S15 K;  1J98 A;  1ISE A;  3GTO K;  1ZYR A;  3Q3Q A;  2B63 A;  3CQZ A;  4A3K K;  4LLG A;  1I3Q K;  1WSV A;  3BUE A;  2ZUF A;  2D6F C;  4BLA A;  1R9T K;  2A6H A;  1ZVU A;  3HOU K;  1KQ4 A;  3GTQ K;  1INN A;  1RU0 A;  4A3B K;  2WB1 L;  3S1Q K;  4YFK A;  4XSZ A;  1TWG C;  1DCO A;  2E2H C;  2P5M A;  3I4N C;  2JA5 K;  1XZQ B;  3H0G A;  3I4M K;  3S1N C;  1USO A;  2R92 A;  3PO2 C;  3RZD C;  4OIQ A;  3AD9 C;  2EBB A;  5FLM C;  4G7H A;  3S15 C;  4FZB A;  3A8K A;  4M1X A;  4MQ9 A;  1O2A A;  5IP7 K;  3GTO C;  3H3V D;  4LJZ A;  2CW0 A;  4A3K C;  1I3Q C;  3S1R K;  4A3L K;  4WIL A;  4GTB A;  3TFJ A;  1I50 A;  5IOQ A;  5M5X K;  2A69 A;  3G4C A;  3HOU C;  4ZH4 A;  3L4K A;  3S2D K;  1BDF A;  1YNJ A;  3N0B A;  3S1Q C;  4YFN A;  1Y1W A;  1TWA K;  3SZZ A;  2JA5 C;  1XPP A;  3I4M C;  5M5W K;  3HXA A;  2XCO A;  2FQO A;  4GTC A;  4QJV A;  3AQP A;  2R7Z A;  3AD7 C;  3ORE A;  4OIN A;  4GT9 A;  1EH1 A;  5IP7 C;  3LAJ A;  2WB1 D;  5C4X K;  1SFO K;  2V6U A;  4Y52 K;  5TMF A;  1WCM A;  3FKI A;  3IPJ A;  4C3I K;  4LOW A;  5IYB K;  2VUM A;  4AH6 A;  3HOY C;  2FQT A;  1VJE A;  1L0W A;  1TWA C;  3GTP A;  4PAA A;  1B4A A;  2BE5 A;  1Y1V C;  4KAS A;  4LK1 A;  3GTL A;  2V6S A;  1X31 C;  3GTK K;  2NVT C;  1SFO C;  4A3G K;  4RMF A;  5C4X C;  4LR2 A;  4Y52 C;  1C0A A;  3OPF A;  4OIP A;  4A3F C;  4C3I C;  2NVY A;  5IOS A;  2JA6 K;  3GEI A;  1TWH K;  5IYD K;  2JA7 A;  1AB4 A;  4Q5S A;  3AQO A;  3FOF A;  1F9N A;  1WQH A;  5JVO A;  1K83 K;  1IS1 A;  1O25 A;  4BY1 C;  1TWC A;  5EGE A;  4G0U A;  3I4N K;  3S1N K;  4G7O A;  3GTK C;  4YG2 A;  4A3G C;  3PO2 K;  4J3N A;  4BY7 K;  3RZD K;  2E2I A;  4A93 K;  3GTG K;  3GEE A;  1IW7 A;  1BJT A;  1IBA A;  2JA6 C;  1TWH C;  5IYD C;  3SZY A;  5IOR A;  2B63 C;  1IE0 A;  1O24 A;  3S16 C;  1XXC A;  5FJ8 K;  3A8J A;  1JVI A;  3S17 C;  4QJV B;  1K83 C;  1PJ6 A;  4X6A C;  3M3Y K;  4A3J K;  4WJ4 A;  4BY7 C;  1ZBS A;  2R93 A;  4KM9 A;  4A93 C;  5EGH A;  3GTG C;  2E2H A;  4QIW L;  1UV7 A;  4KN4 A;  3H0G C;  4KM8 A;  3K7A C;  4P5B A;  1WOS A;  4KAW X;  2CFA A;  1WIH A;  1GE9 A;  4A3C C;  1DCP A;  5IP9 C;  1TWF K;  3GTO A;  3PO3 K;  3T00 A;  4KDD A;  1I3Q A;  1IQ0 A;  3CAG A;  3HOY K;  3TTG A;  1I50 C;  2GSU A;  1R9T A;  1VRQ C;  2NVQ K;  2YU9 K;  3M3Y C;  4A3J C;  1WOP A;  3TFH A;  2GAG C;  3GTQ A;  1Y1V K;  1ZQ1 C;  3GSI A;  4P5A A;  1F7U A;  4KB2 A;  3HOV C;  2NVT K;  1O2B A;  4PAB A;  5M3F K;  1TWF C;  5IOT A;  4A3F K;  3S2H C;  3HOW K;  3PO3 C;  4XLN A;  2KWA A;  4XCH A;  2Y0S L;  4QIW D;  2PPB A;  1WCM C;  2GSO A;  3LAP A;  4OIR A;  2NVQ C;  2YU9 C;  3M4O C;  1F7V A;  5L46 A;  3DXJ A;  3QX3 A;  4KMD A;  4GTL A;  1G51 A;  5C3E K;  1USM A;  2PMZ D;  1EI6 A;  4BY1 K;  1TWA A;  3GTM K;  4Y7N K;  5CJ9 A;  4DDQ A;  4C2M K;  4C3J C;  3N3Y A;  1J6X A;  5CHP A;  3HOW C;  1WOR A;  1SFO A;  2JA8 K;  3A8I A;  4AYB D;  4NOI A;  3G4A A;  1XXA A;  2B63 K;  3CQZ K;  3S16 K;  3EQL A;  5C3E C;  2NVY C;  1PJ5 A;  3S17 K;  2PA8 L;  4ILD A;  2NVX A;  1EFW A;  2P8T A;  4KMU A;  4X6A K;  5HL8 A;  1EK8 A;  3GTM C;  4O2D A;  4Y7N C;  2Y0S D;  4MEX A;  4GTD A;  3ADA C;  3GTJ A;  4A3I K;  3S14 K;  3L4J A;  4GTA A;  2E2J K;  2CFA B;  4C2M C;  3TFI A;  1TWC C;  1HI9 A;  3H0G K;  1XZP A;  1O29 A;  3K7A K;  1PJ7 A;  3NUH A;  2R92 K;  3GTK A;  1F93 A;  2JA8 C;  2JH3 A;  4BLB A;  4A3C K;  2ZUE A;  5IP9 K;  5D4D A;  3CQZ C;  4BXX K;  3V4G A;  5E68 A;  1DD5 A;  1I50 K;  1O26 A;  1TWH A;  2ZFZ A;  5C4J K;  5C44 K;  2W7V A;  5TMC A;  4C3H K;  2PHC B;  3T02 A;  1VGX A;  4A3D K;  4A3I C;  3S14 C;  1TWG A;  1Y1W K;  1K83 A;  2XCR B;  2E2J C;  3HOV K;  1J6W A;  2R92 C;  4GFQ A;  2PA8 D;  2GAH C;  3HOZ K;  4KMA A;  5JFE A;  2R7Z K;  2R93 C;  3GTG A;  1SMY A;  2PMZ L;  5M5Y K;  1YX2 A;  3S2H K;  4BXX C;  2A6E A;  4YFX A;  3BP8 C;  3HOX K;  1WCM K;  4GZY A;  1V5V A;  3HKZ D;  3S0X A;  3FKI K;  5C4J C;  3M4O K;  5C44 C;  4LK0 A;  4C3H C;  4BBS K;  4A3D C;  2VUM K;  3WOD A;  1Y1W C;  4AYB L;  1R9T C;  2JA5 A;  3RZO K;  4G0V A;  3GTP K;  2WAQ L;  4G0W A;  3GTQ C;  4G7Z A;  3HOZ C;  4LQY A;  4A3B C;  1JQW A;  3VA7 A;  1VLO A;  2R7Z C;  3S1M K;  2A68 A;  3LPX A;  4JK1 A;  3GTL K;  4C3J K;  3JST A;  2Y3P A;  4A3M K;  4P9S A;  1I6V A;  2RH6 A;  4KB4 A;  2O5J A;  4WJ3 M;  1O27 A;  1XZQ A;  3HOX C;  3FKI C;  1TWF A;  1B4B A;  4KAR A;  3N0C A;  2NVY K;  3S1R C;  4BBS C;  4A3L C;  4XSX A;  1IL2 A;  2VUM C;  1I6H K;  4BBR K;  3GIR A;  1EQR A;  4BKW A;  4C45 A;  2JA7 K;  2YU9 A;  3RZO C;  3ERE D;  3GTP C;  3BP3 A;  1XZP B;  3FOE A;  3S2D C;  1Y1V A;  5IYC K;  2NVX K;  3S1M C;  3GDZ A;  4A3E K;  3GTL C;  3T01 A;  1TWC K;  3AH5 A;  4KAT A;  1YCL A;  4A3M C;  1JOE A;  3GTJ K;  4KMH A;  2E2I K;  2XCQ A;  4KC6 A;  2WAQ D;  4KN7 A;  4OIO A; 
#chains in the Genus database with same CATH homology
 4A3C C;  4Q4Z A;  4Y52 K;  5IP9 C;  5D4D A;  3CQZ C;  5TMF A;  4BXX K;  1TWF K;  3PO3 K;  1I6H C;  4BBR C;  2JA7 C;  1I50 K;  4C3I K;  5IYB K;  5C4J K;  3HOY K;  1I50 C;  5IYC C;  2NVQ K;  5C44 K;  5IYB C;  2YU9 K;  3HOY C;  2NVX C;  5TMC A;  1TWA C;  4C3H K;  4A3J C;  3M3Y C;  1HQM A;  4A3E C;  4A3D K;  1Y1V K;  4A3I C;  3S14 C;  1Y1W K;  2BE5 A;  4XLP A;  1Y1V C;  2E2J C;  3HKZ L;  3HOV K;  5M3M K;  2R92 C;  3GTJ C;  4LK1 A;  2O5I A;  2PA8 D;  3H3V L;  2R93 K;  3HOV C;  3HOZ K;  2E2I C;  2NVT K;  1TWG K;  2R93 C;  2E2H K;  2R7Z K;  3GTK K;  2NVT C;  1SFO C;  4MEY A;  4A3G K;  5C4X C;  1SMY A;  2PMZ L;  5M5Y K;  5M3F K;  3S2H K;  4Y52 C;  4BXX C;  1YNN A;  1TWF C;  2A6E A;  4A3F K;  4YFX A;  5FLM K;  3HOW K;  3S2H C;  3PO3 C;  4XLN A;  4OIP A;  4A3F C;  3S15 K;  3HOX K;  1WCM K;  3GTO K;  2Y0S L;  4QIW D;  2PPB A;  4GZY A;  1ZYR A;  3HKZ D;  5C4J C;  3FKI K;  3M4O K;  4A3K K;  1WCM C;  2JA6 K;  4LLG A;  1I3Q K;  4OIR A;  2NVQ C;  5C44 C;  2YU9 C;  3M4O C;  1TWH K;  4LK0 A;  3DXJ A;  5IYD K;  4BBS K;  4A3D C;  5C3E K;  1R9T K;  2A6H A;  2VUM K;  4Q5S A;  3WOD A;  1Y1W C;  4AYB L;  2PMZ D;  1R9T C;  3HOU K;  3GTQ K;  3RZO K;  4BY1 K;  4A3B K;  3GTP K;  2WAQ L;  3GTM K;  2WB1 L;  1K83 K;  4G7Z A;  4YFK A;  4XSZ A;  4Y7N K;  4BY1 C;  3GTQ C;  3HOZ C;  3I4N K;  4A3B C;  3S1Q K;  3S1N K;  1TWG C;  4G7O A;  2E2H C;  2R7Z C;  3S1M K;  3GTK C;  4YG2 A;  3I4N C;  2JA5 K;  3I4M K;  2A68 A;  4JK1 A;  3GTL K;  3PO2 K;  3RZD K;  3S1N C;  4A3G C;  4BY7 K;  4C3J K;  3PO2 C;  4A3M K;  4C2M K;  1I6V A;  3RZD C;  4OIQ A;  4A93 K;  3GTG K;  5FLM C;  3HOW C;  2O5J A;  1IW7 A;  2JA8 K;  4G7H A;  3S15 C;  4MQ9 A;  5IP7 K;  3HOX C;  4AYB D;  3GTO C;  4LJZ A;  3H3V D;  2CW0 A;  3FKI C;  4NOI A;  4A3K C;  2JA6 C;  1I3Q C;  3S1R K;  4A3L K;  1TWH C;  2NVY K;  2B63 K;  3CQZ K;  5IYD C;  3S1R C;  3S16 K;  3EQL A;  5C3E C;  4XSX A;  2VUM C;  4BBS C;  4A3L C;  2NVY C;  5M5X K;  2B63 C;  2A69 A;  3S17 K;  4BBR K;  2PA8 L;  3S16 C;  1I6H K;  5FJ8 K;  3HOU C;  4ZH4 A;  2JA7 K;  3S2D K;  3RZO C;  4KMU A;  3S17 C;  4QJV B;  3GTP C;  4X6A K;  3GTM C;  1BDF A;  1K83 C;  1YNJ A;  4Y7N C;  3S1Q C;  3S2D C;  5IYC K;  4YFN A;  4X6A C;  2Y0S D;  4MEX A;  2NVX K;  3S1M C;  1TWA K;  3M3Y K;  4A3J K;  2JA5 C;  1XPP A;  4A3E K;  3GTL C;  3I4M C;  4BY7 C;  5M5W K;  1TWC K;  4A3I K;  3S14 K;  4QJV A;  4A3M C;  2E2J K;  1TWC C;  3H0G K;  4A93 C;  3K7A K;  3GTG C;  2R92 K;  4QIW L;  3GTJ K;  4KN4 A;  3H0G C;  4OIN A;  2JA8 C;  3K7A C;  2E2I K;  5IP7 C;  2WAQ D;  2WB1 D;  4A3C K;  4KN7 A;  4OIO A;  5C4X K;  1SFO K;  5IP9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...