4BBRK

Structure of rna polymerase ii-tfiib complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4bbrK00
3S1QC 3HKZD 4LK0A 4YG2A 3HKZL 3M3YC 2A6EA 3M3YK 2R7ZC 5C3EK 5C3EC 3S1RC 3S1RK 2R7ZK 4Q5SA 4A3LK 4A3LC 4QIWL 3HOVK 4QJVB 5IP9C 3HOVC 2R92K 2YU9C 1Y1VC 1Y1VK 1TWGK 1TWGC 2NVTK 2NVTC 5IYCK 4BY1K 4BY1C 4G7OA 4MEYA 2PPBA 4KN7A 4ZH4A 3PO3C 3I4MK 5FLMC 1I6VA 3PO3K 4A3CK 1TWFC 5D4DA 2VUMK 2VUMC 3GTKK 4A3FK 3S1MK 4XLPA 3M4OC 4Q4ZA 3M4OK 3S1MC 4A3DC 1XPPA 1I6HC 2B63C 2B63K 3EQLA 4GZYA 4A3BC 4LLGA 2WB1D 4A93K 4OINA 3S15K 3S15C 4A93C 4YFNA 4NOIA 5C4XC 3PO2C 3PO2K 3RZOC 3RZOK 5IYBK 5IYBC 3HOWK 3HOWC 2JA5C 2JA5K 4Y52C 4Y52K 1Y1WK 1Y1WC 2R92C 2PA8L 4QIWD 4OIOA 2JA7K 2JA7C 3FKIK 4A3MK 4A3MC 4KN4A 4LJZA 5IYCC 2JA6K 4A3EK 3H0GC 3H0GK 4A3EC 4BXXC 4BXXK 4AYBL 3S1NK 3S1NC 2BE5A 1I3QC 1I3QK 4YFKA 3I4MC 1WCMK 1WCMC 3S17K 4C3HK 3RZDC 3RZDK 3S17C 3HOYC 3GTKC 4LK1A 5TMFA 4A3FC 3GTMC 3GTPC 3GTPK 4A3DK 1YNJA 1IW7A 2E2JK 3K7AC 3K7AK 2A68A 2A69A 5M5YK 2NVQC 2NVQK 3HOUC 3HOUK 1TWAC 1TWAK 3HOZC 3HOZK 4JK1A 5M5XK 4A3IK 4A3IC 3GTJC 3GTJK 4KMUA 4XSXA 5IP7C 5IP7K 4OIRA 3H3VL 5FJ8K 2PA8D 2O5IA 3GTLK 3GTLC 5M5WK 5M3MK 3GTOC 3FKIC 3GTOK 1R9TK 2A6HA 1SMYA 5TMCA 2JA6C 4AYBD 2NVYK 2NVYC 5C44K 5C44C 4BY7K 4G7HA 2O5JA 4X6AK 1TWCK 1TWCC 4X6AC 2PMZL 2E2HC 4BBRC 4BBRK 4A3KK 4A3KC 2E2HK 3GTQK 3GTQC 4QJVA 4MEXA 3GTMK 3HOYK 3S2HK 3S2HC 3S2DK 2JA8C 4C3IK 4G7ZA 2JA8K 3S14K 3S14C 3S2DC 4YFXA 2R93C 2R93K 2CW0A 4XSZA 4OIQA 1YNNA 3S1QK 2E2JC 1SFOK 1BDFA 1SFOC 4BBSC 4BBSK 3DXJA 4A3GK 4A3GC 2Y0SD 5M3FK 4XLNA 4C3JK 1HQMA 2Y0SL 4MQ9A 3H3VD 5IYDC 5IP9K 3HOXC 3HOXK 5IYDK 2YU9K 1TWHK 1TWHC 3I4NK 3I4NC 3CQZK 3CQZC 4A3JK 4A3JC 1R9TC 4C2MK 5C4JK 5C4JC 5FLMK 4OIPA 1TWFK 1I50K 1I50C 2NVXC 2NVXK 4BY7C 1ZYRA 3WODA 2PMZD 3S16K 3S16C 1I6HK 1K83C 1K83K 2E2IC 2E2IK 4A3CC 2WAQD 4A3BK 2WAQL 4Y7NC 4Y7NK 3GTGK 3GTGC 5C4XK 2WB1L
chains in the Genus database with same CATH superfamily
4J3NA 3GTJA 1WORA 1EK8A 3OEPA 4QIWL 1DCHA 1J6XA 2R92K 2YU9C 2NVTK 2NVTC 2R92C 3GTMC 3GTMK 4BY1K 4BY1C 2PPBA 5HL8A 5FLMC 1B4AA 1TWFC 3GTPA 3GTKK 2R93A 4XLPA 1XPPA 1J6WA 4LLGA 2V6TA 4A93K 4OINA 4A93C 4NOIA 3CAGA 5IYBK 5IYBC 3CQZA 1ZQ1C 1Y1WK 1Y1WC 2PA8L 1DCOA 3FKIK 3Q3QA 3GEHA 2NVXA 1PJ6A 1F7UA 4LR2A 4AYBL 5IOTA 1K83A 4A3DC 4A3CC 4A3DK 1WCMK 1WCMC 4XCHA 4C3HC 4C45A 4C3HK 1O2BA 4GTFA 1XXBA 4WILA 2A69A 1UV7A 5M5XK 2R92A 2YU9A 3ADAC 5IP7C 5IP7K 1EQRA 3GTLK 3GTLC 4LOWA 1R9TK 2CFAA 1SMYA 1TWFA 1EH1A 3LAPA 2JA6C 2PHCB 1TWCK 1TWCC 1VGXA 2PMZL 4A3KK 4A3KC 1AB4A 3S2HK 3S2HC 3S2DK 3S2DC 3S14K 4C3IC 4C3IK 5TJ3A 3LAJA 3S14C 5EGEA 4KMDA 2FQOA 2ZFZA 3DXJA 1Y1WA 4C3JC 1XZQA 4MQ9A 4C3JK 3H3VD 1JOEA 1TWHK 1TWHC 3I4NK 3I4NC 1X31C 1WCMA 1B4BA 2VUMA 1XXAA 1I50K 1I50C 4O2DA 3AQOA 2WAQD 2WAQL 3BP3A 4BLAA 4Y7NC 4Y7NK 1O24A 3S1QC 3GDZA 3M3YC 3M3YK 2P8TA 4RMFA 3GTLA 2RH6A 1IE0A 3HOYK 4QJVB 5IP9C 3HOYC 4KMHA 1TWGK 1TWGC 5IYCK 3VA7A 1EFWA 4KMAA 2JA6A 1PJ7A 1TWCA 4FZBA 1I6VA 4GTDA 2P5MA 2FQTA 3M4OC 3M4OK 1VLOA 2B63C 2B63K 1WIHA 3EQLA 4GZYA 4A3BC 2GSOA 2RGRA 3S15K 3S15C 5C4XC 1ZVUA 2JA5C 2W7VA 2JA5K 4QIWD 1USMA 1C0AA 3QX3A 1I50A 3H0GC 3H0GK 1BJTA 1I3QC 1I3QK 1VJEA 2ZUEA 1YX2A 2EBBA 3GTKC 5TMFA 3G4CA 3HXAA 1IW7A 3T02A 1SFOA 2NVQC 5M5YK 2NVQK 5EGHA 1TWGA 2PA8D 2O5IA 5M3MK 4G0UA 3FKIC 3GTOC 3GTOK 2XCQA 4BKWA 5TMCA 4AYBD 2NVYK 2NVYC 4GTEA 2E2HC 1YCLA 2E2HK 2E2IA 3FHZA 1G51A 2GSNA 1WQFA 2CW0A 3ERED 4BBSC 4BBSK 1J6VA 4WJ4A 3T01A 5M3FK 1HQMA 5CJ9A 3SZZA 4M1XA 2GAHC 3GTMA 2KWAA 3G4AA 5IOSA 4A3JK 4A3JC 1O29A 1R9TC 1I3QA 1V5VA 1IL2A 4OIPA 3GTKA 1O26A 5JFEA 3SZYA 2PMZD 4ILDA 4PABA 1I6HK 3BUEA 1F7VA 4G0VA 2WB1L 3A8KA 2CFAB 3OPFA 4FM9A 4YG2A 1WOSA 1IS1A 4KASA 2R7ZC 5C3EK 5C3EC 3S1RC 3S1RK 2R7ZK 4LQYA 3MMLB 4DDQA 3FKIA 3GTOA 3AD9C 3HOVK 3GIRA 3HOVC 3V4GA 1Y1VC 1Y1VK 4G7OA 2NVYA 5JVOA 4KN7A 4ZH4A 3PO3C 3I4MK 3PO3K 4KM8A 3A8IA 5D4DA 4A3FK 1XZQB 4Q4ZA 3NUHA 4WJ3M 4KATA 1ZBSA 1VH2A 4YFNA 3PO2C 3PO2K 3RZOC 3RZOK 1ZXOA 3HOWK 3HOWC 4Y52C 4Y52K 1XXCA 1DCPA 3AQPA 1R9TA 1IQ0A 3N0CA 3BP8C 5IYCC 3AD8C 4A3EK 4A3EC 3S17K 3S17C 3RZDC 3RZDK 5IORA 4KB2A 4LK1A 3GTPC 1EI6A 1F9NA 3GTPK 1YNJA 1O2FB 2E2JK 3K7AC 3K7AK 3TFIA 5L46A 2R7ZA 1TWAC 1TWAK 1XZPA 4A3IK 4A3IC 2XCOA 1O2AA 1TWHA 1Y1VA 3LPXA 4XSXA 5FJ8K 1WQHA 4GTAA 4GTBA 1O28A 4BY7K 2O5JA 4X6AK 4G7HA 4X6AC 3GTQK 3GTQC 3GSIA 5CHPA 4OIQA 2Y3PA 3AD7C 3GEIA 3IPJA 4KB4A 4AH6A 2Y0SD 1O25A 2Y0SL 4P9SA 2YU9K 3L4JA 3AH5A 3T00A 4BLBA 4C2MK 4C2MC 1PJ5A 5C4JK 5C4JC 1WOOA 5FLMK 2ZUFA 1TWFK 4G0WA 3TFHA 3WODA 3S16K 3S16C 4KAWX 2B63A 3GTGK 1O27A 3GTGC 1TWAA 2GAGC 4KM9A 3HKZD 4LK0A 3HKZL 4Q5SA 2A6EA 4GTLA 2JA5A 2JH3A 4A3LK 4A3LC 5IOQA 5E68A 4GFQA 1WSVA 3N3YA 4GT9A 3H0GA 4MEYA 3JSTA 3S0XA 3GTQA 4A3CK 3GEEA 4P5AA 2VUMK 2VUMC 3S1MK 4KDDA 3S1MC 1I6HC 4KARA 3A8JA 2WB1D 4GTCA 1F93A 1WOPA 1BGWA 1BS2A 2GSUA 4OIOA 2JA7K 2JA7C 4A3MK 4A3MC 4KN4A 4LJZA 4P5BA 2JA6K 4BXXC 4BXXK 1L0WA 1HI9A 2E2HA 3S1NK 3S1NC 2BE5A 3I4MC 4YFKA 1JQWA 1VRQC 1WSRA 3GTGA 4A3FC 2V6UA 5C4XK 4PAAA 3FOFA 2A68A 3HOUC 1ISEA 3HOUK 1KQ4A 3HOZC 3HOZK 4JK1A 3GTJC 3GTJK 4KC6A 4KMUA 4OIRA 3H3VL 2D6FC 5M5WK 3L4KA 3FOEA 2A6HA 1GE9A 1RU0A 5C44K 5C44C 4BBRC 4BBRK 4QJVA 4MEXA 2JA8C 1JVIA 2XCRB 4G7ZA 2JA8K 2R93C 3OREA 4YFXA 2R93K 4XSZA 1YNNA 3TTGA 3S1QK 2E2JC 1SFOK 1BDFA 3TFJA 1SFOC 4A3GK 4A3GC 4XLNA 2JA7A 1USOA 5IP9K 5IYDC 3HOXC 3HOXK 5IYDK 1IBAA 3CQZK 3CQZC 1J98A 2NVXC 2NVXK 4BY7C 1ZYRA 1XZPB 1K83C 1K83K 2E2IC 2V6SA 2E2IK 4A3BK 1INNA 1WQGA 1DD5A 3N0BA
chains in the Genus database with same CATH topology
3S1QC 3HKZD 4LK0A 4YG2A 3HKZL 3M3YC 2A6EA 3M3YK 2R7ZC 5C3EK 5C3EC 3S1RC 3S1RK 2R7ZK 4Q5SA 4A3LK 4A3LC 4QIWL 3HOVK 4QJVB 5IP9C 3HOVC 2R92K 2YU9C 1Y1VC 1Y1VK 1TWGK 1TWGC 2NVTK 2NVTC 5IYCK 4BY1K 4BY1C 4G7OA 4MEYA 2PPBA 4KN7A 4ZH4A 3PO3C 3I4MK 5FLMC 1I6VA 3PO3K 4A3CK 1TWFC 5D4DA 2VUMK 2VUMC 3GTKK 4A3FK 3S1MK 4XLPA 3M4OC 4Q4ZA 3M4OK 3S1MC 4A3DC 1XPPA 1I6HC 2B63C 2B63K 3EQLA 4GZYA 4A3BC 4LLGA 2WB1D 4A93K 4OINA 3S15K 3S15C 4A93C 4YFNA 4NOIA 5C4XC 3PO2C 3PO2K 3RZOC 3RZOK 5IYBK 5IYBC 3HOWK 3HOWC 2JA5C 2JA5K 4Y52C 4Y52K 1Y1WK 1Y1WC 2R92C 2PA8L 4QIWD 4OIOA 2JA7K 2JA7C 3FKIK 4A3MK 4A3MC 4KN4A 4LJZA 5IYCC 2JA6K 4A3EK 3H0GC 3H0GK 4A3EC 4BXXC 4BXXK 4AYBL 3S1NK 3S1NC 2BE5A 1I3QC 1I3QK 4YFKA 3I4MC 1WCMK 1WCMC 3S17K 4C3HK 3RZDC 3RZDK 3S17C 3HOYC 3GTKC 4LK1A 5TMFA 4A3FC 3GTMC 3GTPC 3GTPK 4A3DK 1YNJA 1IW7A 2E2JK 3K7AC 3K7AK 2A68A 2A69A 5M5YK 2NVQC 2NVQK 3HOUC 3HOUK 1TWAC 1TWAK 3HOZC 3HOZK 4JK1A 5M5XK 4A3IK 4A3IC 3GTJC 3GTJK 4KMUA 4XSXA 5IP7C 5IP7K 4OIRA 3H3VL 5FJ8K 2PA8D 2O5IA 3GTLK 3GTLC 5M5WK 5M3MK 3GTOC 3FKIC 3GTOK 1R9TK 2A6HA 1SMYA 5TMCA 2JA6C 4AYBD 2NVYK 2NVYC 5C44K 5C44C 4BY7K 4G7HA 2O5JA 4X6AK 1TWCK 1TWCC 4X6AC 2PMZL 2E2HC 4BBRC 4BBRK 4A3KK 4A3KC 2E2HK 3GTQK 3GTQC 4QJVA 4MEXA 3GTMK 3HOYK 3S2HK 3S2HC 3S2DK 2JA8C 4C3IK 4G7ZA 2JA8K 3S14K 3S14C 3S2DC 4YFXA 2R93C 2R93K 2CW0A 4XSZA 4OIQA 1YNNA 3S1QK 2E2JC 1SFOK 1BDFA 1SFOC 4BBSC 4BBSK 3DXJA 4A3GK 4A3GC 2Y0SD 5M3FK 4XLNA 4C3JK 1HQMA 2Y0SL 4MQ9A 3H3VD 5IYDC 5IP9K 3HOXC 3HOXK 5IYDK 2YU9K 1TWHK 1TWHC 3I4NK 3I4NC 3CQZK 3CQZC 4A3JK 4A3JC 1R9TC 4C2MK 5C4JK 5C4JC 5FLMK 4OIPA 1TWFK 1I50K 1I50C 2NVXC 2NVXK 4BY7C 1ZYRA 3WODA 2PMZD 3S16K 3S16C 1I6HK 1K83C 1K83K 2E2IC 2E2IK 4A3CC 2WAQD 4A3BK 2WAQL 4Y7NC 4Y7NK 3GTGK 3GTGC 5C4XK 2WB1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q C;  3HKZ D;  4LK0 A;  4YG2 A;  3HKZ L;  3M3Y C;  2A6E A;  3M3Y K;  2R7Z C;  5C3E K;  5C3E C;  3S1R C;  3S1R K;  2R7Z K;  4Q5S A;  4A3L K;  4A3L C;  4QIW L;  3HOV K;  4QJV B;  5IP9 C;  3HOV C;  2R92 K;  2YU9 C;  1Y1V C;  1Y1V K;  1TWG K;  1TWG C;  2NVT K;  2NVT C;  5IYC K;  4BY1 K;  4BY1 C;  4G7O A;  4MEY A;  2PPB A;  4KN7 A;  4ZH4 A;  3PO3 C;  3I4M K;  5FLM C;  1I6V A;  3PO3 K;  4A3C K;  1TWF C;  5D4D A;  2VUM K;  2VUM C;  3GTK K;  4A3F K;  3S1M K;  4XLP A;  3M4O C;  4Q4Z A;  3M4O K;  3S1M C;  4A3D C;  1XPP A;  1I6H C;  2B63 C;  2B63 K;  3EQL A;  4GZY A;  4A3B C;  4LLG A;  2WB1 D;  4A93 K;  4OIN A;  3S15 K;  3S15 C;  4A93 C;  4YFN A;  4NOI A;  5C4X C;  3PO2 C;  3PO2 K;  3RZO C;  3RZO K;  5IYB K;  5IYB C;  3HOW K;  3HOW C;  2JA5 C;  2JA5 K;  4Y52 C;  4Y52 K;  1Y1W K;  1Y1W C;  2R92 C;  2PA8 L;  4QIW D;  4OIO A;  2JA7 K;  2JA7 C;  3FKI K;  4A3M K;  4A3M C;  4KN4 A;  4LJZ A;  5IYC C;  2JA6 K;  4A3E K;  3H0G C;  3H0G K;  4A3E C;  4BXX C;  4BXX K;  4AYB L;  3S1N K;  3S1N C;  2BE5 A;  1I3Q C;  1I3Q K;  4YFK A;  3I4M C;  1WCM K;  1WCM C;  3S17 K;  4C3H K;  3RZD C;  3RZD K;  3S17 C;  3HOY C;  3GTK C;  4LK1 A;  5TMF A;  4A3F C;  3GTM C;  3GTP C;  3GTP K;  4A3D K;  1YNJ A;  1IW7 A;  2E2J K;  3K7A C;  3K7A K;  2A68 A;  2A69 A;  5M5Y K;  2NVQ C;  2NVQ K;  3HOU C;  3HOU K;  1TWA C;  1TWA K;  3HOZ C;  3HOZ K;  4JK1 A;  5M5X K;  4A3I K;  4A3I C;  3GTJ C;  3GTJ K;  4KMU A;  4XSX A;  5IP7 C;  5IP7 K;  4OIR A;  3H3V L;  5FJ8 K;  2PA8 D;  2O5I A;  3GTL K;  3GTL C;  5M5W K;  5M3M K;  3GTO C;  3FKI C;  3GTO K;  1R9T K;  2A6H A;  1SMY A;  5TMC A;  2JA6 C;  4AYB D;  2NVY K;  2NVY C;  5C44 K;  5C44 C;  4BY7 K;  4G7H A;  2O5J A;  4X6A K;  1TWC K;  1TWC C;  4X6A C;  2PMZ L;  2E2H C;  4BBR C;  4BBR K;  4A3K K;  4A3K C;  2E2H K;  3GTQ K;  3GTQ C;  4QJV A;  4MEX A;  3GTM K;  3HOY K;  3S2H K;  3S2H C;  3S2D K;  2JA8 C;  4C3I K;  4G7Z A;  2JA8 K;  3S14 K;  3S14 C;  3S2D C;  4YFX A;  2R93 C;  2R93 K;  2CW0 A;  4XSZ A;  4OIQ A;  1YNN A;  3S1Q K;  2E2J C;  1SFO K;  1BDF A;  1SFO C;  4BBS C;  4BBS K;  3DXJ A;  4A3G K;  4A3G C;  2Y0S D;  5M3F K;  4XLN A;  4C3J K;  1HQM A;  2Y0S L;  4MQ9 A;  3H3V D;  5IYD C;  5IP9 K;  3HOX C;  3HOX K;  5IYD K;  2YU9 K;  1TWH K;  1TWH C;  3I4N K;  3I4N C;  3CQZ K;  3CQZ C;  4A3J K;  4A3J C;  1R9T C;  4C2M K;  5C4J K;  5C4J C;  5FLM K;  4OIP A;  1TWF K;  1I50 K;  1I50 C;  2NVX C;  2NVX K;  4BY7 C;  1ZYR A;  3WOD A;  2PMZ D;  3S16 K;  3S16 C;  1I6H K;  1K83 C;  1K83 K;  2E2I C;  2E2I K;  4A3C C;  2WAQ D;  4A3B K;  2WAQ L;  4Y7N C;  4Y7N K;  3GTG K;  3GTG C;  5C4X K;  2WB1 L; 
#chains in the Genus database with same CATH topology
 4J3N A;  3GTJ A;  1WOR A;  1EK8 A;  3OEP A;  4QIW L;  1DCH A;  1J6X A;  2R92 K;  2YU9 C;  2NVT K;  2NVT C;  2R92 C;  3GTM C;  3GTM K;  4BY1 K;  4BY1 C;  2PPB A;  5HL8 A;  5FLM C;  1B4A A;  1TWF C;  3GTP A;  3GTK K;  2R93 A;  4XLP A;  1XPP A;  1J6W A;  4LLG A;  2V6T A;  4A93 K;  4OIN A;  4A93 C;  4NOI A;  3CAG A;  5IYB K;  5IYB C;  3CQZ A;  1ZQ1 C;  1Y1W K;  1Y1W C;  2PA8 L;  1DCO A;  3FKI K;  3Q3Q A;  3GEH A;  2NVX A;  1PJ6 A;  1F7U A;  4LR2 A;  4AYB L;  5IOT A;  1K83 A;  4A3D C;  4A3C C;  4A3D K;  1WCM K;  1WCM C;  4XCH A;  4C3H C;  4C45 A;  4C3H K;  1O2B A;  4GTF A;  1XXB A;  4WIL A;  2A69 A;  1UV7 A;  5M5X K;  2R92 A;  2YU9 A;  3ADA C;  5IP7 C;  5IP7 K;  1EQR A;  3GTL K;  3GTL C;  4LOW A;  1R9T K;  2CFA A;  1SMY A;  1TWF A;  1EH1 A;  3LAP A;  2JA6 C;  2PHC B;  1TWC K;  1TWC C;  1VGX A;  2PMZ L;  4A3K K;  4A3K C;  1AB4 A;  3S2H K;  3S2H C;  3S2D K;  3S2D C;  3S14 K;  4C3I C;  4C3I K;  5TJ3 A;  3LAJ A;  3S14 C;  5EGE A;  4KMD A;  2FQO A;  2ZFZ A;  3DXJ A;  1Y1W A;  4C3J C;  1XZQ A;  4MQ9 A;  4C3J K;  3H3V D;  1JOE A;  1TWH K;  1TWH C;  3I4N K;  3I4N C;  1X31 C;  1WCM A;  1B4B A;  2VUM A;  1XXA A;  1I50 K;  1I50 C;  4O2D A;  3AQO A;  2WAQ D;  2WAQ L;  3BP3 A;  4BLA A;  4Y7N C;  4Y7N K;  1O24 A;  3S1Q C;  3GDZ A;  3M3Y C;  3M3Y K;  2P8T A;  4RMF A;  3GTL A;  2RH6 A;  1IE0 A;  3HOY K;  4QJV B;  5IP9 C;  3HOY C;  4KMH A;  1TWG K;  1TWG C;  5IYC K;  3VA7 A;  1EFW A;  4KMA A;  2JA6 A;  1PJ7 A;  1TWC A;  4FZB A;  1I6V A;  4GTD A;  2P5M A;  2FQT A;  3M4O C;  3M4O K;  1VLO A;  2B63 C;  2B63 K;  1WIH A;  3EQL A;  4GZY A;  4A3B C;  2GSO A;  2RGR A;  3S15 K;  3S15 C;  5C4X C;  1ZVU A;  2JA5 C;  2W7V A;  2JA5 K;  4QIW D;  1USM A;  1C0A A;  3QX3 A;  1I50 A;  3H0G C;  3H0G K;  1BJT A;  1I3Q C;  1I3Q K;  1VJE A;  2ZUE A;  1YX2 A;  2EBB A;  3GTK C;  5TMF A;  3G4C A;  3HXA A;  1IW7 A;  3T02 A;  1SFO A;  2NVQ C;  5M5Y K;  2NVQ K;  5EGH A;  1TWG A;  2PA8 D;  2O5I A;  5M3M K;  4G0U A;  3FKI C;  3GTO C;  3GTO K;  2XCQ A;  4BKW A;  5TMC A;  4AYB D;  2NVY K;  2NVY C;  4GTE A;  2E2H C;  1YCL A;  2E2H K;  2E2I A;  3FHZ A;  1G51 A;  2GSN A;  1WQF A;  2CW0 A;  3ERE D;  4BBS C;  4BBS K;  1J6V A;  4WJ4 A;  3T01 A;  5M3F K;  1HQM A;  5CJ9 A;  3SZZ A;  4M1X A;  2GAH C;  3GTM A;  2KWA A;  3G4A A;  5IOS A;  4A3J K;  4A3J C;  1O29 A;  1R9T C;  1I3Q A;  1V5V A;  1IL2 A;  4OIP A;  3GTK A;  1O26 A;  5JFE A;  3SZY A;  2PMZ D;  4ILD A;  4PAB A;  1I6H K;  3BUE A;  1F7V A;  4G0V A;  2WB1 L;  3A8K A;  2CFA B;  3OPF A;  4FM9 A;  4YG2 A;  1WOS A;  1IS1 A;  4KAS A;  2R7Z C;  5C3E K;  5C3E C;  3S1R C;  3S1R K;  2R7Z K;  4LQY A;  3MML B;  4DDQ A;  3FKI A;  3GTO A;  3AD9 C;  3HOV K;  3GIR A;  3HOV C;  3V4G A;  1Y1V C;  1Y1V K;  4G7O A;  2NVY A;  5JVO A;  4KN7 A;  4ZH4 A;  3PO3 C;  3I4M K;  3PO3 K;  4KM8 A;  3A8I A;  5D4D A;  4A3F K;  1XZQ B;  4Q4Z A;  3NUH A;  4WJ3 M;  4KAT A;  1ZBS A;  1VH2 A;  4YFN A;  3PO2 C;  3PO2 K;  3RZO C;  3RZO K;  1ZXO A;  3HOW K;  3HOW C;  4Y52 C;  4Y52 K;  1XXC A;  1DCP A;  3AQP A;  1R9T A;  1IQ0 A;  3N0C A;  3BP8 C;  5IYC C;  3AD8 C;  4A3E K;  4A3E C;  3S17 K;  3S17 C;  3RZD C;  3RZD K;  5IOR A;  4KB2 A;  4LK1 A;  3GTP C;  1EI6 A;  1F9N A;  3GTP K;  1YNJ A;  1O2F B;  2E2J K;  3K7A C;  3K7A K;  3TFI A;  5L46 A;  2R7Z A;  1TWA C;  1TWA K;  1XZP A;  4A3I K;  4A3I C;  2XCO A;  1O2A A;  1TWH A;  1Y1V A;  3LPX A;  4XSX A;  5FJ8 K;  1WQH A;  4GTA A;  4GTB A;  1O28 A;  4BY7 K;  2O5J A;  4X6A K;  4G7H A;  4X6A C;  3GTQ K;  3GTQ C;  3GSI A;  5CHP A;  4OIQ A;  2Y3P A;  3AD7 C;  3GEI A;  3IPJ A;  4KB4 A;  4AH6 A;  2Y0S D;  1O25 A;  2Y0S L;  4P9S A;  2YU9 K;  3L4J A;  3AH5 A;  3T00 A;  4BLB A;  4C2M K;  4C2M C;  1PJ5 A;  5C4J K;  5C4J C;  1WOO A;  5FLM K;  2ZUF A;  1TWF K;  4G0W A;  3TFH A;  3WOD A;  3S16 K;  3S16 C;  4KAW X;  2B63 A;  3GTG K;  1O27 A;  3GTG C;  1TWA A;  2GAG C;  4KM9 A;  3HKZ D;  4LK0 A;  3HKZ L;  4Q5S A;  2A6E A;  4GTL A;  2JA5 A;  2JH3 A;  4A3L K;  4A3L C;  5IOQ A;  5E68 A;  4GFQ A;  1WSV A;  3N3Y A;  4GT9 A;  3H0G A;  4MEY A;  3JST A;  3S0X A;  3GTQ A;  4A3C K;  3GEE A;  4P5A A;  2VUM K;  2VUM C;  3S1M K;  4KDD A;  3S1M C;  1I6H C;  4KAR A;  3A8J A;  2WB1 D;  4GTC A;  1F93 A;  1WOP A;  1BGW A;  1BS2 A;  2GSU A;  4OIO A;  2JA7 K;  2JA7 C;  4A3M K;  4A3M C;  4KN4 A;  4LJZ A;  4P5B A;  2JA6 K;  4BXX C;  4BXX K;  1L0W A;  1HI9 A;  2E2H A;  3S1N K;  3S1N C;  2BE5 A;  3I4M C;  4YFK A;  1JQW A;  1VRQ C;  1WSR A;  3GTG A;  4A3F C;  2V6U A;  5C4X K;  4PAA A;  3FOF A;  2A68 A;  3HOU C;  1ISE A;  3HOU K;  1KQ4 A;  3HOZ C;  3HOZ K;  4JK1 A;  3GTJ C;  3GTJ K;  4KC6 A;  4KMU A;  4OIR A;  3H3V L;  2D6F C;  5M5W K;  3L4K A;  3FOE A;  2A6H A;  1GE9 A;  1RU0 A;  5C44 K;  5C44 C;  4BBR C;  4BBR K;  4QJV A;  4MEX A;  2JA8 C;  1JVI A;  2XCR B;  4G7Z A;  2JA8 K;  2R93 C;  3ORE A;  4YFX A;  2R93 K;  4XSZ A;  1YNN A;  3TTG A;  3S1Q K;  2E2J C;  1SFO K;  1BDF A;  3TFJ A;  1SFO C;  4A3G K;  4A3G C;  4XLN A;  2JA7 A;  1USO A;  5IP9 K;  5IYD C;  3HOX C;  3HOX K;  5IYD K;  1IBA A;  3CQZ K;  3CQZ C;  1J98 A;  2NVX C;  2NVX K;  4BY7 C;  1ZYR A;  1XZP B;  1K83 C;  1K83 K;  2E2I C;  2V6S A;  2E2I K;  4A3B K;  1INN A;  1WQG A;  1DD5 A;  3N0B A; 
#chains in the Genus database with same CATH homology
 3S1Q C;  3HKZ D;  4LK0 A;  4YG2 A;  3HKZ L;  3M3Y C;  2A6E A;  3M3Y K;  2R7Z C;  5C3E K;  5C3E C;  3S1R C;  3S1R K;  2R7Z K;  4Q5S A;  4A3L K;  4A3L C;  4QIW L;  3HOV K;  4QJV B;  5IP9 C;  3HOV C;  2R92 K;  2YU9 C;  1Y1V C;  1Y1V K;  1TWG K;  1TWG C;  2NVT K;  2NVT C;  5IYC K;  4BY1 K;  4BY1 C;  4G7O A;  4MEY A;  2PPB A;  4KN7 A;  4ZH4 A;  3PO3 C;  3I4M K;  5FLM C;  1I6V A;  3PO3 K;  4A3C K;  1TWF C;  5D4D A;  2VUM K;  2VUM C;  3GTK K;  4A3F K;  3S1M K;  4XLP A;  3M4O C;  4Q4Z A;  3M4O K;  3S1M C;  4A3D C;  1XPP A;  1I6H C;  2B63 C;  2B63 K;  3EQL A;  4GZY A;  4A3B C;  4LLG A;  2WB1 D;  4A93 K;  4OIN A;  3S15 K;  3S15 C;  4A93 C;  4YFN A;  4NOI A;  5C4X C;  3PO2 C;  3PO2 K;  3RZO C;  3RZO K;  5IYB K;  5IYB C;  3HOW K;  3HOW C;  2JA5 C;  2JA5 K;  4Y52 C;  4Y52 K;  1Y1W K;  1Y1W C;  2R92 C;  2PA8 L;  4QIW D;  4OIO A;  2JA7 K;  2JA7 C;  3FKI K;  4A3M K;  4A3M C;  4KN4 A;  4LJZ A;  5IYC C;  2JA6 K;  4A3E K;  3H0G C;  3H0G K;  4A3E C;  4BXX C;  4BXX K;  4AYB L;  3S1N K;  3S1N C;  2BE5 A;  1I3Q C;  1I3Q K;  4YFK A;  3I4M C;  1WCM K;  1WCM C;  3S17 K;  4C3H K;  3RZD C;  3RZD K;  3S17 C;  3HOY C;  3GTK C;  4LK1 A;  5TMF A;  4A3F C;  3GTM C;  3GTP C;  3GTP K;  4A3D K;  1YNJ A;  1IW7 A;  2E2J K;  3K7A C;  3K7A K;  2A68 A;  2A69 A;  5M5Y K;  2NVQ C;  2NVQ K;  3HOU C;  3HOU K;  1TWA C;  1TWA K;  3HOZ C;  3HOZ K;  4JK1 A;  5M5X K;  4A3I K;  4A3I C;  3GTJ C;  3GTJ K;  4KMU A;  4XSX A;  5IP7 C;  5IP7 K;  4OIR A;  3H3V L;  5FJ8 K;  2PA8 D;  2O5I A;  3GTL K;  3GTL C;  5M5W K;  5M3M K;  3GTO C;  3FKI C;  3GTO K;  1R9T K;  2A6H A;  1SMY A;  5TMC A;  2JA6 C;  4AYB D;  2NVY K;  2NVY C;  5C44 K;  5C44 C;  4BY7 K;  4G7H A;  2O5J A;  4X6A K;  1TWC K;  1TWC C;  4X6A C;  2PMZ L;  2E2H C;  4BBR C;  4BBR K;  4A3K K;  4A3K C;  2E2H K;  3GTQ K;  3GTQ C;  4QJV A;  4MEX A;  3GTM K;  3HOY K;  3S2H K;  3S2H C;  3S2D K;  2JA8 C;  4C3I K;  4G7Z A;  2JA8 K;  3S14 K;  3S14 C;  3S2D C;  4YFX A;  2R93 C;  2R93 K;  2CW0 A;  4XSZ A;  4OIQ A;  1YNN A;  3S1Q K;  2E2J C;  1SFO K;  1BDF A;  1SFO C;  4BBS C;  4BBS K;  3DXJ A;  4A3G K;  4A3G C;  2Y0S D;  5M3F K;  4XLN A;  4C3J K;  1HQM A;  2Y0S L;  4MQ9 A;  3H3V D;  5IYD C;  5IP9 K;  3HOX C;  3HOX K;  5IYD K;  2YU9 K;  1TWH K;  1TWH C;  3I4N K;  3I4N C;  3CQZ K;  3CQZ C;  4A3J K;  4A3J C;  1R9T C;  4C2M K;  5C4J K;  5C4J C;  5FLM K;  4OIP A;  1TWF K;  1I50 K;  1I50 C;  2NVX C;  2NVX K;  4BY7 C;  1ZYR A;  3WOD A;  2PMZ D;  3S16 K;  3S16 C;  1I6H K;  1K83 C;  1K83 K;  2E2I C;  2E2I K;  4A3C C;  2WAQ D;  4A3B K;  2WAQ L;  4Y7N C;  4Y7N K;  3GTG K;  3GTG C;  5C4X K;  2WB1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...